4ZEYA

Crystal structure of a nuclear receptor binding factor 2 mit domain (nrbf2) from homo sapiens at 1.50 a resolution
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
84
structure length
84
Chain Sequence
GMEGPLNLAHQQSRRADRLLAAGKYEEAISCHKKAAAYLSEAMKLTQSEQAHLSLELQRDSHMKQLLLIQERWKRAQREERLKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nuclear receptor-binding factor 2
publication title Crystal structure of a nuclear receptor binding factor 2 MIT domain (NRBF2) from Homo sapiens at 1.50 A resolution
rcsb
source organism Homo sapiens
molecule tags Transcription regulator
total genus 31
structure length 84
sequence length 84
ec nomenclature
pdb deposition date 2015-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17169 NRBF2_MIT MIT domain of nuclear receptor-binding factor 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.280 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Hypothetical protein 1500032h18. 4zeyA00
2W2UA 2JQ9A 4IT4A 4U3CA 5FVLA 3ZT6A 4U33A 3K1SA 2V6YB 1WFDA 4NIQA 4CN1A 1WR0A 4CN4A 4P1NA 4CN6A 4ZEYA 5FVKA 4U7IA 2JQKA 4WZXA 2A9UA 1WCRA 2LRKA 3EABA 4U2ZA 1YXRA 3ZSSA 3ZT7A 2CPTA 2CRBA 2K3WA 5CGMA 2V6YA 4A5XA 2WY2A 2MPKA 5LB7B 2RPAA 4U7YA 2JQHA 2WWVA 3ZSTA 2V6XA 4U31A 2LRLA 2XZEA 3ZT5A 5CJ5A 4U2YA 2DL1A
chains in the Genus database with same CATH superfamily
2JPFA 4CXYA 3FZFB 3P4SA 2H88A 2XM1A 4P0BA 3H3AA 5FXWA 2BKOA 5L3FB 3OKQA 5C8YE 2VL0A 2V5DA 3NVOA 1FMWA 3BK9A 4QH4A 1HS7A 2KXPB 1ZEEA 1W09A 4TZ4C 3ZYKA 2CHOA 2XUEA 3UQ7A 2WU5A 3CX8B 2V7MA 3RYIE 4JI6T 4C91A 3JADA 5JRCB 2XQ9A 2JIWA 4AQFC 4DMVA 1HFAA 2XPKA 1N32T 2LHRA 3VHLA 4UV9B 4O8SA 4PJLA 4EAHA 5J1GA 5ABFB 3B13A 5AQLB 3SFDA 2Q9QD 4ASKA 1V9DA 1DU2A 2W62A 5AQTB 1KEYA 2LOPA 3PU3A 2NWBA 3L8RA 2XQ4A 3KBUA 2H3RA 1WCRA 4I55E 4H9PC 3JAFA 2JJ9A 4A5XA 2D2SA 4F6RC 4DR7T 3L09A 5FL0A 4XAXB 2CBJA 4U33A 4A97A 2ZM0A 4NIQA 2ACXA 4UEMA 1SA0E 4XBFB 1IAPA 3ONJA 5FYMA 2B1EA 4ZS2A 3TLVA 2BG9B 2FJAA 4YSXA 4HKAA 5JR9B 3AEAA 3U3IA 2XQYA 3AE1A 3RRWA 4JLEA 3AAIA 4CI3B 3FZHB 4Q25A 1ZOYA 4QH5A 2XSAA 2M6BA 5LXTE 2IW5B 4UF0A 1YKEB 4ZEYA 5FMNA 3F57A 4KHZF 4ZI2D 3TLWA 4I0UA 2AXDS 3A7MA 3P8CD 4B3TT 4A98A 1HG2A 2L3LA 3AE5A 5J2TE 1E1HB 4H9RC 2YDRA 3KVAA 2L9QA 1YXRA 2J1DG 2CRBA 2UXBT 2UXXB 4LMLA 3FBZA 5BR8T 3OYXA 1HNZT 3BQIA 4P0AA 2XAHB 4QXCB 1MIWA 4LF9T 4JI0T 4GOUA 1ZV4X 2NTYA 1KNPA 5H6QB 2HN1A 2EHOB 5KDMC 4JBWF 2KNDA 3VRBA 3UUNA 4DV0T 2H7VC 5F8PA 3LG7A 3ZPOA 3E22E 3UU5A 4X66T 2YOEA 3F2EA 5ABGA 3CPZA 3OTOT 1XNRT 4EZHA 4HFCA 1IBLT 3CKDA 1LVKA 3AXJB 5L3BB 3UFEA 4JI2T 4KHPT 4JEHB 3EABA 2UXDT 2CPTA 4AISA 3PUGA 3HA4A 3FXDB 3KV5A 3RQUA 1WYCA 3ZMUB 4G63A 2WMNA 5LJNA 1HNWT 3K3OA 5HEGA 2E9XA 1T72A 3BQKA 2CBIA 3IEEA 3CX7B 2Q9QB 3MXZA 3AEBA 4DNDA 1MNDA 1J5WA 3VKGA 3ZN1B 2NR4A 4YY3T 4ZZBA 4DR6T 2ODUA 2VVSA 3RYHE 5LOVE 3LK3B 5A1LA 2JQHA 5LCYA 3UT5E 2BG9C 3KV6A 2DL1A 2XHEB 4IE5A 5L3GB 3IHRA 2ES0A 5JR9C 3UU6A 2LKGA 4YFSA 3HKCE 2YN6A 4DUYT 2V26A 2MAWA 4HE8A 3EAMA 5CGMA 4LMKA 1HG5A 2D5UA 4YJ2E 4Z91A 4PJNA 2X9YA 2WWVA 3ZSTA 4ILUA 1YQ3A 2KWIB 5LHIB 5JDHA 4YSYA 2BS2A 3EDVA 2BVLA 5L4EA 5FVLA 2OV9A 3PJAJ 1OEDA 4YXDA 5L3DB 3ZYLA 3E08A 1W0AA 2KLQA 3LBXB 5ADXL 3ZSSA 4EGWA 4U72A 1H7CA 5DQWA 1BR2A 1XZYA 2DCFA 2E2AA 2V6XA 1MIYA 2XTLA 3RRCA 4DV4T 4CN1A 4PW8A 3K3NA 2WWUA 4PK4A 2V7KA 2FJDA 3G06A 3N9MA 3I0QA 2NW9A 2WBLA 2N9DA 3P4PA 4CI2B 4KBMB 4YTPA 1XDPA 4JI8T 4DUZT 3IF8B 1BR1A 2EHOC 3GN5B 1WFDA 3RX6A 3AA0B 2MBGA 3FXEB 3P4WA 3E0ZA 5JTGA 4L0RA 3LJCA 1IZNB 2BZBA 4JI3T 4MALA 4TWDA 3FHNA 1UURA 3EUHA 1U5PA 1D0YA 2KZ7B 3RPUA 4H63V 3AAEB 3NRYA 2WU2A 5ABHA 2N2NA 5LP6E 2J47A 4NPPA 3R6NA 4ADZA 5LYJE 2GK9A 3JC6D 3AE3A 4U2YA 2VQFT 3CMLA 4X62T 2JMHA 2IC9A 1WR0A 3LK2B 3PDYA 2XQ7A 3GWHA 2E5VA 4UVBB 4X20E 3UU3A 2IDOB 5IHYA 2X0LB 4IDNA 3MZKB 2Q9QC 5AQQB 2HN2A 1GQEA 2W66A 2CCQA 1KNRA 4WNKA 2YU2A 2IHR1 5HXRA 5LHHB 2WMOA 2PTFA 3MKDA 3FZMB 5LMUT 4UXNB 1UX5A 4F8HA 1QSDA 4IDPA 3AEGA 5AQJB 3RC8A 2CHNA 4MLKA 4I43B 5FY7A 1UK5A 2OA5A 1MNEA 4UVAB 2Z6EA 5HXEA 3N9LA 5CJ5A 3VU7H 2K48A 3FB2A 2UXNB 4AXPA 5LBMA 4ILAA 1SHZC 1MMNA 4DR3T 2HHHT 2F4VT 2P9BA 3ANWB 1VOMA 4WZXA 2V5CA 3SWHA 2IIUA 4JV5T 4ZI2C 4H9NC 3K1SA 4I4TE 4HFVA 4CN6A 2ZM8A 4QKNA 3ABVA 1S94A 2K3WA 2UUCT 5LGTB 4U74A 3ZCJA 3AE6A 2HH7A 2AE9A 2W2UA 3KV4A 4B3RT 3P4RA 1L0VA 3UU4A 4O4LE 3U78A 4EZ4A 1E2AA 5AQUB 4V1Av 2YKSA 4DR5T 3ZEFB 1LRZA 5J0ZA 4CXWA 2RPAA 1UCUA 2CEAA 4B6XA 4JUYA 5DJQC 4YTNA 2BG9E 2VKDA 2LM9A 5AQGB 4P1NA 3OVUA 5AQOB 1YD8G 1O3XA 2XQ6A 3OBVE 3PUSA 5KX5E 2LJLA 1WRDA 3ONLC 2CWOA 1G73A 3ESLA 3RH3A 2JMKA 1YW0A 2WZHA 1M62A 2QRXA 3KDSE 1D1BA 2NW7A 2E5LT 5FXXA 4L9IA 1LVFA 4L5GA 2KINB 4X1IE 4ZI7E 2IUBA 2WZIA 4TN7B 3EVYA 2MTQA 3PV0F 1I6ZA 2CLYB 4IE4A 3L39A 3ZJ2A 5AQHB 5GONE 3CK6A 3Q9DA 2HPLA 4H63H 5EZYE 3AECA 3FZLB 3WAJA 5HYAA 4KP3C 4HEAA 2H7OA 4HWHA 4EYYR 5F3JA 2LM2A 3RF1A 3ZC0A 4U7IA 1JNRA 2MPKA 5LB7B 3ZLIA 3ZJ1A 2DNXA 2WDVA 2XQAA 4QX7B 2WCAA 5EK4A 4LMJA 4AQFA 3I9WA 4HWFA 3JCFA 3SRZA 2W63A 4DR1T 3MA9A 3DJBA 3SOLA 3VR8A 1X79A 4NUVA 5LGNB 4DBRA 3C98B 2WP9A 4K0UA 4OHFA 5FKYA 5EK2A 4PFPA 4ZI3C 3EI0A 2V6YB 2ZM6T 4IHJE 3RIUC 3HI2A 4PJMA 4TNWA 5HEOA 3CQCB 3QK6A 4AKRB 5LG4A 1MMGA 4P09A 2IMLA 5AQVB 4TX5A 4X1YE 4EV6A 2W4XA 2V7LA 3AA1B 1MMDA 5AFUL 2B76A 5H6RB 4OK0A 1MMAA 2OLTA 1Z0PA 1D0XA 3V5SA 5FXZA 3VKHA 3ZT6A 1HX1B 2YDQA 3SFEA 5LGUB 4IGUA 4DR2T 5LMNT 4OX9T 2V8SV 3OYZA 1NWMX 4U7YA 1T98A 3RYFE 5AQNB 3M3ZB 2JQ9A 3MJXA 1CHUA 2BVMA 3HKBE 3BQLA 3KVBA 2I0MA 1SE7A 3D0TA 3ZT7A 5HEHA 5KMGP 4TV9E 4UVCB 2C5IT 2CWYA 2KMFA 2XAFB 4QWNB 2UUAT 2BKPA 3PUAA 3L3PA 3JC6C 1IBKT 4GYRA 4DV5T 1QUUA 2I59A 3KBTA 5IUXA 2CLYC 1ZHCA 4O4JE 1ZP0A 1Y64B 4GYSA 4X1KE 5C3JA 2LLYA 2KT9A 2BBJA 4CXXA 4NXMT 4DO0A 1HF8A 2LE8A 2FBWA 2XASB 3HKEE 3NWIA 2RP4A 3O1HA 3IBPA 1HX8A 3O1IA 3CQXC 4KI0F 2FUPA 2Y48B 3OPCA 2XQ3A 4QH1A 2I6HA 2UUBT 4IE0A 2E9XD 3JAEA 3AE2A 2K9AA 5JRCA 2D9DA 3NRXA 4LFCT 1ZKEA 1HTJF 2YDSA 4GKJT 1W0BA 4OFZA 1G8XA 5L4HA 2LRLA 2XZEA 4TUYE 1D1CA 5ABFA 4PAGA 4UELA 4EXTA 4MBQA 1FJGT 1HNXT 2X51A 1HCIA 2VKOA 2JQKA 2BDEA 2A72A 4EOZB 5AQKB 4EYUA 2FJEA 4AQGA 2NW8A 4UF0B 2XQ8A 4H9OC 4UR9A 2YEVC 2X9XA 4ISSA 3GMIA 3AEFA 4IL4A 3O9XA 2NP9A 2BG9A 2X68A 5FP3A 4ISTA 1T8BA 5JR9A 3Q5EA 1N33T 4CI1B 3C51A 2A9UA 3AAAB 3I1AA 5HAXA 4YHHT 3IA3A 4PK6A 4DV3T 4IL9A 3AEDA 1W9RA 2VQET 1NAFA 3AEEA 4PFOA 3QUJA 2X67A 3RC3A 2PFVA 4PJJA 3N2OA 3N9PA 3ZN0B 1US7B 3M65A 4OYKA 5HEJA 2QVAA 3PTRB 4DV7T 5LJMA 2VB6A 4YHJA 4AQYT 3RIAA 1LKXA 5AQFB 4EB6E 4JI4T 3A5XA 2V6YA 2VWAA 4ILCA 4IDOA 4DV6T 1IBMT 3H37A 5IWAT 5L3EB 4IIJE 4WYVA 3TLUA 4DVDA 4IE6A 3ZMZB 2LSJA 3UUMA 2EHOA 1VCTA 3X1DA 1QLBA 1FMVA 3R84B 1KK7A 3ONXA 1E7PA 3NBXX 1XNQT 2R6GF 4ANJA 2W61A 3PUXF 3AA7B 4EEBA 3O1JA 2WS3A 1D0ZA 2ZLYA 4ZS3A 3HL6A 5M4YA 5CA0E 4EIWA 2SPCA 2E9XB 3AXJA 2DI4A 2E8IA 4MFRA 1N36T 2HPJA 3C50A 2K24A 4H9QC 3ZKRA 2KWHA 3P4QA 5FVKA 5FL1A 3KINB 4IDZA 4X65T 2EHOD 2LOSA 3W15B 2CXDA 2D0UA 2XJ7A 4AKLA 4JI1T 3F31A 5HXCA 2VK9A 1WYBA 3EDUA 5AQPB 2Q9QA 3LSVA 4ERRA 4JEUB 4U2ZA 3UQ4A 3OJAA 2CXFA 5JDMA 4HWCA 2C5JA 3NZQA 5LA6E 3RGLA 3DP7A 2X9WA 3VR9A 5BMVE 4BJMA 5LHGB 2VL8A 2MYSA 4UV8B 3N2GE 1OEDB 1FIOA 2WAUA 2QYWA 3ZC1A 4I50E 2CXLA 1AJ3A 1HR0T 4LFAT 4DBQA 2PBIA 3J7Yq 1JNZA 1I94T 5JDLA 2V7IA 3N9QA 2JRKA 3N2KE 1KNZA 2LSIA 2J4GA 5ETWA 3PJAA 2BKNA 4YLHA 2C0SA 1KFYA 2YU1A 3LBXA 4C90A 5JREA 3AA6B 4LF6T 1XDOA 3CIRA 4O4HE 2X0YA 5ABEA 3RI5A 5CA1E 3AE9A 5KXJA 3LK42 3V5UA 4DV2T 3PUWF 3J9X1 2LHNA 4GK5E 2VKJA 3C4WA 1UX4A 2WM9A 3AVSA 3GA8A 4YJ3E 1UUSA 3GN5A 1NEKA 4KX6A 4CQIA 3C4XA 2WSSV 3B57A 2CMRA 3O4XE 2G0UA 4ILBA 3ETVA 4G2AA 4X5TA 3UTKA 1YKHB 2IC6A 3N9NA 2QA7A 3QB5A 4LF5T 3T1HT 3MK7C 3FBLA 3LFMA 4YTMA 2RA1A 1U4QA 5JDFA 2E9XC 5LNKA 3C64A 4MHCA 1VCSA 1UGOA 4ZXLA 3SS1A 1Y01A 4WBOA 1IJ5A 3RQWA 2WDRA 5FY0A 4AKIA 3QNUA 3ZMVB 1YQ4A 3PE0A 3H3MA 4EEDA 4LFBT 4FJOA 5TAOA 1T7SA 1OXZA 3CWZB 2LRKA 1J1JA 5L3CB 2KSRA 2WDQA 3RLFF 3UU8A 3C4ZA 3P50A 2X9HA 4FI5A 4QHOA 2W0GA 3UUXB 4HFEA 4HTEA 1R8IA 2H89A 4BAYB 4O2AE 4CN4A 3WAKA 3A8YC 3MACA 2QGSA 4QXHB 4JI7T 5CFBA 1OEDC 2XQ5A 5HXHA 5FXVA 2FJBA 4AKGA 3PUYF 3B5MA 2LSKA 3I9YA 2LT3A 4E7SA 5FNVE 4GIWA 2LSGA 3QOFA 3PUQA 1SUMB 4HWIB 2ZM2A 1WR6A 2K5BB 2Y6XA 3ANWA 2NTXA 1X9BA 2C5KT 2BS3A 5EK3A 2IAKA 3T1YT 2PJQA 5DQVA 2NOXA 3PU8A 3RIFA 3RIUA 4XZCA 3DTOA 4NUUA 4B3MT 2W67A 3PUVF 1B7TA 3ZMTB 3HR0A 1MIVA 1M7KA 2XAJB 4ZOLE 5JQGE 3VRAA 1WLXA 4JI5T 4LF4T 2XAQB 1NENA 4K0KT 1BR4A 3CVRA 2WB5A 3RKOA 2UXCT 2ZMAA 4O2BE 3UULA 3TLTA 2M6IA 5LG3A 3AVRA 1CUNA 3AB3B 4ZI3D 2CE7A 2XAGB 4N78D 3Q2MA 5HXSA 5AQMB 4HFDA 4PK5A 4A56A 3HKDE 4DIDB 2L8KA 2MOZA 3NKZA 1N34T 2VVNA 1BR0A 4QX8B 2JQQA 4TV8E 2BS4A 4Z90A 4WW0A 4BA9A 5CB4E 2LEHA 2V7JA 3RYCE 4HN9A 2LKHA 2V1DB 3N5LA 3RHWA 3AE4A 3ZCIA 3AE8A 3KV9A 1XMOT 2A2FX 3QB5K 2YK0A 4Z8XA 4AIUA 5JDQA 5AQIB 3Q5DA 3ETUA 2Y8DA 3PURA 4YT0A 2X66A 3QC9A 3K8PC 5L47A 3Q5WA 4IE7A 2D0TA 4O4IE 2M67A 3PUZF 2BBHA 3WI3A 2YINA 5DABA 5JDNA 3LDQB 4LF8T 4YSZA 3CQGB 3FZKB 3ZMSB 4BJNA 2A3DA 4NXNT 1IJ6A 4HGAA 1FEWA 3NZPA 5F5WA 3UFGA 2DHRA 1XMQT 4TWFA 4AKHA 4J2CA 4HFHA 1S35A 5FY1A 3TLSA 4HWDA 4KMCA 1J5ET 2ODVA 4TWHA 3UUBA 4GKKT 4HFBA 5L2LA 4TNVA 3S4UA 4CZZB 4HFIA 4M1PA 3CX6B 5JH7E 3KFWX 3N9OA 2XY8B 3Q5XA 5IYZE 4KUMB 4DMWA 5JVDE 2CM0A 4DV1T 1OWAA 4JYAT 4IDQA 2XM2A 4E7ZA 5HCMA 2J62A 3TKLB 1D1AA 5J2UE 4QXBB 4LF7T 4IREA 4OYJA 4WBNE 3I0OA 2W00A 3AE7A 4ZZCA 4X64T 2VKHA 4COFA 5HWXA 5E0OA 4PNIA 3ZT5A 2DWKA 3T8OA 1XWMA 5AQRB 2N1GA 4DR4T 4IT4A 4H9SE 3EHZA 1KF6A 2VURA 2DWGA 2X0HA 2CA5A 5LBQB 3K3QC 5JDGA 4GK0E 2WQYA 5HEUA 4UIGA 2XSBA 4AI6A 2WY2A 2DLRA 4B3ST 2LSYA 1OEDE 4U3CA 5C2TA 4ZHQE 1EZ3A 3ZYMA 1VRBA 2VASA 5AQSB 5HWYA 1Z8UA 3P7IA 2ACZA 5HCJA 2UU9T 2PG8A 4U31A 3RKGA
chains in the Genus database with same CATH topology
2W2UA 2JQ9A 4IT4A 4U3CA 5FVLA 3ZT6A 4U33A 3K1SA 2V6YB 1WFDA 4NIQA 4CN1A 1WR0A 4CN4A 4P1NA 4CN6A 4ZEYA 5FVKA 4U7IA 2JQKA 4WZXA 2A9UA 1WCRA 2LRKA 3EABA 4U2ZA 1YXRA 3ZSSA 3ZT7A 2CPTA 2CRBA 2K3WA 5CGMA 2V6YA 4A5XA 2WY2A 2MPKA 5LB7B 2RPAA 4U7YA 2JQHA 2WWVA 3ZSTA 2V6XA 4U31A 2LRLA 2XZEA 3ZT5A 5CJ5A 4U2YA 2DL1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2W2U A;  2JQ9 A;  4IT4 A;  4U3C A;  5FVL A;  3ZT6 A;  4U33 A;  3K1S A;  2V6Y B;  1WFD A;  4NIQ A;  4CN1 A;  1WR0 A;  4CN4 A;  4P1N A;  4CN6 A;  4ZEY A;  5FVK A;  4U7I A;  2JQK A;  4WZX A;  2A9U A;  1WCR A;  2LRK A;  3EAB A;  4U2Z A;  1YXR A;  3ZSS A;  3ZT7 A;  2CPT A;  2CRB A;  2K3W A;  5CGM A;  2V6Y A;  4A5X A;  2WY2 A;  2MPK A;  5LB7 B;  2RPA A;  4U7Y A;  2JQH A;  2WWV A;  3ZST A;  2V6X A;  4U31 A;  2LRL A;  2XZE A;  3ZT5 A;  5CJ5 A;  4U2Y A;  2DL1 A; 
#chains in the Genus database with same CATH topology
 2JPF A;  4CXY A;  3FZF B;  3P4S A;  2H88 A;  2XM1 A;  4P0B A;  3H3A A;  5FXW A;  2BKO A;  5L3F B;  3OKQ A;  5C8Y E;  2VL0 A;  2V5D A;  3NVO A;  1FMW A;  3BK9 A;  4QH4 A;  1HS7 A;  2KXP B;  1ZEE A;  1W09 A;  4TZ4 C;  3ZYK A;  2CHO A;  2XUE A;  3UQ7 A;  2WU5 A;  3CX8 B;  2V7M A;  3RYI E;  4JI6 T;  4C91 A;  3JAD A;  5JRC B;  2XQ9 A;  2JIW A;  4AQF C;  4DMV A;  1HFA A;  2XPK A;  1N32 T;  2LHR A;  3VHL A;  4UV9 B;  4O8S A;  4PJL A;  4EAH A;  5J1G A;  5ABF B;  3B13 A;  5AQL B;  3SFD A;  2Q9Q D;  4ASK A;  1V9D A;  1DU2 A;  2W62 A;  5AQT B;  1KEY A;  2LOP A;  3PU3 A;  2NWB A;  3L8R A;  2XQ4 A;  3KBU A;  2H3R A;  1WCR A;  4I55 E;  4H9P C;  3JAF A;  2JJ9 A;  4A5X A;  2D2S A;  4F6R C;  4DR7 T;  3L09 A;  5FL0 A;  4XAX B;  2CBJ A;  4U33 A;  4A97 A;  2ZM0 A;  4NIQ A;  2ACX A;  4UEM A;  1SA0 E;  4XBF B;  1IAP A;  3ONJ A;  5FYM A;  2B1E A;  4ZS2 A;  3TLV A;  2BG9 B;  2FJA A;  4YSX A;  4HKA A;  5JR9 B;  3AEA A;  3U3I A;  2XQY A;  3AE1 A;  3RRW A;  4JLE A;  3AAI A;  4CI3 B;  3FZH B;  4Q25 A;  1ZOY A;  4QH5 A;  2XSA A;  2M6B A;  5LXT E;  2IW5 B;  4UF0 A;  1YKE B;  4ZEY A;  5FMN A;  3F57 A;  4KHZ F;  4ZI2 D;  3TLW A;  4I0U A;  2AXD S;  3A7M A;  3P8C D;  4B3T T;  4A98 A;  1HG2 A;  2L3L A;  3AE5 A;  5J2T E;  1E1H B;  4H9R C;  2YDR A;  3KVA A;  2L9Q A;  1YXR A;  2J1D G;  2CRB A;  2UXB T;  2UXX B;  4LML A;  3FBZ A;  5BR8 T;  3OYX A;  1HNZ T;  3BQI A;  4P0A A;  2XAH B;  4QXC B;  1MIW A;  4LF9 T;  4JI0 T;  4GOU A;  1ZV4 X;  2NTY A;  1KNP A;  5H6Q B;  2HN1 A;  2EHO B;  5KDM C;  4JBW F;  2KND A;  3VRB A;  3UUN A;  4DV0 T;  2H7V C;  5F8P A;  3LG7 A;  3ZPO A;  3E22 E;  3UU5 A;  4X66 T;  2YOE A;  3F2E A;  5ABG A;  3CPZ A;  3OTO T;  1XNR T;  4EZH A;  4HFC A;  1IBL T;  3CKD A;  1LVK A;  3AXJ B;  5L3B B;  3UFE A;  4JI2 T;  4KHP T;  4JEH B;  3EAB A;  2UXD T;  2CPT A;  4AIS A;  3PUG A;  3HA4 A;  3FXD B;  3KV5 A;  3RQU A;  1WYC A;  3ZMU B;  4G63 A;  2WMN A;  5LJN A;  1HNW T;  3K3O A;  5HEG A;  2E9X A;  1T72 A;  3BQK A;  2CBI A;  3IEE A;  3CX7 B;  2Q9Q B;  3MXZ A;  3AEB A;  4DND A;  1MND A;  1J5W A;  3VKG A;  3ZN1 B;  2NR4 A;  4YY3 T;  4ZZB A;  4DR6 T;  2ODU A;  2VVS A;  3RYH E;  5LOV E;  3LK3 B;  5A1L A;  2JQH A;  5LCY A;  3UT5 E;  2BG9 C;  3KV6 A;  2DL1 A;  2XHE B;  4IE5 A;  5L3G B;  3IHR A;  2ES0 A;  5JR9 C;  3UU6 A;  2LKG A;  4YFS A;  3HKC E;  2YN6 A;  4DUY T;  2V26 A;  2MAW A;  4HE8 A;  3EAM A;  5CGM A;  4LMK A;  1HG5 A;  2D5U A;  4YJ2 E;  4Z91 A;  4PJN A;  2X9Y A;  2WWV A;  3ZST A;  4ILU A;  1YQ3 A;  2KWI B;  5LHI B;  5JDH A;  4YSY A;  2BS2 A;  3EDV A;  2BVL A;  5L4E A;  5FVL A;  2OV9 A;  3PJA J;  1OED A;  4YXD A;  5L3D B;  3ZYL A;  3E08 A;  1W0A A;  2KLQ A;  3LBX B;  5ADX L;  3ZSS A;  4EGW A;  4U72 A;  1H7C A;  5DQW A;  1BR2 A;  1XZY A;  2DCF A;  2E2A A;  2V6X A;  1MIY A;  2XTL A;  3RRC A;  4DV4 T;  4CN1 A;  4PW8 A;  3K3N A;  2WWU A;  4PK4 A;  2V7K A;  2FJD A;  3G06 A;  3N9M A;  3I0Q A;  2NW9 A;  2WBL A;  2N9D A;  3P4P A;  4CI2 B;  4KBM B;  4YTP A;  1XDP A;  4JI8 T;  4DUZ T;  3IF8 B;  1BR1 A;  2EHO C;  3GN5 B;  1WFD A;  3RX6 A;  3AA0 B;  2MBG A;  3FXE B;  3P4W A;  3E0Z A;  5JTG A;  4L0R A;  3LJC A;  1IZN B;  2BZB A;  4JI3 T;  4MAL A;  4TWD A;  3FHN A;  1UUR A;  3EUH A;  1U5P A;  1D0Y A;  2KZ7 B;  3RPU A;  4H63 V;  3AAE B;  3NRY A;  2WU2 A;  5ABH A;  2N2N A;  5LP6 E;  2J47 A;  4NPP A;  3R6N A;  4ADZ A;  5LYJ E;  2GK9 A;  3JC6 D;  3AE3 A;  4U2Y A;  2VQF T;  3CML A;  4X62 T;  2JMH A;  2IC9 A;  1WR0 A;  3LK2 B;  3PDY A;  2XQ7 A;  3GWH A;  2E5V A;  4UVB B;  4X20 E;  3UU3 A;  2IDO B;  5IHY A;  2X0L B;  4IDN A;  3MZK B;  2Q9Q C;  5AQQ B;  2HN2 A;  1GQE A;  2W66 A;  2CCQ A;  1KNR A;  4WNK A;  2YU2 A;  2IHR 1;  5HXR A;  5LHH B;  2WMO A;  2PTF A;  3MKD A;  3FZM B;  5LMU T;  4UXN B;  1UX5 A;  4F8H A;  1QSD A;  4IDP A;  3AEG A;  5AQJ B;  3RC8 A;  2CHN A;  4MLK A;  4I43 B;  5FY7 A;  1UK5 A;  2OA5 A;  1MNE A;  4UVA B;  2Z6E A;  5HXE A;  3N9L A;  5CJ5 A;  3VU7 H;  2K48 A;  3FB2 A;  2UXN B;  4AXP A;  5LBM A;  4ILA A;  1SHZ C;  1MMN A;  4DR3 T;  2HHH T;  2F4V T;  2P9B A;  3ANW B;  1VOM A;  4WZX A;  2V5C A;  3SWH A;  2IIU A;  4JV5 T;  4ZI2 C;  4H9N C;  3K1S A;  4I4T E;  4HFV A;  4CN6 A;  2ZM8 A;  4QKN A;  3ABV A;  1S94 A;  2K3W A;  2UUC T;  5LGT B;  4U74 A;  3ZCJ A;  3AE6 A;  2HH7 A;  2AE9 A;  2W2U A;  3KV4 A;  4B3R T;  3P4R A;  1L0V A;  3UU4 A;  4O4L E;  3U78 A;  4EZ4 A;  1E2A A;  5AQU B;  4V1A v;  2YKS A;  4DR5 T;  3ZEF B;  1LRZ A;  5J0Z A;  4CXW A;  2RPA A;  1UCU A;  2CEA A;  4B6X A;  4JUY A;  5DJQ C;  4YTN A;  2BG9 E;  2VKD A;  2LM9 A;  5AQG B;  4P1N A;  3OVU A;  5AQO B;  1YD8 G;  1O3X A;  2XQ6 A;  3OBV E;  3PUS A;  5KX5 E;  2LJL A;  1WRD A;  3ONL C;  2CWO A;  1G73 A;  3ESL A;  3RH3 A;  2JMK A;  1YW0 A;  2WZH A;  1M62 A;  2QRX A;  3KDS E;  1D1B A;  2NW7 A;  2E5L T;  5FXX A;  4L9I A;  1LVF A;  4L5G A;  2KIN B;  4X1I E;  4ZI7 E;  2IUB A;  2WZI A;  4TN7 B;  3EVY A;  2MTQ A;  3PV0 F;  1I6Z A;  2CLY B;  4IE4 A;  3L39 A;  3ZJ2 A;  5AQH B;  5GON E;  3CK6 A;  3Q9D A;  2HPL A;  4H63 H;  5EZY E;  3AEC A;  3FZL B;  3WAJ A;  5HYA A;  4KP3 C;  4HEA A;  2H7O A;  4HWH A;  4EYY R;  5F3J A;  2LM2 A;  3RF1 A;  3ZC0 A;  4U7I A;  1JNR A;  2MPK A;  5LB7 B;  3ZLI A;  3ZJ1 A;  2DNX A;  2WDV A;  2XQA A;  4QX7 B;  2WCA A;  5EK4 A;  4LMJ A;  4AQF A;  3I9W A;  4HWF A;  3JCF A;  3SRZ A;  2W63 A;  4DR1 T;  3MA9 A;  3DJB A;  3SOL A;  3VR8 A;  1X79 A;  4NUV A;  5LGN B;  4DBR A;  3C98 B;  2WP9 A;  4K0U A;  4OHF A;  5FKY A;  5EK2 A;  4PFP A;  4ZI3 C;  3EI0 A;  2V6Y B;  2ZM6 T;  4IHJ E;  3RIU C;  3HI2 A;  4PJM A;  4TNW A;  5HEO A;  3CQC B;  3QK6 A;  4AKR B;  5LG4 A;  1MMG A;  4P09 A;  2IML A;  5AQV B;  4TX5 A;  4X1Y E;  4EV6 A;  2W4X A;  2V7L A;  3AA1 B;  1MMD A;  5AFU L;  2B76 A;  5H6R B;  4OK0 A;  1MMA A;  2OLT A;  1Z0P A;  1D0X A;  3V5S A;  5FXZ A;  3VKH A;  3ZT6 A;  1HX1 B;  2YDQ A;  3SFE A;  5LGU B;  4IGU A;  4DR2 T;  5LMN T;  4OX9 T;  2V8S V;  3OYZ A;  1NWM X;  4U7Y A;  1T98 A;  3RYF E;  5AQN B;  3M3Z B;  2JQ9 A;  3MJX A;  1CHU A;  2BVM A;  3HKB E;  3BQL A;  3KVB A;  2I0M A;  1SE7 A;  3D0T A;  3ZT7 A;  5HEH A;  5KMG P;  4TV9 E;  4UVC B;  2C5I T;  2CWY A;  2KMF A;  2XAF B;  4QWN B;  2UUA T;  2BKP A;  3PUA A;  3L3P A;  3JC6 C;  1IBK T;  4GYR A;  4DV5 T;  1QUU A;  2I59 A;  3KBT A;  5IUX A;  2CLY C;  1ZHC A;  4O4J E;  1ZP0 A;  1Y64 B;  4GYS A;  4X1K E;  5C3J A;  2LLY A;  2KT9 A;  2BBJ A;  4CXX A;  4NXM T;  4DO0 A;  1HF8 A;  2LE8 A;  2FBW A;  2XAS B;  3HKE E;  3NWI A;  2RP4 A;  3O1H A;  3IBP A;  1HX8 A;  3O1I A;  3CQX C;  4KI0 F;  2FUP A;  2Y48 B;  3OPC A;  2XQ3 A;  4QH1 A;  2I6H A;  2UUB T;  4IE0 A;  2E9X D;  3JAE A;  3AE2 A;  2K9A A;  5JRC A;  2D9D A;  3NRX A;  4LFC T;  1ZKE A;  1HTJ F;  2YDS A;  4GKJ T;  1W0B A;  4OFZ A;  1G8X A;  5L4H A;  2LRL A;  2XZE A;  4TUY E;  1D1C A;  5ABF A;  4PAG A;  4UEL A;  4EXT A;  4MBQ A;  1FJG T;  1HNX T;  2X51 A;  1HCI A;  2VKO A;  2JQK A;  2BDE A;  2A72 A;  4EOZ B;  5AQK B;  4EYU A;  2FJE A;  4AQG A;  2NW8 A;  4UF0 B;  2XQ8 A;  4H9O C;  4UR9 A;  2YEV C;  2X9X A;  4ISS A;  3GMI A;  3AEF A;  4IL4 A;  3O9X A;  2NP9 A;  2BG9 A;  2X68 A;  5FP3 A;  4IST A;  1T8B A;  5JR9 A;  3Q5E A;  1N33 T;  4CI1 B;  3C51 A;  2A9U A;  3AAA B;  3I1A A;  5HAX A;  4YHH T;  3IA3 A;  4PK6 A;  4DV3 T;  4IL9 A;  3AED A;  1W9R A;  2VQE T;  1NAF A;  3AEE A;  4PFO A;  3QUJ A;  2X67 A;  3RC3 A;  2PFV A;  4PJJ A;  3N2O A;  3N9P A;  3ZN0 B;  1US7 B;  3M65 A;  4OYK A;  5HEJ A;  2QVA A;  3PTR B;  4DV7 T;  5LJM A;  2VB6 A;  4YHJ A;  4AQY T;  3RIA A;  1LKX A;  5AQF B;  4EB6 E;  4JI4 T;  3A5X A;  2V6Y A;  2VWA A;  4ILC A;  4IDO A;  4DV6 T;  1IBM T;  3H37 A;  5IWA T;  5L3E B;  4IIJ E;  4WYV A;  3TLU A;  4DVD A;  4IE6 A;  3ZMZ B;  2LSJ A;  3UUM A;  2EHO A;  1VCT A;  3X1D A;  1QLB A;  1FMV A;  3R84 B;  1KK7 A;  3ONX A;  1E7P A;  3NBX X;  1XNQ T;  2R6G F;  4ANJ A;  2W61 A;  3PUX F;  3AA7 B;  4EEB A;  3O1J A;  2WS3 A;  1D0Z A;  2ZLY A;  4ZS3 A;  3HL6 A;  5M4Y A;  5CA0 E;  4EIW A;  2SPC A;  2E9X B;  3AXJ A;  2DI4 A;  2E8I A;  4MFR A;  1N36 T;  2HPJ A;  3C50 A;  2K24 A;  4H9Q C;  3ZKR A;  2KWH A;  3P4Q A;  5FVK A;  5FL1 A;  3KIN B;  4IDZ A;  4X65 T;  2EHO D;  2LOS A;  3W15 B;  2CXD A;  2D0U A;  2XJ7 A;  4AKL A;  4JI1 T;  3F31 A;  5HXC A;  2VK9 A;  1WYB A;  3EDU A;  5AQP B;  2Q9Q A;  3LSV A;  4ERR A;  4JEU B;  4U2Z A;  3UQ4 A;  3OJA A;  2CXF A;  5JDM A;  4HWC A;  2C5J A;  3NZQ A;  5LA6 E;  3RGL A;  3DP7 A;  2X9W A;  3VR9 A;  5BMV E;  4BJM A;  5LHG B;  2VL8 A;  2MYS A;  4UV8 B;  3N2G E;  1OED B;  1FIO A;  2WAU A;  2QYW A;  3ZC1 A;  4I50 E;  2CXL A;  1AJ3 A;  1HR0 T;  4LFA T;  4DBQ A;  2PBI A;  3J7Y q;  1JNZ A;  1I94 T;  5JDL A;  2V7I A;  3N9Q A;  2JRK A;  3N2K E;  1KNZ A;  2LSI A;  2J4G A;  5ETW A;  3PJA A;  2BKN A;  4YLH A;  2C0S A;  1KFY A;  2YU1 A;  3LBX A;  4C90 A;  5JRE A;  3AA6 B;  4LF6 T;  1XDO A;  3CIR A;  4O4H E;  2X0Y A;  5ABE A;  3RI5 A;  5CA1 E;  3AE9 A;  5KXJ A;  3LK4 2;  3V5U A;  4DV2 T;  3PUW F;  3J9X 1;  2LHN A;  4GK5 E;  2VKJ A;  3C4W A;  1UX4 A;  2WM9 A;  3AVS A;  3GA8 A;  4YJ3 E;  1UUS A;  3GN5 A;  1NEK A;  4KX6 A;  4CQI A;  3C4X A;  2WSS V;  3B57 A;  2CMR A;  3O4X E;  2G0U A;  4ILB A;  3ETV A;  4G2A A;  4X5T A;  3UTK A;  1YKH B;  2IC6 A;  3N9N A;  2QA7 A;  3QB5 A;  4LF5 T;  3T1H T;  3MK7 C;  3FBL A;  3LFM A;  4YTM A;  2RA1 A;  1U4Q A;  5JDF A;  2E9X C;  5LNK A;  3C64 A;  4MHC A;  1VCS A;  1UGO A;  4ZXL A;  3SS1 A;  1Y01 A;  4WBO A;  1IJ5 A;  3RQW A;  2WDR A;  5FY0 A;  4AKI A;  3QNU A;  3ZMV B;  1YQ4 A;  3PE0 A;  3H3M A;  4EED A;  4LFB T;  4FJO A;  5TAO A;  1T7S A;  1OXZ A;  3CWZ B;  2LRK A;  1J1J A;  5L3C B;  2KSR A;  2WDQ A;  3RLF F;  3UU8 A;  3C4Z A;  3P50 A;  2X9H A;  4FI5 A;  4QHO A;  2W0G A;  3UUX B;  4HFE A;  4HTE A;  1R8I A;  2H89 A;  4BAY B;  4O2A E;  4CN4 A;  3WAK A;  3A8Y C;  3MAC A;  2QGS A;  4QXH B;  4JI7 T;  5CFB A;  1OED C;  2XQ5 A;  5HXH A;  5FXV A;  2FJB A;  4AKG A;  3PUY F;  3B5M A;  2LSK A;  3I9Y A;  2LT3 A;  4E7S A;  5FNV E;  4GIW A;  2LSG A;  3QOF A;  3PUQ A;  1SUM B;  4HWI B;  2ZM2 A;  1WR6 A;  2K5B B;  2Y6X A;  3ANW A;  2NTX A;  1X9B A;  2C5K T;  2BS3 A;  5EK3 A;  2IAK A;  3T1Y T;  2PJQ A;  5DQV A;  2NOX A;  3PU8 A;  3RIF A;  3RIU A;  4XZC A;  3DTO A;  4NUU A;  4B3M T;  2W67 A;  3PUV F;  1B7T A;  3ZMT B;  3HR0 A;  1MIV A;  1M7K A;  2XAJ B;  4ZOL E;  5JQG E;  3VRA A;  1WLX A;  4JI5 T;  4LF4 T;  2XAQ B;  1NEN A;  4K0K T;  1BR4 A;  3CVR A;  2WB5 A;  3RKO A;  2UXC T;  2ZMA A;  4O2B E;  3UUL A;  3TLT A;  2M6I A;  5LG3 A;  3AVR A;  1CUN A;  3AB3 B;  4ZI3 D;  2CE7 A;  2XAG B;  4N78 D;  3Q2M A;  5HXS A;  5AQM B;  4HFD A;  4PK5 A;  4A56 A;  3HKD E;  4DID B;  2L8K A;  2MOZ A;  3NKZ A;  1N34 T;  2VVN A;  1BR0 A;  4QX8 B;  2JQQ A;  4TV8 E;  2BS4 A;  4Z90 A;  4WW0 A;  4BA9 A;  5CB4 E;  2LEH A;  2V7J A;  3RYC E;  4HN9 A;  2LKH A;  2V1D B;  3N5L A;  3RHW A;  3AE4 A;  3ZCI A;  3AE8 A;  3KV9 A;  1XMO T;  2A2F X;  3QB5 K;  2YK0 A;  4Z8X A;  4AIU A;  5JDQ A;  5AQI B;  3Q5D A;  3ETU A;  2Y8D A;  3PUR A;  4YT0 A;  2X66 A;  3QC9 A;  3K8P C;  5L47 A;  3Q5W A;  4IE7 A;  2D0T A;  4O4I E;  2M67 A;  3PUZ F;  2BBH A;  3WI3 A;  2YIN A;  5DAB A;  5JDN A;  3LDQ B;  4LF8 T;  4YSZ A;  3CQG B;  3FZK B;  3ZMS B;  4BJN A;  2A3D A;  4NXN T;  1IJ6 A;  4HGA A;  1FEW A;  3NZP A;  5F5W A;  3UFG A;  2DHR A;  1XMQ T;  4TWF A;  4AKH A;  4J2C A;  4HFH A;  1S35 A;  5FY1 A;  3TLS A;  4HWD A;  4KMC A;  1J5E T;  2ODV A;  4TWH A;  3UUB A;  4GKK T;  4HFB A;  5L2L A;  4TNV A;  3S4U A;  4CZZ B;  4HFI A;  4M1P A;  3CX6 B;  5JH7 E;  3KFW X;  3N9O A;  2XY8 B;  3Q5X A;  5IYZ E;  4KUM B;  4DMW A;  5JVD E;  2CM0 A;  4DV1 T;  1OWA A;  4JYA T;  4IDQ A;  2XM2 A;  4E7Z A;  5HCM A;  2J62 A;  3TKL B;  1D1A A;  5J2U E;  4QXB B;  4LF7 T;  4IRE A;  4OYJ A;  4WBN E;  3I0O A;  2W00 A;  3AE7 A;  4ZZC A;  4X64 T;  2VKH A;  4COF A;  5HWX A;  5E0O A;  4PNI A;  3ZT5 A;  2DWK A;  3T8O A;  1XWM A;  5AQR B;  2N1G A;  4DR4 T;  4IT4 A;  4H9S E;  3EHZ A;  1KF6 A;  2VUR A;  2DWG A;  2X0H A;  2CA5 A;  5LBQ B;  3K3Q C;  5JDG A;  4GK0 E;  2WQY A;  5HEU A;  4UIG A;  2XSB A;  4AI6 A;  2WY2 A;  2DLR A;  4B3S T;  2LSY A;  1OED E;  4U3C A;  5C2T A;  4ZHQ E;  1EZ3 A;  3ZYM A;  1VRB A;  2VAS A;  5AQS B;  5HWY A;  1Z8U A;  3P7I A;  2ACZ A;  5HCJ A;  2UU9 T;  2PG8 A;  4U31 A;  3RKG A; 
#chains in the Genus database with same CATH homology
 2W2U A;  2JQ9 A;  4IT4 A;  4U3C A;  5FVL A;  3ZT6 A;  4U33 A;  3K1S A;  2V6Y B;  1WFD A;  4NIQ A;  4CN1 A;  1WR0 A;  4CN4 A;  4P1N A;  4CN6 A;  4ZEY A;  5FVK A;  4U7I A;  2JQK A;  4WZX A;  2A9U A;  1WCR A;  2LRK A;  3EAB A;  4U2Z A;  1YXR A;  3ZSS A;  3ZT7 A;  2CPT A;  2CRB A;  2K3W A;  5CGM A;  2V6Y A;  4A5X A;  2WY2 A;  2MPK A;  5LB7 B;  2RPA A;  4U7Y A;  2JQH A;  2WWV A;  3ZST A;  2V6X A;  4U31 A;  2LRL A;  2XZE A;  3ZT5 A;  5CJ5 A;  4U2Y A;  2DL1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...