3UTKA

Structure of the pilotin of the type ii secretion system
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
95
structure length
95
Chain Sequence
VPANEQISQLASLVAASKYLRVQCERSDLPDDGTILKTAVNVAVQKGWDTGRYQSLPQLSENLYQGLLKDGTPKATQCSSFNRTMTPFLDAMRTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein transport
molecule keywords Lipoprotein outS
publication title Structure of the pilotin of the type II secretion system
rcsb
source organism Dickeya dadantii
total genus 34
structure length 95
sequence length 95
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09691 T2SS_PulS_OutS Type II secretion system pilotin lipoprotein (PulS_OutS)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1630 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3utkA00
3SOLA 3UTKA 4A56A 4K0UA
chains in the Genus database with same CATH superfamily
2HPJA 2LSGA 4ASKA 4OK0A 2DHRA 5LHIB 3N9OA 4ZI3C 4P1NA 3VU7H 4DV4T 1HG5A 2XPKA 4WZXA 2KWHA 2CEAA 5EK2A 2G0UA 1QSDA 3ZSTA 5FXXA 1SUMB 2BKPA 4H63V 1IBLT 5JDGA 4TNWA 1HX1B 2LEHA 5LBMA 4PK4A 3LK3B 3NZPA 4DR1T 3CMLA 5IYZE 5EK3A 4AQGA 3RQUA 2XQYA 4DVDA 1UX5A 1IJ6A 3UU4A 4X64T 5L3EB 3RPUA 5LG4A 1G8XA 3C4XA 2HN2A 3OTOT 3RHWA 4HFBA 1WFDA 3PV0F 2CHNA 3CQXC 5JDHA 4CXXA 4UVBB 5ABFA 5AQRB 2DL1A 4EXTA 2WS3A 4X66T 4YTMA 2Z6EA 3T8OA 5JRCB 2W67A 3P4WA 5CFBA 3OJAA 4KHPT 4JI8T 5L47A 3LK42 3T1YT 5HYAA 4QH4A 4ZI3D 4A5XA 1D1AA 2KMFA 4HWCA 4TNVA 4BJMA 4DBQA 4PW8A 2VL0A 2FJDA 2ZLYA 4YSXA 1MNEA 4IL4A 4WYVA 2CE7A 3NKZA 5AQOB 2YN6A 3UUBA 4GYSA 1DU2A 3HKEE 3J7Yq 2A9UA 1Z0PA 5HXCA 3MACA 2JMHA 3NWIA 2WZHA 4NUVA 4DR4T 3P4PA 2X0LB 3JCFA 2RP4A 2N1GA 3ZYKA 3FXDB 4YHHT 4TZ4C 1HS7A 2CPTA 5AQMB 1NAFA 2VL8A 4LFBT 3ZN1B 2LRLA 4H9PC 5FNVE 2JMKA 4H9SE 2WM9A 2DLRA 1QLBA 4QXBB 4DV2T 1IBKT 1MIYA 4EEDA 4IT4A 4GKKT 4YTNA 3KVAA 5LBQB 2XAQB 2KINB 2OV9A 3L8RA 4EGWA 2JIWA 5HWYA 1D1BA 3LJCA 5FP3A 2WQYA 5L3FB 3BK9A 1SA0E 2KNDA 5AQQB 3LG7A 1D0ZA 2WB5A 3GWHA 3OYZA 4PFOA 1MNDA 3EDVA 2UXBT 4EOZB 4LF8T 1FIOA 2E8IA 3K3QC 1J5WA 3EABA 4ILBA 3UFGA 5AFUL 5JR9C 1MMDA 2VASA 3B13A 3AEAA 1SHZC 4JI3T 5KDMC 2XM2A 4HFIA 4AQFA 3Q5XA 2WCAA 3UU3A 2ACXA 4TWFA 5CJ5A 4LFAT 3UUXB 2XQ3A 4X65T 3LBXA 4LF4T 2C5JA 2E2AA 4OX9T 1XNQT 2YDRA 2XQAA 1HR0T 1NWMX 3UQ4A 3AAAB 4HFEA 1U4QA 5ETWA 5FY0A 4Z90A 3QK6A 5FMNA 3C4WA 3LSVA 4H9RC 2XASB 3R6NA 2HN1A 3AE8A 2V5DA 5AQIB 3Q9DA 4QH1A 3ZLIA 4F6RC 1YXRA 3HR0A 5F8PA 2UUBT 4L9IA 5FVLA 3TLWA 5EK4A 2YK0A 4UXNB 4AXPA 4GK5E 4U2YA 3E0ZA 3JC6C 4IDZA 2IDOB 4UIGA 2R6GF 3PUZF 3AE2A 4X1YE 1UK5A 3AXJA 4O2AE 3SRZA 3FZLB 3SOLA 3AE5A 3ESLA 1ZKEA 2D0UA 1M7KA 4ZXLA 5LGNB 2CRBA 4JI5T 4NXMT 4HTEA 4I50E 2BKOA 4YXDA 3ZT5A 3HI2A 3UTKA 4KBMB 1W0BA 3J9X1 2H3RA 2CLYC 5DQVA 2EHOC 1WLXA 2YDSA 4PK5A 4CN1A 5JDQA 4UF0A 2BG9B 2NR4A 2J62A 2AXDS 2M67A 4X1KE 3LDQB 3SFEA 3PUXF 5CGMA 5LMUT 2DI4A 4GIWA 1HNXT 1FJGT 3ZYMA 4PJJA 4QWNB 5FYMA 1LKXA 2X9WA 3AE1A 1E1HB 3HKDE 3JC6D 1IJ5A 2LJLA 4UVAB 1BR1A 1I94T 5LA6E 4QX7B 5C3JA 3NRXA 4EAHA 4TX5A 1EZ3A 2W00A 3K8PC 3PE0A 2BS4A 4UR9A 3PU3A 3RF1A 2X51A 1UX4A 4EYUA 4U3CA 4DR2T 1N36T 4I0UA 4JV5T 2GK9A 5KXJA 5LNKA 1QUUA 3F57A 2WU2A 5ADXL 1UCUA 4L0RA 4L5GA 4GKJT 3IHRA 4QH5A 3AVRA 2EHOD 1D0YA 2VKDA 1YKEB 1HG2A 1T72A 3U3IA 1YD8G 1LVKA 3PUAA 3LFMA 2FJAA 3AAIA 1MMNA 4K0UA 2XTLA 3ANWB 3C64A 4O4IE 3K3NA 4HWDA 2NP9A 1LVFA 4PFPA 2VB6A 3P50A 2ODUA 1KNZA 2X9XA 4KMCA 5LGTB 3AEGA 5FL1A 5LHGB 5JH7E 4XZCA 5IHYA 3FBZA 3RIAA 2Q9QC 2CXDA 2PTFA 4ILAA 2QGSA 5LB7B 2CWYA 2WSSV 4WW0A 3GN5B 2D9DA 2IMLA 2WDVA 2LM2A 3ZT6A 4DR5T 4IE6A 3SFDA 4UV8B 4JUYA 3KINB 1FMWA 2W2UA 3FZKB 2LHNA 4YLHA 2BG9C 3RGLA 2CWOA 1B7TA 4JI2T 3PUWF 1LRZA 1AJ3A 5CA0E 3MXZA 3B57A 4N78D 2LKGA 1BR2A 2J1DG 4YJ2E 3QNUA 3KV9A 1KNRA 2IW5B 2JPFA 2V1DB 5LG3A 3ZJ2A 3P8CD 5BR8T 5AQTB 3DJBA 5FVKA 4C91A 5IUXA 4XAXB 4I55E 3AE9A 2A3DA 4IREA 2XSAA 1YQ4A 2YEVC 1OEDA 2LM9A 3UU8A 1UUSA 1S35A 4QKNA 3N9NA 3AEDA 3ZMUB 3AECA 2BVLA 3U78A 4AKIA 2WDQA 5HXSA 3O9XA 4JEHB 4DR3T 2Q9QD 3CPZA 4BA9A 4DV5T 3AE6A 4OFZA 2W63A 2N9DA 5L3GB 3Q5DA 1WR0A 3C4ZA 2BZBA 4U31A 1KNPA 5HEUA 3AE3A 2VVNA 2PBIA 5HEHA 3Q2MA 2BG9E 4IGUA 2I0MA 4WNKA 1KFYA 3PJAA 2ZM0A 2YINA 2XQ4A 1FMVA 2W66A 3IEEA 1GQEA 5JDLA 5JR9B 2XJ7A 4ZOLE 2Y48B 5LGUB 2NTYA 3KFWX 3OYXA 4B3RT 2ACZA 4ZS3A 1T8BA 4O4HE 1YKHB 2E5LT 4LFCT 3AEBA 3PJAJ 2D5UA 2BKNA 1H7CA 2BVMA 4G2AA 3QB5A 3VKHA 4JI0T 4LF7T 4JLEA 3EDUA 2B76A 3RQWA 1YQ3A 2UXXB 2ZM6T 2CM0A 3ZCIA 2N2NA 3NVOA 3N2KE 5LMNT 5HCJA 5JDMA 3CK6A 4E7SA 1SE7A 2LRKA 4JI4T 3ZMTB 5ABEA 2E9XA 2VKJA 3ONJA 1W9RA 4DR7T 2D0TA 4DIDB 4U72A 4IE0A 4MLKA 3N9LA 2BBHA 3RIUC 3M3ZB 1IBMT 3DP7A 4C90A 1XDOA 3RYFE 4AKLA 4CZZB 4UVCB 1HCIA 2DWGA 3CWZB 4DO0A 3IBPA 5JDFA 3RRCA 2IC9A 5AQKB 4TWDA 2CHOA 3AB3B 4EV6A 3R84B 2MPKA 4AQYT 2NOXA 2CXFA 3TLTA 2LT3A 4DNDA 5AQLB 2MOZA 3RC3A 4H9OC 4KX6A 4PJLA 4UEMA 1KK7A 3ZMSB 3PTRB 2K5BB 3X1DA 5J1GA 2VQET 1OXZA 4HEAA 5H6QB 4F8HA 2VQFT 4DR6T 2CLYB 2EHOB 3P4QA 2W61A 3D0TA 4AQFC 3AEEA 3RKGA 5JDNA 1KEYA 2KSRA 4DMWA 2V7LA 3MA9A 3UU5A 1HX8A 4Z8XA 5AQNB 4QXCB 2CMRA 4TWHA 5FL0A 3RH3A 4HFCA 5L3DB 4NXNT 4FI5A 2NTXA 3HL6A 2PFVA 3FBLA 4YTPA 2A2FX 2C5KT 2V6YB 1N34T 2CBJA 2X68A 4UV9B 3BQIA 2YOEA 5AQGB 5LHHB 2FBWA 4CXYA 3QUJA 1KF6A 5LP6E 4MALA 3CVRA 5L3CB 1U5PA 4ADZA 1S94A 5JRCA 4B3MT 5ABGA 1N32T 3ONLC 2ODVA 4NUUA 4U7IA 2CCQA 2LLYA 4XBFB 3NRYA 4P0BA 3ZEFB 5AQFB 1MMAA 4PJMA 3KVBA 4AKRB 5IWAT 1UGOA 1J5ET 2XUEA 3EUHA 5L2LA 2WAUA 4E7ZA 5GONE 1BR0A 5LCYA 4CI2B 4LF5T 4WBOA 4OYJA 3RLFF 3SS1A 5LYJE 3JAEA 3VR9A 3RKOA 4AIUA 4J2CA 3A5XA 1J1JA 2CBIA 3RRWA 2MYSA 4ZEYA 4DV1T 4B3TT 4H9NC 3AA1B 3ETUA 3I9WA 5JVDE 2Q9QB 2P9BA 3UULA 3RYHE 3FB2A 4O4JE 3MKDA 3ZC1A 4NPPA 4LMJA 5L3BB 1E7PA 4HWFA 4ILUA 2DCFA 2KXPB 3CX7B 2DWKA 4O8SA 3QOFA 1ZHCA 3FZFB 3GA8A 1BR4A 2L3LA 3CX8B 2V7MA 2XZEA 4YSYA 5AQPB 3E22E 3WAKA 3P4RA 5H6RB 1W0AA 3G06A 3I0OA 3A7MA 5HEJA 3O1JA 3C98B 4UELA 5KMGP 3ZJ1A 4JBWF 4MBQA 1FEWA 2WWUA 4WBNE 2HPLA 2KT9A 2LSIA 2MTQA 4X62T 2YU2A 2VWAA 1NENA 2W0GA 3OBVE 2WZIA 4JI7T 5HWXA 4IE7A 4DBRA 3KV5A 1T98A 4IDQA 1WYCA 5EZYE 4DV7T 2VKHA 2VURA 3PU8A 4ANJA 4GYRA 5ABFB 5C2TA 3P7IA 2X9YA 2NW9A 2ES0A 3ZCJA 2JQKA 3L09A 4A56A 1I6ZA 2JJ9A 3CKDA 2UXNB 5HEOA 1Y01A 2JQQA 5J2UE 4M1PA 2PJQA 3ZMZB 4X20E 4CN6A 2XAHB 3N9QA 2IAKA 5FKYA 3Q5EA 3A8YC 4JI6T 3CX6B 5LJMA 3F31A 5FXZA 2BDEA 5L4HA 2LSKA 4KHZF 4DUYT 4HFHA 4JI1T 4DV6T 2Y6XA 3O1IA 4JYAT 5LXTE 1VOMA 2WBLA 1L0VA 2WDRA 1IAPA 4HFDA 2V7JA 3ETVA 5HAXA 5J0ZA 3N9PA 3CQCB 3N2OA 3UUMA 3ZSSA 1OEDC 3MZKB 1Y64B 3UUNA 2XQ9A 3KV6A 1XWMA 3AVSA 4HN9A 1G73A 4K0KT 2WMOA 1D1CA 2RPAA 2J4GA 4I43B 5FY1A 2D2SA 2UUAT 3ZC0A 3ZMVB 2H88A 2BG9A 1CUNA 2IHR1 2LOPA 2W62A 3AE7A 3HA4A 3IA3A 1ZV4X 4AKHA 3CIRA 4ZS2A 2LKHA 2V7KA 2JQ9A 4A98A 4EB6E 2H7VC 3W15B 4KUMB 4ZZCA 2MAWA 3LK2B 2XY8B 4HGAA 3RI5A 1N33T 5E0OA 4KI0F 2L9QA 2QVAA 1HFAA 2C5IT 1YW0A 1R8IA 2V8SV 3IF8B 4O2BE 3WI3A 3TKLB 4HWHA 3ZKRA 5HCMA 1MMGA 1VCSA 4YJ3E 5JTGA 1OEDE 4TV9E 4YY3T 1VCTA 3LBXB 3O1HA 4PAGA 2I59A 2M6IA 2A72A 2XQ5A 1CHUA 2PG8A 4MFRA 2W4XA 1W09A 5A1LA 3UQ7A 3ANWA 4Z91A 4AI6A 1X9BA 5HXRA 2K24A 5F3JA 5JQGE 4IDNA 1ZOYA 4ISTA 3K1SA 2UXDT 2E9XC 2NW7A 3PUVF 5FXVA 2KLQA 5HEGA 2KZ7B 1HTJF 3FXEB 4CXWA 4EZHA 3OVUA 4I4TE 4YT0A 2X9HA 3F2EA 3GN5A 5FY7A 1WYBA 3AAEB 4EYYR 4ISSA 4YSZA 3VR8A 3QC9A 4U33A 2QA7A 3FZMB 2HH7A 1D0XA 4QX8B 3AXJB 3PURA 3BQKA 3ZYLA 3ZPOA 4HFVA 5KX5E 1WRDA 4DMVA 5L4EA 3VRBA 1XMQT 4PNIA 4JEUB 2CA5A 2VVSA 2NWBA 4ZHQE 4ZI7E 3PUSA 3RIFA 3AA6B 1JNZA 3OKQA 4BJNA 3KBTA 2V26A 3UFEA 1XDPA 3AE4A 3RIUA 2K9AA 2XSBA 3GMIA 3EVYA 2WWVA 3NBXX 5ABHA 1HNWT 3RYIE 2H7OA 4UF0B 2E9XD 3C51A 4U2ZA 2YDQA 4H63H 3ZT7A 4TV8E 3SWHA 3VRAA 3FHNA 3PUYF 2V7IA 3AEFA 4LMKA 2LE8A 4ZZBA 1O3XA 2F4VT 3CQGB 2K48A 1HNZT 2RA1A 4IE5A 1V9DA 3PUQA 4LF6T 2XQ7A 4P09A 3ONXA 2V6XA 2XAGB 1HF8A 2MBGA 3B5MA 3JAFA 3N5LA 4DUZT 4GK0E 1JNRA 4NIQA 5HXHA 2SPCA 5AQVB 5JR9A 4B3ST 5DJQC 4QHOA 4EZ4A 4U7YA 2X0YA 3L39A 3NZQA 4U74A 3EAMA 4LMLA 3KBUA 2AE9A 3PUGA 4P0AA 3TLSA 2WP9A 1XZYA 3KDSE 3RX6A 1UURA 3DTOA 2UXCT 4EEBA 3KV4A 5C8YE 3PDYA 2XM1A 5LJNA 2FJEA 2E5VA 3I9YA 4OYKA 4CI3B 4HWIB 3VHLA 4ERRA 4X5TA 4PJNA 2HHHT 2XQ8A 1ZEEA 2WMNA 2BBJA 4DV0T 3K3OA 1NEKA 2BS3A 2XQ6A 2LOSA 3UU6A 1Z8UA 4DV3T 2V5CA 4IE4A 3OPCA 4AISA 2KWIB 2YU1A 2IIUA 2VK9A 3H3MA 2X66A 3EHZA 1WCRA 4TN7B 4G63A 3L3PA 3ABVA 1X79A 4X1IE 5CB4E 2CXLA 3N9MA 5TAOA 4CI1B 3C50A 1MIVA 3UT5E 4CN4A 3Q5WA 4OHFA 2WU5A 1OEDB 2JRKA 3VKGA 1WR6A 2WY2A 5FXWA 3V5SA 3M65A 5HXEA 1M62A 3BQLA 4COFA 2EHOA 5J2TE 4IHJE 4CQIA 3RYCE 3FZHB 2ZMAA 2H89A 5AQJB 3V5UA 4KP3C 3TLVA 3WAJA 2VKOA 2IC6A 1VRBA 3MK7C 3H37A 3JADA 1US7B 2QRXA 2FJBA 4HKAA 2M6BA 2V6YA 2X0HA 2XAJB 4IIJE 3H3AA 4HE8A 4YFSA 2IUBA 3E08A 4ZI2C 1IZNB 4GOUA 3HKBE 4BAYB 2UU9T 4TUYE 3I1AA 2FUPA 2BS2A 2I6HA 2ZM2A 4PK6A 2JQHA 4EIWA 5DABA 5AQSB 4AKGA 2C0SA 4IDPA 1E2AA 4B6XA 2ZM8A 2K3WA 2L8KA 2UUCT 2X67A 2OLTA 2Y8DA 3MJXA 4YHJA 1XNRT 5LOVE 4MHCA 3N2GE 4A97A 5BMVE 3AA7B 3TLUA 1T7SA 2LSYA 5DQWA 4QXHB 2YKSA 2B1EA 2XAFB 2LHRA 4ILCA 3S4UA 2E9XB 2J47A 3QB5K 1OWAA 1ZP0A 5CA1E 3T1HT 4H9QC 4O4LE 2NW8A 4Q25A 4ZI2D 5AQUB 3RC8A 2Q9QA 3I0QA 2OA5A 3ZN0B 1MIWA 4V1Av 4IL9A 4LF9T 5M4YA 1XMOT 2QYWA 2DNXA 3EI0A 2XHEB 5F5WA 2LSJA 3P4SA 5AQHB 4IDOA 4FJOA 3AA0B 3O4XE 3HKCE 5JREA
chains in the Genus database with same CATH topology
2ODVA 4NUUA 2CCQA 2HPJA 3K8PC 3QC9A 3PE0A 2QA7A 2LSGA 2HH7A 3PU3A 1D0XA 2X51A 4OK0A 4ASKA 1UX4A 4QX8B 4XBFB 2DHRA 5LHIB 3NRYA 3PURA 4EYUA 3BQKA 4P0BA 3ZYLA 3N9OA 3ZEFB 3ZPOA 4HFVA 4ZI3C 1MMAA 5KX5E 2GK9A 5LNKA 1WRDA 4PJMA 3VU7H 4DMVA 3KVBA 4PNIA 4AKRB 1QUUA 2CA5A 4JEUB 2NWBA 1HG5A 3F57A 4ZI7E 3PUSA 4ZHQE 5ADXL 1UCUA 4L0RA 2KWHA 2CEAA 3AA6B 4L5GA 3OKQA 2XUEA 3IHRA 5EK2A 2G0UA 1QSDA 3EUHA 3AVRA 5L2LA 4BJNA 2EHOD 2WAUA 3KBTA 5FXXA 1D0YA 4E7ZA 5GONE 2V26A 1BR0A 4H63V 2VKDA 1YKEB 3UFEA 1HG2A 3U3IA 1YD8G 5LCYA 1LVKA 3PUAA 5JDGA 2K9AA 2LEHA 5LBMA 4CI2B 3GMIA 3EVYA 4WBOA 3LFMA 4PK4A 3LK3B 3NZPA 3NBXX 3AAIA 1MMNA 4K0UA 3RYIE 4OYJA 2XTLA 3SS1A 5LYJE 3CMLA 2H7OA 4UF0B 5IYZE 3RKOA 2E9XD 5EK3A 3ANWB 3C51A 3C64A 4O4IE 4AQGA 3K3NA 4J2CA 3A5XA 2XQYA 2NP9A 3RRWA 1LVFA 2MYSA 4PFPA 2VB6A 4DVDA 4H63H 1UX5A 1IJ6A 4H9NC 3AA1B 2ODUA 3ETUA 1KNZA 3I9WA 5JVDE 2X9XA 2Q9QB 2P9BA 4TV8E 3SWHA 3UULA 4KMCA 3RYHE 5L3EB 3RPUA 5LG4A 5LGTB 1G8XA 3C4XA 3FHNA 5LHGB 5JH7E 3FB2A 4O4JE 4XZCA 2V7IA 2LE8A 5IHYA 3FBZA 2Q9QC 1O3XA 3CQGB 3CQXC 5JDHA 4CXXA 2CXDA 2K48A 2RA1A 4IE5A 4UVBB 1V9DA 3PUQA 3MKDA 4P09A 2QGSA 4EXTA 2CWYA 2WSSV 4WW0A 3ZC1A 3GN5B 2Z6EA 5L3BB 3T8OA 5JRCB 4IE6A 2DCFA 4ILUA 3OJAA 2KXPB 3ONXA 4UV8B 4JUYA 3LK42 3KINB 1FMWA 3CX7B 5HYAA 2DWKA 4O8SA 4ZI3D 2XAGB 2LHNA 4YLHA 1HF8A 2MBGA 1D1AA 1ZHCA 2KMFA 3GA8A 1BR4A 2CWOA 4BJMA 1B7TA 3N5LA 2L3LA 4DBQA 4PW8A 3CX8B 2V7MA 1LRZA 1AJ3A 5CA0E 3MXZA 3B57A 2ZLYA 3E22E 4GK0E 1MNEA 4N78D 5H6RB 3WAKA 5HXHA 2SPCA 3I0OA 2CE7A 1BR2A 2J1DG 4YJ2E 3KV9A 5JR9A 2IW5B 2JPFA 2V1DB 5DJQC 4QHOA 4EZ4A 3O1JA 3ZJ2A 3P8CD 3NZQA 4U74A 4GYSA 3C98B 3KBUA 3DJBA 3HKEE 4UELA 3J7Yq 4C91A 4XAXB 1Z0PA 5HXCA 3MACA 3ZJ1A 5KMGP 3PUGA 4I55E 4P0AA 2A3DA 2JMHA 3KDSE 3RX6A 4MBQA 1FEWA 2YEVC 3DTOA 2LM9A 2WWUA 4WBNE 2HPLA 1S35A 4NUVA 3KV4A 4QKNA 2X0LB 3N9NA 5C8YE 2KT9A 2LSIA 3PDYA 5LJNA 2MTQA 2RP4A 2N1GA 3I9YA 3ZMUB 2BVLA 2VWAA 2YU2A 3U78A 4OYKA 4CI3B 4AKIA 3ZYKA 5HXSA 3VHLA 3FXDB 3O9XA 4TZ4C 3OBVE 2W0GA 4JEHB 1HS7A 1NAFA 2VL8A 4ERRA 4PJNA 2Q9QD 3ZN1B 5HWXA 1ZEEA 2WMNA 4IE7A 4DBRA 3CPZA 3KV5A 4H9PC 5FNVE 1T98A 4BA9A 3K3OA 2JMKA 4H9SE 2WM9A 2DLRA 1WYCA 4OFZA 2W63A 4QXBB 2N9DA 5EZYE 5L3GB 1MIYA 3C4ZA 2VKHA 3PU8A 2LOSA 4ANJA 4GYRA 3KVAA 2BZBA 4IE4A 5LBQB 2XAQB 2X9YA 3P7IA 2NW9A 2KINB 2KWIB 2YU1A 2ES0A 2VK9A 3ZCJA 2X66A 3L09A 4A56A 2JJ9A 3CKDA 2UXNB 5HWYA 2PBIA 1D1BA 3LJCA 2JQQA 3Q2MA 5FP3A 5J2UE 4IGUA 4M1PA 2PJQA 4WNKA 4X20E 3ZMZB 2XAHB 3N9QA 2IAKA 5L3FB 2ZM0A 3BK9A 4TN7B 2YINA 1SA0E 2KNDA 1FMVA 3LG7A 1D0ZA 3IEEA 4G63A 3L3PA 5JDLA 3GWHA 3OYZA 5JR9B 3CX6B 5LJMA 1X79A 3F31A 4PFOA 4X1IE 5CB4E 5FXZA 1MNDA 4ZOLE 3EDVA 2Y48B 4EOZB 5LGUB 2NTYA 2BDEA 1FIOA 2E8IA 3K3QC 2CXLA 3N9MA 3KFWX 3OYXA 4ZS3A 5TAOA 2LSKA 4O4HE 1YKHB 4CI1B 3C50A 5AFUL 5JR9C 1MMDA 1MIVA 2Y6XA 3O1IA 2D5UA 3UT5E 1H7CA 3Q5WA 2VASA 3B13A 4OHFA 5LXTE 2BVMA 2JRKA 4G2AA 1SHZC 3VKGA 5KDMC 4AQFA 1VOMA 3Q5XA 1WR6A 2WBLA 5FXWA 3VKHA 3V5SA 1IAPA 2V7JA 3ETVA 5HAXA 4JLEA 3EDUA 3N9PA 3CQCB 3N2OA 3M65A 5HXEA 2ACXA 3UUMA 3BQLA 3MZKB 2EHOA 2UXXB 5J2TE 2CM0A 1Y64B 3UUNA 3ZCIA 2N2NA 4IHJE 3KV6A 3RYCE 3UUXB 4CQIA 3AVSA 2ZMAA 3N2KE 4HN9A 1G73A 3LBXA 2C5JA 3V5UA 2WMOA 5JDMA 1D1CA 4KP3C 4E7SA 3WAJA 4I43B 5FY1A 2D2SA 3ZC0A 2VKOA 2IC6A 1VRBA 3MK7C 3ZMTB 3ZMVB 2E9XA 1NWMX 3H37A 3AAAB 2VKJA 1CUNA 1U4QA 5ETWA 1US7B 2D0TA 4U72A 5FY0A 4IE0A 4MLKA 3N9LA 3QK6A 5FMNA 4HKAA 2LOPA 3C4WA 3DP7A 4C90A 2XAJB 2W62A 4IIJE 3RYFE 3H3AA 4AKLA 3HA4A 4H9RC 4HE8A 4CZZB 2XASB 1ZV4X 4UVCB 4YFSA 3R6NA 4AKHA 1HCIA 2DWGA 3CWZB 3E08A 4ZS2A 1IZNB 4ZI2C 4GOUA 4DO0A 2V7KA 3Q9DA 3IBPA 3HKBE 5JDFA 4BAYB 3RRCA 4TUYE 3ZLIA 4F6RC 2IC9A 3I1AA 3HR0A 5F8PA 3AB3B 4L9IA 4EB6E 3R84B 2ZM2A 4PK6A 2H7VC 5EK4A 2NOXA 2YK0A 4UXNB 3W15B 2CXFA 4KUMB 4AXPA 4GK5E 2LT3A 3E0ZA 3JC6C 4IDZA 4DNDA 4EIWA 5DABA 3LK2B 4UIGA 2MOZA 4AKGA 2C0SA 4HGAA 3RC3A 4H9OC 4X1YE 4B6XA 4O2AE 5E0OA 4PJLA 3SRZA 4UEMA 2ZM8A 2L8KA 1KK7A 3ZMSB 3SOLA 2L9QA 2X67A 1HFAA 3ESLA 1ZKEA 2C5IT 1YW0A 2D0UA 2K5BB 3PTRB 2Y8DA 3IF8B 4O2BE 5J1GA 3WI3A 5LGNB 3TKLB 3MJXA 4YHJA 1OXZA 4HEAA 5H6QB 1MMGA 2CLYB 4HTEA 4I50E 4YJ3E 5LOVE 2EHOB 4MHCA 4TV9E 2W61A 3D0TA 4AQFC 3N2GE 3HI2A 5BMVE 3UTKA 4KBMB 3AA7B 3LBXB 3O1HA 5JDNA 4PAGA 2I59A 2A72A 2LSYA 4DMWA 2V7LA 3MA9A 2H3RA 3J9X1 2CLYC 5DQWA 1HX8A 4Z8XA 4QXHB 5DQVA 2EHOC 2B1EA 2XAFB 2LHRA 2CMRA 1WLXA 2PG8A 4QXCB 4MFRA 3S4UA 4PK5A 5JDQA 5A1LA 4UF0A 2E9XB 3RH3A 3ANWA 5L3DB 4AI6A 1OWAA 5HXRA 2K24A 5CA1E 5F3JA 5JQGE 4H9QC 4O4LE 2NW8A 2M67A 4FI5A 4X1KE 4ISTA 2NTXA 4ZI2D 3HL6A 2PFVA 3FBLA 3RC8A 2A2FX 2C5KT 2Q9QA 2DI4A 2E9XC 3I0QA 2NW7A 4GIWA 5FXVA 2KLQA 2OA5A 1MIWA 4V1Av 3ZN0B 2X68A 4UV9B 3BQIA 2KZ7B 3ZYMA 1HTJF 4PJJA 5LHHB 5M4YA 4QWNB 5FYMA 3FXEB 4CXYA 4CXWA 3QUJA 1LKXA 2DNXA 2X9WA 4EZHA 4I4TE 1E1HB 3HKDE 5LP6E 3JC6D 2XHEB 4MALA 1IJ5A 2X9HA 2LJLA 4UVAB 1BR1A 3CVRA 3F2EA 2LSJA 5L3CB 3GN5A 5LA6E 4QX7B 1U5PA 3NRXA 1S94A 4ADZA 5FY7A 4FJOA 3AA0B 4EAHA 5JRCA 3O4XE 3HKCE 4TX5A 1WYBA 3AAEB 4EYYR 4ISSA 1EZ3A 2W00A 5JREA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SOL A;  3UTK A;  4A56 A;  4K0U A; 
#chains in the Genus database with same CATH topology
 2HPJ A;  2LSG A;  4ASK A;  4OK0 A;  2DHR A;  5LHI B;  3N9O A;  4ZI3 C;  4P1N A;  3VU7 H;  4DV4 T;  1HG5 A;  2XPK A;  4WZX A;  2KWH A;  2CEA A;  5EK2 A;  2G0U A;  1QSD A;  3ZST A;  5FXX A;  1SUM B;  2BKP A;  4H63 V;  1IBL T;  5JDG A;  4TNW A;  1HX1 B;  2LEH A;  5LBM A;  4PK4 A;  3LK3 B;  3NZP A;  4DR1 T;  3CML A;  5IYZ E;  5EK3 A;  4AQG A;  3RQU A;  2XQY A;  4DVD A;  1UX5 A;  1IJ6 A;  3UU4 A;  4X64 T;  5L3E B;  3RPU A;  5LG4 A;  1G8X A;  3C4X A;  2HN2 A;  3OTO T;  3RHW A;  4HFB A;  1WFD A;  3PV0 F;  2CHN A;  3CQX C;  5JDH A;  4CXX A;  4UVB B;  5ABF A;  5AQR B;  2DL1 A;  4EXT A;  2WS3 A;  4X66 T;  4YTM A;  2Z6E A;  3T8O A;  5JRC B;  2W67 A;  3P4W A;  5CFB A;  3OJA A;  4KHP T;  4JI8 T;  5L47 A;  3LK4 2;  3T1Y T;  5HYA A;  4QH4 A;  4ZI3 D;  4A5X A;  1D1A A;  2KMF A;  4HWC A;  4TNV A;  4BJM A;  4DBQ A;  4PW8 A;  2VL0 A;  2FJD A;  2ZLY A;  4YSX A;  1MNE A;  4IL4 A;  4WYV A;  2CE7 A;  3NKZ A;  5AQO B;  2YN6 A;  3UUB A;  4GYS A;  1DU2 A;  3HKE E;  3J7Y q;  2A9U A;  1Z0P A;  5HXC A;  3MAC A;  2JMH A;  3NWI A;  2WZH A;  4NUV A;  4DR4 T;  3P4P A;  2X0L B;  3JCF A;  2RP4 A;  2N1G A;  3ZYK A;  3FXD B;  4YHH T;  4TZ4 C;  1HS7 A;  2CPT A;  5AQM B;  1NAF A;  2VL8 A;  4LFB T;  3ZN1 B;  2LRL A;  4H9P C;  5FNV E;  2JMK A;  4H9S E;  2WM9 A;  2DLR A;  1QLB A;  4QXB B;  4DV2 T;  1IBK T;  1MIY A;  4EED A;  4IT4 A;  4GKK T;  4YTN A;  3KVA A;  5LBQ B;  2XAQ B;  2KIN B;  2OV9 A;  3L8R A;  4EGW A;  2JIW A;  5HWY A;  1D1B A;  3LJC A;  5FP3 A;  2WQY A;  5L3F B;  3BK9 A;  1SA0 E;  2KND A;  5AQQ B;  3LG7 A;  1D0Z A;  2WB5 A;  3GWH A;  3OYZ A;  4PFO A;  1MND A;  3EDV A;  2UXB T;  4EOZ B;  4LF8 T;  1FIO A;  2E8I A;  3K3Q C;  1J5W A;  3EAB A;  4ILB A;  3UFG A;  5AFU L;  5JR9 C;  1MMD A;  2VAS A;  3B13 A;  3AEA A;  1SHZ C;  4JI3 T;  5KDM C;  2XM2 A;  4HFI A;  4AQF A;  3Q5X A;  2WCA A;  3UU3 A;  2ACX A;  4TWF A;  5CJ5 A;  4LFA T;  3UUX B;  2XQ3 A;  4X65 T;  3LBX A;  4LF4 T;  2C5J A;  2E2A A;  4OX9 T;  1XNQ T;  2YDR A;  2XQA A;  1HR0 T;  1NWM X;  3UQ4 A;  3AAA B;  4HFE A;  1U4Q A;  5ETW A;  5FY0 A;  4Z90 A;  3QK6 A;  5FMN A;  3C4W A;  3LSV A;  4H9R C;  2XAS B;  3R6N A;  2HN1 A;  3AE8 A;  2V5D A;  5AQI B;  3Q9D A;  4QH1 A;  3ZLI A;  4F6R C;  1YXR A;  3HR0 A;  5F8P A;  2UUB T;  4L9I A;  5FVL A;  3TLW A;  5EK4 A;  2YK0 A;  4UXN B;  4AXP A;  4GK5 E;  4U2Y A;  3E0Z A;  3JC6 C;  4IDZ A;  2IDO B;  4UIG A;  2R6G F;  3PUZ F;  3AE2 A;  4X1Y E;  1UK5 A;  3AXJ A;  4O2A E;  3SRZ A;  3FZL B;  3SOL A;  3AE5 A;  3ESL A;  1ZKE A;  2D0U A;  1M7K A;  4ZXL A;  5LGN B;  2CRB A;  4JI5 T;  4NXM T;  4HTE A;  4I50 E;  2BKO A;  4YXD A;  3ZT5 A;  3HI2 A;  3UTK A;  4KBM B;  1W0B A;  3J9X 1;  2H3R A;  2CLY C;  5DQV A;  2EHO C;  1WLX A;  2YDS A;  4PK5 A;  4CN1 A;  5JDQ A;  4UF0 A;  2BG9 B;  2NR4 A;  2J62 A;  2AXD S;  2M67 A;  4X1K E;  3LDQ B;  3SFE A;  3PUX F;  5CGM A;  5LMU T;  2DI4 A;  4GIW A;  1HNX T;  1FJG T;  3ZYM A;  4PJJ A;  4QWN B;  5FYM A;  1LKX A;  2X9W A;  3AE1 A;  1E1H B;  3HKD E;  3JC6 D;  1IJ5 A;  2LJL A;  4UVA B;  1BR1 A;  1I94 T;  5LA6 E;  4QX7 B;  5C3J A;  3NRX A;  4EAH A;  4TX5 A;  1EZ3 A;  2W00 A;  3K8P C;  3PE0 A;  2BS4 A;  4UR9 A;  3PU3 A;  3RF1 A;  2X51 A;  1UX4 A;  4EYU A;  4U3C A;  4DR2 T;  1N36 T;  4I0U A;  4JV5 T;  2GK9 A;  5KXJ A;  5LNK A;  1QUU A;  3F57 A;  2WU2 A;  5ADX L;  1UCU A;  4L0R A;  4L5G A;  4GKJ T;  3IHR A;  4QH5 A;  3AVR A;  2EHO D;  1D0Y A;  2VKD A;  1YKE B;  1HG2 A;  1T72 A;  3U3I A;  1YD8 G;  1LVK A;  3PUA A;  3LFM A;  2FJA A;  3AAI A;  1MMN A;  4K0U A;  2XTL A;  3ANW B;  3C64 A;  4O4I E;  3K3N A;  4HWD A;  2NP9 A;  1LVF A;  4PFP A;  2VB6 A;  3P50 A;  2ODU A;  1KNZ A;  2X9X A;  4KMC A;  5LGT B;  3AEG A;  5FL1 A;  5LHG B;  5JH7 E;  4XZC A;  5IHY A;  3FBZ A;  3RIA A;  2Q9Q C;  2CXD A;  2PTF A;  4ILA A;  2QGS A;  5LB7 B;  2CWY A;  2WSS V;  4WW0 A;  3GN5 B;  2D9D A;  2IML A;  2WDV A;  2LM2 A;  3ZT6 A;  4DR5 T;  4IE6 A;  3SFD A;  4UV8 B;  4JUY A;  3KIN B;  1FMW A;  2W2U A;  3FZK B;  2LHN A;  4YLH A;  2BG9 C;  3RGL A;  2CWO A;  1B7T A;  4JI2 T;  3PUW F;  1LRZ A;  1AJ3 A;  5CA0 E;  3MXZ A;  3B57 A;  4N78 D;  2LKG A;  1BR2 A;  2J1D G;  4YJ2 E;  3QNU A;  3KV9 A;  1KNR A;  2IW5 B;  2JPF A;  2V1D B;  5LG3 A;  3ZJ2 A;  3P8C D;  5BR8 T;  5AQT B;  3DJB A;  5FVK A;  4C91 A;  5IUX A;  4XAX B;  4I55 E;  3AE9 A;  2A3D A;  4IRE A;  2XSA A;  1YQ4 A;  2YEV C;  1OED A;  2LM9 A;  3UU8 A;  1UUS A;  1S35 A;  4QKN A;  3N9N A;  3AED A;  3ZMU B;  3AEC A;  2BVL A;  3U78 A;  4AKI A;  2WDQ A;  5HXS A;  3O9X A;  4JEH B;  4DR3 T;  2Q9Q D;  3CPZ A;  4BA9 A;  4DV5 T;  3AE6 A;  4OFZ A;  2W63 A;  2N9D A;  5L3G B;  3Q5D A;  1WR0 A;  3C4Z A;  2BZB A;  4U31 A;  1KNP A;  5HEU A;  3AE3 A;  2VVN A;  2PBI A;  5HEH A;  3Q2M A;  2BG9 E;  4IGU A;  2I0M A;  4WNK A;  1KFY A;  3PJA A;  2ZM0 A;  2YIN A;  2XQ4 A;  1FMV A;  2W66 A;  3IEE A;  1GQE A;  5JDL A;  5JR9 B;  2XJ7 A;  4ZOL E;  2Y48 B;  5LGU B;  2NTY A;  3KFW X;  3OYX A;  4B3R T;  2ACZ A;  4ZS3 A;  1T8B A;  4O4H E;  1YKH B;  2E5L T;  4LFC T;  3AEB A;  3PJA J;  2D5U A;  2BKN A;  1H7C A;  2BVM A;  4G2A A;  3QB5 A;  3VKH A;  4JI0 T;  4LF7 T;  4JLE A;  3EDU A;  2B76 A;  3RQW A;  1YQ3 A;  2UXX B;  2ZM6 T;  2CM0 A;  3ZCI A;  2N2N A;  3NVO A;  3N2K E;  5LMN T;  5HCJ A;  5JDM A;  3CK6 A;  4E7S A;  1SE7 A;  2LRK A;  4JI4 T;  3ZMT B;  5ABE A;  2E9X A;  2VKJ A;  3ONJ A;  1W9R A;  4DR7 T;  2D0T A;  4DID B;  4U72 A;  4IE0 A;  4MLK A;  3N9L A;  2BBH A;  3RIU C;  3M3Z B;  1IBM T;  3DP7 A;  4C90 A;  1XDO A;  3RYF E;  4AKL A;  4CZZ B;  4UVC B;  1HCI A;  2DWG A;  3CWZ B;  4DO0 A;  3IBP A;  5JDF A;  3RRC A;  2IC9 A;  5AQK B;  4TWD A;  2CHO A;  3AB3 B;  4EV6 A;  3R84 B;  2MPK A;  4AQY T;  2NOX A;  2CXF A;  3TLT A;  2LT3 A;  4DND A;  5AQL B;  2MOZ A;  3RC3 A;  4H9O C;  4KX6 A;  4PJL A;  4UEM A;  1KK7 A;  3ZMS B;  3PTR B;  2K5B B;  3X1D A;  5J1G A;  2VQE T;  1OXZ A;  4HEA A;  5H6Q B;  4F8H A;  2VQF T;  4DR6 T;  2CLY B;  2EHO B;  3P4Q A;  2W61 A;  3D0T A;  4AQF C;  3AEE A;  3RKG A;  5JDN A;  1KEY A;  2KSR A;  4DMW A;  2V7L A;  3MA9 A;  3UU5 A;  1HX8 A;  4Z8X A;  5AQN B;  4QXC B;  2CMR A;  4TWH A;  5FL0 A;  3RH3 A;  4HFC A;  5L3D B;  4NXN T;  4FI5 A;  2NTX A;  3HL6 A;  2PFV A;  3FBL A;  4YTP A;  2A2F X;  2C5K T;  2V6Y B;  1N34 T;  2CBJ A;  2X68 A;  4UV9 B;  3BQI A;  2YOE A;  5AQG B;  5LHH B;  2FBW A;  4CXY A;  3QUJ A;  1KF6 A;  5LP6 E;  4MAL A;  3CVR A;  5L3C B;  1U5P A;  4ADZ A;  1S94 A;  5JRC A;  4B3M T;  5ABG A;  1N32 T;  3ONL C;  2ODV A;  4NUU A;  4U7I A;  2CCQ A;  2LLY A;  4XBF B;  3NRY A;  4P0B A;  3ZEF B;  5AQF B;  1MMA A;  4PJM A;  3KVB A;  4AKR B;  5IWA T;  1UGO A;  1J5E T;  2XUE A;  3EUH A;  5L2L A;  2WAU A;  4E7Z A;  5GON E;  1BR0 A;  5LCY A;  4CI2 B;  4LF5 T;  4WBO A;  4OYJ A;  3RLF F;  3SS1 A;  5LYJ E;  3JAE A;  3VR9 A;  3RKO A;  4AIU A;  4J2C A;  3A5X A;  1J1J A;  2CBI A;  3RRW A;  2MYS A;  4ZEY A;  4DV1 T;  4B3T T;  4H9N C;  3AA1 B;  3ETU A;  3I9W A;  5JVD E;  2Q9Q B;  2P9B A;  3UUL A;  3RYH E;  3FB2 A;  4O4J E;  3MKD A;  3ZC1 A;  4NPP A;  4LMJ A;  5L3B B;  1E7P A;  4HWF A;  4ILU A;  2DCF A;  2KXP B;  3CX7 B;  2DWK A;  4O8S A;  3QOF A;  1ZHC A;  3FZF B;  3GA8 A;  1BR4 A;  2L3L A;  3CX8 B;  2V7M A;  2XZE A;  4YSY A;  5AQP B;  3E22 E;  3WAK A;  3P4R A;  5H6R B;  1W0A A;  3G06 A;  3I0O A;  3A7M A;  5HEJ A;  3O1J A;  3C98 B;  4UEL A;  5KMG P;  3ZJ1 A;  4JBW F;  4MBQ A;  1FEW A;  2WWU A;  4WBN E;  2HPL A;  2KT9 A;  2LSI A;  2MTQ A;  4X62 T;  2YU2 A;  2VWA A;  1NEN A;  2W0G A;  3OBV E;  2WZI A;  4JI7 T;  5HWX A;  4IE7 A;  4DBR A;  3KV5 A;  1T98 A;  4IDQ A;  1WYC A;  5EZY E;  4DV7 T;  2VKH A;  2VUR A;  3PU8 A;  4ANJ A;  4GYR A;  5ABF B;  5C2T A;  3P7I A;  2X9Y A;  2NW9 A;  2ES0 A;  3ZCJ A;  2JQK A;  3L09 A;  4A56 A;  1I6Z A;  2JJ9 A;  3CKD A;  2UXN B;  5HEO A;  1Y01 A;  2JQQ A;  5J2U E;  4M1P A;  2PJQ A;  3ZMZ B;  4X20 E;  4CN6 A;  2XAH B;  3N9Q A;  2IAK A;  5FKY A;  3Q5E A;  3A8Y C;  4JI6 T;  3CX6 B;  5LJM A;  3F31 A;  5FXZ A;  2BDE A;  5L4H A;  2LSK A;  4KHZ F;  4DUY T;  4HFH A;  4JI1 T;  4DV6 T;  2Y6X A;  3O1I A;  4JYA T;  5LXT E;  1VOM A;  2WBL A;  1L0V A;  2WDR A;  1IAP A;  4HFD A;  2V7J A;  3ETV A;  5HAX A;  5J0Z A;  3N9P A;  3CQC B;  3N2O A;  3UUM A;  3ZSS A;  1OED C;  3MZK B;  1Y64 B;  3UUN A;  2XQ9 A;  3KV6 A;  1XWM A;  3AVS A;  4HN9 A;  1G73 A;  4K0K T;  2WMO A;  1D1C A;  2RPA A;  2J4G A;  4I43 B;  5FY1 A;  2D2S A;  2UUA T;  3ZC0 A;  3ZMV B;  2H88 A;  2BG9 A;  1CUN A;  2IHR 1;  2LOP A;  2W62 A;  3AE7 A;  3HA4 A;  3IA3 A;  1ZV4 X;  4AKH A;  3CIR A;  4ZS2 A;  2LKH A;  2V7K A;  2JQ9 A;  4A98 A;  4EB6 E;  2H7V C;  3W15 B;  4KUM B;  4ZZC A;  2MAW A;  3LK2 B;  2XY8 B;  4HGA A;  3RI5 A;  1N33 T;  5E0O A;  4KI0 F;  2L9Q A;  2QVA A;  1HFA A;  2C5I T;  1YW0 A;  1R8I A;  2V8S V;  3IF8 B;  4O2B E;  3WI3 A;  3TKL B;  4HWH A;  3ZKR A;  5HCM A;  1MMG A;  1VCS A;  4YJ3 E;  5JTG A;  1OED E;  4TV9 E;  4YY3 T;  1VCT A;  3LBX B;  3O1H A;  4PAG A;  2I59 A;  2M6I A;  2A72 A;  2XQ5 A;  1CHU A;  2PG8 A;  4MFR A;  2W4X A;  1W09 A;  5A1L A;  3UQ7 A;  3ANW A;  4Z91 A;  4AI6 A;  1X9B A;  5HXR A;  2K24 A;  5F3J A;  5JQG E;  4IDN A;  1ZOY A;  4IST A;  3K1S A;  2UXD T;  2E9X C;  2NW7 A;  3PUV F;  5FXV A;  2KLQ A;  5HEG A;  2KZ7 B;  1HTJ F;  3FXE B;  4CXW A;  4EZH A;  3OVU A;  4I4T E;  4YT0 A;  2X9H A;  3F2E A;  3GN5 A;  5FY7 A;  1WYB A;  3AAE B;  4EYY R;  4ISS A;  4YSZ A;  3VR8 A;  3QC9 A;  4U33 A;  2QA7 A;  3FZM B;  2HH7 A;  1D0X A;  4QX8 B;  3AXJ B;  3PUR A;  3BQK A;  3ZYL A;  3ZPO A;  4HFV A;  5KX5 E;  1WRD A;  4DMV A;  5L4E A;  3VRB A;  1XMQ T;  4PNI A;  4JEU B;  2CA5 A;  2VVS A;  2NWB A;  4ZHQ E;  4ZI7 E;  3PUS A;  3RIF A;  3AA6 B;  1JNZ A;  3OKQ A;  4BJN A;  3KBT A;  2V26 A;  3UFE A;  1XDP A;  3AE4 A;  3RIU A;  2K9A A;  2XSB A;  3GMI A;  3EVY A;  2WWV A;  3NBX X;  5ABH A;  1HNW T;  3RYI E;  2H7O A;  4UF0 B;  2E9X D;  3C51 A;  4U2Z A;  2YDQ A;  4H63 H;  3ZT7 A;  4TV8 E;  3SWH A;  3VRA A;  3FHN A;  3PUY F;  2V7I A;  3AEF A;  4LMK A;  2LE8 A;  4ZZB A;  1O3X A;  2F4V T;  3CQG B;  2K48 A;  1HNZ T;  2RA1 A;  4IE5 A;  1V9D A;  3PUQ A;  4LF6 T;  2XQ7 A;  4P09 A;  3ONX A;  2V6X A;  2XAG B;  1HF8 A;  2MBG A;  3B5M A;  3JAF A;  3N5L A;  4DUZ T;  4GK0 E;  1JNR A;  4NIQ A;  5HXH A;  2SPC A;  5AQV B;  5JR9 A;  4B3S T;  5DJQ C;  4QHO A;  4EZ4 A;  4U7Y A;  2X0Y A;  3L39 A;  3NZQ A;  4U74 A;  3EAM A;  4LML A;  3KBU A;  2AE9 A;  3PUG A;  4P0A A;  3TLS A;  2WP9 A;  1XZY A;  3KDS E;  3RX6 A;  1UUR A;  3DTO A;  2UXC T;  4EEB A;  3KV4 A;  5C8Y E;  3PDY A;  2XM1 A;  5LJN A;  2FJE A;  2E5V A;  3I9Y A;  4OYK A;  4CI3 B;  4HWI B;  3VHL A;  4ERR A;  4X5T A;  4PJN A;  2HHH T;  2XQ8 A;  1ZEE A;  2WMN A;  2BBJ A;  4DV0 T;  3K3O A;  1NEK A;  2BS3 A;  2XQ6 A;  2LOS A;  3UU6 A;  1Z8U A;  4DV3 T;  2V5C A;  4IE4 A;  3OPC A;  4AIS A;  2KWI B;  2YU1 A;  2IIU A;  2VK9 A;  3H3M A;  2X66 A;  3EHZ A;  1WCR A;  4TN7 B;  4G63 A;  3L3P A;  3ABV A;  1X79 A;  4X1I E;  5CB4 E;  2CXL A;  3N9M A;  5TAO A;  4CI1 B;  3C50 A;  1MIV A;  3UT5 E;  4CN4 A;  3Q5W A;  4OHF A;  2WU5 A;  1OED B;  2JRK A;  3VKG A;  1WR6 A;  2WY2 A;  5FXW A;  3V5S A;  3M65 A;  5HXE A;  1M62 A;  3BQL A;  4COF A;  2EHO A;  5J2T E;  4IHJ E;  4CQI A;  3RYC E;  3FZH B;  2ZMA A;  2H89 A;  5AQJ B;  3V5U A;  4KP3 C;  3TLV A;  3WAJ A;  2VKO A;  2IC6 A;  1VRB A;  3MK7 C;  3H37 A;  3JAD A;  1US7 B;  2QRX A;  2FJB A;  4HKA A;  2M6B A;  2V6Y A;  2X0H A;  2XAJ B;  4IIJ E;  3H3A A;  4HE8 A;  4YFS A;  2IUB A;  3E08 A;  4ZI2 C;  1IZN B;  4GOU A;  3HKB E;  4BAY B;  2UU9 T;  4TUY E;  3I1A A;  2FUP A;  2BS2 A;  2I6H A;  2ZM2 A;  4PK6 A;  2JQH A;  4EIW A;  5DAB A;  5AQS B;  4AKG A;  2C0S A;  4IDP A;  1E2A A;  4B6X A;  2ZM8 A;  2K3W A;  2L8K A;  2UUC T;  2X67 A;  2OLT A;  2Y8D A;  3MJX A;  4YHJ A;  1XNR T;  5LOV E;  4MHC A;  3N2G E;  4A97 A;  5BMV E;  3AA7 B;  3TLU A;  1T7S A;  2LSY A;  5DQW A;  4QXH B;  2YKS A;  2B1E A;  2XAF B;  2LHR A;  4ILC A;  3S4U A;  2E9X B;  2J47 A;  3QB5 K;  1OWA A;  1ZP0 A;  5CA1 E;  3T1H T;  4H9Q C;  4O4L E;  2NW8 A;  4Q25 A;  4ZI2 D;  5AQU B;  3RC8 A;  2Q9Q A;  3I0Q A;  2OA5 A;  3ZN0 B;  1MIW A;  4V1A v;  4IL9 A;  4LF9 T;  5M4Y A;  1XMO T;  2QYW A;  2DNX A;  3EI0 A;  2XHE B;  5F5W A;  2LSJ A;  3P4S A;  5AQH B;  4IDO A;  4FJO A;  3AA0 B;  3O4X E;  3HKC E;  5JRE A; 
#chains in the Genus database with same CATH homology
 2ODV A;  4NUU A;  2CCQ A;  2HPJ A;  3K8P C;  3QC9 A;  3PE0 A;  2QA7 A;  2LSG A;  2HH7 A;  3PU3 A;  1D0X A;  2X51 A;  4OK0 A;  4ASK A;  1UX4 A;  4QX8 B;  4XBF B;  2DHR A;  5LHI B;  3NRY A;  3PUR A;  4EYU A;  3BQK A;  4P0B A;  3ZYL A;  3N9O A;  3ZEF B;  3ZPO A;  4HFV A;  4ZI3 C;  1MMA A;  5KX5 E;  2GK9 A;  5LNK A;  1WRD A;  4PJM A;  3VU7 H;  4DMV A;  3KVB A;  4PNI A;  4AKR B;  1QUU A;  2CA5 A;  4JEU B;  2NWB A;  1HG5 A;  3F57 A;  4ZI7 E;  3PUS A;  4ZHQ E;  5ADX L;  1UCU A;  4L0R A;  2KWH A;  2CEA A;  3AA6 B;  4L5G A;  3OKQ A;  2XUE A;  3IHR A;  5EK2 A;  2G0U A;  1QSD A;  3EUH A;  3AVR A;  5L2L A;  4BJN A;  2EHO D;  2WAU A;  3KBT A;  5FXX A;  1D0Y A;  4E7Z A;  5GON E;  2V26 A;  1BR0 A;  4H63 V;  2VKD A;  1YKE B;  3UFE A;  1HG2 A;  3U3I A;  1YD8 G;  5LCY A;  1LVK A;  3PUA A;  5JDG A;  2K9A A;  2LEH A;  5LBM A;  4CI2 B;  3GMI A;  3EVY A;  4WBO A;  3LFM A;  4PK4 A;  3LK3 B;  3NZP A;  3NBX X;  3AAI A;  1MMN A;  4K0U A;  3RYI E;  4OYJ A;  2XTL A;  3SS1 A;  5LYJ E;  3CML A;  2H7O A;  4UF0 B;  5IYZ E;  3RKO A;  2E9X D;  5EK3 A;  3ANW B;  3C51 A;  3C64 A;  4O4I E;  4AQG A;  3K3N A;  4J2C A;  3A5X A;  2XQY A;  2NP9 A;  3RRW A;  1LVF A;  2MYS A;  4PFP A;  2VB6 A;  4DVD A;  4H63 H;  1UX5 A;  1IJ6 A;  4H9N C;  3AA1 B;  2ODU A;  3ETU A;  1KNZ A;  3I9W A;  5JVD E;  2X9X A;  2Q9Q B;  2P9B A;  4TV8 E;  3SWH A;  3UUL A;  4KMC A;  3RYH E;  5L3E B;  3RPU A;  5LG4 A;  5LGT B;  1G8X A;  3C4X A;  3FHN A;  5LHG B;  5JH7 E;  3FB2 A;  4O4J E;  4XZC A;  2V7I A;  2LE8 A;  5IHY A;  3FBZ A;  2Q9Q C;  1O3X A;  3CQG B;  3CQX C;  5JDH A;  4CXX A;  2CXD A;  2K48 A;  2RA1 A;  4IE5 A;  4UVB B;  1V9D A;  3PUQ A;  3MKD A;  4P09 A;  2QGS A;  4EXT A;  2CWY A;  2WSS V;  4WW0 A;  3ZC1 A;  3GN5 B;  2Z6E A;  5L3B B;  3T8O A;  5JRC B;  4IE6 A;  2DCF A;  4ILU A;  3OJA A;  2KXP B;  3ONX A;  4UV8 B;  4JUY A;  3LK4 2;  3KIN B;  1FMW A;  3CX7 B;  5HYA A;  2DWK A;  4O8S A;  4ZI3 D;  2XAG B;  2LHN A;  4YLH A;  1HF8 A;  2MBG A;  1D1A A;  1ZHC A;  2KMF A;  3GA8 A;  1BR4 A;  2CWO A;  4BJM A;  1B7T A;  3N5L A;  2L3L A;  4DBQ A;  4PW8 A;  3CX8 B;  2V7M A;  1LRZ A;  1AJ3 A;  5CA0 E;  3MXZ A;  3B57 A;  2ZLY A;  3E22 E;  4GK0 E;  1MNE A;  4N78 D;  5H6R B;  3WAK A;  5HXH A;  2SPC A;  3I0O A;  2CE7 A;  1BR2 A;  2J1D G;  4YJ2 E;  3KV9 A;  5JR9 A;  2IW5 B;  2JPF A;  2V1D B;  5DJQ C;  4QHO A;  4EZ4 A;  3O1J A;  3ZJ2 A;  3P8C D;  3NZQ A;  4U74 A;  4GYS A;  3C98 B;  3KBU A;  3DJB A;  3HKE E;  4UEL A;  3J7Y q;  4C91 A;  4XAX B;  1Z0P A;  5HXC A;  3MAC A;  3ZJ1 A;  5KMG P;  3PUG A;  4I55 E;  4P0A A;  2A3D A;  2JMH A;  3KDS E;  3RX6 A;  4MBQ A;  1FEW A;  2YEV C;  3DTO A;  2LM9 A;  2WWU A;  4WBN E;  2HPL A;  1S35 A;  4NUV A;  3KV4 A;  4QKN A;  2X0L B;  3N9N A;  5C8Y E;  2KT9 A;  2LSI A;  3PDY A;  5LJN A;  2MTQ A;  2RP4 A;  2N1G A;  3I9Y A;  3ZMU B;  2BVL A;  2VWA A;  2YU2 A;  3U78 A;  4OYK A;  4CI3 B;  4AKI A;  3ZYK A;  5HXS A;  3VHL A;  3FXD B;  3O9X A;  4TZ4 C;  3OBV E;  2W0G A;  4JEH B;  1HS7 A;  1NAF A;  2VL8 A;  4ERR A;  4PJN A;  2Q9Q D;  3ZN1 B;  5HWX A;  1ZEE A;  2WMN A;  4IE7 A;  4DBR A;  3CPZ A;  3KV5 A;  4H9P C;  5FNV E;  1T98 A;  4BA9 A;  3K3O A;  2JMK A;  4H9S E;  2WM9 A;  2DLR A;  1WYC A;  4OFZ A;  2W63 A;  4QXB B;  2N9D A;  5EZY E;  5L3G B;  1MIY A;  3C4Z A;  2VKH A;  3PU8 A;  2LOS A;  4ANJ A;  4GYR A;  3KVA A;  2BZB A;  4IE4 A;  5LBQ B;  2XAQ B;  2X9Y A;  3P7I A;  2NW9 A;  2KIN B;  2KWI B;  2YU1 A;  2ES0 A;  2VK9 A;  3ZCJ A;  2X66 A;  3L09 A;  4A56 A;  2JJ9 A;  3CKD A;  2UXN B;  5HWY A;  2PBI A;  1D1B A;  3LJC A;  2JQQ A;  3Q2M A;  5FP3 A;  5J2U E;  4IGU A;  4M1P A;  2PJQ A;  4WNK A;  4X20 E;  3ZMZ B;  2XAH B;  3N9Q A;  2IAK A;  5L3F B;  2ZM0 A;  3BK9 A;  4TN7 B;  2YIN A;  1SA0 E;  2KND A;  1FMV A;  3LG7 A;  1D0Z A;  3IEE A;  4G63 A;  3L3P A;  5JDL A;  3GWH A;  3OYZ A;  5JR9 B;  3CX6 B;  5LJM A;  1X79 A;  3F31 A;  4PFO A;  4X1I E;  5CB4 E;  5FXZ A;  1MND A;  4ZOL E;  3EDV A;  2Y48 B;  4EOZ B;  5LGU B;  2NTY A;  2BDE A;  1FIO A;  2E8I A;  3K3Q C;  2CXL A;  3N9M A;  3KFW X;  3OYX A;  4ZS3 A;  5TAO A;  2LSK A;  4O4H E;  1YKH B;  4CI1 B;  3C50 A;  5AFU L;  5JR9 C;  1MMD A;  1MIV A;  2Y6X A;  3O1I A;  2D5U A;  3UT5 E;  1H7C A;  3Q5W A;  2VAS A;  3B13 A;  4OHF A;  5LXT E;  2BVM A;  2JRK A;  4G2A A;  1SHZ C;  3VKG A;  5KDM C;  4AQF A;  1VOM A;  3Q5X A;  1WR6 A;  2WBL A;  5FXW A;  3VKH A;  3V5S A;  1IAP A;  2V7J A;  3ETV A;  5HAX A;  4JLE A;  3EDU A;  3N9P A;  3CQC B;  3N2O A;  3M65 A;  5HXE A;  2ACX A;  3UUM A;  3BQL A;  3MZK B;  2EHO A;  2UXX B;  5J2T E;  2CM0 A;  1Y64 B;  3UUN A;  3ZCI A;  2N2N A;  4IHJ E;  3KV6 A;  3RYC E;  3UUX B;  4CQI A;  3AVS A;  2ZMA A;  3N2K E;  4HN9 A;  1G73 A;  3LBX A;  2C5J A;  3V5U A;  2WMO A;  5JDM A;  1D1C A;  4KP3 C;  4E7S A;  3WAJ A;  4I43 B;  5FY1 A;  2D2S A;  3ZC0 A;  2VKO A;  2IC6 A;  1VRB A;  3MK7 C;  3ZMT B;  3ZMV B;  2E9X A;  1NWM X;  3H37 A;  3AAA B;  2VKJ A;  1CUN A;  1U4Q A;  5ETW A;  1US7 B;  2D0T A;  4U72 A;  5FY0 A;  4IE0 A;  4MLK A;  3N9L A;  3QK6 A;  5FMN A;  4HKA A;  2LOP A;  3C4W A;  3DP7 A;  4C90 A;  2XAJ B;  2W62 A;  4IIJ E;  3RYF E;  3H3A A;  4AKL A;  3HA4 A;  4H9R C;  4HE8 A;  4CZZ B;  2XAS B;  1ZV4 X;  4UVC B;  4YFS A;  3R6N A;  4AKH A;  1HCI A;  2DWG A;  3CWZ B;  3E08 A;  4ZS2 A;  1IZN B;  4ZI2 C;  4GOU A;  4DO0 A;  2V7K A;  3Q9D A;  3IBP A;  3HKB E;  5JDF A;  4BAY B;  3RRC A;  4TUY E;  3ZLI A;  4F6R C;  2IC9 A;  3I1A A;  3HR0 A;  5F8P A;  3AB3 B;  4L9I A;  4EB6 E;  3R84 B;  2ZM2 A;  4PK6 A;  2H7V C;  5EK4 A;  2NOX A;  2YK0 A;  4UXN B;  3W15 B;  2CXF A;  4KUM B;  4AXP A;  4GK5 E;  2LT3 A;  3E0Z A;  3JC6 C;  4IDZ A;  4DND A;  4EIW A;  5DAB A;  3LK2 B;  4UIG A;  2MOZ A;  4AKG A;  2C0S A;  4HGA A;  3RC3 A;  4H9O C;  4X1Y E;  4B6X A;  4O2A E;  5E0O A;  4PJL A;  3SRZ A;  4UEM A;  2ZM8 A;  2L8K A;  1KK7 A;  3ZMS B;  3SOL A;  2L9Q A;  2X67 A;  1HFA A;  3ESL A;  1ZKE A;  2C5I T;  1YW0 A;  2D0U A;  2K5B B;  3PTR B;  2Y8D A;  3IF8 B;  4O2B E;  5J1G A;  3WI3 A;  5LGN B;  3TKL B;  3MJX A;  4YHJ A;  1OXZ A;  4HEA A;  5H6Q B;  1MMG A;  2CLY B;  4HTE A;  4I50 E;  4YJ3 E;  5LOV E;  2EHO B;  4MHC A;  4TV9 E;  2W61 A;  3D0T A;  4AQF C;  3N2G E;  3HI2 A;  5BMV E;  3UTK A;  4KBM B;  3AA7 B;  3LBX B;  3O1H A;  5JDN A;  4PAG A;  2I59 A;  2A72 A;  2LSY A;  4DMW A;  2V7L A;  3MA9 A;  2H3R A;  3J9X 1;  2CLY C;  5DQW A;  1HX8 A;  4Z8X A;  4QXH B;  5DQV A;  2EHO C;  2B1E A;  2XAF B;  2LHR A;  2CMR A;  1WLX A;  2PG8 A;  4QXC B;  4MFR A;  3S4U A;  4PK5 A;  5JDQ A;  5A1L A;  4UF0 A;  2E9X B;  3RH3 A;  3ANW A;  5L3D B;  4AI6 A;  1OWA A;  5HXR A;  2K24 A;  5CA1 E;  5F3J A;  5JQG E;  4H9Q C;  4O4L E;  2NW8 A;  2M67 A;  4FI5 A;  4X1K E;  4IST A;  2NTX A;  4ZI2 D;  3HL6 A;  2PFV A;  3FBL A;  3RC8 A;  2A2F X;  2C5K T;  2Q9Q A;  2DI4 A;  2E9X C;  3I0Q A;  2NW7 A;  4GIW A;  5FXV A;  2KLQ A;  2OA5 A;  1MIW A;  4V1A v;  3ZN0 B;  2X68 A;  4UV9 B;  3BQI A;  2KZ7 B;  3ZYM A;  1HTJ F;  4PJJ A;  5LHH B;  5M4Y A;  4QWN B;  5FYM A;  3FXE B;  4CXY A;  4CXW A;  3QUJ A;  1LKX A;  2DNX A;  2X9W A;  4EZH A;  4I4T E;  1E1H B;  3HKD E;  5LP6 E;  3JC6 D;  2XHE B;  4MAL A;  1IJ5 A;  2X9H A;  2LJL A;  4UVA B;  1BR1 A;  3CVR A;  3F2E A;  2LSJ A;  5L3C B;  3GN5 A;  5LA6 E;  4QX7 B;  1U5P A;  3NRX A;  1S94 A;  4ADZ A;  5FY7 A;  4FJO A;  3AA0 B;  4EAH A;  5JRC A;  3O4X E;  3HKC E;  4TX5 A;  1WYB A;  3AAE B;  4EYY R;  4ISS A;  1EZ3 A;  2W00 A;  5JRE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...