4ZEYA

Crystal structure of a nuclear receptor binding factor 2 mit domain (nrbf2) from homo sapiens at 1.50 a resolution
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
84
structure length
84
Chain Sequence
GMEGPLNLAHQQSRRADRLLAAGKYEEAISCHKKAAAYLSEAMKLTQSEQAHLSLELQRDSHMKQLLLIQERWKRAQREERLKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription regulator
molecule keywords Nuclear receptor-binding factor 2
publication title Crystal structure of a nuclear receptor binding factor 2 MIT domain (NRBF2) from Homo sapiens at 1.50 A resolution
rcsb
source organism Homo sapiens
total genus 31
structure length 84
sequence length 84
ec nomenclature
pdb deposition date 2015-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17169 NRBF2_MIT MIT domain of nuclear receptor-binding factor 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.280 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Hypothetical protein 1500032h18. 4zeyA00
2V6YA 3ZSTA 2RPAA 2CRBA 2JQKA 1WCRA 2MPKA 3ZSSA 2WWVA 5FVLA 5FVKA 4CN1A 4U2ZA 4U2YA 5LB7B 3EABA 3ZT7A 4U7IA 3K1SA 4ZEYA 1WFDA 4U33A 4U31A 2W2UA 1YXRA 2V6YB 2JQHA 2JQ9A 4WZXA 4IT4A 2A9UA 2DL1A 2WY2A 3ZT5A 2K3WA 4U7YA 5CGMA 2V6XA 2LRLA 2XZEA 4CN4A 1WR0A 4P1NA 2CPTA 5CJ5A 4U3CA 3ZT6A 4CN6A 2LRKA 4NIQA 4A5XA
chains in the Genus database with same CATH superfamily
5FXWA 1MIVA 1XMOT 2XY8B 3RYIE 3LK42 2UXXB 3UUMA 2FJBA 2D9DA 3M65A 5FP3A 4U33A 2NTXA 2LOPA 3HL6A 2WWUA 2EHOA 1NAFA 3ETUA 3RHWA 3QNUA 1Z0PA 4O2BE 1HNWT 2XQ4A 3I1AA 2WS3A 2JQKA 4DV1T 4C90A 4BJMA 4QX7B 5LCYA 2RA1A 2BVLA 4FI5A 3VHLA 2ODVA 2XAGB 3AEGA 5ETWA 5ABGA 5J2UE 5JR9C 1SE7A 2Z6EA 3RYCE 3JC6C 3KDSE 5LNKA 4E7ZA 3FBLA 5FMNA 4UR9A 4AQGA 1KNPA 5FXZA 5JDQA 5JDMA 4UF0B 3AXJA 2XQ6A 3VR9A 3AVSA 4JV5T 2BVMA 2IC6A 3NRYA 1WFDA 5JTGA 2DHRA 4IE4A 4LF9T 2IHR1 2DLRA 2YN6A 3CWZB 4I4TE 4HWFA 4YTPA 3LBXA 2XQ7A 3ONLC 2V6YA 2G0UA 3O1JA 4P0BA 2IMLA 4DIDB 1I6ZA 4ISTA 4X5TA 4U72A 2KSRA 4ANJA 4MBQA 4MALA 3EVYA 3UFEA 3KVBA 4ZZBA 5LA6E 1KFYA 3GMIA 4YHJA 1U5PA 2CBIA 2E9XC 2LT3A 1W0AA 3HKCE 4JI5T 4COFA 2BS3A 4UELA 2H88A 2OLTA 5EK2A 2YU1A 5LMNT 3FZHB 4X65T 4LF8T 3EHZA 2BS2A 1OEDA 3MACA 5M4YA 4PK5A 2X0YA 3PUWF 3WI3A 3GN5A 3FZLB 4WYVA 4Z8XA 2JQQA 4TWHA 4CN6A 4LF5T 4EIWA 3NZQA 2NW7A 3WAJA 3AE2A 2BBJA 3RPUA 3SFEA 1YKEB 4LF4T 2VB6A 2VKJA 2HPLA 4BAYB 4XBFB 3PJAJ 4JUYA 2Y8DA 1OEDE 2UUAT 4H63H 4F6RC 2I6HA 3TLWA 3QK6A 2BDEA 3J9X1 3PURA 3P4SA 4YJ2E 3Q5WA 2EHOC 2LSKA 3AVRA 4O8SA 5J2TE 2XM2A 1M7KA 4X64T 3CX6B 4KX6A 4ZI2D 4CXWA 2YU2A 5HAXA 4TWDA 3UU4A 1XNRT 2WMOA 4DMVA 4I50E 2JQHA 3ANWA 5L4EA 3UUXB 2LHRA 1IBKT 4HWHA 4EAHA 3R6NA 2QA7A 2B76A 2XQAA 5HWXA 4DR3T 3JADA 3ZKRA 1CHUA 1YW0A 4EXTA 3ABVA 4ZEYA 4U7IA 2FUPA 3KV6A 3RKOA 3AEEA 2LM9A 4EYUA 3ZEFB 3OKQA 3L3PA 4JI2T 3RIUC 1JNZA 3V5SA 1BR2A 4PFPA 3ZT6A 1S94A 4UVAB 5AQFB 3N2OA 3AE7A 3PUVF 2XPKA 5HEOA 3IA3A 1QLBA 4LF6T 4H9SE 4K0UA 3UU6A 3CMLA 2HN1A 4LMKA 3K3OA 1KEYA 3I0QA 2YK0A 2BKPA 1XNQT 2E5VA 4O2AE 2P9BA 3OYZA 5FXXA 2WU5A 3ETVA 3P4WA 4N78D 4ASKA 3UUNA 4V1Av 2V8SV 3FZKB 1MIYA 5AQOB 3UU3A 2W4XA 4O4IE 3SS1A 1DU2A 3CQXC 1GQEA 2LOSA 4IE7A 5CGMA 4GK0E 4L0RA 3O1IA 4DV2T 3ZMUB 5JREA 3IEEA 3AE5A 2BZBA 4QKNA 3ZSSA 5HYAA 4JI7T 2PBIA 2XAQB 1EZ3A 3AA1B 2PG8A 3ZT5A 4GKKT 2UXBT 1YKHB 2WSSV 2XQ5A 1E7PA 2VVNA 1O3XA 1ZHCA 4TV9E 3O1HA 2MPKA 3P4RA 4DV3T 3UFGA 2XAHB 4QWNB 2C5JA 4IHJE 3IBPA 1YD8G 4QXCB 2C5KT 4AQFC 1HG2A 4DUZT 3BK9A 2CHOA 5LJNA 2ZMAA 3PUAA 5FL0A 5KXJA 3F2EA 5CA1E 3EABA 3BQLA 4YY3T 3FZFB 5FXVA 2WBLA 3M3ZB 1UURA 3C4XA 3ESLA 3Q5XA 2HPJA 1HTJF 3P4QA 1UGOA 2MYSA 4YLHA 5GONE 4LFBT 4LFAT 3Q2MA 3KV5A 1R8IA 4AISA 1Z8UA 2Q9QC 3F57A 5ABHA 3RGLA 1MMAA 5CA0E 2XQYA 2E9XB 4EB6E 2VVSA 4PAGA 4TX5A 5C8YE 1ZKEA 4A56A 4ZI3D 3ZC0A 3U78A 3LJCA 2WMNA 3LG7A 2JMHA 3CPZA 2FJAA 4YTMA 3Q9DA 1W0BA 2J1DG 2XAFB 3I9YA 5LG3A 2ZM6T 5CJ5A 4DUYT 3AE1A 4ILAA 3VU7H 4GK5E 3SFDA 1L0VA 5HEHA 2OA5A 4WBOA 4CI3B 4ZHQE 2XQ8A 1MMGA 4HFHA 2J47A 2Y48B 3ZMTB 3B57A 5HXSA 5JDNA 3ZYLA 5AQVB 3H37A 3AE4A 2X9HA 1IBLT 3ZMZB 2LE8A 4TWFA 2WZHA 2ZM0A 2L9QA 4GYSA 5J0ZA 4TN7B 4DV4T 2PFVA 1YQ3A 4Z91A 3VKGA 4HFIA 1MMNA 5LG4A 4UIGA 4ZZCA 2MTQA 3FXEB 4PJLA 5IWAT 2NTYA 3PUZF 1D1AA 3N9NA 3GA8A 3RH3A 5DQVA 4Z90A 3T8OA 2DI4A 3AECA 5L3GB 5L3FB 4ADZA 2YINA 4QXBB 2CWOA 2DL1A 4TV8E 4NUVA 5JDHA 3ZCJA 5F8PA 2HH7A 3AE6A 3HR0A 4GOUA 3PU3A 4P0AA 2X9YA 2KINB 1SHZC 4QXHB 4X20E 4O4LE 5L3CB 3SWHA 4UV8B 3RQWA 4AKHA 1J5ET 4BA9A 3FHNA 2WWVA 2V1DB 2K48A 5L3DB 1HNXT 2HHHT 2VURA 3HKEE 4FJOA 2BG9B 1FMWA 3FB2A 3ZYKA 2CCQA 2DWKA 2IC9A 1X79A 4Q25A 4WBNE 4O4HE 4DBRA 4ILCA 4MFRA 2IDOB 3ZN1B 3AA0B 1ZOYA 3ZT7A 4HKAA 4GYRA 1WR6A 2A9UA 3N9OA 4B3RT 3LK3B 3P50A 4HFDA 5BR8T 4IDZA 2MOZA 2UU9T 4ZI2C 2ES0A 2CRBA 1FEWA 1J1JA 4ERRA 3ZJ2A 2LSIA 2QYWA 5JRCB 3Q5DA 5ABEA 3AAEB 4UF0A 4AKLA 2LM2A 3ZN0B 2NWBA 3E08A 1KK7A 5EK3A 2X67A 2CHNA 2PJQA 2W2UA 3PJAA 3MKDA 4UVCB 4YSXA 3VRBA 2K3WA 2CLYC 1VRBA 3O4XE 4EYYR 5HXCA 3KFWX 2V7MA 1NEKA 2H89A 1ZP0A 4DV6T 4C91A 4NPPA 3A5XA 1WLXA 3X1DA 2ZM2A 5CFBA 3H3AA 2CBJA 4U31A 3L09A 3RQUA 3IF8B 2WZIA 2JQ9A 2LSYA 1T98A 1VCTA 2XZEA 2BG9E 4L9IA 3MZKB 1WYCA 5HXRA 3PTRB 3TLSA 1S35A 4M1PA 1T8BA 4OHFA 2Y6XA 3OVUA 3PV0F 3UU8A 5F3JA 2VL0A 4ZOLE 2JIWA 3P8CD 3CQGB 3EDVA 5ABFB 2DCFA 4GKJT 4JI6T 2J62A 4L5GA 4G63A 5LB7B 2AXDS 1U4QA 2CE7A 4IGUA 4JYAT 4B6XA 2E8IA 3QOFA 2VK9A 2KWIB 4G2AA 4U74A 4KHPT 5LP6E 3Q5EA 5H6RB 5AQQB 2IW5B 2M6BA 2YDQA 4DMWA 1IZNB 4KBMB 4UEMA 2E9XD 3F31A 2YDRA 2H7OA 3QB5K 5KX5E 3UQ7A 2CXDA 3HA4A 2QGSA 3ZC1A 4DR6T 4YT0A 2F4VT 2LKGA 5F5WA 3I9WA 4XAXB 4QHOA 3AEFA 1T72A 4WW0A 5L3EB 3S4UA 3RC3A 5FVKA 4HE8A 4U2YA 5ABFA 4EV6A 2JMKA 3K1SA 2VKOA 3AB3B 4YSYA 3K3QC 2QRXA 3RX6A 4DR7T 2H3RA 3AE8A 4A98A 4HEAA 4H9RC 3PUXF 4EZHA 5BMVE 2YEVC 5HEJA 1N33T 3N2KE 4LFCT 3CX8B 1BR4A 4EZ4A 4NXNT 2W0GA 1US7B 3PU8A 2WB5A 1OEDC 4IE5A 5LOVE 2V5DA 4IDNA 2VWAA 1YQ4A 2WM9A 2CPTA 4NUUA 1XDPA 4A5XA 2LLYA 2V5CA 3RI5A 4CI1B 4IDQA 3UULA 4ZI3C 4MHCA 2W62A 5C3JA 3KV9A 3T1YT 5LBMA 2V7JA 2L3LA 4CZZB 3D0TA 2V7KA 3AEDA 4YXDA 2KMFA 4CXXA 3IHRA 5JR9B 3UT5E 4PK6A 3C51A 5AQTB 2IIUA 1N34T 2CEAA 1N32T 2WQYA 3AA7B 3UUBA 1LVKA 1XZYA 4JEHB 3C98B 1D0ZA 5EK4A 4OYJA 4OX9T 1UX5A 3CK6A 4H9NC 2CM0A 1FJGT 2W61A 4U2ZA 4PFOA 4X1KE 3U3IA 5JDGA 1MNDA 4QX8B 3BQKA 1D1BA 3C4ZA 1JNRA 4DV7T 4HWDA 5HEGA 4CQIA 4PW8A 2VL8A 2UUBT 4X62T 3JCFA 1W9RA 2MBGA 5TAOA 2N9DA 2BKOA 2SPCA 4O4JE 5LGUB 5A1LA 1BR0A 2V7IA 4E7SA 5HWYA 2NR4A 2WAUA 3PUSA 2JJ9A 3C50A 3O9XA 3VKHA 3PUGA 1XWMA 4YHHT 1CUNA 2ACXA 5DABA 2ZM8A 4EOZB 1XDOA 1SUMB 2D5UA 4X66T 5AQSB 4HFVA 2D2SA 2XM1A 3QC9A 2V7LA 2CLYB 4B3ST 2BBHA 1VCSA 3A8YC 4HFBA 5FKYA 1M62A 4DVDA 5LBQB 1MMDA 1E2AA 5L47A 2UXDT 2W63A 2BS4A 5L2LA 2XQ3A 5DQWA 2RPAA 2E9XA 4DR2T 5H6QB 2X0LB 2UXNB 5FY7A 1UK5A 3AE9A 4H9OC 2YOEA 3N9QA 2CA5A 3DJBA 4KI0F 4U7YA 4P09A 3VR8A 3P7IA 2XSBA 3RIFA 1D0XA 3R84B 2WP9A 2EHOB 1HX8A 4AKRB 3PE0A 3RLFF 1ZEEA 4EGWA 2YKSA 4F8HA 2K5BB 1KNZA 4X1YE 3PDYA 3WAKA 2LHNA 4QH5A 3E0ZA 4JLEA 4YFSA 1LKXA 3N9LA 2VQET 5HEUA 4H9QC 1WCRA 2HN2A 3HKDE 5JQGE 3UU5A 2KT9A 4ILBA 5LGNB 3AXJB 2X9XA 2X51A 1I94T 1UCUA 2XSAA 1IJ6A 2M67A 3C64A 1D1CA 5AQRB 1N36T 1MIWA 3RYFE 3TLTA 4YTNA 3N9MA 3LBXB 2W67A 3L39A 2CXFA 2V6YB 2XAJB 3I0OA 3DP7A 2E2AA 5AQMB 1YXRA 3RIAA 5IUXA 4IT4A 2V6XA 2DNXA 1HCIA 4CI2B 3AAAB 2K24A 4IREA 3CVRA 4H63V 2KWHA 4TNWA 2NP9A 4I55E 4DV0T 4HWCA 5FYMA 5ADXL 2A72A 3NVOA 2JPFA 3QUJA 2KNDA 3RIUA 3ZMSB 4KP3C 4HFCA 5AQJB 5CB4E 2ZLYA 1V9DA 5HXHA 1OEDB 2VKDA 4IIJE 1HG5A 4IL9A 3GN5B 4I0UA 4IDOA 2DWGA 3ONJA 2L8KA 3FZMB 4ZI7E 5E0OA 2H7VC 4IE0A 4PJJA 3RC8A 3B5MA 3RRCA 2XASB 1MNEA 4XZCA 2OV9A 1VOMA 2I59A 3CQCB 3SRZA 4MLKA 4OFZA 1G8XA 4TUYE 2BG9A 1UX4A 3EUHA 5IHYA 5LJMA 3G06A 2XHEB 4LF7T 5KDMC 4ZS2A 3RRWA 3BQIA 3OJAA 4P1NA 2GK9A 1HF8A 1OXZA 4AQYT 2A3DA 3T1HT 4I43B 4OK0A 2XQ9A 5L4HA 5HCJA 4DBQA 4IDPA 3TKLB 3JC6D 4TZ4C 3DTOA 5L3BB 3ONXA 3KV4A 3MJXA 3ANWB 3FXDB 5JRCA 5LGTB 1HFAA 3OPCA 1WRDA 3KINB 1HS7A 2LEHA 4AXPA 5LHGB 2Q9QB 4UXNB 2UXCT 1E1HB 2LSGA 2BKNA 1HNZT 4B3MT 3CKDA 4HFEA 2N2NA 4AQFA 2LSJA 3HI2A 2NW9A 3KBTA 2WCAA 1X9BA 4HGAA 3RYHE 4DR4T 2XTLA 3N5LA 1OWAA 5DJQC 3EI0A 3H3MA 1KNRA 5LHIB 1G73A 5AQPB 2LRLA 3EDUA 3CIRA 2FJDA 3ZCIA 1KF6A 4PJMA 2C5IT 1NWMX 5AQIB 3LDQB 1W09A 5KMGP 4KMCA 2ACZA 5FVLA 2Q9QA 2KZ7B 3AEAA 3NWIA 5JDLA 5HXEA 4GIWA 4PNIA 4LMJA 2PTFA 2JRKA 4U3CA 3N9PA 3LK2B 2UUCT 1J5WA 2QVAA 2R6GF 3JAEA 1AJ3A 1QUUA 1ZV4X 2W66A 3ZLIA 4ILUA 1Y01A 5LMUT 1WR0A 5AQUB 4EEDA 2IUBA 2BG9C 4UVBB 2IAKA 3AE3A 2NOXA 5FNVE 5AQNB 2EHOD 4WNKA 3OYXA 5J1GA 4TNVA 1Y64B 4QH4A 2ODUA 3KVAA 2KXPB 5FY1A 1XMQT 3ZPOA 1BR1A 4H9PC 2FBWA 2WY2A 1HX1B 3CX7B 2N1GA 4KHZF 4DR5T 4JBWF 4NXMT 3A7MA 1WYBA 3RF1A 4PK4A 5LYJE 4KUMB 3ZMVB 3P4PA 2VASA 1IBMT 3TLVA 3JAFA 3W15B 3AAIA 5AQHB 2W00A 3LSVA 3UTKA 2C0SA 5LXTE 1FMVA 3MA9A 4HN9A 4CXYA 4DR1T 2J4GA 3V5UA 4X1IE 2AE9A 2K9AA 5AQKB 2CXLA 4AKIA 2VQFT 3TLUA 5AQGB 3J7Yq 1D0YA 5LHHB 4ISSA 4JI8T 4QH1A 3FBZA 4NIQA 4DV5T 2LJLA 3NKZA 4PJNA 1H7CA 3N2GE 5FY0A 5JR9A 4WZXA 3VRAA 3K8PC 5IYZE 4LMLA 4CN4A 1IJ5A 3LFMA 2LKHA 5JH7E 2M6IA 4JI1T 4IE6A 3HKBE 2WDVA 1QSDA 4AKGA 2NW8A 4HTEA 2D0TA 4JEUB 2A2FX 4JI4T 2VKHA 4UV9B 4IL4A 3AA6B 1HR0T 2CMRA 4HWIB 4DNDA 1SA0E 3NRXA 1LVFA 4A97A 4J2CA 3B13A 2X66A 1NENA 5HCMA 2WU2A 3PUQA 3EAMA 2X0HA 1IAPA 3NBXX 2RP4A 4YSZA 2KLQA 3AEBA 3E22E 1FIOA 5AFUL 2XUEA 3ZSTA 3QB5A 3KBUA 2V26A 3ZJ1A 3K3NA 2X68A 5C2TA 3OTOT 5JVDE 3ZYMA 3UQ4A 4B3TT 5JDFA 4AIUA 4JI3T 4CN1A 3NZPA 1T7SA 2YDSA 2B1EA 5FL1A 2WDQA 2E5LT 1B7TA 5EZYE 4DO0A 2I0MA 4AI6A 2WDRA 2LRKA 3GWHA 2MAWA 4ZS3A 4YJ3E 3SOLA 3C4WA 2D0UA 4EEBA 4K0KT 2Q9QD 3MK7C 4OYKA 2FJEA 2X9WA 3PUYF 4BJNA 3OBVE 3RKGA 2CWYA 4JI0T 4ZXLA 2XJ7A 1UUSA 1LRZA 5AQLB 3MXZA 3L8RA
chains in the Genus database with same CATH topology
2V6YA 3ZSTA 2RPAA 2CRBA 2JQKA 1WCRA 2MPKA 3ZSSA 2WWVA 5FVLA 5FVKA 4CN1A 4U2ZA 4U2YA 5LB7B 3EABA 3ZT7A 4U7IA 3K1SA 4ZEYA 1WFDA 4U33A 4U31A 2W2UA 1YXRA 2V6YB 2JQHA 2JQ9A 4WZXA 4IT4A 2A9UA 2DL1A 2WY2A 3ZT5A 2K3WA 4U7YA 5CGMA 2V6XA 2LRLA 2XZEA 4CN4A 1WR0A 4P1NA 2CPTA 5CJ5A 4U3CA 3ZT6A 4CN6A 2LRKA 4NIQA 4A5XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2V6Y A;  3ZST A;  2RPA A;  2CRB A;  2JQK A;  1WCR A;  2MPK A;  3ZSS A;  2WWV A;  5FVL A;  5FVK A;  4CN1 A;  4U2Z A;  4U2Y A;  5LB7 B;  3EAB A;  3ZT7 A;  4U7I A;  3K1S A;  4ZEY A;  1WFD A;  4U33 A;  4U31 A;  2W2U A;  1YXR A;  2V6Y B;  2JQH A;  2JQ9 A;  4WZX A;  4IT4 A;  2A9U A;  2DL1 A;  2WY2 A;  3ZT5 A;  2K3W A;  4U7Y A;  5CGM A;  2V6X A;  2LRL A;  2XZE A;  4CN4 A;  1WR0 A;  4P1N A;  2CPT A;  5CJ5 A;  4U3C A;  3ZT6 A;  4CN6 A;  2LRK A;  4NIQ A;  4A5X A; 
#chains in the Genus database with same CATH topology
 5FXW A;  1MIV A;  1XMO T;  2XY8 B;  3RYI E;  3LK4 2;  2UXX B;  3UUM A;  2FJB A;  2D9D A;  3M65 A;  5FP3 A;  4U33 A;  2NTX A;  2LOP A;  3HL6 A;  2WWU A;  2EHO A;  1NAF A;  3ETU A;  3RHW A;  3QNU A;  1Z0P A;  4O2B E;  1HNW T;  2XQ4 A;  3I1A A;  2WS3 A;  2JQK A;  4DV1 T;  4C90 A;  4BJM A;  4QX7 B;  5LCY A;  2RA1 A;  2BVL A;  4FI5 A;  3VHL A;  2ODV A;  2XAG B;  3AEG A;  5ETW A;  5ABG A;  5J2U E;  5JR9 C;  1SE7 A;  2Z6E A;  3RYC E;  3JC6 C;  3KDS E;  5LNK A;  4E7Z A;  3FBL A;  5FMN A;  4UR9 A;  4AQG A;  1KNP A;  5FXZ A;  5JDQ A;  5JDM A;  4UF0 B;  3AXJ A;  2XQ6 A;  3VR9 A;  3AVS A;  4JV5 T;  2BVM A;  2IC6 A;  3NRY A;  1WFD A;  5JTG A;  2DHR A;  4IE4 A;  4LF9 T;  2IHR 1;  2DLR A;  2YN6 A;  3CWZ B;  4I4T E;  4HWF A;  4YTP A;  3LBX A;  2XQ7 A;  3ONL C;  2V6Y A;  2G0U A;  3O1J A;  4P0B A;  2IML A;  4DID B;  1I6Z A;  4IST A;  4X5T A;  4U72 A;  2KSR A;  4ANJ A;  4MBQ A;  4MAL A;  3EVY A;  3UFE A;  3KVB A;  4ZZB A;  5LA6 E;  1KFY A;  3GMI A;  4YHJ A;  1U5P A;  2CBI A;  2E9X C;  2LT3 A;  1W0A A;  3HKC E;  4JI5 T;  4COF A;  2BS3 A;  4UEL A;  2H88 A;  2OLT A;  5EK2 A;  2YU1 A;  5LMN T;  3FZH B;  4X65 T;  4LF8 T;  3EHZ A;  2BS2 A;  1OED A;  3MAC A;  5M4Y A;  4PK5 A;  2X0Y A;  3PUW F;  3WI3 A;  3GN5 A;  3FZL B;  4WYV A;  4Z8X A;  2JQQ A;  4TWH A;  4CN6 A;  4LF5 T;  4EIW A;  3NZQ A;  2NW7 A;  3WAJ A;  3AE2 A;  2BBJ A;  3RPU A;  3SFE A;  1YKE B;  4LF4 T;  2VB6 A;  2VKJ A;  2HPL A;  4BAY B;  4XBF B;  3PJA J;  4JUY A;  2Y8D A;  1OED E;  2UUA T;  4H63 H;  4F6R C;  2I6H A;  3TLW A;  3QK6 A;  2BDE A;  3J9X 1;  3PUR A;  3P4S A;  4YJ2 E;  3Q5W A;  2EHO C;  2LSK A;  3AVR A;  4O8S A;  5J2T E;  2XM2 A;  1M7K A;  4X64 T;  3CX6 B;  4KX6 A;  4ZI2 D;  4CXW A;  2YU2 A;  5HAX A;  4TWD A;  3UU4 A;  1XNR T;  2WMO A;  4DMV A;  4I50 E;  2JQH A;  3ANW A;  5L4E A;  3UUX B;  2LHR A;  1IBK T;  4HWH A;  4EAH A;  3R6N A;  2QA7 A;  2B76 A;  2XQA A;  5HWX A;  4DR3 T;  3JAD A;  3ZKR A;  1CHU A;  1YW0 A;  4EXT A;  3ABV A;  4ZEY A;  4U7I A;  2FUP A;  3KV6 A;  3RKO A;  3AEE A;  2LM9 A;  4EYU A;  3ZEF B;  3OKQ A;  3L3P A;  4JI2 T;  3RIU C;  1JNZ A;  3V5S A;  1BR2 A;  4PFP A;  3ZT6 A;  1S94 A;  4UVA B;  5AQF B;  3N2O A;  3AE7 A;  3PUV F;  2XPK A;  5HEO A;  3IA3 A;  1QLB A;  4LF6 T;  4H9S E;  4K0U A;  3UU6 A;  3CML A;  2HN1 A;  4LMK A;  3K3O A;  1KEY A;  3I0Q A;  2YK0 A;  2BKP A;  1XNQ T;  2E5V A;  4O2A E;  2P9B A;  3OYZ A;  5FXX A;  2WU5 A;  3ETV A;  3P4W A;  4N78 D;  4ASK A;  3UUN A;  4V1A v;  2V8S V;  3FZK B;  1MIY A;  5AQO B;  3UU3 A;  2W4X A;  4O4I E;  3SS1 A;  1DU2 A;  3CQX C;  1GQE A;  2LOS A;  4IE7 A;  5CGM A;  4GK0 E;  4L0R A;  3O1I A;  4DV2 T;  3ZMU B;  5JRE A;  3IEE A;  3AE5 A;  2BZB A;  4QKN A;  3ZSS A;  5HYA A;  4JI7 T;  2PBI A;  2XAQ B;  1EZ3 A;  3AA1 B;  2PG8 A;  3ZT5 A;  4GKK T;  2UXB T;  1YKH B;  2WSS V;  2XQ5 A;  1E7P A;  2VVN A;  1O3X A;  1ZHC A;  4TV9 E;  3O1H A;  2MPK A;  3P4R A;  4DV3 T;  3UFG A;  2XAH B;  4QWN B;  2C5J A;  4IHJ E;  3IBP A;  1YD8 G;  4QXC B;  2C5K T;  4AQF C;  1HG2 A;  4DUZ T;  3BK9 A;  2CHO A;  5LJN A;  2ZMA A;  3PUA A;  5FL0 A;  5KXJ A;  3F2E A;  5CA1 E;  3EAB A;  3BQL A;  4YY3 T;  3FZF B;  5FXV A;  2WBL A;  3M3Z B;  1UUR A;  3C4X A;  3ESL A;  3Q5X A;  2HPJ A;  1HTJ F;  3P4Q A;  1UGO A;  2MYS A;  4YLH A;  5GON E;  4LFB T;  4LFA T;  3Q2M A;  3KV5 A;  1R8I A;  4AIS A;  1Z8U A;  2Q9Q C;  3F57 A;  5ABH A;  3RGL A;  1MMA A;  5CA0 E;  2XQY A;  2E9X B;  4EB6 E;  2VVS A;  4PAG A;  4TX5 A;  5C8Y E;  1ZKE A;  4A56 A;  4ZI3 D;  3ZC0 A;  3U78 A;  3LJC A;  2WMN A;  3LG7 A;  2JMH A;  3CPZ A;  2FJA A;  4YTM A;  3Q9D A;  1W0B A;  2J1D G;  2XAF B;  3I9Y A;  5LG3 A;  2ZM6 T;  5CJ5 A;  4DUY T;  3AE1 A;  4ILA A;  3VU7 H;  4GK5 E;  3SFD A;  1L0V A;  5HEH A;  2OA5 A;  4WBO A;  4CI3 B;  4ZHQ E;  2XQ8 A;  1MMG A;  4HFH A;  2J47 A;  2Y48 B;  3ZMT B;  3B57 A;  5HXS A;  5JDN A;  3ZYL A;  5AQV B;  3H37 A;  3AE4 A;  2X9H A;  1IBL T;  3ZMZ B;  2LE8 A;  4TWF A;  2WZH A;  2ZM0 A;  2L9Q A;  4GYS A;  5J0Z A;  4TN7 B;  4DV4 T;  2PFV A;  1YQ3 A;  4Z91 A;  3VKG A;  4HFI A;  1MMN A;  5LG4 A;  4UIG A;  4ZZC A;  2MTQ A;  3FXE B;  4PJL A;  5IWA T;  2NTY A;  3PUZ F;  1D1A A;  3N9N A;  3GA8 A;  3RH3 A;  5DQV A;  4Z90 A;  3T8O A;  2DI4 A;  3AEC A;  5L3G B;  5L3F B;  4ADZ A;  2YIN A;  4QXB B;  2CWO A;  2DL1 A;  4TV8 E;  4NUV A;  5JDH A;  3ZCJ A;  5F8P A;  2HH7 A;  3AE6 A;  3HR0 A;  4GOU A;  3PU3 A;  4P0A A;  2X9Y A;  2KIN B;  1SHZ C;  4QXH B;  4X20 E;  4O4L E;  5L3C B;  3SWH A;  4UV8 B;  3RQW A;  4AKH A;  1J5E T;  4BA9 A;  3FHN A;  2WWV A;  2V1D B;  2K48 A;  5L3D B;  1HNX T;  2HHH T;  2VUR A;  3HKE E;  4FJO A;  2BG9 B;  1FMW A;  3FB2 A;  3ZYK A;  2CCQ A;  2DWK A;  2IC9 A;  1X79 A;  4Q25 A;  4WBN E;  4O4H E;  4DBR A;  4ILC A;  4MFR A;  2IDO B;  3ZN1 B;  3AA0 B;  1ZOY A;  3ZT7 A;  4HKA A;  4GYR A;  1WR6 A;  2A9U A;  3N9O A;  4B3R T;  3LK3 B;  3P50 A;  4HFD A;  5BR8 T;  4IDZ A;  2MOZ A;  2UU9 T;  4ZI2 C;  2ES0 A;  2CRB A;  1FEW A;  1J1J A;  4ERR A;  3ZJ2 A;  2LSI A;  2QYW A;  5JRC B;  3Q5D A;  5ABE A;  3AAE B;  4UF0 A;  4AKL A;  2LM2 A;  3ZN0 B;  2NWB A;  3E08 A;  1KK7 A;  5EK3 A;  2X67 A;  2CHN A;  2PJQ A;  2W2U A;  3PJA A;  3MKD A;  4UVC B;  4YSX A;  3VRB A;  2K3W A;  2CLY C;  1VRB A;  3O4X E;  4EYY R;  5HXC A;  3KFW X;  2V7M A;  1NEK A;  2H89 A;  1ZP0 A;  4DV6 T;  4C91 A;  4NPP A;  3A5X A;  1WLX A;  3X1D A;  2ZM2 A;  5CFB A;  3H3A A;  2CBJ A;  4U31 A;  3L09 A;  3RQU A;  3IF8 B;  2WZI A;  2JQ9 A;  2LSY A;  1T98 A;  1VCT A;  2XZE A;  2BG9 E;  4L9I A;  3MZK B;  1WYC A;  5HXR A;  3PTR B;  3TLS A;  1S35 A;  4M1P A;  1T8B A;  4OHF A;  2Y6X A;  3OVU A;  3PV0 F;  3UU8 A;  5F3J A;  2VL0 A;  4ZOL E;  2JIW A;  3P8C D;  3CQG B;  3EDV A;  5ABF B;  2DCF A;  4GKJ T;  4JI6 T;  2J62 A;  4L5G A;  4G63 A;  5LB7 B;  2AXD S;  1U4Q A;  2CE7 A;  4IGU A;  4JYA T;  4B6X A;  2E8I A;  3QOF A;  2VK9 A;  2KWI B;  4G2A A;  4U74 A;  4KHP T;  5LP6 E;  3Q5E A;  5H6R B;  5AQQ B;  2IW5 B;  2M6B A;  2YDQ A;  4DMW A;  1IZN B;  4KBM B;  4UEM A;  2E9X D;  3F31 A;  2YDR A;  2H7O A;  3QB5 K;  5KX5 E;  3UQ7 A;  2CXD A;  3HA4 A;  2QGS A;  3ZC1 A;  4DR6 T;  4YT0 A;  2F4V T;  2LKG A;  5F5W A;  3I9W A;  4XAX B;  4QHO A;  3AEF A;  1T72 A;  4WW0 A;  5L3E B;  3S4U A;  3RC3 A;  5FVK A;  4HE8 A;  4U2Y A;  5ABF A;  4EV6 A;  2JMK A;  3K1S A;  2VKO A;  3AB3 B;  4YSY A;  3K3Q C;  2QRX A;  3RX6 A;  4DR7 T;  2H3R A;  3AE8 A;  4A98 A;  4HEA A;  4H9R C;  3PUX F;  4EZH A;  5BMV E;  2YEV C;  5HEJ A;  1N33 T;  3N2K E;  4LFC T;  3CX8 B;  1BR4 A;  4EZ4 A;  4NXN T;  2W0G A;  1US7 B;  3PU8 A;  2WB5 A;  1OED C;  4IE5 A;  5LOV E;  2V5D A;  4IDN A;  2VWA A;  1YQ4 A;  2WM9 A;  2CPT A;  4NUU A;  1XDP A;  4A5X A;  2LLY A;  2V5C A;  3RI5 A;  4CI1 B;  4IDQ A;  3UUL A;  4ZI3 C;  4MHC A;  2W62 A;  5C3J A;  3KV9 A;  3T1Y T;  5LBM A;  2V7J A;  2L3L A;  4CZZ B;  3D0T A;  2V7K A;  3AED A;  4YXD A;  2KMF A;  4CXX A;  3IHR A;  5JR9 B;  3UT5 E;  4PK6 A;  3C51 A;  5AQT B;  2IIU A;  1N34 T;  2CEA A;  1N32 T;  2WQY A;  3AA7 B;  3UUB A;  1LVK A;  1XZY A;  4JEH B;  3C98 B;  1D0Z A;  5EK4 A;  4OYJ A;  4OX9 T;  1UX5 A;  3CK6 A;  4H9N C;  2CM0 A;  1FJG T;  2W61 A;  4U2Z A;  4PFO A;  4X1K E;  3U3I A;  5JDG A;  1MND A;  4QX8 B;  3BQK A;  1D1B A;  3C4Z A;  1JNR A;  4DV7 T;  4HWD A;  5HEG A;  4CQI A;  4PW8 A;  2VL8 A;  2UUB T;  4X62 T;  3JCF A;  1W9R A;  2MBG A;  5TAO A;  2N9D A;  2BKO A;  2SPC A;  4O4J E;  5LGU B;  5A1L A;  1BR0 A;  2V7I A;  4E7S A;  5HWY A;  2NR4 A;  2WAU A;  3PUS A;  2JJ9 A;  3C50 A;  3O9X A;  3VKH A;  3PUG A;  1XWM A;  4YHH T;  1CUN A;  2ACX A;  5DAB A;  2ZM8 A;  4EOZ B;  1XDO A;  1SUM B;  2D5U A;  4X66 T;  5AQS B;  4HFV A;  2D2S A;  2XM1 A;  3QC9 A;  2V7L A;  2CLY B;  4B3S T;  2BBH A;  1VCS A;  3A8Y C;  4HFB A;  5FKY A;  1M62 A;  4DVD A;  5LBQ B;  1MMD A;  1E2A A;  5L47 A;  2UXD T;  2W63 A;  2BS4 A;  5L2L A;  2XQ3 A;  5DQW A;  2RPA A;  2E9X A;  4DR2 T;  5H6Q B;  2X0L B;  2UXN B;  5FY7 A;  1UK5 A;  3AE9 A;  4H9O C;  2YOE A;  3N9Q A;  2CA5 A;  3DJB A;  4KI0 F;  4U7Y A;  4P09 A;  3VR8 A;  3P7I A;  2XSB A;  3RIF A;  1D0X A;  3R84 B;  2WP9 A;  2EHO B;  1HX8 A;  4AKR B;  3PE0 A;  3RLF F;  1ZEE A;  4EGW A;  2YKS A;  4F8H A;  2K5B B;  1KNZ A;  4X1Y E;  3PDY A;  3WAK A;  2LHN A;  4QH5 A;  3E0Z A;  4JLE A;  4YFS A;  1LKX A;  3N9L A;  2VQE T;  5HEU A;  4H9Q C;  1WCR A;  2HN2 A;  3HKD E;  5JQG E;  3UU5 A;  2KT9 A;  4ILB A;  5LGN B;  3AXJ B;  2X9X A;  2X51 A;  1I94 T;  1UCU A;  2XSA A;  1IJ6 A;  2M67 A;  3C64 A;  1D1C A;  5AQR B;  1N36 T;  1MIW A;  3RYF E;  3TLT A;  4YTN A;  3N9M A;  3LBX B;  2W67 A;  3L39 A;  2CXF A;  2V6Y B;  2XAJ B;  3I0O A;  3DP7 A;  2E2A A;  5AQM B;  1YXR A;  3RIA A;  5IUX A;  4IT4 A;  2V6X A;  2DNX A;  1HCI A;  4CI2 B;  3AAA B;  2K24 A;  4IRE A;  3CVR A;  4H63 V;  2KWH A;  4TNW A;  2NP9 A;  4I55 E;  4DV0 T;  4HWC A;  5FYM A;  5ADX L;  2A72 A;  3NVO A;  2JPF A;  3QUJ A;  2KND A;  3RIU A;  3ZMS B;  4KP3 C;  4HFC A;  5AQJ B;  5CB4 E;  2ZLY A;  1V9D A;  5HXH A;  1OED B;  2VKD A;  4IIJ E;  1HG5 A;  4IL9 A;  3GN5 B;  4I0U A;  4IDO A;  2DWG A;  3ONJ A;  2L8K A;  3FZM B;  4ZI7 E;  5E0O A;  2H7V C;  4IE0 A;  4PJJ A;  3RC8 A;  3B5M A;  3RRC A;  2XAS B;  1MNE A;  4XZC A;  2OV9 A;  1VOM A;  2I59 A;  3CQC B;  3SRZ A;  4MLK A;  4OFZ A;  1G8X A;  4TUY E;  2BG9 A;  1UX4 A;  3EUH A;  5IHY A;  5LJM A;  3G06 A;  2XHE B;  4LF7 T;  5KDM C;  4ZS2 A;  3RRW A;  3BQI A;  3OJA A;  4P1N A;  2GK9 A;  1HF8 A;  1OXZ A;  4AQY T;  2A3D A;  3T1H T;  4I43 B;  4OK0 A;  2XQ9 A;  5L4H A;  5HCJ A;  4DBQ A;  4IDP A;  3TKL B;  3JC6 D;  4TZ4 C;  3DTO A;  5L3B B;  3ONX A;  3KV4 A;  3MJX A;  3ANW B;  3FXD B;  5JRC A;  5LGT B;  1HFA A;  3OPC A;  1WRD A;  3KIN B;  1HS7 A;  2LEH A;  4AXP A;  5LHG B;  2Q9Q B;  4UXN B;  2UXC T;  1E1H B;  2LSG A;  2BKN A;  1HNZ T;  4B3M T;  3CKD A;  4HFE A;  2N2N A;  4AQF A;  2LSJ A;  3HI2 A;  2NW9 A;  3KBT A;  2WCA A;  1X9B A;  4HGA A;  3RYH E;  4DR4 T;  2XTL A;  3N5L A;  1OWA A;  5DJQ C;  3EI0 A;  3H3M A;  1KNR A;  5LHI B;  1G73 A;  5AQP B;  2LRL A;  3EDU A;  3CIR A;  2FJD A;  3ZCI A;  1KF6 A;  4PJM A;  2C5I T;  1NWM X;  5AQI B;  3LDQ B;  1W09 A;  5KMG P;  4KMC A;  2ACZ A;  5FVL A;  2Q9Q A;  2KZ7 B;  3AEA A;  3NWI A;  5JDL A;  5HXE A;  4GIW A;  4PNI A;  4LMJ A;  2PTF A;  2JRK A;  4U3C A;  3N9P A;  3LK2 B;  2UUC T;  1J5W A;  2QVA A;  2R6G F;  3JAE A;  1AJ3 A;  1QUU A;  1ZV4 X;  2W66 A;  3ZLI A;  4ILU A;  1Y01 A;  5LMU T;  1WR0 A;  5AQU B;  4EED A;  2IUB A;  2BG9 C;  4UVB B;  2IAK A;  3AE3 A;  2NOX A;  5FNV E;  5AQN B;  2EHO D;  4WNK A;  3OYX A;  5J1G A;  4TNV A;  1Y64 B;  4QH4 A;  2ODU A;  3KVA A;  2KXP B;  5FY1 A;  1XMQ T;  3ZPO A;  1BR1 A;  4H9P C;  2FBW A;  2WY2 A;  1HX1 B;  3CX7 B;  2N1G A;  4KHZ F;  4DR5 T;  4JBW F;  4NXM T;  3A7M A;  1WYB A;  3RF1 A;  4PK4 A;  5LYJ E;  4KUM B;  3ZMV B;  3P4P A;  2VAS A;  1IBM T;  3TLV A;  3JAF A;  3W15 B;  3AAI A;  5AQH B;  2W00 A;  3LSV A;  3UTK A;  2C0S A;  5LXT E;  1FMV A;  3MA9 A;  4HN9 A;  4CXY A;  4DR1 T;  2J4G A;  3V5U A;  4X1I E;  2AE9 A;  2K9A A;  5AQK B;  2CXL A;  4AKI A;  2VQF T;  3TLU A;  5AQG B;  3J7Y q;  1D0Y A;  5LHH B;  4ISS A;  4JI8 T;  4QH1 A;  3FBZ A;  4NIQ A;  4DV5 T;  2LJL A;  3NKZ A;  4PJN A;  1H7C A;  3N2G E;  5FY0 A;  5JR9 A;  4WZX A;  3VRA A;  3K8P C;  5IYZ E;  4LML A;  4CN4 A;  1IJ5 A;  3LFM A;  2LKH A;  5JH7 E;  2M6I A;  4JI1 T;  4IE6 A;  3HKB E;  2WDV A;  1QSD A;  4AKG A;  2NW8 A;  4HTE A;  2D0T A;  4JEU B;  2A2F X;  4JI4 T;  2VKH A;  4UV9 B;  4IL4 A;  3AA6 B;  1HR0 T;  2CMR A;  4HWI B;  4DND A;  1SA0 E;  3NRX A;  1LVF A;  4A97 A;  4J2C A;  3B13 A;  2X66 A;  1NEN A;  5HCM A;  2WU2 A;  3PUQ A;  3EAM A;  2X0H A;  1IAP A;  3NBX X;  2RP4 A;  4YSZ A;  2KLQ A;  3AEB A;  3E22 E;  1FIO A;  5AFU L;  2XUE A;  3ZST A;  3QB5 A;  3KBU A;  2V26 A;  3ZJ1 A;  3K3N A;  2X68 A;  5C2T A;  3OTO T;  5JVD E;  3ZYM A;  3UQ4 A;  4B3T T;  5JDF A;  4AIU A;  4JI3 T;  4CN1 A;  3NZP A;  1T7S A;  2YDS A;  2B1E A;  5FL1 A;  2WDQ A;  2E5L T;  1B7T A;  5EZY E;  4DO0 A;  2I0M A;  4AI6 A;  2WDR A;  2LRK A;  3GWH A;  2MAW A;  4ZS3 A;  4YJ3 E;  3SOL A;  3C4W A;  2D0U A;  4EEB A;  4K0K T;  2Q9Q D;  3MK7 C;  4OYK A;  2FJE A;  2X9W A;  3PUY F;  4BJN A;  3OBV E;  3RKG A;  2CWY A;  4JI0 T;  4ZXL A;  2XJ7 A;  1UUS A;  1LRZ A;  5AQL B;  3MXZ A;  3L8R A; 
#chains in the Genus database with same CATH homology
 2V6Y A;  3ZST A;  2RPA A;  2CRB A;  2JQK A;  1WCR A;  2MPK A;  3ZSS A;  2WWV A;  5FVL A;  5FVK A;  4CN1 A;  4U2Z A;  4U2Y A;  5LB7 B;  3EAB A;  3ZT7 A;  4U7I A;  3K1S A;  4ZEY A;  1WFD A;  4U33 A;  4U31 A;  2W2U A;  1YXR A;  2V6Y B;  2JQH A;  2JQ9 A;  4WZX A;  4IT4 A;  2A9U A;  2DL1 A;  2WY2 A;  3ZT5 A;  2K3W A;  4U7Y A;  5CGM A;  2V6X A;  2LRL A;  2XZE A;  4CN4 A;  1WR0 A;  4P1N A;  2CPT A;  5CJ5 A;  4U3C A;  3ZT6 A;  4CN6 A;  2LRK A;  4NIQ A;  4A5X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...