4ZEYA

Crystal structure of a nuclear receptor binding factor 2 mit domain (nrbf2) from homo sapiens at 1.50 a resolution
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
84
structure length
84
Chain Sequence
GMEGPLNLAHQQSRRADRLLAAGKYEEAISCHKKAAAYLSEAMKLTQSEQAHLSLELQRDSHMKQLLLIQERWKRAQREERLKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a nuclear receptor binding factor 2 MIT domain (NRBF2) from Homo sapiens at 1.50 A resolution
rcsb
source organism Homo sapiens
molecule tags Transcription regulator
molecule keywords Nuclear receptor-binding factor 2
total genus 31
structure length 84
sequence length 84
ec nomenclature
pdb deposition date 2015-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17169 NRBF2_MIT MIT domain of nuclear receptor-binding factor 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.280 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Hypothetical protein 1500032h18. 4zeyA00
2XZEA 2DL1A 2V6YA 4U2ZA 4CN4A 1WCRA 2LRLA 4U7YA 2JQKA 2V6XA 4NIQA 4CN1A 2V6YB 2JQHA 1WFDA 4P1NA 5CGMA 1WR0A 1YXRA 5FVKA 4U3CA 3K1SA 4IT4A 5FVLA 2CRBA 2LRKA 2WWVA 4WZXA 4U33A 4U2YA 2W2UA 2WY2A 2MPKA 3ZT6A 2K3WA 5CJ5A 2JQ9A 2RPAA 2CPTA 2A9UA 4ZEYA 4A5XA 3ZT7A 4U31A 5LB7B 3ZSTA 3EABA 3ZT5A 4U7IA 3ZSSA 4CN6A
chains in the Genus database with same CATH superfamily
2WM9A 4GYSA 3PJAJ 1N33T 1UX5A 5HXRA 5JDQA 3G06A 2W62A 2Q9QC 3AE3A 2KNDA 5HEJA 5HEUA 2JQKA 3P4RA 1XMOT 3ZC0A 2CBIA 3KVAA 2X0HA 5AQGB 4AQFA 5KX5E 4NXMT 5FVKA 1N34T 4O2BE 4U3CA 3C98B 3KV9A 2MAWA 3LFMA 1V9DA 3Q5EA 2JQQA 2E8IA 3ANWA 4IE6A 3TLUA 2W63A 3WAKA 3CVRA 4J2CA 4YHHT 3LK42 2V5DA 5L4EA 4DR4T 4O4IE 2WY2A 2NR4A 2X66A 3IEEA 3HKDE 3QB5A 1LVFA 1SHZC 2LM9A 4ZEYA 4AXPA 5CA1E 3AEAA 3ONLC 3NZPA 1D0XA 5HXSA 1D0ZA 3AA0B 4KHZF 5HEOA 4K0KT 1CUNA 2GK9A 4ILBA 4PNIA 1J5ET 2IHR1 3KINB 3Q9DA 3LSVA 4QXBB 2X9HA 3JAEA 2BKNA 1OWAA 1KF6A 3N9PA 4IE5A 2WDVA 2B1EA 3FB2A 1ZKEA 3RGLA 4H63H 2LSIA 3MA9A 2RP4A 4PFOA 3FXEB 2CXFA 2L8KA 5HCMA 4A97A 4DMWA 5BR8T 4YJ2E 4AKLA 1WYBA 3RIAA 1HG5A 4ADZA 1UUSA 2V8SV 2XAHB 1MMDA 4KX6A 4HFHA 4IE4A 3GMIA 2F4VT 1KEYA 2H89A 2KLQA 2LSGA 4L5GA 2UXCT 4UXNB 2XQ4A 2YDRA 4YSXA 3ABVA 3RYFE 4H9RC 1H7CA 3OBVE 5LP6E 5J2UE 4LF7T 5AQPB 4KP3C 3AECA 3RLFF 2M6IA 2A9UA 2RPAA 3UUBA 1HS7A 2XHEB 5LG4A 3ZN0B 4X66T 3PURA 3N2OA 1HNWT 1E1HB 5LOVE 1IBLT 4HWFA 4KMCA 3AE9A 4QH4A 3PUXF 3BK9A 4QHOA 4YFSA 4C91A 4BJMA 3ESLA 3RIUA 4BJNA 4DVDA 2NW9A 3N9NA 3UQ7A 4N78D 3RC8A 3GA8A 2YU2A 3ZMTB 2JIWA 2VASA 2I59A 5C2TA 5JRCB 3KBUA 2ODVA 2NP9A 2CM0A 3C4ZA 4YTNA 2UXDT 3AVSA 3CMLA 1MMGA 2E9XC 3ZEFB 2XAQB 4H9PC 1Y01A 2OLTA 4AKIA 2V7IA 1US7B 3QNUA 3ZMUB 1HNXT 1SUMB 3AEBA 3EVYA 4ISTA 4TWFA 5KMGP 2PTFA 5CB4E 2MPKA 3RYCE 3CQGB 3AAEB 3JC6C 1N36T 2V7JA 3C4WA 3NWIA 3PUGA 4AQGA 5EK4A 2WB5A 3D0TA 5ADXL 3JAFA 3N9QA 4HWIB 4IDPA 2XAFB 2BVLA 4LMJA 3LK3B 5FNVE 3VU7H 3MK7C 5AQLB 3CX6B 3ZSTA 5JREA 3NRYA 3LK2B 4DR6T 3EDUA 1WYCA 4TWHA 4ZZCA 1MMNA 3FZHB 4DR7T 4H63V 2PG8A 3I9YA 3L09A 2VKHA 3KV4A 4TX5A 2H7OA 3NVOA 3NZQA 4FJOA 2CHNA 3P4SA 1VOMA 3LG7A 4UV8B 4GKKT 1T7SA 4LF6T 2CA5A 4JEUB 4BAYB 5LA6E 2WQYA 5CFBA 5JR9C 3C64A 1JNZA 1UK5A 2D0TA 3RYIE 1J5WA 5TAOA 1HX8A 2BKOA 1ZP0A 3NRXA 4P09A 5AQVB 2H3RA 2ZM2A 2CBJA 4UF0A 2D5UA 2LKHA 2LOPA 4QXHB 5FY7A 4ZI3C 4CI1B 4LMKA 4AKRB 4JUYA 2HH7A 2WMOA 4U2YA 5L47A 4DR5T 2MOZA 4XZCA 3ZT6A 5AFUL 3O9XA 2L9QA 5ABGA 3WI3A 2X9WA 5LNKA 4GK0E 3F57A 1BR2A 1KNPA 2K48A 2LHNA 4HTEA 3I0QA 1VCTA 4HWDA 3ONXA 3FXDB 4MBQA 5L4HA 2XQAA 2G0UA 2DWGA 3F31A 2ZM0A 3AE6A 4MFRA 2H88A 3PUWF 2BG9C 2DI4A 4ZS3A 3RIFA 1XMQT 3OYZA 4KBMB 4DMVA 2DWKA 4IL9A 1MIYA 2BKPA 2JJ9A 2AE9A 2BZBA 2Q9QD 2SPCA 3JC6D 2LRLA 5AQTB 2KMFA 2XQ8A 3TLTA 3ZKRA 2E5LT 5AQUB 4B3TT 3KV6A 3DTOA 3UU4A 4JI1T 1BR0A 2VB6A 2JPFA 4HFIA 3ETUA 2LSYA 4EZHA 4IT4A 2N2NA 2BG9B 3P50A 1IBMT 2XAJB 3RQWA 1G8XA 4ZS2A 3SWHA 3P4WA 1IJ6A 1I94T 2OA5A 3N5LA 4MLKA 3QB5K 3U78A 2A3DA 4X62T 4QH1A 3PJAA 1FEWA 1R8IA 2X51A 4AIUA 2Y6XA 3MACA 2YDSA 3RIUC 4ZHQE 4IHJE 3I9WA 2YK0A 3CX8B 2DNXA 3KFWX 3V5UA 2EHOB 3ZN1B 4EOZB 2XY8B 5AQOB 2Q9QA 4K0UA 4CQIA 1QSDA 1HG2A 5IWAT 2C0SA 4IE0A 1FIOA 2X68A 4OFZA 1FMWA 4JI4T 3B57A 3CQXC 2A72A 3OVUA 1MIVA 4CXXA 3KVBA 2LT3A 3AE1A 1HFAA 4COFA 5LXTE 4H9OC 2CCQA 4PJMA 1HF8A 3PU3A 1KFYA 4P1NA 1T8BA 4CXYA 3VKHA 2YINA 1YXRA 3P8CD 1YD8G 4EV6A 4XBFB 2PJQA 2WDRA 3SOLA 2W61A 4WBNE 2UXNB 5LGNB 2UXXB 4O4JE 4IDOA 4UIGA 4LF9T 2L3LA 3GWHA 2VVSA 1KNRA 1NENA 3RRWA 3H3MA 3PDYA 3BQIA 4PK6A 4X5TA 5DABA 3UU6A 5JDLA 5L3GB 4DUYT 1MMAA 4UV9B 3HL6A 3UU5A 1VRBA 4F8HA 5C8YE 3ZMSB 3R6NA 1S94A 3J9X1 3X1DA 5L3FB 4ZI2C 5L3CB 4IE7A 4PK4A 3IHRA 3ZT5A 2EHOC 5C3JA 1W0BA 2X9XA 1O3XA 1UURA 3N9LA 4U2ZA 5LHIB 5LMNT 1D1BA 4JYAT 1WCRA 2VQET 4O4HE 2XQ7A 1IJ5A 2XPKA 3GN5A 2UXBT 3AEEA 4MHCA 5EZYE 2AXDS 2WU2A 2XQ9A 1VCSA 1ZOYA 4QH5A 5E0OA 2CRBA 2JMKA 4CI3B 4ZI3D 3OTOT 1WLXA 1U4QA 2KXPB 2LEHA 4U33A 4X1KE 2XQYA 3EDVA 1YQ3A 2KZ7B 4TUYE 1GQEA 3CIRA 3E22E 2WS3A 2V26A 3PUVF 4M1PA 2DCFA 2LLYA 5AQJB 3UULA 3HA4A 4QX7B 3LBXB 5LBMA 4NUUA 5LB7B 3AEGA 3A7MA 3I0OA 2CWYA 3Q5WA 3ZLIA 4DR3T 4ILCA 5H6QB 3ZSSA 3BQKA 2WAUA 1T72A 2IMLA 4ZI2D 3PU8A 1YQ4A 5JTGA 5KDMC 5LJNA 4Z8XA 3PUQA 5GONE 2BS3A 3MXZA 4IDNA 1M62A 2CXDA 3H3AA 5JDMA 3VKGA 4H9NC 2Y48B 3UUNA 4HFBA 5HEHA 5JDGA 2CXLA 4IDZA 4JI2T 2XASB 3C51A 4WW0A 4EXTA 3CX7B 4AKHA 3U3IA 4JBWF 1CHUA 1QUUA 2BVMA 2C5JA 2IDOB 3AE2A 4E7SA 5FXZA 2WWVA 4DV2T 1JNRA 4KHPT 2ZM6T 4O4LE 1XDPA 2A2FX 2HPLA 3UUXB 3VHLA 5AQFB 3N9OA 1X9BA 1UCUA 5CA0E 2K3WA 1X79A 2JQ9A 1LRZA 1ZEEA 5HXEA 2X67A 4ISSA 4LMLA 1HR0T 4EEBA 3SRZA 5FXVA 4PK5A 4UVBB 3L39A 4U31A 5IHYA 4BA9A 1SA0E 1OEDA 3AEFA 4HFDA 3EUHA 2C5IT 2NWBA 5JDFA 5JR9A 4YSYA 2W66A 4TNWA 2W67A 4EIWA 5HCJA 2HN1A 5FYMA 2ZM8A 4Z91A 3ZPOA 1HCIA 2PBIA 5FY1A 5F3JA 4G2AA 5FY0A 5JR9B 2FJDA 1T98A 3KV5A 4EGWA 5HWXA 4NIQA 2W0GA 3N9MA 5FXXA 2E9XB 3UQ4A 5M4YA 5FP3A 2J47A 3IA3A 3PUYF 4X1YE 4E7ZA 4DV4T 3O1HA 5HWYA 3L8RA 2CE7A 2LRKA 2YDQA 3L3PA 3P4QA 4WZXA 3AXJA 3K8PC 4IDQA 4P0BA 3UUMA 2KWIB 2ACZA 2VL8A 1N32T 2ES0A 3KDSE 3TLWA 1HTJF 2KSRA 4TV9E 3NKZA 2BG9A 3HKBE 2X9YA 4OK0A 3CK6A 4QX8B 2VL0A 3BQLA 3N2KE 4FI5A 2CLYB 2KINB 3ZYMA 2NTYA 1E7PA 4IREA 2CHOA 2E2AA 3O1IA 4I50E 1XNQT 2CMRA 2XJ7A 5HXCA 4AQFC 4GOUA 3AE4A 3UU3A 4PAGA 4TNVA 1ZV4X 4DIDB 3O1JA 4UVCB 1MNDA 4U7YA 4DO0A 4LF5T 3PTRB 1WFDA 3ZJ2A 3DJBA 3TLVA 3QK6A 3T8OA 5LGUB 3ZC1A 2XQ5A 4ZXLA 2FJAA 4ANJA 5BMVE 4OYJA 1W0AA 3B5MA 4CXWA 1MNEA 5AQHB 3JADA 2IIUA 4JI7T 4KUMB 4QXCB 2CWOA 3RH3A 3SFDA 1YW0A 2RA1A 2C5KT 4JLEA 4L0RA 3RI5A 2WDQA 2WCAA 1W9RA 5LCYA 3CQCB 3RHWA 4UF0B 1I6ZA 5L3BB 5AQKB 4EEDA 3PUZF 5JDHA 3AAIA 3J7Yq 3M65A 3ZCJA 3EHZA 2P9BA 4CI2B 3ZYLA 2WZIA 2CLYC 5HEGA 4GYRA 1MIWA 3K3QC 1UGOA 2OV9A 4AISA 2H7VC 4PW8A 3TKLB 3A5XA 1D1AA 3AEDA 3M3ZB 2J62A 4YXDA 3LBXA 3VRBA 1FJGT 4JEHB 1NAFA 3AA7B 2FJBA 3LJCA 4HFEA 2VKOA 3UT5E 4DR1T 4UELA 2BDEA 2XSAA 4EZ4A 2QVAA 2XTLA 3K3OA 1S35A 3O4XE 1LKXA 4YT0A 1KNZA 1D1CA 5FMNA 3RYHE 5AQQB 5LGTB 3AE8A 3MZKB 2HN2A 2X0YA 5LYJE 5HYAA 1U5PA 5ABEA 2NW7A 4ZI7E 4IIJE 2MTQA 2UUBT 3HR0A 4OHFA 4A5XA 3Q5DA 4HEAA 2LM2A 2V5CA 3ZJ1A 2ODUA 4I0UA 4X65T 4DV5T 3FBZA 4EB6E 4U7IA 3RC3A 2BS2A 3Q2MA 4WNKA 3PE0A 3QUJA 4UVAB 4LFAT 4YJ3E 4YHJA 4LF8T 3UTKA 5CGMA 4EYUA 5J2TE 4YLHA 3MJXA 4I43B 2YEVC 2UU9T 2Q9QB 4CN1A 2YOEA 3HKCE 1IAPA 2D2SA 2LSJA 5ABHA 2MBGA 3ZYKA 4IL4A 4ZZBA 5HAXA 2XSBA 3EAMA 3KBTA 4HKAA 2M67A 3P7IA 3C50A 4YY3T 1OEDB 3H37A 4DV0T 4B3RT 2I6HA 3CKDA 5J1GA 5CJ5A 4HWCA 5IYZE 2X0LB 3RF1A 4DV3T 3FZFB 5L3EB 5JRCA 1UX4A 2YKSA 5ETWA 5JDNA 3ZT7A 5J0ZA 2BS4A 2QRXA 2XUEA 3MKDA 2N1GA 3PUAA 4ILUA 4KI0F 5AQSB 3ONJA 3ZMZB 2V1DB 4A56A 2EHOD 1NWMX 3AB3B 4B6XA 2LKGA 2QA7A 2XM1A 4Q25A 4PFPA 2ACXA 2J1DG 2BBHA 4U72A 1HNZT 5LHGB 5LJMA 5LBQB 2WU5A 1KK7A 4QWNB 3E08A 2MYSA 1EZ3A 3HKEE 2D0UA 1IZNB 2E5VA 1HX1B 2E9XD 3NBXX 4OYKA 2J4GA 4TWDA 3E0ZA 4U74A 2W00A 4WBOA 4YTMA 3A8YC 5FKYA 5FXWA 4DNDA 4JI3T 5DQVA 3FHNA 2VKJA 4TV8E 2DHRA 4UR9A 1YKHB 2JMHA 2R6GF 1M7KA 2W4XA 3OPCA 4NPPA 2DLRA 4HFCA 4XAXB 5DJQC 2W2UA 2YN6A 3S4UA 5F8PA 4DV1T 2HHHT 3RKGA 2VQFT 5L2LA 2M6BA 4MALA 1Z8UA 2IUBA 2NOXA 3OKQA 3AE7A 3VRAA 4CN6A 4DBRA 2XQ6A 4F6RC 4DBQA 2WMNA 3AE5A 3CWZB 1IBKT 4HWHA 1XNRT 1LVKA 1QLBA 3FBLA 4A98A 2WWUA 5AQIB 4YTPA 4DV7T 3AVRA 4CN4A 3JCFA 2K9AA 4TN7B 3WAJA 4HFVA 4B3ST 5IUXA 3FZKB 1W09A 2EHOA 2UUAT 3RRCA 2V6XA 4PJNA 1BR4A 2V6YB 2KWHA 4H9QC 3AA6B 4WYVA 4I4TE 2K5BB 4V1Av 3UFEA 4ZOLE 3F2EA 5FVLA 2VWAA 4Z90A 3V5SA 1OEDE 2V7KA 2Z6EA 2ZLYA 2FJEA 3VR8A 4ERRA 2VKDA 1WRDA 5EK3A 2BG9E 4HGAA 4G63A 4LFCT 2QYWA 3IF8B 2IAKA 3EI0A 2VURA 4O8SA 3Q5XA 4X64T 3T1HT 1DU2A 4JV5T 1XDOA 1OXZA 1SE7A 2FBWA 2IC6A 3LDQB 2LE8A 4ASKA 3SS1A 4AI6A 3UFGA 4C90A 4AQYT 4JI6T 2CEAA 3AAAB 2KT9A 2XM2A 4LF4T 3ETVA 2LJLA 4X1IE 5ABFA 4GKJT 4X20E 5ABFB 3RX6A 5L3DB 4QKNA 3VR9A 4NUVA 4P0AA 1WR0A 2BBJA 3K1SA 5JH7E 5HXHA 2VK9A 2JRKA 2D9DA 4JI5T 2B76A 2UUCT 4PJJA 2WZHA 3N2GE 2WSSV 4IGUA 5FL0A 3FZMB 2VVNA 3C4XA 3OYXA 3PUSA 3PV0F 4AKGA 1L0VA 5JVDE 3RQUA 4HN9A 5KXJA 3TLSA 5JQGE 2CPTA 4I55E 3IBPA 5FL1A 5LMUT 3QC9A 2ZMAA 2XQ3A 2PFVA 4H9SE 3UU8A 2YU1A 3I1AA 3P4PA 4CZZB 4GIWA 3EABA 1FMVA 4HE8A 5AQMB 3RKOA 2QGSA 2I0MA 2K24A 3DP7A 2V7LA 4ILAA 5H6RB 4YSZA 1NEKA 2XZEA 3GN5B 2DL1A 2V6YA 4DUZT 4OX9T 2XAGB 4GK5E 1B7TA 1OEDC 1ZHCA 4DV6T 3CPZA 3R84B 4NXNT 3W15B 1BR1A 2IW5B 3T1YT 1Z0PA 4B3MT 5LG3A 2IC9A 2JQHA 2LOSA 5DQWA 3ZMVB 5AQRB 5F5WA 4L9IA 3B13A 2V7MA 5EK2A 4UEMA 2WBLA 4JI0T 2WP9A 4EAHA 1YKEB 3AA1B 5AQNB 2LSKA 3RPUA 5A1LA 1AJ3A 1D0YA 1Y64B 4PJLA 3FZLB 2FUPA 3ANWB 3OJAA 1J1JA 3SFEA 4EYYR 4LFBT 3AXJB 1E2AA 4TZ4C 4DR2T 2NTXA 4JI8T 2N9DA 1XWMA 2HPJA 3K3NA 2Y8DA 3QOFA 2NW8A 4O2AE 3ZCIA 1WR6A 5LHHB 1G73A 2LHRA 1XZYA 2E9XA 3HI2A
chains in the Genus database with same CATH topology
2XZEA 2DL1A 2V6YA 4U2ZA 4CN4A 1WCRA 2LRLA 4U7YA 2JQKA 2V6XA 4NIQA 4CN1A 2V6YB 2JQHA 1WFDA 4P1NA 5CGMA 1WR0A 1YXRA 5FVKA 4U3CA 3K1SA 4IT4A 5FVLA 2CRBA 2LRKA 2WWVA 4WZXA 4U33A 4U2YA 2W2UA 2WY2A 2MPKA 3ZT6A 2K3WA 5CJ5A 2JQ9A 2RPAA 2CPTA 2A9UA 4ZEYA 4A5XA 3ZT7A 4U31A 5LB7B 3ZSTA 3EABA 3ZT5A 4U7IA 3ZSSA 4CN6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XZE A;  2DL1 A;  2V6Y A;  4U2Z A;  4CN4 A;  1WCR A;  2LRL A;  4U7Y A;  2JQK A;  2V6X A;  4NIQ A;  4CN1 A;  2V6Y B;  2JQH A;  1WFD A;  4P1N A;  5CGM A;  1WR0 A;  1YXR A;  5FVK A;  4U3C A;  3K1S A;  4IT4 A;  5FVL A;  2CRB A;  2LRK A;  2WWV A;  4WZX A;  4U33 A;  4U2Y A;  2W2U A;  2WY2 A;  2MPK A;  3ZT6 A;  2K3W A;  5CJ5 A;  2JQ9 A;  2RPA A;  2CPT A;  2A9U A;  4ZEY A;  4A5X A;  3ZT7 A;  4U31 A;  5LB7 B;  3ZST A;  3EAB A;  3ZT5 A;  4U7I A;  3ZSS A;  4CN6 A; 
#chains in the Genus database with same CATH topology
 2WM9 A;  4GYS A;  3PJA J;  1N33 T;  1UX5 A;  5HXR A;  5JDQ A;  3G06 A;  2W62 A;  2Q9Q C;  3AE3 A;  2KND A;  5HEJ A;  5HEU A;  2JQK A;  3P4R A;  1XMO T;  3ZC0 A;  2CBI A;  3KVA A;  2X0H A;  5AQG B;  4AQF A;  5KX5 E;  4NXM T;  5FVK A;  1N34 T;  4O2B E;  4U3C A;  3C98 B;  3KV9 A;  2MAW A;  3LFM A;  1V9D A;  3Q5E A;  2JQQ A;  2E8I A;  3ANW A;  4IE6 A;  3TLU A;  2W63 A;  3WAK A;  3CVR A;  4J2C A;  4YHH T;  3LK4 2;  2V5D A;  5L4E A;  4DR4 T;  4O4I E;  2WY2 A;  2NR4 A;  2X66 A;  3IEE A;  3HKD E;  3QB5 A;  1LVF A;  1SHZ C;  2LM9 A;  4ZEY A;  4AXP A;  5CA1 E;  3AEA A;  3ONL C;  3NZP A;  1D0X A;  5HXS A;  1D0Z A;  3AA0 B;  4KHZ F;  5HEO A;  4K0K T;  1CUN A;  2GK9 A;  4ILB A;  4PNI A;  1J5E T;  2IHR 1;  3KIN B;  3Q9D A;  3LSV A;  4QXB B;  2X9H A;  3JAE A;  2BKN A;  1OWA A;  1KF6 A;  3N9P A;  4IE5 A;  2WDV A;  2B1E A;  3FB2 A;  1ZKE A;  3RGL A;  4H63 H;  2LSI A;  3MA9 A;  2RP4 A;  4PFO A;  3FXE B;  2CXF A;  2L8K A;  5HCM A;  4A97 A;  4DMW A;  5BR8 T;  4YJ2 E;  4AKL A;  1WYB A;  3RIA A;  1HG5 A;  4ADZ A;  1UUS A;  2V8S V;  2XAH B;  1MMD A;  4KX6 A;  4HFH A;  4IE4 A;  3GMI A;  2F4V T;  1KEY A;  2H89 A;  2KLQ A;  2LSG A;  4L5G A;  2UXC T;  4UXN B;  2XQ4 A;  2YDR A;  4YSX A;  3ABV A;  3RYF E;  4H9R C;  1H7C A;  3OBV E;  5LP6 E;  5J2U E;  4LF7 T;  5AQP B;  4KP3 C;  3AEC A;  3RLF F;  2M6I A;  2A9U A;  2RPA A;  3UUB A;  1HS7 A;  2XHE B;  5LG4 A;  3ZN0 B;  4X66 T;  3PUR A;  3N2O A;  1HNW T;  1E1H B;  5LOV E;  1IBL T;  4HWF A;  4KMC A;  3AE9 A;  4QH4 A;  3PUX F;  3BK9 A;  4QHO A;  4YFS A;  4C91 A;  4BJM A;  3ESL A;  3RIU A;  4BJN A;  4DVD A;  2NW9 A;  3N9N A;  3UQ7 A;  4N78 D;  3RC8 A;  3GA8 A;  2YU2 A;  3ZMT B;  2JIW A;  2VAS A;  2I59 A;  5C2T A;  5JRC B;  3KBU A;  2ODV A;  2NP9 A;  2CM0 A;  3C4Z A;  4YTN A;  2UXD T;  3AVS A;  3CML A;  1MMG A;  2E9X C;  3ZEF B;  2XAQ B;  4H9P C;  1Y01 A;  2OLT A;  4AKI A;  2V7I A;  1US7 B;  3QNU A;  3ZMU B;  1HNX T;  1SUM B;  3AEB A;  3EVY A;  4IST A;  4TWF A;  5KMG P;  2PTF A;  5CB4 E;  2MPK A;  3RYC E;  3CQG B;  3AAE B;  3JC6 C;  1N36 T;  2V7J A;  3C4W A;  3NWI A;  3PUG A;  4AQG A;  5EK4 A;  2WB5 A;  3D0T A;  5ADX L;  3JAF A;  3N9Q A;  4HWI B;  4IDP A;  2XAF B;  2BVL A;  4LMJ A;  3LK3 B;  5FNV E;  3VU7 H;  3MK7 C;  5AQL B;  3CX6 B;  3ZST A;  5JRE A;  3NRY A;  3LK2 B;  4DR6 T;  3EDU A;  1WYC A;  4TWH A;  4ZZC A;  1MMN A;  3FZH B;  4DR7 T;  4H63 V;  2PG8 A;  3I9Y A;  3L09 A;  2VKH A;  3KV4 A;  4TX5 A;  2H7O A;  3NVO A;  3NZQ A;  4FJO A;  2CHN A;  3P4S A;  1VOM A;  3LG7 A;  4UV8 B;  4GKK T;  1T7S A;  4LF6 T;  2CA5 A;  4JEU B;  4BAY B;  5LA6 E;  2WQY A;  5CFB A;  5JR9 C;  3C64 A;  1JNZ A;  1UK5 A;  2D0T A;  3RYI E;  1J5W A;  5TAO A;  1HX8 A;  2BKO A;  1ZP0 A;  3NRX A;  4P09 A;  5AQV B;  2H3R A;  2ZM2 A;  2CBJ A;  4UF0 A;  2D5U A;  2LKH A;  2LOP A;  4QXH B;  5FY7 A;  4ZI3 C;  4CI1 B;  4LMK A;  4AKR B;  4JUY A;  2HH7 A;  2WMO A;  4U2Y A;  5L47 A;  4DR5 T;  2MOZ A;  4XZC A;  3ZT6 A;  5AFU L;  3O9X A;  2L9Q A;  5ABG A;  3WI3 A;  2X9W A;  5LNK A;  4GK0 E;  3F57 A;  1BR2 A;  1KNP A;  2K48 A;  2LHN A;  4HTE A;  3I0Q A;  1VCT A;  4HWD A;  3ONX A;  3FXD B;  4MBQ A;  5L4H A;  2XQA A;  2G0U A;  2DWG A;  3F31 A;  2ZM0 A;  3AE6 A;  4MFR A;  2H88 A;  3PUW F;  2BG9 C;  2DI4 A;  4ZS3 A;  3RIF A;  1XMQ T;  3OYZ A;  4KBM B;  4DMV A;  2DWK A;  4IL9 A;  1MIY A;  2BKP A;  2JJ9 A;  2AE9 A;  2BZB A;  2Q9Q D;  2SPC A;  3JC6 D;  2LRL A;  5AQT B;  2KMF A;  2XQ8 A;  3TLT A;  3ZKR A;  2E5L T;  5AQU B;  4B3T T;  3KV6 A;  3DTO A;  3UU4 A;  4JI1 T;  1BR0 A;  2VB6 A;  2JPF A;  4HFI A;  3ETU A;  2LSY A;  4EZH A;  4IT4 A;  2N2N A;  2BG9 B;  3P50 A;  1IBM T;  2XAJ B;  3RQW A;  1G8X A;  4ZS2 A;  3SWH A;  3P4W A;  1IJ6 A;  1I94 T;  2OA5 A;  3N5L A;  4MLK A;  3QB5 K;  3U78 A;  2A3D A;  4X62 T;  4QH1 A;  3PJA A;  1FEW A;  1R8I A;  2X51 A;  4AIU A;  2Y6X A;  3MAC A;  2YDS A;  3RIU C;  4ZHQ E;  4IHJ E;  3I9W A;  2YK0 A;  3CX8 B;  2DNX A;  3KFW X;  3V5U A;  2EHO B;  3ZN1 B;  4EOZ B;  2XY8 B;  5AQO B;  2Q9Q A;  4K0U A;  4CQI A;  1QSD A;  1HG2 A;  5IWA T;  2C0S A;  4IE0 A;  1FIO A;  2X68 A;  4OFZ A;  1FMW A;  4JI4 T;  3B57 A;  3CQX C;  2A72 A;  3OVU A;  1MIV A;  4CXX A;  3KVB A;  2LT3 A;  3AE1 A;  1HFA A;  4COF A;  5LXT E;  4H9O C;  2CCQ A;  4PJM A;  1HF8 A;  3PU3 A;  1KFY A;  4P1N A;  1T8B A;  4CXY A;  3VKH A;  2YIN A;  1YXR A;  3P8C D;  1YD8 G;  4EV6 A;  4XBF B;  2PJQ A;  2WDR A;  3SOL A;  2W61 A;  4WBN E;  2UXN B;  5LGN B;  2UXX B;  4O4J E;  4IDO A;  4UIG A;  4LF9 T;  2L3L A;  3GWH A;  2VVS A;  1KNR A;  1NEN A;  3RRW A;  3H3M A;  3PDY A;  3BQI A;  4PK6 A;  4X5T A;  5DAB A;  3UU6 A;  5JDL A;  5L3G B;  4DUY T;  1MMA A;  4UV9 B;  3HL6 A;  3UU5 A;  1VRB A;  4F8H A;  5C8Y E;  3ZMS B;  3R6N A;  1S94 A;  3J9X 1;  3X1D A;  5L3F B;  4ZI2 C;  5L3C B;  4IE7 A;  4PK4 A;  3IHR A;  3ZT5 A;  2EHO C;  5C3J A;  1W0B A;  2X9X A;  1O3X A;  1UUR A;  3N9L A;  4U2Z A;  5LHI B;  5LMN T;  1D1B A;  4JYA T;  1WCR A;  2VQE T;  4O4H E;  2XQ7 A;  1IJ5 A;  2XPK A;  3GN5 A;  2UXB T;  3AEE A;  4MHC A;  5EZY E;  2AXD S;  2WU2 A;  2XQ9 A;  1VCS A;  1ZOY A;  4QH5 A;  5E0O A;  2CRB A;  2JMK A;  4CI3 B;  4ZI3 D;  3OTO T;  1WLX A;  1U4Q A;  2KXP B;  2LEH A;  4U33 A;  4X1K E;  2XQY A;  3EDV A;  1YQ3 A;  2KZ7 B;  4TUY E;  1GQE A;  3CIR A;  3E22 E;  2WS3 A;  2V26 A;  3PUV F;  4M1P A;  2DCF A;  2LLY A;  5AQJ B;  3UUL A;  3HA4 A;  4QX7 B;  3LBX B;  5LBM A;  4NUU A;  5LB7 B;  3AEG A;  3A7M A;  3I0O A;  2CWY A;  3Q5W A;  3ZLI A;  4DR3 T;  4ILC A;  5H6Q B;  3ZSS A;  3BQK A;  2WAU A;  1T72 A;  2IML A;  4ZI2 D;  3PU8 A;  1YQ4 A;  5JTG A;  5KDM C;  5LJN A;  4Z8X A;  3PUQ A;  5GON E;  2BS3 A;  3MXZ A;  4IDN A;  1M62 A;  2CXD A;  3H3A A;  5JDM A;  3VKG A;  4H9N C;  2Y48 B;  3UUN A;  4HFB A;  5HEH A;  5JDG A;  2CXL A;  4IDZ A;  4JI2 T;  2XAS B;  3C51 A;  4WW0 A;  4EXT A;  3CX7 B;  4AKH A;  3U3I A;  4JBW F;  1CHU A;  1QUU A;  2BVM A;  2C5J A;  2IDO B;  3AE2 A;  4E7S A;  5FXZ A;  2WWV A;  4DV2 T;  1JNR A;  4KHP T;  2ZM6 T;  4O4L E;  1XDP A;  2A2F X;  2HPL A;  3UUX B;  3VHL A;  5AQF B;  3N9O A;  1X9B A;  1UCU A;  5CA0 E;  2K3W A;  1X79 A;  2JQ9 A;  1LRZ A;  1ZEE A;  5HXE A;  2X67 A;  4ISS A;  4LML A;  1HR0 T;  4EEB A;  3SRZ A;  5FXV A;  4PK5 A;  4UVB B;  3L39 A;  4U31 A;  5IHY A;  4BA9 A;  1SA0 E;  1OED A;  3AEF A;  4HFD A;  3EUH A;  2C5I T;  2NWB A;  5JDF A;  5JR9 A;  4YSY A;  2W66 A;  4TNW A;  2W67 A;  4EIW A;  5HCJ A;  2HN1 A;  5FYM A;  2ZM8 A;  4Z91 A;  3ZPO A;  1HCI A;  2PBI A;  5FY1 A;  5F3J A;  4G2A A;  5FY0 A;  5JR9 B;  2FJD A;  1T98 A;  3KV5 A;  4EGW A;  5HWX A;  4NIQ A;  2W0G A;  3N9M A;  5FXX A;  2E9X B;  3UQ4 A;  5M4Y A;  5FP3 A;  2J47 A;  3IA3 A;  3PUY F;  4X1Y E;  4E7Z A;  4DV4 T;  3O1H A;  5HWY A;  3L8R A;  2CE7 A;  2LRK A;  2YDQ A;  3L3P A;  3P4Q A;  4WZX A;  3AXJ A;  3K8P C;  4IDQ A;  4P0B A;  3UUM A;  2KWI B;  2ACZ A;  2VL8 A;  1N32 T;  2ES0 A;  3KDS E;  3TLW A;  1HTJ F;  2KSR A;  4TV9 E;  3NKZ A;  2BG9 A;  3HKB E;  2X9Y A;  4OK0 A;  3CK6 A;  4QX8 B;  2VL0 A;  3BQL A;  3N2K E;  4FI5 A;  2CLY B;  2KIN B;  3ZYM A;  2NTY A;  1E7P A;  4IRE A;  2CHO A;  2E2A A;  3O1I A;  4I50 E;  1XNQ T;  2CMR A;  2XJ7 A;  5HXC A;  4AQF C;  4GOU A;  3AE4 A;  3UU3 A;  4PAG A;  4TNV A;  1ZV4 X;  4DID B;  3O1J A;  4UVC B;  1MND A;  4U7Y A;  4DO0 A;  4LF5 T;  3PTR B;  1WFD A;  3ZJ2 A;  3DJB A;  3TLV A;  3QK6 A;  3T8O A;  5LGU B;  3ZC1 A;  2XQ5 A;  4ZXL A;  2FJA A;  4ANJ A;  5BMV E;  4OYJ A;  1W0A A;  3B5M A;  4CXW A;  1MNE A;  5AQH B;  3JAD A;  2IIU A;  4JI7 T;  4KUM B;  4QXC B;  2CWO A;  3RH3 A;  3SFD A;  1YW0 A;  2RA1 A;  2C5K T;  4JLE A;  4L0R A;  3RI5 A;  2WDQ A;  2WCA A;  1W9R A;  5LCY A;  3CQC B;  3RHW A;  4UF0 B;  1I6Z A;  5L3B B;  5AQK B;  4EED A;  3PUZ F;  5JDH A;  3AAI A;  3J7Y q;  3M65 A;  3ZCJ A;  3EHZ A;  2P9B A;  4CI2 B;  3ZYL A;  2WZI A;  2CLY C;  5HEG A;  4GYR A;  1MIW A;  3K3Q C;  1UGO A;  2OV9 A;  4AIS A;  2H7V C;  4PW8 A;  3TKL B;  3A5X A;  1D1A A;  3AED A;  3M3Z B;  2J62 A;  4YXD A;  3LBX A;  3VRB A;  1FJG T;  4JEH B;  1NAF A;  3AA7 B;  2FJB A;  3LJC A;  4HFE A;  2VKO A;  3UT5 E;  4DR1 T;  4UEL A;  2BDE A;  2XSA A;  4EZ4 A;  2QVA A;  2XTL A;  3K3O A;  1S35 A;  3O4X E;  1LKX A;  4YT0 A;  1KNZ A;  1D1C A;  5FMN A;  3RYH E;  5AQQ B;  5LGT B;  3AE8 A;  3MZK B;  2HN2 A;  2X0Y A;  5LYJ E;  5HYA A;  1U5P A;  5ABE A;  2NW7 A;  4ZI7 E;  4IIJ E;  2MTQ A;  2UUB T;  3HR0 A;  4OHF A;  4A5X A;  3Q5D A;  4HEA A;  2LM2 A;  2V5C A;  3ZJ1 A;  2ODU A;  4I0U A;  4X65 T;  4DV5 T;  3FBZ A;  4EB6 E;  4U7I A;  3RC3 A;  2BS2 A;  3Q2M A;  4WNK A;  3PE0 A;  3QUJ A;  4UVA B;  4LFA T;  4YJ3 E;  4YHJ A;  4LF8 T;  3UTK A;  5CGM A;  4EYU A;  5J2T E;  4YLH A;  3MJX A;  4I43 B;  2YEV C;  2UU9 T;  2Q9Q B;  4CN1 A;  2YOE A;  3HKC E;  1IAP A;  2D2S A;  2LSJ A;  5ABH A;  2MBG A;  3ZYK A;  4IL4 A;  4ZZB A;  5HAX A;  2XSB A;  3EAM A;  3KBT A;  4HKA A;  2M67 A;  3P7I A;  3C50 A;  4YY3 T;  1OED B;  3H37 A;  4DV0 T;  4B3R T;  2I6H A;  3CKD A;  5J1G A;  5CJ5 A;  4HWC A;  5IYZ E;  2X0L B;  3RF1 A;  4DV3 T;  3FZF B;  5L3E B;  5JRC A;  1UX4 A;  2YKS A;  5ETW A;  5JDN A;  3ZT7 A;  5J0Z A;  2BS4 A;  2QRX A;  2XUE A;  3MKD A;  2N1G A;  3PUA A;  4ILU A;  4KI0 F;  5AQS B;  3ONJ A;  3ZMZ B;  2V1D B;  4A56 A;  2EHO D;  1NWM X;  3AB3 B;  4B6X A;  2LKG A;  2QA7 A;  2XM1 A;  4Q25 A;  4PFP A;  2ACX A;  2J1D G;  2BBH A;  4U72 A;  1HNZ T;  5LHG B;  5LJM A;  5LBQ B;  2WU5 A;  1KK7 A;  4QWN B;  3E08 A;  2MYS A;  1EZ3 A;  3HKE E;  2D0U A;  1IZN B;  2E5V A;  1HX1 B;  2E9X D;  3NBX X;  4OYK A;  2J4G A;  4TWD A;  3E0Z A;  4U74 A;  2W00 A;  4WBO A;  4YTM A;  3A8Y C;  5FKY A;  5FXW A;  4DND A;  4JI3 T;  5DQV A;  3FHN A;  2VKJ A;  4TV8 E;  2DHR A;  4UR9 A;  1YKH B;  2JMH A;  2R6G F;  1M7K A;  2W4X A;  3OPC A;  4NPP A;  2DLR A;  4HFC A;  4XAX B;  5DJQ C;  2W2U A;  2YN6 A;  3S4U A;  5F8P A;  4DV1 T;  2HHH T;  3RKG A;  2VQF T;  5L2L A;  2M6B A;  4MAL A;  1Z8U A;  2IUB A;  2NOX A;  3OKQ A;  3AE7 A;  3VRA A;  4CN6 A;  4DBR A;  2XQ6 A;  4F6R C;  4DBQ A;  2WMN A;  3AE5 A;  3CWZ B;  1IBK T;  4HWH A;  1XNR T;  1LVK A;  1QLB A;  3FBL A;  4A98 A;  2WWU A;  5AQI B;  4YTP A;  4DV7 T;  3AVR A;  4CN4 A;  3JCF A;  2K9A A;  4TN7 B;  3WAJ A;  4HFV A;  4B3S T;  5IUX A;  3FZK B;  1W09 A;  2EHO A;  2UUA T;  3RRC A;  2V6X A;  4PJN A;  1BR4 A;  2V6Y B;  2KWH A;  4H9Q C;  3AA6 B;  4WYV A;  4I4T E;  2K5B B;  4V1A v;  3UFE A;  4ZOL E;  3F2E A;  5FVL A;  2VWA A;  4Z90 A;  3V5S A;  1OED E;  2V7K A;  2Z6E A;  2ZLY A;  2FJE A;  3VR8 A;  4ERR A;  2VKD A;  1WRD A;  5EK3 A;  2BG9 E;  4HGA A;  4G63 A;  4LFC T;  2QYW A;  3IF8 B;  2IAK A;  3EI0 A;  2VUR A;  4O8S A;  3Q5X A;  4X64 T;  3T1H T;  1DU2 A;  4JV5 T;  1XDO A;  1OXZ A;  1SE7 A;  2FBW A;  2IC6 A;  3LDQ B;  2LE8 A;  4ASK A;  3SS1 A;  4AI6 A;  3UFG A;  4C90 A;  4AQY T;  4JI6 T;  2CEA A;  3AAA B;  2KT9 A;  2XM2 A;  4LF4 T;  3ETV A;  2LJL A;  4X1I E;  5ABF A;  4GKJ T;  4X20 E;  5ABF B;  3RX6 A;  5L3D B;  4QKN A;  3VR9 A;  4NUV A;  4P0A A;  1WR0 A;  2BBJ A;  3K1S A;  5JH7 E;  5HXH A;  2VK9 A;  2JRK A;  2D9D A;  4JI5 T;  2B76 A;  2UUC T;  4PJJ A;  2WZH A;  3N2G E;  2WSS V;  4IGU A;  5FL0 A;  3FZM B;  2VVN A;  3C4X A;  3OYX A;  3PUS A;  3PV0 F;  4AKG A;  1L0V A;  5JVD E;  3RQU A;  4HN9 A;  5KXJ A;  3TLS A;  5JQG E;  2CPT A;  4I55 E;  3IBP A;  5FL1 A;  5LMU T;  3QC9 A;  2ZMA A;  2XQ3 A;  2PFV A;  4H9S E;  3UU8 A;  2YU1 A;  3I1A A;  3P4P A;  4CZZ B;  4GIW A;  3EAB A;  1FMV A;  4HE8 A;  5AQM B;  3RKO A;  2QGS A;  2I0M A;  2K24 A;  3DP7 A;  2V7L A;  4ILA A;  5H6R B;  4YSZ A;  1NEK A;  2XZE A;  3GN5 B;  2DL1 A;  2V6Y A;  4DUZ T;  4OX9 T;  2XAG B;  4GK5 E;  1B7T A;  1OED C;  1ZHC A;  4DV6 T;  3CPZ A;  3R84 B;  4NXN T;  3W15 B;  1BR1 A;  2IW5 B;  3T1Y T;  1Z0P A;  4B3M T;  5LG3 A;  2IC9 A;  2JQH A;  2LOS A;  5DQW A;  3ZMV B;  5AQR B;  5F5W A;  4L9I A;  3B13 A;  2V7M A;  5EK2 A;  4UEM A;  2WBL A;  4JI0 T;  2WP9 A;  4EAH A;  1YKE B;  3AA1 B;  5AQN B;  2LSK A;  3RPU A;  5A1L A;  1AJ3 A;  1D0Y A;  1Y64 B;  4PJL A;  3FZL B;  2FUP A;  3ANW B;  3OJA A;  1J1J A;  3SFE A;  4EYY R;  4LFB T;  3AXJ B;  1E2A A;  4TZ4 C;  4DR2 T;  2NTX A;  4JI8 T;  2N9D A;  1XWM A;  2HPJ A;  3K3N A;  2Y8D A;  3QOF A;  2NW8 A;  4O2A E;  3ZCI A;  1WR6 A;  5LHH B;  1G73 A;  2LHR A;  1XZY A;  2E9X A;  3HI2 A; 
#chains in the Genus database with same CATH homology
 2XZE A;  2DL1 A;  2V6Y A;  4U2Z A;  4CN4 A;  1WCR A;  2LRL A;  4U7Y A;  2JQK A;  2V6X A;  4NIQ A;  4CN1 A;  2V6Y B;  2JQH A;  1WFD A;  4P1N A;  5CGM A;  1WR0 A;  1YXR A;  5FVK A;  4U3C A;  3K1S A;  4IT4 A;  5FVL A;  2CRB A;  2LRK A;  2WWV A;  4WZX A;  4U33 A;  4U2Y A;  2W2U A;  2WY2 A;  2MPK A;  3ZT6 A;  2K3W A;  5CJ5 A;  2JQ9 A;  2RPA A;  2CPT A;  2A9U A;  4ZEY A;  4A5X A;  3ZT7 A;  4U31 A;  5LB7 B;  3ZST A;  3EAB A;  3ZT5 A;  4U7I A;  3ZSS A;  4CN6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...