4ZEYA

Crystal structure of a nuclear receptor binding factor 2 mit domain (nrbf2) from homo sapiens at 1.50 a resolution
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
84
structure length
84
Chain Sequence
b'GMEGPLNLAHQQSRRADRLLAAGKYEEAISCHKKAAAYLSEAMKLTQSEQAHLSLELQRDSHMKQLLLIQERWKRAQREERLKA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nuclear receptor-binding factor 2
publication title Crystal structure of a nuclear receptor binding factor 2 MIT domain (NRBF2) from Homo sapiens at 1.50 A resolution
rcsb
source organism Homo sapiens
molecule tags Transcription regulator
total genus 31
structure length 84
sequence length 84
ec nomenclature
pdb deposition date 2015-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17169 NRBF2_MIT MIT domain of nuclear receptor-binding factor 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.280 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Hypothetical protein 1500032h18. 4zeyA00
4U7IA 2JQKA 4WZXA 2K3WA 2CRBA 3EABA 1WFDA 2DL1A 2XZEA 3K1SA 2W2UA 2RPAA 4P1NA 4U33A 5FVLA 3ZT5A 4CN6A 4ZEYA 5CGMA 2WWVA 5FVKA 4CN4A 3ZT7A 4A5XA 2V6YB 2JQ9A 1WR0A 4U3CA 2LRLA 2WY2A 5LB7B 2CPTA 2JQHA 4U2YA 4U2ZA 4CN1A 2LRKA 1WCRA 4IT4A 2MPKA 3ZSSA 4U7YA 1YXRA 2V6YA 4NIQA 3ZSTA 3ZT6A 5CJ5A 2A9UA 4U31A 2V6XA
chains in the Genus database with same CATH superfamily
5FMNA 2GK9A 4JV5T 4QWNB 4AKLA 5LBQB 3FXDB 2UXCT 3PUZF 5F8PA 4OFZA 2YK0A 2X0LB 2X0YA 4DV3T 3O1JA 1HG5A 1FMWA 5TAOA 3J9X1 3N2KE 1T8BA 3N5LA 3VR8A 3ETVA 3ZMVB 4AQYT 2RPAA 4PK6A 5C8YE 3NZPA 3VHLA 3AEDA 1YW0A 5F3JA 1H7CA 5KXJA 4O4LE 5J0ZA 1OXZA 1KNZA 3N9LA 5LGUB 3RF1A 2CWYA 4MBQA 1JNZA 1D1CA 4C91A 2V1DB 2UXXB 3T1HT 4DUZT 2XASB 4TNVA 5LHGB 3IF8B 2D0UA 4DV2T 3P4RA 3ANWB 4ZEYA 2NW8A 3EVYA 1J1JA 5FKYA 2ES0A 4TV9E 2ZM8A 3TKLB 4GK0E 3AECA 2LEHA 4X1IE 3ZC1A 2CXDA 5HEOA 4ILUA 4IE5A 3R84B 3MKDA 4WYVA 2ZM6T 3CMLA 2WSSV 1XNRT 1D0XA 4YJ2E 4X1YE 1KNPA 3Q5DA 5LXTE 1T72A 4KX6A 3PUXF 4I4TE 4F6RC 2BG9E 3HKDE 3OTOT 4AKHA 4YHHT 4AKIA 3CQXC 3BQIA 3WAJA 3QUJA 2QA7A 4GK5E 3LSVA 5AQPB 4DVDA 2CEAA 3FZHB 4KI0F 4EOZB 4ISTA 5HYAA 1SE7A 3UU4A 5LGNB 2NTXA 1G73A 4ZI3C 4LF9T 4AKGA 3NWIA 3FZLB 1D0YA 1HNXT 4TWHA 5FXVA 2Q9QC 4H9OC 3B13A 2LOSA 1JNRA 5JH7E 2ODUA 4HFIA 3JC6C 5H6QB 4P0BA 5JDMA 3IHRA 3WAKA 2Z6EA 1WCRA 3JAFA 3P4WA 4DV0T 3UU6A 3CVRA 2MBGA 3LK2B 2HN1A 4JI6T 4IL4A 2WU2A 4YTNA 3ZKRA 4HWIB 2NW7A 2QRXA 4DR4T 4NUUA 3VU7H 2YOEA 4I50E 3IBPA 4HE8A 4JEHB 4CXYA 5DQVA 2NWBA 2OA5A 2CXLA 2XY8B 3OVUA 3K3NA 4P09A 3L3PA 5FXWA 3KBTA 3O4XE 1E7PA 3AE8A 4WW0A 1UURA 1MIVA 4O4HE 3NZQA 5LG4A 3FB2A 5HEJA 2LLYA 4TNWA 5ABGA 2W2UA 5L3DB 2W00A 5HEUA 2BS2A 2NP9A 3P8CD 4LFBT 4X62T 2KMFA 3RC3A 4CN1A 3QNUA 3ZC0A 2J62A 2FJDA 4UVAB 3AEGA 4EGWA 4GYRA 1X79A 3LG7A 4XAXB 4G63A 4ADZA 1NENA 1T98A 4M1PA 1UK5A 4DV4T 3C4XA 4IDZA 3H37A 3ZMSB 2B1EA 1ZEEA 2NR4A 2WY2A 2K48A 1M7KA 2WWUA 3RIFA 2XQ3A 2YINA 2BS4A 4BJNA 1Z0PA 4EEBA 2ZMAA 3AA7B 5DJQC 3ONXA 2VWAA 4DR7T 1J5ET 4GOUA 4HKAA 5AQKB 2M6BA 2EHOB 3P7IA 3PV0F 4J2CA 4PFPA 4YTMA 5L47A 2X0HA 2VASA 4HFDA 2LSYA 2EHOA 2MTQA 5GONE 3UQ7A 3RI5A 4HFVA 3UFGA 4O2BE 4H9QC 4LFAT 4XBFB 2J1DG 2QYWA 2IHR1 2WCAA 5JDGA 3FZKB 4QXCB 3OYXA 4E7ZA 4DO0A 2L8KA 5L3GB 5AQSB 5J2UE 2FJBA 4AQFC 2W67A 3NRYA 4MHCA 2CMRA 4LMJA 4KBMB 4CN6A 4CI1B 4JI8T 2IW5B 2DI4A 1T7SA 1NWMX 4IT4A 5JRCB 4CZZB 2P9BA 3AA1B 4PNIA 2JJ9A 4IIJE 3W15B 2DL1A 2WDVA 5AQQB 5JRCA 4ILBA 1N34T 2PFVA 1UUSA 3OKQA 1ZHCA 2X9WA 3Q2MA 2LM2A 2ODVA 4EV6A 3QOFA 2H7OA 2I6HA 2YDRA 3ABVA 5LA6E 3HKCE 2VK9A 2BG9C 3P4QA 2VURA 3ZEFB 4U74A 3PURA 5AQTB 4G2AA 2PJQA 2XQ4A 3NRXA 4AI6A 1IBKT 4DMWA 5HCJA 2LT3A 4DNDA 1WR6A 5AQVB 4IE6A 5FY0A 4DUYT 5CFBA 2VKHA 2C5IT 1HR0T 3I9YA 1VCSA 2LM9A 2MYSA 2V26A 2CLYB 2C5JA 4OYKA 1WYBA 3UT5E 2ZLYA 4BAYB 4JUYA 1S94A 3AVSA 3RRCA 1VCTA 2SPCA 3LDQB 5LG3A 3UFEA 2KZ7B 2V7JA 2V7IA 2XAHB 4ZOLE 2VVSA 1YKEB 1UCUA 4YHJA 2A72A 4HWDA 4YTPA 2V5DA 2X9YA 4P0AA 2JMKA 4LF8T 5JTGA 5L2LA 3CKDA 5EK4A 1HF8A 4GKKT 2IMLA 4UVBB 1QUUA 4H9RC 2UXBT 2VQET 5ADXL 2XQ7A 5HXCA 2LRLA 3ZN1B 4QX8B 3OBVE 3AA0B 2X67A 1Y01A 2KT9A 4EYUA 3ZCJA 5FVLA 4ZI2C 4LF4T 5KDMC 4K0UA 5HAXA 5L3BB 3PUQA 2LOPA 4X66T 3CPZA 1SA0E 3ZT6A 2XJ7A 3AAAB 3AEEA 1KNRA 2LHNA 2D5UA 1HS7A 2DLRA 4A97A 1BR2A 2EHOD 3Q5XA 1XMOT 2H3RA 3ONJA 4CI3B 2YU2A 4KHZF 2WAUA 3PUWF 2D9DA 2VKOA 4P1NA 5CGMA 2K5BB 4EIWA 3E0ZA 2DWKA 2OLTA 2WMNA 4TX5A 4U2YA 1FJGT 3WI3A 3GN5B 3J7Yq 2BG9B 3O1HA 3G06A 3L09A 4ZI3D 3GN5A 2BG9A 3V5SA 3C50A 2Q9QD 3CQGB 2IDOB 4JI5T 4QKNA 5LMNT 5EK3A 2PTFA 3JC6D 1HX1B 2DHRA 5ABHA 4N78D 2WDRA 5LBMA 4BJMA 3VKGA 5FVKA 2VL0A 5AQRB 4YSZA 1MIWA 4AQGA 2YDSA 2UXNB 4NXMT 2LKHA 3ZLIA 3OPCA 2EHOC 3K1SA 3PDYA 3TLVA 2VQFT 4DR3T 4JI2T 2WP9A 2KWHA 3RRWA 3MA9A 5L3CB 3LK42 1W09A 4PK5A 3AE4A 4NXNT 4ZI7E 3AVRA 3D0TA 5FY7A 2WWVA 1N33T 1CUNA 2K24A 2VB6A 2CPTA 3KV4A 5LP6E 3A5XA 4IE4A 1BR4A 3CK6A 2X66A 1MMGA 2XAGB 2YN6A 2JPFA 1ZP0A 4DV7T 4LF7T 4TWFA 4HWHA 4UELA 1HG2A 2BKPA 2LE8A 3QB5A 2CM0A 4X65T 2MOZA 2BKNA 4YSYA 2V6XA 4L9IA 1B7TA 4IGUA 5IUXA 2WZIA 4HFHA 4EXTA 2X9XA 2L3LA 3ZJ1A 2XAQB 2IC9A 1V9DA 2CBIA 2N1GA 1VRBA 4DV5T 2L9QA 1XWMA 1W0BA 4LF5T 4UVCB 4PK4A 3UU3A 2J4GA 3ZT5A 5J1GA 4MALA 4CN4A 2M6IA 2JMHA 3AXJB 2PG8A 1D1BA 4U3CA 1Y64B 3N9MA 2X9HA 3AXJA 5FY1A 4U31A 4UR9A 4UV9B 4JI4T 3ZYMA 5CA1E 3F57A 3JAEA 3N9QA 4IDPA 5LB7B 4UV8B 3BK9A 5AQLB 2CLYC 4DV1T 3AE7A 3PUVF 1KF6A 3SFDA 3K8PC 3H3AA 3T8OA 3EDUA 5IYZE 1CHUA 1HFAA 2LSGA 1X9BA 3ZN0B 4KMCA 3ZMTB 3MK7C 4U2ZA 4QHOA 3NKZA 1HNZT 2MPKA 5CJ5A 3IEEA 4OK0A 2WU5A 3N2OA 1OEDB 3ONLC 2HHHT 5EZYE 3GA8A 3RYHE 4CXXA 2XAFB 1OEDA 2XQAA 4PW8A 2N9DA 3FZFB 3RHWA 5FYMA 3UQ4A 4KP3C 3CWZB 5JREA 5AQHB 2QGSA 4JI0T 4JI3T 1S35A 2IC6A 3I1AA 5FXZA 2HPJA 2W4XA 3CX8B 5JDLA 1Z8UA 4PJLA 3F2EA 3PE0A 2LRKA 2K9AA 1E2AA 2I0MA 1DU2A 2BBHA 3RKGA 2A2FX 3KV9A 2XSAA 4IREA 2XQ6A 2UUBT 1QLBA 3PUSA 2VKJA 3AEBA 2JQQA 2CHNA 3FBLA 4GYSA 2HPLA 4FJOA 1WLXA 1OEDE 4MLKA 4LF6T 3KVBA 3ZT7A 5HEGA 4BA9A 3C98B 4HGAA 3O1IA 2CE7A 5FXXA 2YKSA 2XM2A 3ETUA 2CXFA 3X1DA 2M67A 4OX9T 2IIUA 2FJAA 5L4HA 4HTEA 4ZXLA 4O4JE 1KEYA 3NVOA 2BBJA 3AAEB 2VKDA 4AXPA 5IHYA 2CA5A 1WR0A 3RLFF 3UULA 2R6GF 3RX6A 2YEVC 3A8YC 4O8SA 4QH5A 4U7IA 3C4WA 4EEDA 4IHJE 5KMGP 1MMAA 4JEUB 4ZI2D 4UF0B 5JDNA 3PJAA 3AE1A 1W9RA 1YQ4A 2WZHA 1YKHB 4UF0A 3MACA 3UU8A 3V5UA 3AE3A 4DV6T 3B57A 4HWFA 4I0UA 3PU3A 3BQKA 3PUGA 3HA4A 3AEAA 4EB6E 4ISSA 3AAIA 4YJ3E 5AQIB 2VL8A 4PAGA 3UUXB 1YXRA 4TUYE 3AE9A 2E2AA 4ANJA 3LJCA 2J47A 3SFEA 1I6ZA 3EHZA 4DBRA 1SHZC 2LSJA 3FZMB 1N32T 2DWGA 3LFMA 4IDNA 5LCYA 1E1HB 3PUAA 5ABEA 4LFCT 1LVKA 4X5TA 5IWAT 5BMVE 2KNDA 4QXHB 2V7KA 2E9XC 2IAKA 4HFEA 4DMVA 4EAHA 4V1Av 5HEHA 1ZOYA 4HFBA 3EAMA 2C0SA 2XAJB 3ZMUB 4E7SA 2C5KT 4A56A 2WM9A 4JBWF 3E08A 4IE0A 5JVDE 3RKOA 1U5PA 1AJ3A 4I55E 3AE5A 1D1AA 2KSRA 3ZPOA 4JLEA 2N2NA 2I59A 3JADA 4MFRA 2LKGA 2JQHA 3LK3B 2WDQA 2H88A 2BVLA 4U7YA 4CXWA 2UXDT 3RYFE 4YT0A 3FXEB 4WZXA 2E8IA 5BR8T 4X20E 4QX7B 1HX8A 4OHFA 4ZZCA 4DR5T 3DP7A 3RH3A 2BS3A 2ZM2A 4DR6T 3VR9A 3SRZA 4B6XA 2JIWA 4B3RT 1MMDA 5HXRA 3GMIA 3OJAA 5LJMA 5EK2A 3EABA 2MAWA 4KHPT 1UX5A 2QVAA 2NOXA 1LVFA 2WS3A 4COFA 2XUEA 3I0QA 3K3QC 2AXDS 3C4ZA 4HWCA 4YSXA 1OWAA 2BZBA 1XDPA 3RQWA 3AE6A 3TLUA 4TWDA 4UEMA 2CCQA 5JDFA 1US7B 4H9NC 1R8IA 5LGTB 3AB3B 5CA0E 3TLTA 3ZSTA 2XM1A 2XSBA 3KDSE 2CHOA 2E5LT 5DABA 4U72A 2XQ8A 2BKOA 4TZ4C 3CIRA 3MXZA 1MIYA 4Q25A 5L3EB 4DR1T 1OEDC 5ABFB 3GWHA 1FIOA 1QSDA 4K0KT 5AFUL 4AKRB 4O4IE 2K3WA 5ABFA 5FL0A 4OYJA 4L0RA 5FNVE 3O9XA 1IZNB 1XZYA 3P4SA 4WNKA 4FI5A 3ZMZB 2XTLA 3ANWA 3EDVA 3KBUA 3P4PA 2DNXA 5LOVE 4PJNA 4HFCA 3BQLA 4ILCA 4H63H 4DBQA 3M65A 3HI2A 5LMUT 2HH7A 2E9XB 4A5XA 2LSKA 2JQ9A 3Q5EA 4PJMA 1D0ZA 3PTRB 4H9PC 2HN2A 2CWOA 2BDEA 1ZKEA 5LYJE 3RGLA 2E9XA 3KVAA 4ZS2A 4YXDA 3KINB 2W0GA 4KUMB 2V7MA 2V5CA 2PBIA 3K3OA 4IL9A 3LBXB 3A7MA 2FBWA 3NBXX 3DJBA 3EUHA 4AIUA 5HXSA 2NTYA 2W62A 4WBNE 4YLHA 3LBXA 5AQUB 4H63V 3OYZA 1SUMB 2B76A 3UUMA 3UUBA 4O2AE 4ASKA 2WB5A 5L4EA 3N9NA 4Z91A 5LJNA 1VOMA 3ZJ2A 3RIUA 5LNKA 1MNEA 1W0AA 3KV5A 3KV6A 4QXBB 1U4QA 1ZV4X 3RYCE 3I0OA 4GKJT 5HXHA 1FMVA 3ZYKA 1GQEA 4CQIA 3UTKA 2W66A 2YU1A 3IA3A 1N36T 1L0VA 3SS1A 1KK7A 3MJXA 2XZEA 3R6NA 1O3XA 2LSIA 4B3TT 4U33A 2DCFA 2KWIB 2WQYA 3VRAA 5JDHA 4JYAT 4F8HA 1XDOA 3UUNA 3E22E 3RQUA 3RPUA 3PJAJ 3HL6A 3VRBA 2A9UA 4B3MT 5HXEA 2KINB 3MZKB 2XQ5A 3CX7B 4HN9A 2AE9A 5DQWA 1EZ3A 4JI1T 3AE2A 2ACXA 4NUVA 3KFWX 5E0OA 4EZ4A 4LMLA 4TN7B 1IAPA 2UUAT 4NPPA 2XPKA 3C51A 2NW9A 3RYIE 1UX4A 2A3DA 3CX6B 3FBZA 5AQJB 2FJEA 3SWHA 4QH4A 1G8XA 2JRKA 5JR9C 2BVMA 5ETWA 3U3IA 1NAFA 2H7VC 2XQYA 1YD8G 4X1KE 4ZS3A 5AQMB 3TLSA 4C90A 4B3ST 3S4UA 4ZHQE 5FL1A 1IJ6A 2W63A 4PFOA 4WBOA 4LMKA 3QK6A 3DTOA 4QH1A 2ACZA 3RIAA 3EI0A 3T1YT 4X64T 3B5MA 3L39A 1XNQT 2Q9QB 1I94T 3QC9A 2LHRA 3N9OA 2WBLA 2UUCT 2V7LA 4NIQA 2Q9QA 3AEFA 2E9XD 1J5WA 4ZZBA 5JDQA 3AA6B 2E5VA 2XQ9A 5F5WA 5LHIB 3Q5WA 3L8RA 2XHEB 3F31A 2WMOA 3HR0A 3H3MA 1UGOA 5J2TE 1BR1A 2KXPB 4L5GA 4TV8E 3ZCIA 4YY3T 1LKXA 2VVNA 4IDOA 3U78A 4Z8XA 3CQCB 2X51A 1WYCA 1HNWT 2CBJA 5AQGB 3HKBE 4H9SE 4IDQA 5C2TA 5AQOB 2CRBA 1WFDA 2LJLA 1HTJF 2D2SA 1LRZA 4DR2T 5C3JA 4HEAA 5AQNB 3TLWA 3UU5A 1KFYA 5HWXA 2UU9T 2RP4A 3N2GE 4IE7A 2JQKA 1HCIA 2X68A 5KX5E 1IBMT 1BR0A 3P50A 5H6RB 5HWYA 2V6YB 5HCMA 5L3FB 4CI2B 5M4YA 3ZYLA 4GIWA 2V8SV 2YDQA 4Z90A 2V6YA 3FHNA 3RC8A 3I9WA 3PUYF 2ZM0A 2FUPA 4A98A 2G0UA 2D0TA 2Y48B 4EZHA 3PU8A 1FEWA 3JCFA 5LHHB 4JI7T 1IJ5A 3HKEE 5FP3A 2Y8DA 3ESLA 1YQ3A 3SOLA 2IUBA 5CB4E 1NEKA 4I43B 1IBLT 3VKHA 4ERRA 5AQFB 5JR9B 3Q9DA 1MNDA 2RA1A 4YFSA 3C64A 2H89A 2W61A 5JR9A 1MMNA 2F4VT 3QB5K 2Y6XA 4AISA 4UXNB 1XMQT 3RIUC 5JQGE 3M3ZB 1WRDA 3N9PA 4DIDB 5A1LA 1M62A 4UIGA 4AQFA 4XZCA 4PJJA 3ZSSA 4EYYR 2OV9A 4ILAA 2KLQA
chains in the Genus database with same CATH topology
4U7IA 2JQKA 4WZXA 2K3WA 2CRBA 3EABA 1WFDA 2DL1A 2XZEA 3K1SA 2W2UA 2RPAA 4P1NA 4U33A 5FVLA 3ZT5A 4CN6A 4ZEYA 5CGMA 2WWVA 5FVKA 4CN4A 3ZT7A 4A5XA 2V6YB 2JQ9A 1WR0A 4U3CA 2LRLA 2WY2A 5LB7B 2CPTA 2JQHA 4U2YA 4U2ZA 4CN1A 2LRKA 1WCRA 4IT4A 2MPKA 3ZSSA 4U7YA 1YXRA 2V6YA 4NIQA 3ZSTA 3ZT6A 5CJ5A 2A9UA 4U31A 2V6XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4U7I A;  2JQK A;  4WZX A;  2K3W A;  2CRB A;  3EAB A;  1WFD A;  2DL1 A;  2XZE A;  3K1S A;  2W2U A;  2RPA A;  4P1N A;  4U33 A;  5FVL A;  3ZT5 A;  4CN6 A;  4ZEY A;  5CGM A;  2WWV A;  5FVK A;  4CN4 A;  3ZT7 A;  4A5X A;  2V6Y B;  2JQ9 A;  1WR0 A;  4U3C A;  2LRL A;  2WY2 A;  5LB7 B;  2CPT A;  2JQH A;  4U2Y A;  4U2Z A;  4CN1 A;  2LRK A;  1WCR A;  4IT4 A;  2MPK A;  3ZSS A;  4U7Y A;  1YXR A;  2V6Y A;  4NIQ A;  3ZST A;  3ZT6 A;  5CJ5 A;  2A9U A;  4U31 A;  2V6X A; 
#chains in the Genus database with same CATH topology
 5FMN A;  2GK9 A;  4JV5 T;  4QWN B;  4AKL A;  5LBQ B;  3FXD B;  2UXC T;  3PUZ F;  5F8P A;  4OFZ A;  2YK0 A;  2X0L B;  2X0Y A;  4DV3 T;  3O1J A;  1HG5 A;  1FMW A;  5TAO A;  3J9X 1;  3N2K E;  1T8B A;  3N5L A;  3VR8 A;  3ETV A;  3ZMV B;  4AQY T;  2RPA A;  4PK6 A;  5C8Y E;  3NZP A;  3VHL A;  3AED A;  1YW0 A;  5F3J A;  1H7C A;  5KXJ A;  4O4L E;  5J0Z A;  1OXZ A;  1KNZ A;  3N9L A;  5LGU B;  3RF1 A;  2CWY A;  4MBQ A;  1JNZ A;  1D1C A;  4C91 A;  2V1D B;  2UXX B;  3T1H T;  4DUZ T;  2XAS B;  4TNV A;  5LHG B;  3IF8 B;  2D0U A;  4DV2 T;  3P4R A;  3ANW B;  4ZEY A;  2NW8 A;  3EVY A;  1J1J A;  5FKY A;  2ES0 A;  4TV9 E;  2ZM8 A;  3TKL B;  4GK0 E;  3AEC A;  2LEH A;  4X1I E;  3ZC1 A;  2CXD A;  5HEO A;  4ILU A;  4IE5 A;  3R84 B;  3MKD A;  4WYV A;  2ZM6 T;  3CML A;  2WSS V;  1XNR T;  1D0X A;  4YJ2 E;  4X1Y E;  1KNP A;  3Q5D A;  5LXT E;  1T72 A;  4KX6 A;  3PUX F;  4I4T E;  4F6R C;  2BG9 E;  3HKD E;  3OTO T;  4AKH A;  4YHH T;  4AKI A;  3CQX C;  3BQI A;  3WAJ A;  3QUJ A;  2QA7 A;  4GK5 E;  3LSV A;  5AQP B;  4DVD A;  2CEA A;  3FZH B;  4KI0 F;  4EOZ B;  4IST A;  5HYA A;  1SE7 A;  3UU4 A;  5LGN B;  2NTX A;  1G73 A;  4ZI3 C;  4LF9 T;  4AKG A;  3NWI A;  3FZL B;  1D0Y A;  1HNX T;  4TWH A;  5FXV A;  2Q9Q C;  4H9O C;  3B13 A;  2LOS A;  1JNR A;  5JH7 E;  2ODU A;  4HFI A;  3JC6 C;  5H6Q B;  4P0B A;  5JDM A;  3IHR A;  3WAK A;  2Z6E A;  1WCR A;  3JAF A;  3P4W A;  4DV0 T;  3UU6 A;  3CVR A;  2MBG A;  3LK2 B;  2HN1 A;  4JI6 T;  4IL4 A;  2WU2 A;  4YTN A;  3ZKR A;  4HWI B;  2NW7 A;  2QRX A;  4DR4 T;  4NUU A;  3VU7 H;  2YOE A;  4I50 E;  3IBP A;  4HE8 A;  4JEH B;  4CXY A;  5DQV A;  2NWB A;  2OA5 A;  2CXL A;  2XY8 B;  3OVU A;  3K3N A;  4P09 A;  3L3P A;  5FXW A;  3KBT A;  3O4X E;  1E7P A;  3AE8 A;  4WW0 A;  1UUR A;  1MIV A;  4O4H E;  3NZQ A;  5LG4 A;  3FB2 A;  5HEJ A;  2LLY A;  4TNW A;  5ABG A;  2W2U A;  5L3D B;  2W00 A;  5HEU A;  2BS2 A;  2NP9 A;  3P8C D;  4LFB T;  4X62 T;  2KMF A;  3RC3 A;  4CN1 A;  3QNU A;  3ZC0 A;  2J62 A;  2FJD A;  4UVA B;  3AEG A;  4EGW A;  4GYR A;  1X79 A;  3LG7 A;  4XAX B;  4G63 A;  4ADZ A;  1NEN A;  1T98 A;  4M1P A;  1UK5 A;  4DV4 T;  3C4X A;  4IDZ A;  3H37 A;  3ZMS B;  2B1E A;  1ZEE A;  2NR4 A;  2WY2 A;  2K48 A;  1M7K A;  2WWU A;  3RIF A;  2XQ3 A;  2YIN A;  2BS4 A;  4BJN A;  1Z0P A;  4EEB A;  2ZMA A;  3AA7 B;  5DJQ C;  3ONX A;  2VWA A;  4DR7 T;  1J5E T;  4GOU A;  4HKA A;  5AQK B;  2M6B A;  2EHO B;  3P7I A;  3PV0 F;  4J2C A;  4PFP A;  4YTM A;  5L47 A;  2X0H A;  2VAS A;  4HFD A;  2LSY A;  2EHO A;  2MTQ A;  5GON E;  3UQ7 A;  3RI5 A;  4HFV A;  3UFG A;  4O2B E;  4H9Q C;  4LFA T;  4XBF B;  2J1D G;  2QYW A;  2IHR 1;  2WCA A;  5JDG A;  3FZK B;  4QXC B;  3OYX A;  4E7Z A;  4DO0 A;  2L8K A;  5L3G B;  5AQS B;  5J2U E;  2FJB A;  4AQF C;  2W67 A;  3NRY A;  4MHC A;  2CMR A;  4LMJ A;  4KBM B;  4CN6 A;  4CI1 B;  4JI8 T;  2IW5 B;  2DI4 A;  1T7S A;  1NWM X;  4IT4 A;  5JRC B;  4CZZ B;  2P9B A;  3AA1 B;  4PNI A;  2JJ9 A;  4IIJ E;  3W15 B;  2DL1 A;  2WDV A;  5AQQ B;  5JRC A;  4ILB A;  1N34 T;  2PFV A;  1UUS A;  3OKQ A;  1ZHC A;  2X9W A;  3Q2M A;  2LM2 A;  2ODV A;  4EV6 A;  3QOF A;  2H7O A;  2I6H A;  2YDR A;  3ABV A;  5LA6 E;  3HKC E;  2VK9 A;  2BG9 C;  3P4Q A;  2VUR A;  3ZEF B;  4U74 A;  3PUR A;  5AQT B;  4G2A A;  2PJQ A;  2XQ4 A;  3NRX A;  4AI6 A;  1IBK T;  4DMW A;  5HCJ A;  2LT3 A;  4DND A;  1WR6 A;  5AQV B;  4IE6 A;  5FY0 A;  4DUY T;  5CFB A;  2VKH A;  2C5I T;  1HR0 T;  3I9Y A;  1VCS A;  2LM9 A;  2MYS A;  2V26 A;  2CLY B;  2C5J A;  4OYK A;  1WYB A;  3UT5 E;  2ZLY A;  4BAY B;  4JUY A;  1S94 A;  3AVS A;  3RRC A;  1VCT A;  2SPC A;  3LDQ B;  5LG3 A;  3UFE A;  2KZ7 B;  2V7J A;  2V7I A;  2XAH B;  4ZOL E;  2VVS A;  1YKE B;  1UCU A;  4YHJ A;  2A72 A;  4HWD A;  4YTP A;  2V5D A;  2X9Y A;  4P0A A;  2JMK A;  4LF8 T;  5JTG A;  5L2L A;  3CKD A;  5EK4 A;  1HF8 A;  4GKK T;  2IML A;  4UVB B;  1QUU A;  4H9R C;  2UXB T;  2VQE T;  5ADX L;  2XQ7 A;  5HXC A;  2LRL A;  3ZN1 B;  4QX8 B;  3OBV E;  3AA0 B;  2X67 A;  1Y01 A;  2KT9 A;  4EYU A;  3ZCJ A;  5FVL A;  4ZI2 C;  4LF4 T;  5KDM C;  4K0U A;  5HAX A;  5L3B B;  3PUQ A;  2LOP A;  4X66 T;  3CPZ A;  1SA0 E;  3ZT6 A;  2XJ7 A;  3AAA B;  3AEE A;  1KNR A;  2LHN A;  2D5U A;  1HS7 A;  2DLR A;  4A97 A;  1BR2 A;  2EHO D;  3Q5X A;  1XMO T;  2H3R A;  3ONJ A;  4CI3 B;  2YU2 A;  4KHZ F;  2WAU A;  3PUW F;  2D9D A;  2VKO A;  4P1N A;  5CGM A;  2K5B B;  4EIW A;  3E0Z A;  2DWK A;  2OLT A;  2WMN A;  4TX5 A;  4U2Y A;  1FJG T;  3WI3 A;  3GN5 B;  3J7Y q;  2BG9 B;  3O1H A;  3G06 A;  3L09 A;  4ZI3 D;  3GN5 A;  2BG9 A;  3V5S A;  3C50 A;  2Q9Q D;  3CQG B;  2IDO B;  4JI5 T;  4QKN A;  5LMN T;  5EK3 A;  2PTF A;  3JC6 D;  1HX1 B;  2DHR A;  5ABH A;  4N78 D;  2WDR A;  5LBM A;  4BJM A;  3VKG A;  5FVK A;  2VL0 A;  5AQR B;  4YSZ A;  1MIW A;  4AQG A;  2YDS A;  2UXN B;  4NXM T;  2LKH A;  3ZLI A;  3OPC A;  2EHO C;  3K1S A;  3PDY A;  3TLV A;  2VQF T;  4DR3 T;  4JI2 T;  2WP9 A;  2KWH A;  3RRW A;  3MA9 A;  5L3C B;  3LK4 2;  1W09 A;  4PK5 A;  3AE4 A;  4NXN T;  4ZI7 E;  3AVR A;  3D0T A;  5FY7 A;  2WWV A;  1N33 T;  1CUN A;  2K24 A;  2VB6 A;  2CPT A;  3KV4 A;  5LP6 E;  3A5X A;  4IE4 A;  1BR4 A;  3CK6 A;  2X66 A;  1MMG A;  2XAG B;  2YN6 A;  2JPF A;  1ZP0 A;  4DV7 T;  4LF7 T;  4TWF A;  4HWH A;  4UEL A;  1HG2 A;  2BKP A;  2LE8 A;  3QB5 A;  2CM0 A;  4X65 T;  2MOZ A;  2BKN A;  4YSY A;  2V6X A;  4L9I A;  1B7T A;  4IGU A;  5IUX A;  2WZI A;  4HFH A;  4EXT A;  2X9X A;  2L3L A;  3ZJ1 A;  2XAQ B;  2IC9 A;  1V9D A;  2CBI A;  2N1G A;  1VRB A;  4DV5 T;  2L9Q A;  1XWM A;  1W0B A;  4LF5 T;  4UVC B;  4PK4 A;  3UU3 A;  2J4G A;  3ZT5 A;  5J1G A;  4MAL A;  4CN4 A;  2M6I A;  2JMH A;  3AXJ B;  2PG8 A;  1D1B A;  4U3C A;  1Y64 B;  3N9M A;  2X9H A;  3AXJ A;  5FY1 A;  4U31 A;  4UR9 A;  4UV9 B;  4JI4 T;  3ZYM A;  5CA1 E;  3F57 A;  3JAE A;  3N9Q A;  4IDP A;  5LB7 B;  4UV8 B;  3BK9 A;  5AQL B;  2CLY C;  4DV1 T;  3AE7 A;  3PUV F;  1KF6 A;  3SFD A;  3K8P C;  3H3A A;  3T8O A;  3EDU A;  5IYZ E;  1CHU A;  1HFA A;  2LSG A;  1X9B A;  3ZN0 B;  4KMC A;  3ZMT B;  3MK7 C;  4U2Z A;  4QHO A;  3NKZ A;  1HNZ T;  2MPK A;  5CJ5 A;  3IEE A;  4OK0 A;  2WU5 A;  3N2O A;  1OED B;  3ONL C;  2HHH T;  5EZY E;  3GA8 A;  3RYH E;  4CXX A;  2XAF B;  1OED A;  2XQA A;  4PW8 A;  2N9D A;  3FZF B;  3RHW A;  5FYM A;  3UQ4 A;  4KP3 C;  3CWZ B;  5JRE A;  5AQH B;  2QGS A;  4JI0 T;  4JI3 T;  1S35 A;  2IC6 A;  3I1A A;  5FXZ A;  2HPJ A;  2W4X A;  3CX8 B;  5JDL A;  1Z8U A;  4PJL A;  3F2E A;  3PE0 A;  2LRK A;  2K9A A;  1E2A A;  2I0M A;  1DU2 A;  2BBH A;  3RKG A;  2A2F X;  3KV9 A;  2XSA A;  4IRE A;  2XQ6 A;  2UUB T;  1QLB A;  3PUS A;  2VKJ A;  3AEB A;  2JQQ A;  2CHN A;  3FBL A;  4GYS A;  2HPL A;  4FJO A;  1WLX A;  1OED E;  4MLK A;  4LF6 T;  3KVB A;  3ZT7 A;  5HEG A;  4BA9 A;  3C98 B;  4HGA A;  3O1I A;  2CE7 A;  5FXX A;  2YKS A;  2XM2 A;  3ETU A;  2CXF A;  3X1D A;  2M67 A;  4OX9 T;  2IIU A;  2FJA A;  5L4H A;  4HTE A;  4ZXL A;  4O4J E;  1KEY A;  3NVO A;  2BBJ A;  3AAE B;  2VKD A;  4AXP A;  5IHY A;  2CA5 A;  1WR0 A;  3RLF F;  3UUL A;  2R6G F;  3RX6 A;  2YEV C;  3A8Y C;  4O8S A;  4QH5 A;  4U7I A;  3C4W A;  4EED A;  4IHJ E;  5KMG P;  1MMA A;  4JEU B;  4ZI2 D;  4UF0 B;  5JDN A;  3PJA A;  3AE1 A;  1W9R A;  1YQ4 A;  2WZH A;  1YKH B;  4UF0 A;  3MAC A;  3UU8 A;  3V5U A;  3AE3 A;  4DV6 T;  3B57 A;  4HWF A;  4I0U A;  3PU3 A;  3BQK A;  3PUG A;  3HA4 A;  3AEA A;  4EB6 E;  4ISS A;  3AAI A;  4YJ3 E;  5AQI B;  2VL8 A;  4PAG A;  3UUX B;  1YXR A;  4TUY E;  3AE9 A;  2E2A A;  4ANJ A;  3LJC A;  2J47 A;  3SFE A;  1I6Z A;  3EHZ A;  4DBR A;  1SHZ C;  2LSJ A;  3FZM B;  1N32 T;  2DWG A;  3LFM A;  4IDN A;  5LCY A;  1E1H B;  3PUA A;  5ABE A;  4LFC T;  1LVK A;  4X5T A;  5IWA T;  5BMV E;  2KND A;  4QXH B;  2V7K A;  2E9X C;  2IAK A;  4HFE A;  4DMV A;  4EAH A;  4V1A v;  5HEH A;  1ZOY A;  4HFB A;  3EAM A;  2C0S A;  2XAJ B;  3ZMU B;  4E7S A;  2C5K T;  4A56 A;  2WM9 A;  4JBW F;  3E08 A;  4IE0 A;  5JVD E;  3RKO A;  1U5P A;  1AJ3 A;  4I55 E;  3AE5 A;  1D1A A;  2KSR A;  3ZPO A;  4JLE A;  2N2N A;  2I59 A;  3JAD A;  4MFR A;  2LKG A;  2JQH A;  3LK3 B;  2WDQ A;  2H88 A;  2BVL A;  4U7Y A;  4CXW A;  2UXD T;  3RYF E;  4YT0 A;  3FXE B;  4WZX A;  2E8I A;  5BR8 T;  4X20 E;  4QX7 B;  1HX8 A;  4OHF A;  4ZZC A;  4DR5 T;  3DP7 A;  3RH3 A;  2BS3 A;  2ZM2 A;  4DR6 T;  3VR9 A;  3SRZ A;  4B6X A;  2JIW A;  4B3R T;  1MMD A;  5HXR A;  3GMI A;  3OJA A;  5LJM A;  5EK2 A;  3EAB A;  2MAW A;  4KHP T;  1UX5 A;  2QVA A;  2NOX A;  1LVF A;  2WS3 A;  4COF A;  2XUE A;  3I0Q A;  3K3Q C;  2AXD S;  3C4Z A;  4HWC A;  4YSX A;  1OWA A;  2BZB A;  1XDP A;  3RQW A;  3AE6 A;  3TLU A;  4TWD A;  4UEM A;  2CCQ A;  5JDF A;  1US7 B;  4H9N C;  1R8I A;  5LGT B;  3AB3 B;  5CA0 E;  3TLT A;  3ZST A;  2XM1 A;  2XSB A;  3KDS E;  2CHO A;  2E5L T;  5DAB A;  4U72 A;  2XQ8 A;  2BKO A;  4TZ4 C;  3CIR A;  3MXZ A;  1MIY A;  4Q25 A;  5L3E B;  4DR1 T;  1OED C;  5ABF B;  3GWH A;  1FIO A;  1QSD A;  4K0K T;  5AFU L;  4AKR B;  4O4I E;  2K3W A;  5ABF A;  5FL0 A;  4OYJ A;  4L0R A;  5FNV E;  3O9X A;  1IZN B;  1XZY A;  3P4S A;  4WNK A;  4FI5 A;  3ZMZ B;  2XTL A;  3ANW A;  3EDV A;  3KBU A;  3P4P A;  2DNX A;  5LOV E;  4PJN A;  4HFC A;  3BQL A;  4ILC A;  4H63 H;  4DBQ A;  3M65 A;  3HI2 A;  5LMU T;  2HH7 A;  2E9X B;  4A5X A;  2LSK A;  2JQ9 A;  3Q5E A;  4PJM A;  1D0Z A;  3PTR B;  4H9P C;  2HN2 A;  2CWO A;  2BDE A;  1ZKE A;  5LYJ E;  3RGL A;  2E9X A;  3KVA A;  4ZS2 A;  4YXD A;  3KIN B;  2W0G A;  4KUM B;  2V7M A;  2V5C A;  2PBI A;  3K3O A;  4IL9 A;  3LBX B;  3A7M A;  2FBW A;  3NBX X;  3DJB A;  3EUH A;  4AIU A;  5HXS A;  2NTY A;  2W62 A;  4WBN E;  4YLH A;  3LBX A;  5AQU B;  4H63 V;  3OYZ A;  1SUM B;  2B76 A;  3UUM A;  3UUB A;  4O2A E;  4ASK A;  2WB5 A;  5L4E A;  3N9N A;  4Z91 A;  5LJN A;  1VOM A;  3ZJ2 A;  3RIU A;  5LNK A;  1MNE A;  1W0A A;  3KV5 A;  3KV6 A;  4QXB B;  1U4Q A;  1ZV4 X;  3RYC E;  3I0O A;  4GKJ T;  5HXH A;  1FMV A;  3ZYK A;  1GQE A;  4CQI A;  3UTK A;  2W66 A;  2YU1 A;  3IA3 A;  1N36 T;  1L0V A;  3SS1 A;  1KK7 A;  3MJX A;  2XZE A;  3R6N A;  1O3X A;  2LSI A;  4B3T T;  4U33 A;  2DCF A;  2KWI B;  2WQY A;  3VRA A;  5JDH A;  4JYA T;  4F8H A;  1XDO A;  3UUN A;  3E22 E;  3RQU A;  3RPU A;  3PJA J;  3HL6 A;  3VRB A;  2A9U A;  4B3M T;  5HXE A;  2KIN B;  3MZK B;  2XQ5 A;  3CX7 B;  4HN9 A;  2AE9 A;  5DQW A;  1EZ3 A;  4JI1 T;  3AE2 A;  2ACX A;  4NUV A;  3KFW X;  5E0O A;  4EZ4 A;  4LML A;  4TN7 B;  1IAP A;  2UUA T;  4NPP A;  2XPK A;  3C51 A;  2NW9 A;  3RYI E;  1UX4 A;  2A3D A;  3CX6 B;  3FBZ A;  5AQJ B;  2FJE A;  3SWH A;  4QH4 A;  1G8X A;  2JRK A;  5JR9 C;  2BVM A;  5ETW A;  3U3I A;  1NAF A;  2H7V C;  2XQY A;  1YD8 G;  4X1K E;  4ZS3 A;  5AQM B;  3TLS A;  4C90 A;  4B3S T;  3S4U A;  4ZHQ E;  5FL1 A;  1IJ6 A;  2W63 A;  4PFO A;  4WBO A;  4LMK A;  3QK6 A;  3DTO A;  4QH1 A;  2ACZ A;  3RIA A;  3EI0 A;  3T1Y T;  4X64 T;  3B5M A;  3L39 A;  1XNQ T;  2Q9Q B;  1I94 T;  3QC9 A;  2LHR A;  3N9O A;  2WBL A;  2UUC T;  2V7L A;  4NIQ A;  2Q9Q A;  3AEF A;  2E9X D;  1J5W A;  4ZZB A;  5JDQ A;  3AA6 B;  2E5V A;  2XQ9 A;  5F5W A;  5LHI B;  3Q5W A;  3L8R A;  2XHE B;  3F31 A;  2WMO A;  3HR0 A;  3H3M A;  1UGO A;  5J2T E;  1BR1 A;  2KXP B;  4L5G A;  4TV8 E;  3ZCI A;  4YY3 T;  1LKX A;  2VVN A;  4IDO A;  3U78 A;  4Z8X A;  3CQC B;  2X51 A;  1WYC A;  1HNW T;  2CBJ A;  5AQG B;  3HKB E;  4H9S E;  4IDQ A;  5C2T A;  5AQO B;  2CRB A;  1WFD A;  2LJL A;  1HTJ F;  2D2S A;  1LRZ A;  4DR2 T;  5C3J A;  4HEA A;  5AQN B;  3TLW A;  3UU5 A;  1KFY A;  5HWX A;  2UU9 T;  2RP4 A;  3N2G E;  4IE7 A;  2JQK A;  1HCI A;  2X68 A;  5KX5 E;  1IBM T;  1BR0 A;  3P50 A;  5H6R B;  5HWY A;  2V6Y B;  5HCM A;  5L3F B;  4CI2 B;  5M4Y A;  3ZYL A;  4GIW A;  2V8S V;  2YDQ A;  4Z90 A;  2V6Y A;  3FHN A;  3RC8 A;  3I9W A;  3PUY F;  2ZM0 A;  2FUP A;  4A98 A;  2G0U A;  2D0T A;  2Y48 B;  4EZH A;  3PU8 A;  1FEW A;  3JCF A;  5LHH B;  4JI7 T;  1IJ5 A;  3HKE E;  5FP3 A;  2Y8D A;  3ESL A;  1YQ3 A;  3SOL A;  2IUB A;  5CB4 E;  1NEK A;  4I43 B;  1IBL T;  3VKH A;  4ERR A;  5AQF B;  5JR9 B;  3Q9D A;  1MND A;  2RA1 A;  4YFS A;  3C64 A;  2H89 A;  2W61 A;  5JR9 A;  1MMN A;  2F4V T;  3QB5 K;  2Y6X A;  4AIS A;  4UXN B;  1XMQ T;  3RIU C;  5JQG E;  3M3Z B;  1WRD A;  3N9P A;  4DID B;  5A1L A;  1M62 A;  4UIG A;  4AQF A;  4XZC A;  4PJJ A;  3ZSS A;  4EYY R;  2OV9 A;  4ILA A;  2KLQ A; 
#chains in the Genus database with same CATH homology
 4U7I A;  2JQK A;  4WZX A;  2K3W A;  2CRB A;  3EAB A;  1WFD A;  2DL1 A;  2XZE A;  3K1S A;  2W2U A;  2RPA A;  4P1N A;  4U33 A;  5FVL A;  3ZT5 A;  4CN6 A;  4ZEY A;  5CGM A;  2WWV A;  5FVK A;  4CN4 A;  3ZT7 A;  4A5X A;  2V6Y B;  2JQ9 A;  1WR0 A;  4U3C A;  2LRL A;  2WY2 A;  5LB7 B;  2CPT A;  2JQH A;  4U2Y A;  4U2Z A;  4CN1 A;  2LRK A;  1WCR A;  4IT4 A;  2MPK A;  3ZSS A;  4U7Y A;  1YXR A;  2V6Y A;  4NIQ A;  3ZST A;  3ZT6 A;  5CJ5 A;  2A9U A;  4U31 A;  2V6X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...