4BJNA

Crystal structure of the flax-rust effector avrm-a
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
225
structure length
222
Chain Sequence
EFDRGFLRPFGAKMKFLKPDQVQKLSTDDLITYMAEKDKNVRDLAIKLRDAKQDSTTPEIKQTYDKAYEKTKAAAEKLVSEESLTRDALLKLTEEQYVEKAALFDKDVYRNNLKRQTYEKLLRSETDVLYREVARIFIAREGEPALTAKIERLALTLENNADTRSKPIDYLAIAADFLKNQANLHADDPELNLYKAEIKAREIEANRAMKEALKGADKLFKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AVRM-A
publication title Structures of the Flax-Rust Effector Avrm Reveal Insights Into the Molecular Basis of Plant-Cell Entry and Effector-Triggered Immunity
pubmed doi rcsb
source organism Melampsora lini
molecule tags Protein transport
total genus 87
structure length 222
sequence length 225
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2013-04-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18241 AvrM-A Flax-rust effector AvrM-A
A PF18247 AvrM_N Flax-rust effector AvrM N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1680 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4bjnA00
4BJNA 4BJMA
chains in the Genus database with same CATH superfamily
3CQGB 5EK3A 2EHOA 2V5DA 2DI4A 3TKLB 4QKNA 4U7YA 4BJMA 3LSVA 4IT4A 4DR4T 3KVAA 2LM9A 2Q9QB 2WCAA 4IL9A 5ABFB 3P4QA 1XMQT 4IREA 1D0XA 2WP9A 2XAHB 2XPKA 1LRZA 2NR4A 2WAUA 3FZMB 4DV6T 4UV8B 4U2ZA 5JRCB 4L5GA 4J2CA 3CX8B 5FXXA 3AE8A 2V6YA 1N34T 4AKLA 2ES0A 2IAKA 1BR4A 3MKDA 2LM2A 3RKOA 3JADA 2ZM6T 4JI5T 1X9BA 4BAYB 1M62A 1Z0PA 2OA5A 5GONE 5ADXL 4B3ST 4EZ4A 2WWUA 5LMNT 1ZEEA 3U78A 4OYJA 2DWKA 4ILUA 4ZOLE 1YKEB 4ZZCA 4KMCA 4GKKT 3P8CD 4X5TA 1JNZA 3WI3A 2YINA 2X51A 4PK5A 4K0UA 2YU1A 3DP7A 4PJNA 1X79A 5JDHA 2LJLA 3T1YT 3OVUA 3FXEB 4OYKA 3W15B 4X62T 2MOZA 5JR9B 3ZMZB 4X66T 3ETUA 3JCFA 3RPUA 3FHNA 3UUXB 4AQGA 3RIUC 3VR9A 4NUVA 3NZPA 3VKGA 2I59A 5M4YA 3ZEFB 3PUXF 4YY3T 2L3LA 5H6QB 3E08A 4X1YE 2C5JA 2ZM2A 4DV7T 2B76A 3NWIA 2NTYA 2CPTA 2CE7A 4H9PC 1T98A 1NWMX 2JRKA 2EHOD 2L8KA 4YTMA 2Q9QA 5LBMA 3FXDB 4A5XA 4B6XA 2Y48B 2J62A 4O2BE 3QB5K 3CVRA 4Q25A 4AKGA 2D5UA 2KMFA 1UX4A 1MIVA 2BZBA 4JI7T 4WW0A 2JIWA 4IE4A 3UT5E 2V5CA 4JI6T 2BG9C 3HKBE 3HKEE 2DLRA 4AKHA 3H3MA 3WAJA 4TNWA 3AA7B 3HKCE 3ZMVB 4CXWA 3N9PA 5JH7E 4HKAA 3CX7B 3SWHA 2NTXA 5HAXA 2VVNA 4PNIA 1HTJF 1OEDB 2CRBA 3HKDE 3AEDA 4WNKA 4AKIA 2K5BB 4QWNB 5FXWA 4EZHA 4L9IA 4HFIA 3N9NA 3RGLA 4MFRA 3P4SA 2WDRA 2RP4A 2P9BA 3QOFA 2KINB 3RQWA 4GYRA 4B3MT 2CLYC 5FMNA 2UUAT 3RIUA 5AQUB 4YSXA 2V7IA 3PJAA 5HEOA 4PAGA 3LJCA 3LDQB 2X9WA 4GOUA 4TN7B 5ETWA 2WY2A 4DR1T 3Q2MA 3ETVA 2CWYA 4O4HE 3K3OA 5JR9A 3AE4A 3MACA 2E2AA 3PV0F 2VASA 3CIRA 5ABEA 5C8YE 3RI5A 3X1DA 2ODVA 5AQQB 2BVLA 5L3GB 1OWAA 2D0UA 5F8PA 5FVKA 4EYUA 1W0AA 1WYBA 2DL1A 4FJOA 2CMRA 2UXNB 1D1CA 2ZM0A 4LF7T 2XAJB 5HXCA 1HNZT 2BS2A 4G2AA 2G0UA 3ZCJA 4JYAT 4DV2T 1W9RA 4QX8B 4U72A 1WYCA 1OEDE 2WB5A 4KUMB 3MA9A 4DUZT 2QA7A 1IBLT 4IDQA 4NXNT 1MMGA 2YK0A 1US7B 2EHOB 3N2OA 4YTPA 2XQYA 2HPLA 3NRYA 1Y01A 3U3IA 5FNVE 2HN1A 3MK7C 3BK9A 5AQRB 5IWAT 2XQ5A 5JDQA 4EGWA 5LB7B 4ASKA 2Q9QD 3RHWA 4I43B 4AXPA 2NW7A 2CWOA 3UQ7A 4U74A 2MBGA 1GQEA 4XZCA 3KVBA 1FEWA 1FMWA 4YHHT 1XNQT 3UU8A 1HF8A 2ZLYA 5HWYA 3NZQA 5L47A 4NPPA 3AECA 1UURA 2DNXA 2WU2A 3UUBA 2JJ9A 3TLVA 1LVKA 3ABVA 3LFMA 3UFGA 2DWGA 4WBOA 2KSRA 1J5ET 5CA1E 4DVDA 3OBVE 3F57A 3CK6A 2XQ8A 4C91A 5EZYE 4CI1B 3PU8A 3JC6C 4GK5E 4YFSA 2VK9A 1QUUA 4MHCA 1KF6A 3N9MA 3UU6A 4KP3C 2WDQA 4HFDA 4X65T 2V7JA 3BQKA 2MTQA 3PUWF 5HEJA 4H9NC 4ZI2C 4U3CA 3JAFA 5LBQB 5FXVA 2XHEB 2CXDA 4TNVA 4HFCA 5HYAA 2OV9A 2VURA 2XQ6A 4ZS3A 4TWHA 4UR9A 3LG7A 3PE0A 2CA5A 3PUZF 3C98B 5CFBA 5L3CB 1VRBA 3AVSA 5JTGA 4JUYA 1VOMA 3T8OA 1B7TA 3KV9A 4UXNB 1E2AA 2XTLA 4ADZA 3CKDA 3IEEA 2QGSA 3AAAB 5JDLA 2VL0A 4HWFA 4EAHA 2X67A 3SRZA 2HHHT 3SFDA 3N2KE 2WQYA 2KWHA 3UUNA 1IBMT 1J1JA 2VKOA 2JPFA 2VVSA 1T7SA 1Y64B 3FZHB 1MMAA 4QHOA 3RF1A 4ILAA 4M1PA 3HR0A 2M67A 5DABA 1KNPA 3PUYF 4EIWA 3Q9DA 5HXEA 1EZ3A 2V26A 2JMKA 4EXTA 5BMVE 4BJNA 4DMVA 3RYIE 3RRCA 5HXSA 1UK5A 3I9YA 4P09A 4DV1T 3B13A 3AE7A 3O9XA 2SPCA 2LHRA 2IW5B 2W4XA 3O4XE 3M65A 2YOEA 1ZHCA 5BR8T 3AEEA 3AE1A 1KFYA 5KDMC 2H89A 2BKPA 4IDNA 2XM1A 4H63V 5AQHB 4IDPA 4LMKA 4EB6E 5FKYA 2W63A 4CN1A 2CBIA 1XDPA 4JI8T 1WRDA 4ISTA 5L3BB 1OXZA 4UELA 4JBWF 1R8IA 1WLXA 4P1NA 1YW0A 2BS3A 5LJNA 4TWDA 4K0KT 4I4TE 3G06A 4F6RC 3PDYA 5J2UE 4MALA 1NAFA 2BBHA 2V7MA 3CQXC 5IHYA 2IC6A 4I50E 3BQIA 5CJ5A 1UUSA 3OTOT 2NW9A 3RYFE 4C90A 2CEAA 3IBPA 2M6IA 1LKXA 2X0LB 2B1EA 2X0YA 2K9AA 5HCMA 2ACZA 3EDUA 3RYHE 3ONLC 3ZYKA 2FJBA 3R6NA 1D1BA 2VQFT 2J1DG 3ZT6A 4XAXB 1HG2A 5DJQC 3I0OA 4HEAA 3N5LA 3S4UA 5IUXA 3ZN1B 3IHRA 2I6HA 5FYMA 3B5MA 5JDMA 2W66A 2XQ4A 5C3JA 3VU7H 1Z8UA 2FUPA 5FY0A 2CHNA 1YQ4A 3AE2A 5CA0E 3RQUA 3ONXA 4CXYA 4UVCB 4PW8A 5ABGA 4CI3B 1V9DA 1ZV4X 4Z91A 5HEGA 2UUBT 2BG9B 4B3TT 2RPAA 4IE6A 1HR0T 5HWXA 4HFBA 5JDNA 2KXPB 4UIGA 2A9UA 5LG4A 3KDSE 2H88A 4KX6A 5HEHA 2ODUA 4Z8XA 5AQJB 4X1KE 4ZZBA 4AKRB 4TX5A 2LKGA 1G73A 2D0TA 3QUJA 5AQNB 3DTOA 2XSAA 2LSIA 2KT9A 4EOZB 3BQLA 5EK2A 5LYJE 2Y6XA 2NWBA 2QYWA 3JC6D 2CLYB 4LF4T 2PJQA 3AE5A 2R6GF 2LOSA 5LGUB 3LBXB 3KBUA 3IF8B 3LK42 4GYSA 4ZI2D 3CQCB 3ZKRA 2PBIA 4O8SA 2WDVA 2X68A 5LHIB 4DR6T 1YXRA 4O2AE 4JEUB 3K1SA 2LRLA 4EEBA 2F4VT 2IMLA 2E5VA 2YKSA 1MNDA 2LEHA 1S35A 1IJ5A 3L39A 3MJXA 3RC8A 3AE3A 3C64A 1L0VA 1IAPA 3C4XA 4YSZA 2YDSA 3QC9A 1U4QA 3H37A 4FI5A 1SHZC 3TLUA 4QX7B 5JQGE 4QXHB 2X9XA 3UUMA 5L2LA 2UXCT 3AA0B 3AVRA 3R84B 1H7CA 4E7SA 4O4JE 2N9DA 2I0MA 3V5UA 1QLBA 5F3JA 3AE9A 2YDQA 2H7OA 3AEGA 3I9WA 2PG8A 3AAEB 2VQET 4E7ZA 3ZLIA 2V7KA 4U2YA 4UF0B 4I55E 4AQFC 2V8SV 3FZLB 4P0AA 4IL4A 3PU3A 3Q5XA 3UU3A 3EHZA 2XQ3A 2BG9A 2ZM8A 2LE8A 3H3AA 3ZT7A 1AJ3A 4U33A 4CN6A 3CMLA 4V1Av 1HX8A 2FJAA 2A2FX 4IE5A 3E22E 2LT3A 3NKZA 1I94T 3QK6A 3AEAA 4PJMA 4IE7A 1CUNA 4LFBT 2CXLA 2JQQA 1FMVA 2QRXA 5LP6E 3GN5A 3ZJ1A 5FXZA 2UUCT 2E9XC 4UVBB 4ZI3C 3SFEA 4LF5T 3FZFB 3NBXX 2YEVC 5KXJA 4DR2T 2X9YA 3KINB 3VRBA 2IDOB 3LBXA 4DV4T 2JMHA 4BA9A 4H9OC 2XAGB 4KHPT 4LMJA 4XBFB 2JQKA 2IHR1 2XQ7A 4A97A 2PFVA 4DR7T 5ABHA 3KFWX 3PJAJ 4AISA 2JQ9A 3ONJA 5CGMA 2C0SA 2MYSA 4DBQA 3ZN0B 1N32T 3GMIA 3OKQA 4PFOA 4DV5T 1UX5A 2YDRA 1XWMA 1IJ6A 4YXDA 2IUBA 4YJ3E 5CB4E 2XM2A 3HA4A 4AQFA 1HCIA 1SE7A 2CXFA 2V1DB 4U31A 4GIWA 3AAIA 3V5SA 1YQ3A 4HE8A 3LK3B 2IC9A 3AXJA 3O1JA 3KV5A 4U7IA 1U5PA 5L4EA 3ZJ2A 3I0QA 3GA8A 5L3EB 1KEYA 1VCTA 2E9XA 2KZ7B 4UF0A 3I1AA 3RH3A 3OYZA 5LJMA 3UULA 3HI2A 4QH1A 1UCUA 5E0OA 3ANWA 3F2EA 5AQOB 1BR1A 4HWHA 1LVFA 4N78D 4ZXLA 1KNZA 2N1GA 1BR0A 2C5IT 2X66A 3RYCE 5JVDE 5AQSB 3AEFA 3KV6A 2VB6A 4DO0A 5JDFA 5TAOA 1HG5A 2VWAA 2GK9A 3RC3A 3ZYLA 5LOVE 5DQVA 4HWIB 3KBTA 3VR8A 2XQAA 1E1HB 2CBJA 5LG3A 3Q5DA 5EK4A 2FJEA 3GWHA 2LSKA 3QNUA 4YHJA 3ZYMA 2LOPA 3KV4A 2BS4A 2NP9A 2J4GA 3C4ZA 3ZSSA 4HFVA 2V7LA 4H9SE 4YTNA 2NOXA 4H63H 1XNRT 1D0ZA 2AE9A 5LGNB 4KBMB 4UV9B 2PTFA 4QXCB 3EI0A 4JI4T 3PTRB 2WM9A 4X20E 2WMNA 3N2GE 1IZNB 5FP3A 2Q9QC 2N2NA 4MLKA 3L8RA 4YT0A 2W0GA 5LMUT 4JI0T 4YLHA 3ZPOA 4IE0A 5AQLB 5FY1A 1HNXT 5A1LA 4LMLA 3CPZA 3A7MA 2DCFA 2QVAA 3AA1B 4L0RA 4F8HA 3RIAA 3RKGA 4TUYE 3TLSA 4H9RC 4NIQA 2MAWA 3C50A 4OFZA 4HN9A 1CHUA 5J2TE 2Z6EA 2WS3A 3EVYA 2X0HA 2K48A 4IDOA 5HXHA 4LF9T 1T72A 4X1IE 2LSYA 3MXZA 4CZZB 3ZC0A 1E7PA 1IBKT 2HH7A 1XDOA 1S94A 3A5XA 4DR3T 3N9OA 1KK7A 3WAKA 1HNWT 3C51A 4JLEA 2D9DA 4AI6A 3RIFA 2IIUA 2E9XD 4LF6T 4HWCA 2UXDT 4B3RT 4ZI3D 3L3PA 2CHOA 2H3RA 5LGTB 2BDEA 3P50A 5J0ZA 4DBRA 1ZOYA 3PUSA 4KHZF 4ZHQE 2DHRA 4HGAA 5KX5E 2LLYA 5AQIB 2CCQA 4JI3T 2W2UA 1YKHB 4GKJT 1ZP0A 1QSDA 4WBNE 3AB3B 4UVAB 2XAQB 1M7KA 1D1AA 5HEUA 2OLTA 4IIJE 3AEBA 3GN5B 2H7VC 5JR9C 1MIWA 2L9QA 1BR2A 3NVOA 3ZC1A 4YJ2E 3MZKB 1UGOA 3D0TA 3QB5A 5LA6E 4TWFA 2BKNA 3UU5A 5C2TA 4OHFA 3PUAA 4O4LE 5FVLA 3O1HA 1WFDA 5AQVB 2JQHA 5ABFA 3P4PA 2E8IA 2WZIA 4CXXA 3CWZB 2YN6A 4I0UA 3AA6B 4EEDA 4JEHB 1DU2A 4TV8E 4EV6A 1SA0E 5JRCA 4TV9E 1J5WA 4PJJA 2LHNA 4Z90A 4TZ4C 1VCSA 2BBJA 4DNDA 4WZXA 1I6ZA 5LXTE 4CI2B 3N9QA 5FL1A 3EUHA 5J1GA 4DIDB 3L09A 4HFHA 2W00A 5JREA 3JAEA 2E5LT 3EDVA 3RLFF 4ILBA 4JI1T 3VRAA 3K8PC 1YD8G 2BG9E 3TLTA 3ESLA 1MNEA 4ZEYA 4P0BA 3PUVF 2C5KT 1OEDC 5AQFB 3UQ4A 2UXBT 2A72A 4CQIA 1O3XA 3VKHA 2LSJA 3AXJB 1MMDA 4ILCA 4DV0T 3TLWA 2UU9T 2ACXA 1SUMB 4CN4A 4JV5T 3T1HT 4GK0E 1ZKEA 1XZYA 3P7IA 3K3QC 3SOLA 3ZCIA 4OX9T 2E9XB 3A8YC 5L4HA 2XY8B 5LNKA 3IA3A 3O1IA 5H6RB 3RRWA 4DR5T 2KLQA 4ERRA 5AQGB 3EABA 2WZHA 4HWDA 5AQTB 5AQMB 4DUYT 3ZSTA 1N33T 5FL0A 3FB2A 2CM0A 2FJDA 3ANWB 5JDGA 4ZS2A 3ZT5A 2BKOA 3J9X1 3J7Yq 2WBLA 4X64T 4LF8T 2KWIB 3ZMSB 3PURA 4UEMA 1HS7A 2K24A 1FIOA 2A3DA 3ZMTB 2AXDS 4A98A 4JI2T 2HPJA 1T8BA 2WMOA 3FZKB 2NW8A 4G63A 1N36T 2WSSV 3FBZA 2HN2A 2X9HA 5AQPB 2VL8A 1D0YA 3K3NA 5FY7A 2W62A 2V6XA 3P4RA 4NUUA 3EAMA 2KNDA 2VKHA 3PUGA 4ZI7E 1KNRA 4ANJA 4EYYR 3N9LA 2J47A 1OEDA 4A56A 2VKJA 2ZMAA 3OYXA 4QH4A 2V6YB 3C4WA 2EHOC 2XASB 4IGUA 5DQWA 4PK6A 1W09A 3AE6A 4KI0F 3E0ZA 4IDZA 3HL6A 3RX6A 2WWVA 2XSBA 4QXBB 2VKDA 5LHHB 2W61A 3OPCA 2XJ7A 5AQKB 2UXXB 1W0BA 2WU5A 3VHLA 4O4IE 5IYZE 2XZEA 3Q5EA 4HFEA 5L3DB 4YSYA 3CX6B 3Q5WA 4PJLA 2D2SA 1XMOT 3PUQA 4OK0A 3UTKA 3FBLA 2XQ9A 3DJBA 1G8XA 4IHJE 5F5WA 5HXRA 3OJAA 3ZMUB 4DMWA 1NEKA 2M6BA 4LFAT 1WR0A 5AFUL 3UU4A 3B57A 1WR6A 2BVMA 4H9QC 5KMGP 4AIUA 4AQYT 4DV3T 4ISSA 3P4WA 2LKHA 4LFCT 3UFEA 2W67A 2LSGA 2FBWA 3LK2B 4QH5A 2RA1A 1WCRA 5HCJA 1MIYA 4NXMT 1HX1B 2XUEA 4COFA 1FJGT 2MPKA 2YU2A 4WYVA 5LHGB 1HFAA 1NENA 3NRXA 4PFPA 4MBQA 4HTEA 2K3WA 2Y8DA 3F31A 4PK4A 3M3ZB 2XAFB 5L3FB 1JNRA 1MMNA 2LRKA 5LCYA 3SS1A
chains in the Genus database with same CATH topology
3RC8A 5HWYA 3NZQA 4JLEA 3CQGB 4AI6A 3C64A 5EK3A 1IAPA 2EHOA 2E9XD 2DNXA 3C4XA 4ZI3D 3L3PA 2JJ9A 1LVKA 2H3RA 5LGTB 2BDEA 4DBRA 3QC9A 3PUSA 3LFMA 2DHRA 4HGAA 4ZHQE 2DI4A 1U4QA 3TKLB 2DWGA 4QKNA 4WBOA 3H37A 5KX5E 4BJMA 4FI5A 1SHZC 3KVAA 2CCQA 2LM9A 2Q9QB 5CA1E 4QX7B 4DVDA 3OBVE 5JQGE 1D0XA 2XAHB 3F57A 1YKHB 4QXHB 2X9XA 3UUMA 1LRZA 5L2LA 1QSDA 4C91A 4WBNE 5EZYE 3AA0B 3AB3B 3AVRA 4CI1B 2WAUA 3R84B 3PU8A 4UVAB 2XAQB 1H7CA 3JC6C 4GK5E 4YFSA 4E7SA 1D1AA 2N9DA 4O4JE 4UV8B 2VK9A 4IIJE 3V5UA 3GN5B 5F3JA 1QUUA 4MHCA 2H7VC 5JR9C 3N9MA 1MIWA 2L9QA 5JRCB 2H7OA 1BR2A 4L5GA 3I9WA 4KP3C 3ZC1A 4J2CA 2PG8A 3CX8B 5FXXA 3AAEB 4YJ2E 3MZKB 4E7ZA 3D0TA 2V7JA 4AKLA 3ZLIA 2V7KA 3BQKA 5LA6E 2MTQA 2ES0A 2IAKA 1BR4A 3MKDA 4UF0B 4I55E 4AQFC 4H9NC 4OHFA 3PUAA 4O4LE 4ZI2C 3RKOA 4P0AA 3O1HA 3PU3A 3Q5XA 2ZM8A 5LBQB 5FXVA 2LE8A 3H3AA 4BAYB 1AJ3A 1Z0PA 2XHEB 2CXDA 5LP6E 2OA5A 3CMLA 4V1Av 1HX8A 2E8IA 5HYAA 2A2FX 4IE5A 3E22E 5GONE 2LT3A 4ZS3A 4CXXA 3CWZB 5ADXL 3LG7A 3PE0A 2CA5A 4EZ4A 2WWUA 3QK6A 3AA6B 3C98B 4PJMA 5L3CB 1VRBA 4IE7A 4JEHB 1CUNA 3AVSA 1ZEEA 4TV8E 2CXLA 2JQQA 4JUYA 1FMVA 1VOMA 3U78A 3GN5A 4OYJA 1B7TA 2DWKA 3KV9A 4UXNB 3T8OA 1SA0E 4ILUA 4ZOLE 1YKEB 5JRCA 4KMCA 3ZJ1A 3P8CD 4TV9E 5FXZA 2XTLA 4PJJA 2LHNA 3WI3A 4ADZA 2YINA 3CKDA 3IEEA 4TZ4C 2QGSA 2X51A 2E9XC 4UVBB 4PK5A 4K0UA 3AAAB 4ZI3C 5JDLA 2YU1A 3DP7A 4PJNA 4DNDA 1X79A 5JDHA 4EAHA 2X67A 2LJLA 3SRZA 5LXTE 3FXEB 3NBXX 3N2KE 4OYKA 2KWHA 3W15B 3UUNA 4CI2B 3N9QA 3EUHA 2VKOA 2JPFA 2MOZA 2YEVC 3L09A 5J1GA 2X9YA 2W00A 1Y64B 5JREA 5JR9B 3KINB 3EDVA 3ZMZB 1MMAA 3LBXA 4QHOA 2JMHA 3ETUA 4M1PA 3RPUA 3HR0A 2M67A 5DABA 4BA9A 3FHNA 4H9OC 3UUXB 2XAGB 4EIWA 4XBFB 3Q9DA 4AQGA 5HXEA 3K8PC 1YD8G 1EZ3A 2V26A 3ESLA 2JMKA 4EXTA 1MNEA 4NUVA 3NZPA 5BMVE 3VKGA 2PFVA 2I59A 5M4YA 4P0BA 3KFWX 4BJNA 3RYIE 4DMVA 2C5KT 3RRCA 5HXSA 3I9YA 3ZEFB 4P09A 3B13A 2A72A 4CQIA 2L3LA 5H6QB 3O9XA 2SPCA 2C0SA 2MYSA 1O3XA 2LHRA 2LSJA 3ZN0B 4DBQA 3VKHA 3GMIA 3OKQA 1MMDA 4PFOA 2IW5B 3E08A 3O4XE 3M65A 4X1YE 1UX5A 2C5JA 1ZHCA 2ACXA 2ZM2A 1IJ6A 5KDMC 4H63V 4GK0E 1ZKEA 4YJ3E 3P7IA 3K3QC 2NTYA 3SOLA 3ZCIA 2E9XB 2CE7A 4H9PC 5CB4E 4EB6E 1T98A 1NWMX 2JRKA 2EHOD 2W63A 3HA4A 5LNKA 4AQFA 1HCIA 2L8KA 2CXFA 1WRDA 3O1IA 4ISTA 5H6RB 3RRWA 2V1DB 5L3BB 1OXZA 2KLQA 4GIWA 4UELA 4ERRA 3AAIA 3V5SA 1WLXA 2Q9QA 5LBMA 3FXDB 4HE8A 1YW0A 4B6XA 2Y48B 3LK3B 4O2BE 3CVRA 5LJNA 4AKGA 2D5UA 2KMFA 1UX4A 1MIVA 2BZBA 4WW0A 2IC9A 4IE4A 3FB2A 3UT5E 2CM0A 4I4TE 4F6RC 3ANWB 3PDYA 5J2UE 5JDGA 4ZS2A 3O1JA 4MALA 3KV5A 3HKBE 3HKEE 2DLRA 1NAFA 4AKHA 3J9X1 1U5PA 3WAJA 3J7Yq 3ZJ2A 2V7MA 3AA7B 3CQXC 2WBLA 3HKCE 3I0QA 3GA8A 3N9PA 5IHYA 2IC6A 3ZMVB 4I50E 4CXWA 5JH7E 3BQIA 5L3EB 4HKAA 2KWIB 3CX7B 3SWHA 2NTXA 3PURA 4UEMA 5HAXA 2K24A 2NW9A 3RYFE 3ZMSB 4C90A 1HS7A 1FIOA 2A3DA 3ZMTB 4PNIA 2E9XA 2CEAA 1HTJF 3IBPA 2KZ7B 1LKXA 4UF0A 2X0LB 3HKDE 2B1EA 3I1AA 2HPJA 4WNKA 3RH3A 2K9AA 4AKIA 3OYZA 3EDUA 2K5BB 5LJMA 3RYHE 2WMOA 4G63A 2NW8A 4QWNB 5FXWA 4EZHA 2WSSV 4L9IA 3FBZA 3N9NA 2X9HA 3ZYKA 4MFRA 3R6NA 3UULA 1D1BA 2J1DG 2RP4A 3HI2A 2VL8A 1UCUA 1D0YA 3K3NA 4XAXB 5E0OA 5FY7A 2P9BA 3ANWA 2W62A 1HG2A 2KINB 3F2EA 5DJQC 3I0OA 1BR1A 4HEAA 4GYRA 1LVFA 4N78D 3N5LA 3S4UA 3ZN1B 1KNZA 3IHRA 4NUUA 2CLYC 5FMNA 2N1GA 2KNDA 2VKHA 1BR0A 3PUGA 5FYMA 4ZI7E 2C5IT 5JDMA 4ANJA 4EYYR 3N9LA 2X66A 4A56A 3RYCE 2VKJA 3VU7H 2ZMAA 3OYXA 5JVDE 5FY0A 2V7IA 3C4WA 2EHOC 3KV6A 5CA0E 2XASB 4IGUA 5DQWA 3ONXA 4CXYA 4PK6A 4PAGA 2VB6A 3LJCA 3E0ZA 4UVCB 4IDZA 4PW8A 3HL6A 4DO0A 4CI3B 2X9WA 4GOUA 1V9DA 1ZV4X 3RX6A 4TN7B 5ETWA 5JDFA 3Q2MA 3ETVA 2CWYA 4QXBB 5TAOA 2VKDA 5LHHB 4O4HE 2W61A 4IE6A 1HG5A 2VWAA 5HWXA 3K3OA 5JDNA 2GK9A 2KXPB 4UIGA 5JR9A 5LOVE 2UXXB 3RC3A 3MACA 3ZYLA 5DQVA 3VHLA 2VASA 3KBTA 5C8YE 4O4IE 5IYZE 2ODVA 1E1HB 5L3DB 2BVLA 5EK4A 3CX6B 5LG4A 3Q5WA 4PJLA 5L3GB 1OWAA 2D2SA 3KDSE 3GWHA 2D0UA 2LSKA 5F8PA 4YHJA 4EYUA 2ODUA 3PUQA 4Z8XA 4OK0A 3ZYMA 2LOPA 3KV4A 3UTKA 3FBLA 3DJBA 1G8XA 2NP9A 4X1KE 1WYBA 4IHJE 3C4ZA 5HXRA 4AKRB 4TX5A 1G73A 2D0TA 3OJAA 3QUJA 4FJOA 2CMRA 4HFVA 3DTOA 3ZMUB 2UXNB 2V7LA 4H9SE 4DMWA 2LSIA 5AFUL 1D1CA 2NOXA 3B57A 2ZM0A 4H63H 1D0ZA 2KT9A 2XAJB 5HXCA 4EOZB 3BQLA 5EK2A 4G2AA 5LGNB 1WR6A 2BVMA 4H9QC 4KBMB 2G0UA 4QXCB 4UV9B 5KMGP 5LYJE 2Y6XA 3PTRB 2WM9A 4X20E 3ZCJA 2WMNA 3N2GE 1IZNB 2NWBA 5FP3A 2Q9QC 3JC6D 2N2NA 4MLKA 4QX8B 2CLYB 2W0GA 4ISSA 2PJQA 4U72A 1WYCA 3SS1A 4YLHA 3ZPOA 4IE0A 5FY1A 2LOSA 4KUMB 3MA9A 5LGUB 3LBXB 2QA7A 1MMGA 2YK0A 3UFEA 5A1LA 1US7B 2LSGA 3CPZA 3KBUA 2EHOB 3LK2B 3N2OA 2DCFA 3IF8B 2RA1A 2XQYA 1MIYA 2HPLA 3AA1B 3NRYA 4L0RA 3U3IA 2XUEA 3LK42 4GYSA 4ZI2D 5FNVE 3CQCB 3MK7C 4TUYE 3BK9A 4H9RC 2YU2A 2PBIA 3C50A 4OFZA 4HN9A 4O8SA 5JDQA 2X68A 5LHIB 4ASKA 2Q9QD 5J2TE 5LHGB 2Z6EA 4I43B 1HFAA 4O2AE 3EVYA 4JEUB 4AXPA 3NRXA 2K48A 5HXHA 4PFPA 2NW7A 2CWOA 4U74A 4X1IE 2LSYA 3MXZA 4MBQA 2MBGA 4CZZB 4HTEA 2Y8DA 3F31A 3ZC0A 4PK4A 4XZCA 2XAFB 1MNDA 3KVBA 1FEWA 1FMWA 2LEHA 1S35A 1IJ5A 2HH7A 1HF8A 1S94A 3A5XA 5L3FB 3N9OA 1KK7A 1MMNA 3MJXA 5LCYA 3WAKA 3C51A 2ZLYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BJN A;  4BJM A; 
#chains in the Genus database with same CATH topology
 3CQG B;  5EK3 A;  2EHO A;  2V5D A;  2DI4 A;  3TKL B;  4QKN A;  4U7Y A;  4BJM A;  3LSV A;  4IT4 A;  4DR4 T;  3KVA A;  2LM9 A;  2Q9Q B;  2WCA A;  4IL9 A;  5ABF B;  3P4Q A;  1XMQ T;  4IRE A;  1D0X A;  2WP9 A;  2XAH B;  2XPK A;  1LRZ A;  2NR4 A;  2WAU A;  3FZM B;  4DV6 T;  4UV8 B;  4U2Z A;  5JRC B;  4L5G A;  4J2C A;  3CX8 B;  5FXX A;  3AE8 A;  2V6Y A;  1N34 T;  4AKL A;  2ES0 A;  2IAK A;  1BR4 A;  3MKD A;  2LM2 A;  3RKO A;  3JAD A;  2ZM6 T;  4JI5 T;  1X9B A;  4BAY B;  1M62 A;  1Z0P A;  2OA5 A;  5GON E;  5ADX L;  4B3S T;  4EZ4 A;  2WWU A;  5LMN T;  1ZEE A;  3U78 A;  4OYJ A;  2DWK A;  4ILU A;  4ZOL E;  1YKE B;  4ZZC A;  4KMC A;  4GKK T;  3P8C D;  4X5T A;  1JNZ A;  3WI3 A;  2YIN A;  2X51 A;  4PK5 A;  4K0U A;  2YU1 A;  3DP7 A;  4PJN A;  1X79 A;  5JDH A;  2LJL A;  3T1Y T;  3OVU A;  3FXE B;  4OYK A;  3W15 B;  4X62 T;  2MOZ A;  5JR9 B;  3ZMZ B;  4X66 T;  3ETU A;  3JCF A;  3RPU A;  3FHN A;  3UUX B;  4AQG A;  3RIU C;  3VR9 A;  4NUV A;  3NZP A;  3VKG A;  2I59 A;  5M4Y A;  3ZEF B;  3PUX F;  4YY3 T;  2L3L A;  5H6Q B;  3E08 A;  4X1Y E;  2C5J A;  2ZM2 A;  4DV7 T;  2B76 A;  3NWI A;  2NTY A;  2CPT A;  2CE7 A;  4H9P C;  1T98 A;  1NWM X;  2JRK A;  2EHO D;  2L8K A;  4YTM A;  2Q9Q A;  5LBM A;  3FXD B;  4A5X A;  4B6X A;  2Y48 B;  2J62 A;  4O2B E;  3QB5 K;  3CVR A;  4Q25 A;  4AKG A;  2D5U A;  2KMF A;  1UX4 A;  1MIV A;  2BZB A;  4JI7 T;  4WW0 A;  2JIW A;  4IE4 A;  3UT5 E;  2V5C A;  4JI6 T;  2BG9 C;  3HKB E;  3HKE E;  2DLR A;  4AKH A;  3H3M A;  3WAJ A;  4TNW A;  3AA7 B;  3HKC E;  3ZMV B;  4CXW A;  3N9P A;  5JH7 E;  4HKA A;  3CX7 B;  3SWH A;  2NTX A;  5HAX A;  2VVN A;  4PNI A;  1HTJ F;  1OED B;  2CRB A;  3HKD E;  3AED A;  4WNK A;  4AKI A;  2K5B B;  4QWN B;  5FXW A;  4EZH A;  4L9I A;  4HFI A;  3N9N A;  3RGL A;  4MFR A;  3P4S A;  2WDR A;  2RP4 A;  2P9B A;  3QOF A;  2KIN B;  3RQW A;  4GYR A;  4B3M T;  2CLY C;  5FMN A;  2UUA T;  3RIU A;  5AQU B;  4YSX A;  2V7I A;  3PJA A;  5HEO A;  4PAG A;  3LJC A;  3LDQ B;  2X9W A;  4GOU A;  4TN7 B;  5ETW A;  2WY2 A;  4DR1 T;  3Q2M A;  3ETV A;  2CWY A;  4O4H E;  3K3O A;  5JR9 A;  3AE4 A;  3MAC A;  2E2A A;  3PV0 F;  2VAS A;  3CIR A;  5ABE A;  5C8Y E;  3RI5 A;  3X1D A;  2ODV A;  5AQQ B;  2BVL A;  5L3G B;  1OWA A;  2D0U A;  5F8P A;  5FVK A;  4EYU A;  1W0A A;  1WYB A;  2DL1 A;  4FJO A;  2CMR A;  2UXN B;  1D1C A;  2ZM0 A;  4LF7 T;  2XAJ B;  5HXC A;  1HNZ T;  2BS2 A;  4G2A A;  2G0U A;  3ZCJ A;  4JYA T;  4DV2 T;  1W9R A;  4QX8 B;  4U72 A;  1WYC A;  1OED E;  2WB5 A;  4KUM B;  3MA9 A;  4DUZ T;  2QA7 A;  1IBL T;  4IDQ A;  4NXN T;  1MMG A;  2YK0 A;  1US7 B;  2EHO B;  3N2O A;  4YTP A;  2XQY A;  2HPL A;  3NRY A;  1Y01 A;  3U3I A;  5FNV E;  2HN1 A;  3MK7 C;  3BK9 A;  5AQR B;  5IWA T;  2XQ5 A;  5JDQ A;  4EGW A;  5LB7 B;  4ASK A;  2Q9Q D;  3RHW A;  4I43 B;  4AXP A;  2NW7 A;  2CWO A;  3UQ7 A;  4U74 A;  2MBG A;  1GQE A;  4XZC A;  3KVB A;  1FEW A;  1FMW A;  4YHH T;  1XNQ T;  3UU8 A;  1HF8 A;  2ZLY A;  5HWY A;  3NZQ A;  5L47 A;  4NPP A;  3AEC A;  1UUR A;  2DNX A;  2WU2 A;  3UUB A;  2JJ9 A;  3TLV A;  1LVK A;  3ABV A;  3LFM A;  3UFG A;  2DWG A;  4WBO A;  2KSR A;  1J5E T;  5CA1 E;  4DVD A;  3OBV E;  3F57 A;  3CK6 A;  2XQ8 A;  4C91 A;  5EZY E;  4CI1 B;  3PU8 A;  3JC6 C;  4GK5 E;  4YFS A;  2VK9 A;  1QUU A;  4MHC A;  1KF6 A;  3N9M A;  3UU6 A;  4KP3 C;  2WDQ A;  4HFD A;  4X65 T;  2V7J A;  3BQK A;  2MTQ A;  3PUW F;  5HEJ A;  4H9N C;  4ZI2 C;  4U3C A;  3JAF A;  5LBQ B;  5FXV A;  2XHE B;  2CXD A;  4TNV A;  4HFC A;  5HYA A;  2OV9 A;  2VUR A;  2XQ6 A;  4ZS3 A;  4TWH A;  4UR9 A;  3LG7 A;  3PE0 A;  2CA5 A;  3PUZ F;  3C98 B;  5CFB A;  5L3C B;  1VRB A;  3AVS A;  5JTG A;  4JUY A;  1VOM A;  3T8O A;  1B7T A;  3KV9 A;  4UXN B;  1E2A A;  2XTL A;  4ADZ A;  3CKD A;  3IEE A;  2QGS A;  3AAA B;  5JDL A;  2VL0 A;  4HWF A;  4EAH A;  2X67 A;  3SRZ A;  2HHH T;  3SFD A;  3N2K E;  2WQY A;  2KWH A;  3UUN A;  1IBM T;  1J1J A;  2VKO A;  2JPF A;  2VVS A;  1T7S A;  1Y64 B;  3FZH B;  1MMA A;  4QHO A;  3RF1 A;  4ILA A;  4M1P A;  3HR0 A;  2M67 A;  5DAB A;  1KNP A;  3PUY F;  4EIW A;  3Q9D A;  5HXE A;  1EZ3 A;  2V26 A;  2JMK A;  4EXT A;  5BMV E;  4BJN A;  4DMV A;  3RYI E;  3RRC A;  5HXS A;  1UK5 A;  3I9Y A;  4P09 A;  4DV1 T;  3B13 A;  3AE7 A;  3O9X A;  2SPC A;  2LHR A;  2IW5 B;  2W4X A;  3O4X E;  3M65 A;  2YOE A;  1ZHC A;  5BR8 T;  3AEE A;  3AE1 A;  1KFY A;  5KDM C;  2H89 A;  2BKP A;  4IDN A;  2XM1 A;  4H63 V;  5AQH B;  4IDP A;  4LMK A;  4EB6 E;  5FKY A;  2W63 A;  4CN1 A;  2CBI A;  1XDP A;  4JI8 T;  1WRD A;  4IST A;  5L3B B;  1OXZ A;  4UEL A;  4JBW F;  1R8I A;  1WLX A;  4P1N A;  1YW0 A;  2BS3 A;  5LJN A;  4TWD A;  4K0K T;  4I4T E;  3G06 A;  4F6R C;  3PDY A;  5J2U E;  4MAL A;  1NAF A;  2BBH A;  2V7M A;  3CQX C;  5IHY A;  2IC6 A;  4I50 E;  3BQI A;  5CJ5 A;  1UUS A;  3OTO T;  2NW9 A;  3RYF E;  4C90 A;  2CEA A;  3IBP A;  2M6I A;  1LKX A;  2X0L B;  2B1E A;  2X0Y A;  2K9A A;  5HCM A;  2ACZ A;  3EDU A;  3RYH E;  3ONL C;  3ZYK A;  2FJB A;  3R6N A;  1D1B A;  2VQF T;  2J1D G;  3ZT6 A;  4XAX B;  1HG2 A;  5DJQ C;  3I0O A;  4HEA A;  3N5L A;  3S4U A;  5IUX A;  3ZN1 B;  3IHR A;  2I6H A;  5FYM A;  3B5M A;  5JDM A;  2W66 A;  2XQ4 A;  5C3J A;  3VU7 H;  1Z8U A;  2FUP A;  5FY0 A;  2CHN A;  1YQ4 A;  3AE2 A;  5CA0 E;  3RQU A;  3ONX A;  4CXY A;  4UVC B;  4PW8 A;  5ABG A;  4CI3 B;  1V9D A;  1ZV4 X;  4Z91 A;  5HEG A;  2UUB T;  2BG9 B;  4B3T T;  2RPA A;  4IE6 A;  1HR0 T;  5HWX A;  4HFB A;  5JDN A;  2KXP B;  4UIG A;  2A9U A;  5LG4 A;  3KDS E;  2H88 A;  4KX6 A;  5HEH A;  2ODU A;  4Z8X A;  5AQJ B;  4X1K E;  4ZZB A;  4AKR B;  4TX5 A;  2LKG A;  1G73 A;  2D0T A;  3QUJ A;  5AQN B;  3DTO A;  2XSA A;  2LSI A;  2KT9 A;  4EOZ B;  3BQL A;  5EK2 A;  5LYJ E;  2Y6X A;  2NWB A;  2QYW A;  3JC6 D;  2CLY B;  4LF4 T;  2PJQ A;  3AE5 A;  2R6G F;  2LOS A;  5LGU B;  3LBX B;  3KBU A;  3IF8 B;  3LK4 2;  4GYS A;  4ZI2 D;  3CQC B;  3ZKR A;  2PBI A;  4O8S A;  2WDV A;  2X68 A;  5LHI B;  4DR6 T;  1YXR A;  4O2A E;  4JEU B;  3K1S A;  2LRL A;  4EEB A;  2F4V T;  2IML A;  2E5V A;  2YKS A;  1MND A;  2LEH A;  1S35 A;  1IJ5 A;  3L39 A;  3MJX A;  3RC8 A;  3AE3 A;  3C64 A;  1L0V A;  1IAP A;  3C4X A;  4YSZ A;  2YDS A;  3QC9 A;  1U4Q A;  3H37 A;  4FI5 A;  1SHZ C;  3TLU A;  4QX7 B;  5JQG E;  4QXH B;  2X9X A;  3UUM A;  5L2L A;  2UXC T;  3AA0 B;  3AVR A;  3R84 B;  1H7C A;  4E7S A;  4O4J E;  2N9D A;  2I0M A;  3V5U A;  1QLB A;  5F3J A;  3AE9 A;  2YDQ A;  2H7O A;  3AEG A;  3I9W A;  2PG8 A;  3AAE B;  2VQE T;  4E7Z A;  3ZLI A;  2V7K A;  4U2Y A;  4UF0 B;  4I55 E;  4AQF C;  2V8S V;  3FZL B;  4P0A A;  4IL4 A;  3PU3 A;  3Q5X A;  3UU3 A;  3EHZ A;  2XQ3 A;  2BG9 A;  2ZM8 A;  2LE8 A;  3H3A A;  3ZT7 A;  1AJ3 A;  4U33 A;  4CN6 A;  3CML A;  4V1A v;  1HX8 A;  2FJA A;  2A2F X;  4IE5 A;  3E22 E;  2LT3 A;  3NKZ A;  1I94 T;  3QK6 A;  3AEA A;  4PJM A;  4IE7 A;  1CUN A;  4LFB T;  2CXL A;  2JQQ A;  1FMV A;  2QRX A;  5LP6 E;  3GN5 A;  3ZJ1 A;  5FXZ A;  2UUC T;  2E9X C;  4UVB B;  4ZI3 C;  3SFE A;  4LF5 T;  3FZF B;  3NBX X;  2YEV C;  5KXJ A;  4DR2 T;  2X9Y A;  3KIN B;  3VRB A;  2IDO B;  3LBX A;  4DV4 T;  2JMH A;  4BA9 A;  4H9O C;  2XAG B;  4KHP T;  4LMJ A;  4XBF B;  2JQK A;  2IHR 1;  2XQ7 A;  4A97 A;  2PFV A;  4DR7 T;  5ABH A;  3KFW X;  3PJA J;  4AIS A;  2JQ9 A;  3ONJ A;  5CGM A;  2C0S A;  2MYS A;  4DBQ A;  3ZN0 B;  1N32 T;  3GMI A;  3OKQ A;  4PFO A;  4DV5 T;  1UX5 A;  2YDR A;  1XWM A;  1IJ6 A;  4YXD A;  2IUB A;  4YJ3 E;  5CB4 E;  2XM2 A;  3HA4 A;  4AQF A;  1HCI A;  1SE7 A;  2CXF A;  2V1D B;  4U31 A;  4GIW A;  3AAI A;  3V5S A;  1YQ3 A;  4HE8 A;  3LK3 B;  2IC9 A;  3AXJ A;  3O1J A;  3KV5 A;  4U7I A;  1U5P A;  5L4E A;  3ZJ2 A;  3I0Q A;  3GA8 A;  5L3E B;  1KEY A;  1VCT A;  2E9X A;  2KZ7 B;  4UF0 A;  3I1A A;  3RH3 A;  3OYZ A;  5LJM A;  3UUL A;  3HI2 A;  4QH1 A;  1UCU A;  5E0O A;  3ANW A;  3F2E A;  5AQO B;  1BR1 A;  4HWH A;  1LVF A;  4N78 D;  4ZXL A;  1KNZ A;  2N1G A;  1BR0 A;  2C5I T;  2X66 A;  3RYC E;  5JVD E;  5AQS B;  3AEF A;  3KV6 A;  2VB6 A;  4DO0 A;  5JDF A;  5TAO A;  1HG5 A;  2VWA A;  2GK9 A;  3RC3 A;  3ZYL A;  5LOV E;  5DQV A;  4HWI B;  3KBT A;  3VR8 A;  2XQA A;  1E1H B;  2CBJ A;  5LG3 A;  3Q5D A;  5EK4 A;  2FJE A;  3GWH A;  2LSK A;  3QNU A;  4YHJ A;  3ZYM A;  2LOP A;  3KV4 A;  2BS4 A;  2NP9 A;  2J4G A;  3C4Z A;  3ZSS A;  4HFV A;  2V7L A;  4H9S E;  4YTN A;  2NOX A;  4H63 H;  1XNR T;  1D0Z A;  2AE9 A;  5LGN B;  4KBM B;  4UV9 B;  2PTF A;  4QXC B;  3EI0 A;  4JI4 T;  3PTR B;  2WM9 A;  4X20 E;  2WMN A;  3N2G E;  1IZN B;  5FP3 A;  2Q9Q C;  2N2N A;  4MLK A;  3L8R A;  4YT0 A;  2W0G A;  5LMU T;  4JI0 T;  4YLH A;  3ZPO A;  4IE0 A;  5AQL B;  5FY1 A;  1HNX T;  5A1L A;  4LML A;  3CPZ A;  3A7M A;  2DCF A;  2QVA A;  3AA1 B;  4L0R A;  4F8H A;  3RIA A;  3RKG A;  4TUY E;  3TLS A;  4H9R C;  4NIQ A;  2MAW A;  3C50 A;  4OFZ A;  4HN9 A;  1CHU A;  5J2T E;  2Z6E A;  2WS3 A;  3EVY A;  2X0H A;  2K48 A;  4IDO A;  5HXH A;  4LF9 T;  1T72 A;  4X1I E;  2LSY A;  3MXZ A;  4CZZ B;  3ZC0 A;  1E7P A;  1IBK T;  2HH7 A;  1XDO A;  1S94 A;  3A5X A;  4DR3 T;  3N9O A;  1KK7 A;  3WAK A;  1HNW T;  3C51 A;  4JLE A;  2D9D A;  4AI6 A;  3RIF A;  2IIU A;  2E9X D;  4LF6 T;  4HWC A;  2UXD T;  4B3R T;  4ZI3 D;  3L3P A;  2CHO A;  2H3R A;  5LGT B;  2BDE A;  3P50 A;  5J0Z A;  4DBR A;  1ZOY A;  3PUS A;  4KHZ F;  4ZHQ E;  2DHR A;  4HGA A;  5KX5 E;  2LLY A;  5AQI B;  2CCQ A;  4JI3 T;  2W2U A;  1YKH B;  4GKJ T;  1ZP0 A;  1QSD A;  4WBN E;  3AB3 B;  4UVA B;  2XAQ B;  1M7K A;  1D1A A;  5HEU A;  2OLT A;  4IIJ E;  3AEB A;  3GN5 B;  2H7V C;  5JR9 C;  1MIW A;  2L9Q A;  1BR2 A;  3NVO A;  3ZC1 A;  4YJ2 E;  3MZK B;  1UGO A;  3D0T A;  3QB5 A;  5LA6 E;  4TWF A;  2BKN A;  3UU5 A;  5C2T A;  4OHF A;  3PUA A;  4O4L E;  5FVL A;  3O1H A;  1WFD A;  5AQV B;  2JQH A;  5ABF A;  3P4P A;  2E8I A;  2WZI A;  4CXX A;  3CWZ B;  2YN6 A;  4I0U A;  3AA6 B;  4EED A;  4JEH B;  1DU2 A;  4TV8 E;  4EV6 A;  1SA0 E;  5JRC A;  4TV9 E;  1J5W A;  4PJJ A;  2LHN A;  4Z90 A;  4TZ4 C;  1VCS A;  2BBJ A;  4DND A;  4WZX A;  1I6Z A;  5LXT E;  4CI2 B;  3N9Q A;  5FL1 A;  3EUH A;  5J1G A;  4DID B;  3L09 A;  4HFH A;  2W00 A;  5JRE A;  3JAE A;  2E5L T;  3EDV A;  3RLF F;  4ILB A;  4JI1 T;  3VRA A;  3K8P C;  1YD8 G;  2BG9 E;  3TLT A;  3ESL A;  1MNE A;  4ZEY A;  4P0B A;  3PUV F;  2C5K T;  1OED C;  5AQF B;  3UQ4 A;  2UXB T;  2A72 A;  4CQI A;  1O3X A;  3VKH A;  2LSJ A;  3AXJ B;  1MMD A;  4ILC A;  4DV0 T;  3TLW A;  2UU9 T;  2ACX A;  1SUM B;  4CN4 A;  4JV5 T;  3T1H T;  4GK0 E;  1ZKE A;  1XZY A;  3P7I A;  3K3Q C;  3SOL A;  3ZCI A;  4OX9 T;  2E9X B;  3A8Y C;  5L4H A;  2XY8 B;  5LNK A;  3IA3 A;  3O1I A;  5H6R B;  3RRW A;  4DR5 T;  2KLQ A;  4ERR A;  5AQG B;  3EAB A;  2WZH A;  4HWD A;  5AQT B;  5AQM B;  4DUY T;  3ZST A;  1N33 T;  5FL0 A;  3FB2 A;  2CM0 A;  2FJD A;  3ANW B;  5JDG A;  4ZS2 A;  3ZT5 A;  2BKO A;  3J9X 1;  3J7Y q;  2WBL A;  4X64 T;  4LF8 T;  2KWI B;  3ZMS B;  3PUR A;  4UEM A;  1HS7 A;  2K24 A;  1FIO A;  2A3D A;  3ZMT B;  2AXD S;  4A98 A;  4JI2 T;  2HPJ A;  1T8B A;  2WMO A;  3FZK B;  2NW8 A;  4G63 A;  1N36 T;  2WSS V;  3FBZ A;  2HN2 A;  2X9H A;  5AQP B;  2VL8 A;  1D0Y A;  3K3N A;  5FY7 A;  2W62 A;  2V6X A;  3P4R A;  4NUU A;  3EAM A;  2KND A;  2VKH A;  3PUG A;  4ZI7 E;  1KNR A;  4ANJ A;  4EYY R;  3N9L A;  2J47 A;  1OED A;  4A56 A;  2VKJ A;  2ZMA A;  3OYX A;  4QH4 A;  2V6Y B;  3C4W A;  2EHO C;  2XAS B;  4IGU A;  5DQW A;  4PK6 A;  1W09 A;  3AE6 A;  4KI0 F;  3E0Z A;  4IDZ A;  3HL6 A;  3RX6 A;  2WWV A;  2XSB A;  4QXB B;  2VKD A;  5LHH B;  2W61 A;  3OPC A;  2XJ7 A;  5AQK B;  2UXX B;  1W0B A;  2WU5 A;  3VHL A;  4O4I E;  5IYZ E;  2XZE A;  3Q5E A;  4HFE A;  5L3D B;  4YSY A;  3CX6 B;  3Q5W A;  4PJL A;  2D2S A;  1XMO T;  3PUQ A;  4OK0 A;  3UTK A;  3FBL A;  2XQ9 A;  3DJB A;  1G8X A;  4IHJ E;  5F5W A;  5HXR A;  3OJA A;  3ZMU B;  4DMW A;  1NEK A;  2M6B A;  4LFA T;  1WR0 A;  5AFU L;  3UU4 A;  3B57 A;  1WR6 A;  2BVM A;  4H9Q C;  5KMG P;  4AIU A;  4AQY T;  4DV3 T;  4ISS A;  3P4W A;  2LKH A;  4LFC T;  3UFE A;  2W67 A;  2LSG A;  2FBW A;  3LK2 B;  4QH5 A;  2RA1 A;  1WCR A;  5HCJ A;  1MIY A;  4NXM T;  1HX1 B;  2XUE A;  4COF A;  1FJG T;  2MPK A;  2YU2 A;  4WYV A;  5LHG B;  1HFA A;  1NEN A;  3NRX A;  4PFP A;  4MBQ A;  4HTE A;  2K3W A;  2Y8D A;  3F31 A;  4PK4 A;  3M3Z B;  2XAF B;  5L3F B;  1JNR A;  1MMN A;  2LRK A;  5LCY A;  3SS1 A; 
#chains in the Genus database with same CATH homology
 3RC8 A;  5HWY A;  3NZQ A;  4JLE A;  3CQG B;  4AI6 A;  3C64 A;  5EK3 A;  1IAP A;  2EHO A;  2E9X D;  2DNX A;  3C4X A;  4ZI3 D;  3L3P A;  2JJ9 A;  1LVK A;  2H3R A;  5LGT B;  2BDE A;  4DBR A;  3QC9 A;  3PUS A;  3LFM A;  2DHR A;  4HGA A;  4ZHQ E;  2DI4 A;  1U4Q A;  3TKL B;  2DWG A;  4QKN A;  4WBO A;  3H37 A;  5KX5 E;  4BJM A;  4FI5 A;  1SHZ C;  3KVA A;  2CCQ A;  2LM9 A;  2Q9Q B;  5CA1 E;  4QX7 B;  4DVD A;  3OBV E;  5JQG E;  1D0X A;  2XAH B;  3F57 A;  1YKH B;  4QXH B;  2X9X A;  3UUM A;  1LRZ A;  5L2L A;  1QSD A;  4C91 A;  4WBN E;  5EZY E;  3AA0 B;  3AB3 B;  3AVR A;  4CI1 B;  2WAU A;  3R84 B;  3PU8 A;  4UVA B;  2XAQ B;  1H7C A;  3JC6 C;  4GK5 E;  4YFS A;  4E7S A;  1D1A A;  2N9D A;  4O4J E;  4UV8 B;  2VK9 A;  4IIJ E;  3V5U A;  3GN5 B;  5F3J A;  1QUU A;  4MHC A;  2H7V C;  5JR9 C;  3N9M A;  1MIW A;  2L9Q A;  5JRC B;  2H7O A;  1BR2 A;  4L5G A;  3I9W A;  4KP3 C;  3ZC1 A;  4J2C A;  2PG8 A;  3CX8 B;  5FXX A;  3AAE B;  4YJ2 E;  3MZK B;  4E7Z A;  3D0T A;  2V7J A;  4AKL A;  3ZLI A;  2V7K A;  3BQK A;  5LA6 E;  2MTQ A;  2ES0 A;  2IAK A;  1BR4 A;  3MKD A;  4UF0 B;  4I55 E;  4AQF C;  4H9N C;  4OHF A;  3PUA A;  4O4L E;  4ZI2 C;  3RKO A;  4P0A A;  3O1H A;  3PU3 A;  3Q5X A;  2ZM8 A;  5LBQ B;  5FXV A;  2LE8 A;  3H3A A;  4BAY B;  1AJ3 A;  1Z0P A;  2XHE B;  2CXD A;  5LP6 E;  2OA5 A;  3CML A;  4V1A v;  1HX8 A;  2E8I A;  5HYA A;  2A2F X;  4IE5 A;  3E22 E;  5GON E;  2LT3 A;  4ZS3 A;  4CXX A;  3CWZ B;  5ADX L;  3LG7 A;  3PE0 A;  2CA5 A;  4EZ4 A;  2WWU A;  3QK6 A;  3AA6 B;  3C98 B;  4PJM A;  5L3C B;  1VRB A;  4IE7 A;  4JEH B;  1CUN A;  3AVS A;  1ZEE A;  4TV8 E;  2CXL A;  2JQQ A;  4JUY A;  1FMV A;  1VOM A;  3U78 A;  3GN5 A;  4OYJ A;  1B7T A;  2DWK A;  3KV9 A;  4UXN B;  3T8O A;  1SA0 E;  4ILU A;  4ZOL E;  1YKE B;  5JRC A;  4KMC A;  3ZJ1 A;  3P8C D;  4TV9 E;  5FXZ A;  2XTL A;  4PJJ A;  2LHN A;  3WI3 A;  4ADZ A;  2YIN A;  3CKD A;  3IEE A;  4TZ4 C;  2QGS A;  2X51 A;  2E9X C;  4UVB B;  4PK5 A;  4K0U A;  3AAA B;  4ZI3 C;  5JDL A;  2YU1 A;  3DP7 A;  4PJN A;  4DND A;  1X79 A;  5JDH A;  4EAH A;  2X67 A;  2LJL A;  3SRZ A;  5LXT E;  3FXE B;  3NBX X;  3N2K E;  4OYK A;  2KWH A;  3W15 B;  3UUN A;  4CI2 B;  3N9Q A;  3EUH A;  2VKO A;  2JPF A;  2MOZ A;  2YEV C;  3L09 A;  5J1G A;  2X9Y A;  2W00 A;  1Y64 B;  5JRE A;  5JR9 B;  3KIN B;  3EDV A;  3ZMZ B;  1MMA A;  3LBX A;  4QHO A;  2JMH A;  3ETU A;  4M1P A;  3RPU A;  3HR0 A;  2M67 A;  5DAB A;  4BA9 A;  3FHN A;  4H9O C;  3UUX B;  2XAG B;  4EIW A;  4XBF B;  3Q9D A;  4AQG A;  5HXE A;  3K8P C;  1YD8 G;  1EZ3 A;  2V26 A;  3ESL A;  2JMK A;  4EXT A;  1MNE A;  4NUV A;  3NZP A;  5BMV E;  3VKG A;  2PFV A;  2I59 A;  5M4Y A;  4P0B A;  3KFW X;  4BJN A;  3RYI E;  4DMV A;  2C5K T;  3RRC A;  5HXS A;  3I9Y A;  3ZEF B;  4P09 A;  3B13 A;  2A72 A;  4CQI A;  2L3L A;  5H6Q B;  3O9X A;  2SPC A;  2C0S A;  2MYS A;  1O3X A;  2LHR A;  2LSJ A;  3ZN0 B;  4DBQ A;  3VKH A;  3GMI A;  3OKQ A;  1MMD A;  4PFO A;  2IW5 B;  3E08 A;  3O4X E;  3M65 A;  4X1Y E;  1UX5 A;  2C5J A;  1ZHC A;  2ACX A;  2ZM2 A;  1IJ6 A;  5KDM C;  4H63 V;  4GK0 E;  1ZKE A;  4YJ3 E;  3P7I A;  3K3Q C;  2NTY A;  3SOL A;  3ZCI A;  2E9X B;  2CE7 A;  4H9P C;  5CB4 E;  4EB6 E;  1T98 A;  1NWM X;  2JRK A;  2EHO D;  2W63 A;  3HA4 A;  5LNK A;  4AQF A;  1HCI A;  2L8K A;  2CXF A;  1WRD A;  3O1I A;  4IST A;  5H6R B;  3RRW A;  2V1D B;  5L3B B;  1OXZ A;  2KLQ A;  4GIW A;  4UEL A;  4ERR A;  3AAI A;  3V5S A;  1WLX A;  2Q9Q A;  5LBM A;  3FXD B;  4HE8 A;  1YW0 A;  4B6X A;  2Y48 B;  3LK3 B;  4O2B E;  3CVR A;  5LJN A;  4AKG A;  2D5U A;  2KMF A;  1UX4 A;  1MIV A;  2BZB A;  4WW0 A;  2IC9 A;  4IE4 A;  3FB2 A;  3UT5 E;  2CM0 A;  4I4T E;  4F6R C;  3ANW B;  3PDY A;  5J2U E;  5JDG A;  4ZS2 A;  3O1J A;  4MAL A;  3KV5 A;  3HKB E;  3HKE E;  2DLR A;  1NAF A;  4AKH A;  3J9X 1;  1U5P A;  3WAJ A;  3J7Y q;  3ZJ2 A;  2V7M A;  3AA7 B;  3CQX C;  2WBL A;  3HKC E;  3I0Q A;  3GA8 A;  3N9P A;  5IHY A;  2IC6 A;  3ZMV B;  4I50 E;  4CXW A;  5JH7 E;  3BQI A;  5L3E B;  4HKA A;  2KWI B;  3CX7 B;  3SWH A;  2NTX A;  3PUR A;  4UEM A;  5HAX A;  2K24 A;  2NW9 A;  3RYF E;  3ZMS B;  4C90 A;  1HS7 A;  1FIO A;  2A3D A;  3ZMT B;  4PNI A;  2E9X A;  2CEA A;  1HTJ F;  3IBP A;  2KZ7 B;  1LKX A;  4UF0 A;  2X0L B;  3HKD E;  2B1E A;  3I1A A;  2HPJ A;  4WNK A;  3RH3 A;  2K9A A;  4AKI A;  3OYZ A;  3EDU A;  2K5B B;  5LJM A;  3RYH E;  2WMO A;  4G63 A;  2NW8 A;  4QWN B;  5FXW A;  4EZH A;  2WSS V;  4L9I A;  3FBZ A;  3N9N A;  2X9H A;  3ZYK A;  4MFR A;  3R6N A;  3UUL A;  1D1B A;  2J1D G;  2RP4 A;  3HI2 A;  2VL8 A;  1UCU A;  1D0Y A;  3K3N A;  4XAX B;  5E0O A;  5FY7 A;  2P9B A;  3ANW A;  2W62 A;  1HG2 A;  2KIN B;  3F2E A;  5DJQ C;  3I0O A;  1BR1 A;  4HEA A;  4GYR A;  1LVF A;  4N78 D;  3N5L A;  3S4U A;  3ZN1 B;  1KNZ A;  3IHR A;  4NUU A;  2CLY C;  5FMN A;  2N1G A;  2KND A;  2VKH A;  1BR0 A;  3PUG A;  5FYM A;  4ZI7 E;  2C5I T;  5JDM A;  4ANJ A;  4EYY R;  3N9L A;  2X66 A;  4A56 A;  3RYC E;  2VKJ A;  3VU7 H;  2ZMA A;  3OYX A;  5JVD E;  5FY0 A;  2V7I A;  3C4W A;  2EHO C;  3KV6 A;  5CA0 E;  2XAS B;  4IGU A;  5DQW A;  3ONX A;  4CXY A;  4PK6 A;  4PAG A;  2VB6 A;  3LJC A;  3E0Z A;  4UVC B;  4IDZ A;  4PW8 A;  3HL6 A;  4DO0 A;  4CI3 B;  2X9W A;  4GOU A;  1V9D A;  1ZV4 X;  3RX6 A;  4TN7 B;  5ETW A;  5JDF A;  3Q2M A;  3ETV A;  2CWY A;  4QXB B;  5TAO A;  2VKD A;  5LHH B;  4O4H E;  2W61 A;  4IE6 A;  1HG5 A;  2VWA A;  5HWX A;  3K3O A;  5JDN A;  2GK9 A;  2KXP B;  4UIG A;  5JR9 A;  5LOV E;  2UXX B;  3RC3 A;  3MAC A;  3ZYL A;  5DQV A;  3VHL A;  2VAS A;  3KBT A;  5C8Y E;  4O4I E;  5IYZ E;  2ODV A;  1E1H B;  5L3D B;  2BVL A;  5EK4 A;  3CX6 B;  5LG4 A;  3Q5W A;  4PJL A;  5L3G B;  1OWA A;  2D2S A;  3KDS E;  3GWH A;  2D0U A;  2LSK A;  5F8P A;  4YHJ A;  4EYU A;  2ODU A;  3PUQ A;  4Z8X A;  4OK0 A;  3ZYM A;  2LOP A;  3KV4 A;  3UTK A;  3FBL A;  3DJB A;  1G8X A;  2NP9 A;  4X1K E;  1WYB A;  4IHJ E;  3C4Z A;  5HXR A;  4AKR B;  4TX5 A;  1G73 A;  2D0T A;  3OJA A;  3QUJ A;  4FJO A;  2CMR A;  4HFV A;  3DTO A;  3ZMU B;  2UXN B;  2V7L A;  4H9S E;  4DMW A;  2LSI A;  5AFU L;  1D1C A;  2NOX A;  3B57 A;  2ZM0 A;  4H63 H;  1D0Z A;  2KT9 A;  2XAJ B;  5HXC A;  4EOZ B;  3BQL A;  5EK2 A;  4G2A A;  5LGN B;  1WR6 A;  2BVM A;  4H9Q C;  4KBM B;  2G0U A;  4QXC B;  4UV9 B;  5KMG P;  5LYJ E;  2Y6X A;  3PTR B;  2WM9 A;  4X20 E;  3ZCJ A;  2WMN A;  3N2G E;  1IZN B;  2NWB A;  5FP3 A;  2Q9Q C;  3JC6 D;  2N2N A;  4MLK A;  4QX8 B;  2CLY B;  2W0G A;  4ISS A;  2PJQ A;  4U72 A;  1WYC A;  3SS1 A;  4YLH A;  3ZPO A;  4IE0 A;  5FY1 A;  2LOS A;  4KUM B;  3MA9 A;  5LGU B;  3LBX B;  2QA7 A;  1MMG A;  2YK0 A;  3UFE A;  5A1L A;  1US7 B;  2LSG A;  3CPZ A;  3KBU A;  2EHO B;  3LK2 B;  3N2O A;  2DCF A;  3IF8 B;  2RA1 A;  2XQY A;  1MIY A;  2HPL A;  3AA1 B;  3NRY A;  4L0R A;  3U3I A;  2XUE A;  3LK4 2;  4GYS A;  4ZI2 D;  5FNV E;  3CQC B;  3MK7 C;  4TUY E;  3BK9 A;  4H9R C;  2YU2 A;  2PBI A;  3C50 A;  4OFZ A;  4HN9 A;  4O8S A;  5JDQ A;  2X68 A;  5LHI B;  4ASK A;  2Q9Q D;  5J2T E;  5LHG B;  2Z6E A;  4I43 B;  1HFA A;  4O2A E;  3EVY A;  4JEU B;  4AXP A;  3NRX A;  2K48 A;  5HXH A;  4PFP A;  2NW7 A;  2CWO A;  4U74 A;  4X1I E;  2LSY A;  3MXZ A;  4MBQ A;  2MBG A;  4CZZ B;  4HTE A;  2Y8D A;  3F31 A;  3ZC0 A;  4PK4 A;  4XZC A;  2XAF B;  1MND A;  3KVB A;  1FEW A;  1FMW A;  2LEH A;  1S35 A;  1IJ5 A;  2HH7 A;  1HF8 A;  1S94 A;  3A5X A;  5L3F B;  3N9O A;  1KK7 A;  1MMN A;  3MJX A;  5LCY A;  3WAK A;  3C51 A;  2ZLY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...