2VKOA

Structure of the soluble domain of the membrane protein tm1634 from thermotoga maritima
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
104
structure length
104
Chain Sequence
HMNLAVKLTRMEKTLKAYELYIFSDYENFENYVKKEGLKIEGMELLKEKKARSLIAEGKDLFETANYGEALVFFEKALNLSDNEEIKKIASFYLEECRKKLAGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and Ligand Binding of the Soluble Domain of a Thermotoga Maritima Membrane Protein of Unknown Function Tm1634.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Membrane protein
molecule keywords TM1634
total genus 44
structure length 104
sequence length 104
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-12-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.2030 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2vkoA00
2VKOA 2VKJA
chains in the Genus database with same CATH superfamily
1UCUA 2EHOD 1NEKA 3ZT5A 2UU9T 2BVMA 2V7KA 2OV9A 2Y6XA 3I0QA 3P4PA 1LRZA 2YKSA 5AQNB 3V5SA 3UU5A 4DR7T 2BS2A 1U4QA 2E9XB 2MAWA 5LG3A 3IF8B 1VCSA 2VURA 3JAEA 4HWHA 5ADXL 3NRYA 4DV7T 3P4WA 2CWYA 2Q9QA 4IE0A 3GWHA 3KVBA 2W66A 1FIOA 1WLXA 2LM2A 3ZYLA 2JQ9A 2V7JA 4HFHA 4Z8XA 3UU4A 3TLWA 4HWFA 4GIWA 4DNDA 4ISTA 2HN1A 4DBQA 5FXZA 4BAYB 2CHNA 3TLTA 3T1HT 3I0OA 4L9IA 4UF0A 3N5LA 2J4GA 2AE9A 3LK42 3IEEA 2LM9A 4FI5A 4YHJA 2LSKA 1B7TA 5AQJB 1W0AA 2W61A 1NENA 3L39A 4IE4A 4KMCA 5AQIB 2CMRA 3LFMA 4TV9E 4J2CA 3UT5E 3E22E 5JREA 4EZHA 5LMUT 4JI8T 3AE6A 2ZMAA 4IDZA 3RRWA 3UFGA 4B6XA 1MMDA 5F5WA 3ZMTB 3T1YT 2RP4A 2L8KA 4HE8A 4LF8T 4JI5T 4GOUA 2D0UA 2MOZA 1SA0E 2BS3A 2K24A 2OLTA 4PK6A 4QXCB 1BR4A 3ZMSB 5ABFA 4YJ3E 4DV5T 5HCMA 4HEAA 3UULA 1OWAA 1SE7A 1D1BA 2C5JA 2EHOA 3GA8A 3MJXA 3O1JA 4IE6A 5EZYE 5FXXA 5LBMA 1HS7A 4B3RT 3HKBE 3NVOA 2H3RA 5FY7A 1HX8A 2H7OA 4K0UA 4JLEA 4MHCA 4X66T 1N34T 2UUBT 2X51A 4H9NC 3TLUA 5LHIB 2EHOC 2A2FX 2YK0A 3WAJA 2E8IA 1G73A 2I59A 3CX6B 4QWNB 4WW0A 5LG4A 1HCIA 5ABFB 1J1JA 2XASB 3PU8A 1GQEA 2HPJA 4LF4T 1AJ3A 4OX9T 1WR0A 3A7MA 1YQ3A 3ZN1B 1MIVA 2N1GA 2YDQA 5FVKA 2X0HA 2XJ7A 3PUYF 5DQWA 5IYZE 3LDQB 3HA4A 2V8SV 3AAIA 2KNDA 2LE8A 2W4XA 3D0TA 4QHOA 2DLRA 4ZI3C 5LGTB 3VKHA 2DWKA 1CUNA 4ISSA 5ABHA 4YTPA 3ZKRA 4AKRB 4F8HA 2ZM0A 4UV8B 3MK7C 5HXSA 2XQ5A 4ZS3A 3QOFA 4Q25A 2J1DG 2C5KT 2CM0A 1OEDE 1XDOA 4YHHT 3KBTA 3KVAA 3ONJA 2JMKA 2BS4A 1WYBA 3ESLA 1HG5A 1MIWA 2BG9E 3KINB 4PJJA 5C8YE 4U3CA 2E5LT 4AI6A 1T72A 2XAJB 2NWBA 4OFZA 4UVAB 4EB6E 3QC9A 2ODUA 1JNRA 2NR4A 1E1HB 2CE7A 3SOLA 2CEAA 3O4XE 2XQ3A 3AAEB 3NWIA 4LF6T 4H63H 4CXYA 2XPKA 4KUMB 3ZT7A 1IAPA 2CCQA 2BBHA 2BKPA 3QB5K 4X64T 3WAKA 2BG9C 2W67A 4AQGA 1XNQT 1MIYA 3NRXA 2V6XA 4P1NA 2BKOA 2JMHA 4I55E 4B3TT 5LGUB 3KDSE 4IREA 3ETVA 3LK2B 2FBWA 2E9XC 2B76A 4HWIB 4TUYE 4HFEA 2H7VC 5L3GB 3KV5A 2NW8A 1D0YA 3AXJA 4H9QC 1W09A 2WMNA 4YFSA 3MA9A 4HN9A 5DABA 4X65T 2Y48B 5AQHB 5HWYA 2V26A 1WCRA 5LNKA 3OKQA 5AQMB 4IT4A 2UUCT 3ZEFB 5L3BB 4O4HE 4O8SA 3FZLB 1SUMB 3F31A 4I4TE 4LMKA 2YU1A 5JH7E 4EEBA 5BMVE 4H9PC 1HNXT 2JJ9A 3AAAB 3BK9A 4V1Av 4KHPT 2ZM6T 4JI3T 4Z90A 3EI0A 2DL1A 2LSYA 3RQUA 1ZP0A 3BQLA 3X1DA 1KNZA 2DHRA 2KINB 3HKDE 2V6YB 4ASKA 3J7Yq 5HWXA 1HNWT 4UXNB 1VRBA 1YKHB 3RQWA 3ZCJA 2A3DA 1VOMA 2BBJA 2BDEA 5AQUB 2MYSA 2C0SA 3I9YA 3LJCA 2W00A 1IZNB 4DVDA 2KXPB 1MNEA 2WZHA 2XSAA 3EAMA 3OYXA 3UU3A 3VR8A 4DR1T 4BJMA 1HX1B 4LMLA 2K3WA 2W0GA 5FY0A 5F3JA 1KK7A 3Q5EA 4NIQA 3KFWX 3I1AA 4NUUA 2PFVA 4YSZA 4HWDA 4KP3C 5EK3A 2X9HA 4TN7B 5LJNA 3AA7B 2WS3A 2B1EA 1X79A 4JYAT 4PW8A 2I6HA 3P50A 4U74A 4UEMA 4DMVA 3OTOT 1UX5A 3OJAA 1L0VA 4IDOA 4AKLA 3CQCB 3QK6A 5A1LA 4MLKA 4EZ4A 4IDPA 5L3CB 2X9WA 4H9SE 5E0OA 3IBPA 2LEHA 2BG9A 2C5IT 4IE7A 4JEHB 4KHZF 4HFIA 3VR9A 4CN1A 4QH5A 4TV8E 1QSDA 5KXJA 3AA6B 4ILBA 1ZEEA 4JV5T 3N9LA 2Q9QC 3ZPOA 3AA0B 2WSSV 2NW9A 1MMAA 3N9OA 3UU6A 4KX6A 3NZQA 2UUAT 1VCTA 4OHFA 5AQFB 5CA1E 4OYKA 2PJQA 4ADZA 4P0BA 4CXXA 4IGUA 3HI2A 2KWHA 4IL9A 4ZZBA 1V9DA 2FJDA 3K3NA 4ANJA 3MZKB 4I43B 1N32T 2MTQA 2FJBA 3C4ZA 5C3JA 1FMWA 4QXBB 1MMGA 4UVBB 2IC6A 3LSVA 4DV4T 1OEDA 3OYZA 3G06A 3N9NA 3KV9A 2D0TA 3RIAA 3RYIE 4DO0A 2XY8B 2WDQA 3QNUA 2D5UA 4O4JE 2IAKA 2YINA 4JI2T 3T8OA 2W63A 2WP9A 5FL1A 5LMNT 4B3MT 2CLYB 4EEDA 4IL4A 2Y8DA 3UUNA 4A97A 2QYWA 3AE1A 2NP9A 3EUHA 1N33T 2CBJA 5JRCA 3Q9DA 2UXXB 2I0MA 3RC3A 4JBWF 1KNPA 2CA5A 3L3PA 2XAHB 2WU2A 3B5MA 4N78D 3ZYKA 2VKOA 4EOZB 3EHZA 3GMIA 4PFOA 2X67A 3IHRA 1XMOT 2CRBA 5LJMA 1UGOA 4X1YE 1KEYA 4XZCA 5JVDE 1HFAA 5J2UE 3L8RA 2XQ7A 3ETUA 5HXRA 4EGWA 3AE5A 2LOPA 2HN2A 3JAFA 3SFDA 4A5XA 2NOXA 2YEVC 2UXBT 2V5DA 2XQAA 1YQ4A 2XUEA 3FZMB 2KZ7B 3RIFA 3TLVA 4GK5E 4YJ2E 3Q2MA 2NW7A 1KF6A 3PJAA 5LOVE 1U5PA 2V7LA 4CI3B 3P4SA 2WBLA 5AQPB 5FYMA 2A9UA 2WB5A 3JCFA 3P7IA 2JPFA 4WZXA 4ZS2A 5KMGP 1OXZA 1MNDA 2DWGA 5ETWA 3C98B 2BZBA 5JDFA 4CQIA 5CA0E 2F4VT 4DR4T 2BVLA 5CGMA 5LYJE 1YW0A 1DU2A 2VVSA 3ZSSA 4OK0A 4TZ4C 1WFDA 1T7SA 4JI7T 3ONXA 4AXPA 5FXVA 3VRBA 3O9XA 4WNKA 2K48A 4UF0B 2FUPA 3ABVA 3C4WA 3L09A 5IUXA 3JADA 1XNRT 2WWVA 4UR9A 4EV6A 4HFDA 3RKGA 3CWZB 3ZC1A 1D0ZA 5TAOA 4EAHA 5AQGB 3DTOA 3RPUA 4CXWA 4LFCT 3IA3A 2QVAA 3DJBA 3QUJA 4DV6T 3MXZA 3N9QA 2CXDA 1UUSA 3CK6A 3RC8A 2H88A 4AKIA 2IDOB 1XWMA 2ACXA 3N9MA 3N2OA 5AQQB 4CZZB 2D9DA 2WWUA 2UXNB 2K5BB 2XAGB 1T8BA 3H3MA 3CVRA 4PK5A 5L3FB 1QLBA 5JQGE 2SPCA 4PK4A 4Z91A 3R6NA 3FHNA 4QH4A 5IWAT 1N36T 4PJMA 1YXRA 1WRDA 4JI1T 3AEEA 4HTEA 4LFAT 2IIUA 4QX8B 3RF1A 1M62A 5HXEA 2LRLA 2IC9A 4YLHA 3RIUA 3NKZA 2X68A 3AVRA 4UELA 4E7SA 2CPTA 2ZLYA 5JR9A 4CN4A 2X0LB 2JRKA 2JIWA 3AE7A 4NUVA 5HAXA 3BQIA 3PU3A 4G63A 2LSGA 4PJNA 4TWFA 4YTNA 3NBXX 5KDMC 4F6RC 2IHR1 4LMJA 1XDPA 1S94A 2DCFA 3N9PA 3ZJ2A 4HGAA 5DQVA 4X5TA 4PJLA 5JDQA 1UX4A 2M6IA 2XTLA 3RRCA 5J1GA 4DMWA 4O2AE 1E7PA 5H6RB 4AQFC 3RI5A 2P9BA 2WDVA 2WZIA 3UFEA 4XAXB 1JNZA 1BR2A 3OPCA 1FEWA 1H7CA 4KI0F 4EIWA 1IJ6A 2E2AA 3SWHA 3BQKA 5JR9C 1KNRA 2AXDS 2XQ6A 3HL6A 4YY3T 4U72A 5AFUL 1Z0PA 2X9YA 4GKJT 2M6BA 4O2BE 4QX7B 3CQGB 5L3DB 4YT0A 3EVYA 2HHHT 3ZC0A 4ZHQE 4HFVA 4EYYR 1HF8A 5HXHA 4U33A 4AKGA 3E0ZA 5JDLA 4U7YA 3LG7A 3AXJB 3PUVF 1UURA 4X20E 5FVLA 2YDRA 4XBFB 1E2AA 2CBIA 2ACZA 2VKDA 2XAQB 2DI4A 4GYSA 5L3EB 4LF5T 5LBQB 1ZOYA 2LT3A 1D0XA 1FMVA 2CXFA 2JQQA 1LVFA 3Q5WA 4H63V 3PUAA 4FJOA 3C50A 4H9OC 3RX6A 1ZHCA 4L5GA 3RYHE 2VVNA 2L3LA 3S4UA 5JTGA 5HEGA 3UUXB 1W0BA 3UUBA 4ZI2D 3FBLA 4DR2T 3LBXA 3E08A 5DJQC 3PV0F 3VKGA 5FL0A 3HKCE 5LCYA 5HEOA 1J5ET 1HTJF 4ILCA 2XHEB 1FJGT 4BJNA 2QGSA 4JUYA 5AQRB 4QXHB 1SHZC 3LK3B 4C90A 3WI3A 5EK2A 3CX8B 1QUUA 3VHLA 2VWAA 4O4LE 2WQYA 2WDRA 3A5XA 2HH7A 1XMQT 1HNZT 2V1DB 4ILAA 3ZYMA 3HR0A 5CFBA 1X9BA 2J47A 2WU5A 3F57A 2UXDT 3O1HA 4H9RC 5GONE 2R6GF 5HEHA 3CQXC 5ABEA 4JI6T 4MBQA 4IIJE 4KBMB 4ZI3D 3C64A 2QA7A 4M1PA 4DUYT 5FNVE 2D2SA 2KMFA 3AEFA 5JDHA 4X62T 2BKNA 3FB2A 2PG8A 3UTKA 2M67A 3FXEB 2XZEA 4IDNA 3CMLA 3U78A 5IHYA 1WYCA 1J5WA 3AE8A 2VKHA 4GK0E 4IHJE 5H6QB 4ZXLA 5HEJA 2VK9A 5JDNA 5J0ZA 2LHRA 2N9DA 1D1AA 2RA1A 2X0YA 4QKNA 4MFRA 4AQFA 3PUXF 3UUMA 2DNXA 4NXNT 5AQLB 3K3QC 3C4XA 3PUQA 4A56A 4IDQA 3PUWF 2J62A 2NTYA 4CN6A 3Q5DA 3ZLIA 5JDGA 2WMOA 4UIGA 2E9XD 3AEDA 3ZT6A 2KLQA 2XM1A 4WYVA 4A98A 3P4RA 3A8YC 3OVUA 3N2KE 4C91A 5FP3A 2MPKA 1D1CA 4I0UA 4DV0T 3FXDB 1IBMT 5LA6E 4LFBT 4ZI2C 1M7KA 4E7ZA 4HKAA 2KSRA 3ONLC 1EZ3A 4MALA 4LF9T 3NZPA 4PAGA 5LXTE 2PTFA 2YN6A 4OYJA 4DR3T 2Z6EA 2ES0A 4GKKT 3PTRB 4HFCA 2LRKA 2VKJA 3AECA 4P09A 3HKEE 2H89A 3M3ZB 3RHWA 3AE2A 2IUBA 3KV4A 4TNWA 4WBOA 2LKHA 4DIDB 5FKYA 2V7IA 4K0KT 1Z8UA 5L47A 3RH3A 3RYFE 4TNVA 1BR0A 1WR6A 2LOSA 4ZEYA 4QH1A 1S35A 4PNIA 3TKLB 1YKEB 3UU8A 1I6ZA 2Q9QB 2FJAA 2PBIA 4HWCA 1HR0T 2WM9A 3ZN0B 3LBXB 1LKXA 3M65A 1G8XA 4JEUB 4PFPA 4UV9B 4ZOLE 2IW5B 4U2ZA 3RLFF 4EXTA 2MBGA 2EHOB 3K1SA 3AE4A 3R84B 3CPZA 4YSYA 2RPAA 3MKDA 1Y64B 3N2GE 4ZI7E 2VQFT 2E9XA 3ZJ1A 2VL0A 3ZMZB 1OEDB 2W2UA 3H37A 3UQ4A 1R8IA 3FBZA 5JDMA 2Q9QD 3AA1B 2XAFB 5FMNA 4DBRA 3AEBA 5LB7B 2W62A 3AE3A 2NTXA 5L2LA 3FZKB 3U3IA 2XQ8A 3RYCE 3RKOA 2A72A 2JQKA 2YDSA 3ZMVB 4ZZCA 2VL8A 3CIRA 3FZHB 2KT9A 4TX5A 5HYAA 3ANWB 5C2TA 2XQ4A 3K8PC 4AISA 5M4YA 5KX5E 1IBLT 4GYRA 3RIUC 4UVCB 2ZM8A 2ZM2A 4AQYT 5FY1A 3O1IA 5LHGB 2JQHA 1IBKT 5CB4E 2X66A 4CI1B 1XZYA 3P4QA 1IJ5A 2XQ9A 4YTMA 4YSXA 2KWIB 1KFYA 2CHOA 4DR6T 2BG9B 2VASA 2V6YA 4WBNE 5F8PA 4ERRA 5BR8T 4IE5A 1HG2A 4YXDA 3OBVE 3PDYA 3VU7H 1YD8G 3AB3B 5EK4A 2N2NA 3EDVA 4LF7T 5L4EA 2LHNA 4DV3T 2IMLA 2VB6A 3PJAJ 1OEDC 4P0AA 2OA5A 3H3AA 2QRXA 3KBUA 2XQYA 5AQVB 5AQKB 5FXWA 4B3ST 3CKDA 5JR9B 3CX7B 4ILUA 1CHUA 1W9RA 2E5VA 2LKGA 3I9WA 4HFBA 4U31A 5AQSB 5HCJA 5L4HA 3PUZF 2LSIA 3J9X1 5AQTB 3VRAA 4CI2B 3UQ7A 5JRCB 1BR1A 2G0UA 3GN5B 3ZCIA 4EYUA 2K9AA 1ZKEA 3GN5A 4AKHA 4U2YA 3PUGA 2V5CA 4DV2T 1NWMX 3SFEA 5HEUA 4JI4T 2GK9A 2XSBA 3QB5A 4G2AA 5LGNB 1Y01A 2XM2A 5LP6E 5ABGA 3RGLA 4DR5T 5HXCA 3JC6C 3C51A 2VQET 3FZFB 2HPLA 4NPPA 1US7B 3EDUA 3PURA 5LHHB 3SRZA 2WY2A 2YU2A 3B57A 4I50E 2LJLA 3V5UA 2WCAA 2FJEA 3MACA 3ZSTA 4BA9A 3JC6D 1UK5A 4TWHA 3PUSA 3P8CD 3AEGA 1ZV4X 5AQOB 1MMNA 3DP7A 2X9XA 3AEAA 4AIUA 2LLYA 4U7IA 3B13A 2CLYC 3EABA 3SS1A 1LVKA 2ODVA 5CJ5A 3K3OA 3W15B 4DV1T 4L0RA 4DUZT 4X1KE 4JI0T 2CWOA 4NXMT 1I94T 3PE0A 4TWDA 3ANWA 2WAUA 3AE9A 3KV6A 1NAFA 4X1IE 3ZMUB 1O3XA 2L9QA 2YOEA 4COFA 4O4IE 5J2TE 3F2EA 3TLSA 3AVSA 2UXCT 2CXLA 2V7MA 2LSJA 3Q5XA 1T98A
chains in the Genus database with same CATH topology
1UCUA 2EHOD 2BVMA 2V7KA 2Y6XA 3I0QA 1LRZA 3V5SA 2E9XB 1U4QA 1AJ3A 3IF8B 5ADXL 3NRYA 2CWYA 2Q9QA 4IE0A 3GWHA 3KVBA 1FIOA 1WLXA 3ZYLA 2V7JA 4Z8XA 4GIWA 4DNDA 4ISTA 4DBQA 5FXZA 4BAYB 3I0OA 4L9IA 4UF0A 3N5LA 4YHJA 3LK42 3IEEA 2LM9A 4FI5A 2LSKA 1B7TA 2W61A 4IE4A 4KMCA 2CMRA 3LFMA 4TV9E 4J2CA 3UT5E 3E22E 5JREA 4EZHA 4IDZA 2ZMAA 3RRWA 4B6XA 1MMDA 3ZMTB 2RP4A 2L8KA 4HE8A 4GOUA 2D0UA 2MOZA 1SA0E 2K24A 4PK6A 4QXCB 1BR4A 3ZMSB 4YJ3E 3UULA 4HEAA 1OWAA 5EZYE 1D1BA 2C5JA 2EHOA 3GA8A 3MJXA 3O1JA 4IE6A 5FXXA 5LBMA 1HS7A 3HKBE 5FY7A 2H3RA 1HX8A 2H7OA 4K0UA 4JLEA 4MHCA 2X51A 4H9NC 5LHIB 2EHOC 2A2FX 2YK0A 3WAJA 2E8IA 1G73A 2I59A 3CX6B 4QWNB 4WW0A 5LG4A 1HCIA 2XASB 3PU8A 2HPJA 3ZN1B 1MIVA 2N1GA 5DQWA 5IYZE 3HA4A 3AAIA 3D0TA 2KNDA 2LE8A 4QHOA 4ZI3C 3VKHA 2DLRA 5LGTB 2DWKA 1CUNA 4ISSA 4AKRB 2ZM0A 4UV8B 3MK7C 5HXSA 4ZS3A 2J1DG 2C5KT 2CM0A 3KBTA 3KVAA 2JMKA 3KINB 1WYBA 3ESLA 1HG5A 1MIWA 4AI6A 4PJJA 5C8YE 2XAJB 2NWBA 4OFZA 4UVAB 4EB6E 3QC9A 2ODUA 1E1HB 2CE7A 3SOLA 2CEAA 3O4XE 3AAEB 4H63H 4CXYA 4KUMB 1IAPA 2CCQA 3WAKA 4AQGA 1MIYA 3NRXA 4I55E 2JMHA 5LGUB 3KDSE 3ETVA 3LK2B 2E9XC 4TUYE 2H7VC 5L3GB 3KV5A 2NW8A 1D0YA 4H9QC 2WMNA 4YFSA 3MA9A 4HN9A 5DABA 2Y48B 5HWYA 2V26A 5LNKA 3OKQA 3ZEFB 5L3BB 4O4HE 4O8SA 3F31A 4I4TE 2YU1A 5JH7E 5BMVE 4H9PC 2JJ9A 3AAAB 3BK9A 4V1Av 2LSYA 3BQLA 1KNZA 2DHRA 2KINB 3HKDE 4ASKA 3J7Yq 5HWXA 4UXNB 1VRBA 1YKHB 3ZCJA 2A3DA 1VOMA 2BDEA 2MYSA 2C0SA 3I9YA 3LJCA 2W00A 1IZNB 4DVDA 2KXPB 1MNEA 3OYXA 4BJMA 5FY0A 2W0GA 5F3JA 1KK7A 3KFWX 3I1AA 4NUUA 2PFVA 4KP3C 5EK3A 2X9HA 4TN7B 5LJNA 3AA7B 2B1EA 1X79A 4PW8A 4U74A 4UEMA 4DMVA 1UX5A 3OJAA 4AKLA 3CQCB 3QK6A 5A1LA 4MLKA 4EZ4A 5L3CB 2X9WA 4H9SE 5E0OA 3IBPA 2LEHA 4IE7A 2C5IT 4JEHB 4TV8E 1QSDA 3AA6B 1ZEEA 3N9LA 2Q9QC 3ZPOA 3AA0B 2WSSV 2NW9A 1MMAA 3N9OA 3NZQA 5CA1E 4OHFA 4OYKA 2PJQA 4ADZA 4P0BA 4CXXA 4IGUA 3HI2A 2KWHA 1V9DA 3K3NA 4ANJA 3MZKB 4I43B 2MTQA 3C4ZA 1FMWA 4QXBB 1MMGA 4UVBB 2IC6A 3OYZA 3N9NA 3KV9A 2D0TA 3RYIE 4DO0A 2D5UA 4O4JE 2IAKA 2YINA 3T8OA 2W63A 2CLYB 2Y8DA 3UUNA 2NP9A 3EUHA 3Q9DA 2UXXB 3RC3A 3ZYKA 2CA5A 3L3PA 2XAHB 4N78D 2VKOA 4EOZB 3GMIA 4PFOA 2X67A 3IHRA 5LJMA 4X1YE 4XZCA 5JVDE 1HFAA 5J2UE 5HXRA 3ETUA 2LOPA 2NOXA 2YEVC 2XUEA 2KZ7B 4GK5E 4YJ2E 3Q2MA 2NW7A 5LOVE 1U5PA 2V7LA 4CI3B 2WBLA 5FYMA 3P7IA 4ZS2A 2JPFA 5KMGP 1OXZA 1MNDA 2DWGA 5ETWA 3C98B 2BZBA 5JDFA 5CA0E 2BVLA 5LYJE 1YW0A 4OK0A 4TZ4C 3ONXA 4AXPA 5FXVA 3O9XA 4WNKA 2K48A 4UF0B 3C4WA 3L09A 3CWZB 3ZC1A 1D0ZA 5TAOA 4EAHA 3DTOA 3RPUA 4CXWA 3DJBA 3QUJA 3MXZA 3N9QA 2CXDA 3RC8A 4AKIA 3N9MA 2ACXA 3N2OA 4CZZB 4PK5A 2WWUA 2UXNB 2K5BB 2XAGB 5L3FB 3CVRA 2SPCA 4PK4A 3R6NA 3FHNA 4PJMA 1WRDA 4HTEA 4QX8B 5HXEA 2IC9A 4YLHA 4E7SA 2X68A 3AVRA 4UELA 2ZLYA 5JR9A 2X0LB 2JRKA 5HAXA 4NUVA 3BQIA 3PU3A 4G63A 2LSGA 4PJNA 5KDMC 3NBXX 4F6RC 1S94A 2DCFA 3N9PA 3ZJ2A 4HGAA 5DQVA 5JDQA 4PJLA 1UX4A 3RRCA 2XTLA 5J1GA 4DMWA 4O2AE 5H6RB 4AQFC 2P9BA 3UFEA 5JQGE 4XAXB 1BR2A 4EIWA 1FEWA 1H7CA 1IJ6A 3SWHA 3BQKA 5JR9C 3HL6A 4U72A 5AFUL 1Z0PA 2X9YA 4O2BE 4QX7B 3CQGB 5L3DB 3EVYA 3ZC0A 4ZHQE 4HFVA 4EYYR 1HF8A 5HXHA 4AKGA 3E0ZA 5JDLA 3LG7A 4X20E 4XBFB 2VKDA 2XAQB 2DI4A 4GYSA 5L3EB 5LBQB 1D0XA 2LT3A 1FMVA 2CXFA 2JQQA 1LVFA 3Q5WA 4H63V 3PUAA 4FJOA 3C50A 4H9OC 3RX6A 1ZHCA 4L5GA 3RYHE 3S4UA 2L3LA 3UUXB 4ZI2D 3FBLA 3LBXA 3E08A 5DJQC 3VKGA 3HKCE 5LCYA 1HTJF 2XHEB 4BJNA 2QGSA 4JUYA 4C90A 4QXHB 1SHZC 3LK3B 3WI3A 5EK2A 3CX8B 1QUUA 3VHLA 2VWAA 4O4LE 3A5XA 2HH7A 2V1DB 3ZYMA 3HR0A 3F57A 3O1HA 4H9RC 5GONE 3CQXC 4MBQA 4IIJE 4KBMB 4ZI3D 3C64A 2QA7A 4M1PA 5FNVE 2D2SA 2KMFA 5JDHA 3FB2A 2PG8A 3UTKA 2M67A 3FXEB 3CMLA 3U78A 5IHYA 1WYCA 2VKHA 4GK0E 4IHJE 5H6QB 2VK9A 5JDNA 2LHRA 2N9DA 1D1AA 2RA1A 4QKNA 4MFRA 4AQFA 3UUMA 2DNXA 3K3QC 3C4XA 3PUQA 4A56A 2NTYA 3ZLIA 5JDGA 2WMOA 4UIGA 2E9XD 2KLQA 4C91A 3N2KE 5FP3A 1D1CA 3FXDB 5LA6E 4ZI2C 4E7ZA 4HKAA 1EZ3A 4MALA 3NZPA 4PAGA 5LXTE 4OYJA 2Z6EA 2ES0A 3PTRB 4P09A 2VKJA 3HKEE 3KV4A 4WBOA 2V7IA 3RH3A 3RYFE 1BR0A 1WR6A 2LOSA 1S35A 4PNIA 3TKLB 1YKEB 2Q9QB 2PBIA 2WM9A 3ZN0B 3LBXB 1LKXA 3M65A 1G8XA 4JEUB 4PFPA 4UV9B 4ZOLE 2IW5B 4EXTA 2MBGA 2EHOB 3R84B 3CPZA 3MKDA 1Y64B 3N2GE 4ZI7E 2E9XA 3ZJ1A 3ZMZB 3H37A 3FBZA 5JDMA 2Q9QD 3AA1B 2XAFB 5FMNA 4DBRA 2W62A 2NTXA 5L2LA 3U3IA 3RYCE 3RKOA 2A72A 3ZMVB 2VL8A 4TX5A 2KT9A 5HYAA 3ANWB 3K8PC 5M4YA 5KX5E 4GYRA 4UVCB 2ZM8A 2ZM2A 5FY1A 3O1IA 5LHGB 5CB4E 2X66A 4CI1B 1IJ5A 2KWIB 2VASA 4WBNE 5F8PA 4ERRA 4IE5A 1HG2A 3OBVE 3PDYA 3VU7H 1YD8G 3AB3B 5EK4A 2N2NA 3EDVA 2LHNA 2VB6A 4P0AA 2OA5A 3H3AA 3KBUA 2XQYA 5FXWA 3CKDA 5JR9B 3CX7B 4ILUA 3I9WA 4CQIA 5JRCA 3J9X1 4CI2B 2LSIA 5JRCB 4AKHA 3GN5B 1BR1A 2G0UA 3ZCIA 4EYUA 3GN5A 2K9AA 1ZKEA 3PUGA 1NWMX 2GK9A 4G2AA 5LGNB 5LP6E 5HXCA 3JC6C 3C51A 2HPLA 5LHHB 3EDUA 1US7B 3PURA 3SRZA 2YU2A 3B57A 4I50E 2LJLA 3V5UA 3MACA 4BA9A 3JC6D 3PUSA 3P8CD 1ZV4X 1MMNA 3DP7A 2X9XA 3B13A 2CLYC 3SS1A 1LVKA 2ODVA 3K3OA 3W15B 4L0RA 4X1KE 2CWOA 3PE0A 3ZMUB 3ANWA 2WAUA 3KV6A 4X1IE 1NAFA 1O3XA 2L9QA 5J2TE 4O4IE 3F2EA 3AVSA 2CXLA 2V7MA 2LSJA 3Q5XA 1T98A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VKO A;  2VKJ A; 
#chains in the Genus database with same CATH topology
 1UCU A;  2EHO D;  1NEK A;  3ZT5 A;  2UU9 T;  2BVM A;  2V7K A;  2OV9 A;  2Y6X A;  3I0Q A;  3P4P A;  1LRZ A;  2YKS A;  5AQN B;  3V5S A;  3UU5 A;  4DR7 T;  2BS2 A;  1U4Q A;  2E9X B;  2MAW A;  5LG3 A;  3IF8 B;  1VCS A;  2VUR A;  3JAE A;  4HWH A;  5ADX L;  3NRY A;  4DV7 T;  3P4W A;  2CWY A;  2Q9Q A;  4IE0 A;  3GWH A;  3KVB A;  2W66 A;  1FIO A;  1WLX A;  2LM2 A;  3ZYL A;  2JQ9 A;  2V7J A;  4HFH A;  4Z8X A;  3UU4 A;  3TLW A;  4HWF A;  4GIW A;  4DND A;  4IST A;  2HN1 A;  4DBQ A;  5FXZ A;  4BAY B;  2CHN A;  3TLT A;  3T1H T;  3I0O A;  4L9I A;  4UF0 A;  3N5L A;  2J4G A;  2AE9 A;  3LK4 2;  3IEE A;  2LM9 A;  4FI5 A;  4YHJ A;  2LSK A;  1B7T A;  5AQJ B;  1W0A A;  2W61 A;  1NEN A;  3L39 A;  4IE4 A;  4KMC A;  5AQI B;  2CMR A;  3LFM A;  4TV9 E;  4J2C A;  3UT5 E;  3E22 E;  5JRE A;  4EZH A;  5LMU T;  4JI8 T;  3AE6 A;  2ZMA A;  4IDZ A;  3RRW A;  3UFG A;  4B6X A;  1MMD A;  5F5W A;  3ZMT B;  3T1Y T;  2RP4 A;  2L8K A;  4HE8 A;  4LF8 T;  4JI5 T;  4GOU A;  2D0U A;  2MOZ A;  1SA0 E;  2BS3 A;  2K24 A;  2OLT A;  4PK6 A;  4QXC B;  1BR4 A;  3ZMS B;  5ABF A;  4YJ3 E;  4DV5 T;  5HCM A;  4HEA A;  3UUL A;  1OWA A;  1SE7 A;  1D1B A;  2C5J A;  2EHO A;  3GA8 A;  3MJX A;  3O1J A;  4IE6 A;  5EZY E;  5FXX A;  5LBM A;  1HS7 A;  4B3R T;  3HKB E;  3NVO A;  2H3R A;  5FY7 A;  1HX8 A;  2H7O A;  4K0U A;  4JLE A;  4MHC A;  4X66 T;  1N34 T;  2UUB T;  2X51 A;  4H9N C;  3TLU A;  5LHI B;  2EHO C;  2A2F X;  2YK0 A;  3WAJ A;  2E8I A;  1G73 A;  2I59 A;  3CX6 B;  4QWN B;  4WW0 A;  5LG4 A;  1HCI A;  5ABF B;  1J1J A;  2XAS B;  3PU8 A;  1GQE A;  2HPJ A;  4LF4 T;  1AJ3 A;  4OX9 T;  1WR0 A;  3A7M A;  1YQ3 A;  3ZN1 B;  1MIV A;  2N1G A;  2YDQ A;  5FVK A;  2X0H A;  2XJ7 A;  3PUY F;  5DQW A;  5IYZ E;  3LDQ B;  3HA4 A;  2V8S V;  3AAI A;  2KND A;  2LE8 A;  2W4X A;  3D0T A;  4QHO A;  2DLR A;  4ZI3 C;  5LGT B;  3VKH A;  2DWK A;  1CUN A;  4ISS A;  5ABH A;  4YTP A;  3ZKR A;  4AKR B;  4F8H A;  2ZM0 A;  4UV8 B;  3MK7 C;  5HXS A;  2XQ5 A;  4ZS3 A;  3QOF A;  4Q25 A;  2J1D G;  2C5K T;  2CM0 A;  1OED E;  1XDO A;  4YHH T;  3KBT A;  3KVA A;  3ONJ A;  2JMK A;  2BS4 A;  1WYB A;  3ESL A;  1HG5 A;  1MIW A;  2BG9 E;  3KIN B;  4PJJ A;  5C8Y E;  4U3C A;  2E5L T;  4AI6 A;  1T72 A;  2XAJ B;  2NWB A;  4OFZ A;  4UVA B;  4EB6 E;  3QC9 A;  2ODU A;  1JNR A;  2NR4 A;  1E1H B;  2CE7 A;  3SOL A;  2CEA A;  3O4X E;  2XQ3 A;  3AAE B;  3NWI A;  4LF6 T;  4H63 H;  4CXY A;  2XPK A;  4KUM B;  3ZT7 A;  1IAP A;  2CCQ A;  2BBH A;  2BKP A;  3QB5 K;  4X64 T;  3WAK A;  2BG9 C;  2W67 A;  4AQG A;  1XNQ T;  1MIY A;  3NRX A;  2V6X A;  4P1N A;  2BKO A;  2JMH A;  4I55 E;  4B3T T;  5LGU B;  3KDS E;  4IRE A;  3ETV A;  3LK2 B;  2FBW A;  2E9X C;  2B76 A;  4HWI B;  4TUY E;  4HFE A;  2H7V C;  5L3G B;  3KV5 A;  2NW8 A;  1D0Y A;  3AXJ A;  4H9Q C;  1W09 A;  2WMN A;  4YFS A;  3MA9 A;  4HN9 A;  5DAB A;  4X65 T;  2Y48 B;  5AQH B;  5HWY A;  2V26 A;  1WCR A;  5LNK A;  3OKQ A;  5AQM B;  4IT4 A;  2UUC T;  3ZEF B;  5L3B B;  4O4H E;  4O8S A;  3FZL B;  1SUM B;  3F31 A;  4I4T E;  4LMK A;  2YU1 A;  5JH7 E;  4EEB A;  5BMV E;  4H9P C;  1HNX T;  2JJ9 A;  3AAA B;  3BK9 A;  4V1A v;  4KHP T;  2ZM6 T;  4JI3 T;  4Z90 A;  3EI0 A;  2DL1 A;  2LSY A;  3RQU A;  1ZP0 A;  3BQL A;  3X1D A;  1KNZ A;  2DHR A;  2KIN B;  3HKD E;  2V6Y B;  4ASK A;  3J7Y q;  5HWX A;  1HNW T;  4UXN B;  1VRB A;  1YKH B;  3RQW A;  3ZCJ A;  2A3D A;  1VOM A;  2BBJ A;  2BDE A;  5AQU B;  2MYS A;  2C0S A;  3I9Y A;  3LJC A;  2W00 A;  1IZN B;  4DVD A;  2KXP B;  1MNE A;  2WZH A;  2XSA A;  3EAM A;  3OYX A;  3UU3 A;  3VR8 A;  4DR1 T;  4BJM A;  1HX1 B;  4LML A;  2K3W A;  2W0G A;  5FY0 A;  5F3J A;  1KK7 A;  3Q5E A;  4NIQ A;  3KFW X;  3I1A A;  4NUU A;  2PFV A;  4YSZ A;  4HWD A;  4KP3 C;  5EK3 A;  2X9H A;  4TN7 B;  5LJN A;  3AA7 B;  2WS3 A;  2B1E A;  1X79 A;  4JYA T;  4PW8 A;  2I6H A;  3P50 A;  4U74 A;  4UEM A;  4DMV A;  3OTO T;  1UX5 A;  3OJA A;  1L0V A;  4IDO A;  4AKL A;  3CQC B;  3QK6 A;  5A1L A;  4MLK A;  4EZ4 A;  4IDP A;  5L3C B;  2X9W A;  4H9S E;  5E0O A;  3IBP A;  2LEH A;  2BG9 A;  2C5I T;  4IE7 A;  4JEH B;  4KHZ F;  4HFI A;  3VR9 A;  4CN1 A;  4QH5 A;  4TV8 E;  1QSD A;  5KXJ A;  3AA6 B;  4ILB A;  1ZEE A;  4JV5 T;  3N9L A;  2Q9Q C;  3ZPO A;  3AA0 B;  2WSS V;  2NW9 A;  1MMA A;  3N9O A;  3UU6 A;  4KX6 A;  3NZQ A;  2UUA T;  1VCT A;  4OHF A;  5AQF B;  5CA1 E;  4OYK A;  2PJQ A;  4ADZ A;  4P0B A;  4CXX A;  4IGU A;  3HI2 A;  2KWH A;  4IL9 A;  4ZZB A;  1V9D A;  2FJD A;  3K3N A;  4ANJ A;  3MZK B;  4I43 B;  1N32 T;  2MTQ A;  2FJB A;  3C4Z A;  5C3J A;  1FMW A;  4QXB B;  1MMG A;  4UVB B;  2IC6 A;  3LSV A;  4DV4 T;  1OED A;  3OYZ A;  3G06 A;  3N9N A;  3KV9 A;  2D0T A;  3RIA A;  3RYI E;  4DO0 A;  2XY8 B;  2WDQ A;  3QNU A;  2D5U A;  4O4J E;  2IAK A;  2YIN A;  4JI2 T;  3T8O A;  2W63 A;  2WP9 A;  5FL1 A;  5LMN T;  4B3M T;  2CLY B;  4EED A;  4IL4 A;  2Y8D A;  3UUN A;  4A97 A;  2QYW A;  3AE1 A;  2NP9 A;  3EUH A;  1N33 T;  2CBJ A;  5JRC A;  3Q9D A;  2UXX B;  2I0M A;  3RC3 A;  4JBW F;  1KNP A;  2CA5 A;  3L3P A;  2XAH B;  2WU2 A;  3B5M A;  4N78 D;  3ZYK A;  2VKO A;  4EOZ B;  3EHZ A;  3GMI A;  4PFO A;  2X67 A;  3IHR A;  1XMO T;  2CRB A;  5LJM A;  1UGO A;  4X1Y E;  1KEY A;  4XZC A;  5JVD E;  1HFA A;  5J2U E;  3L8R A;  2XQ7 A;  3ETU A;  5HXR A;  4EGW A;  3AE5 A;  2LOP A;  2HN2 A;  3JAF A;  3SFD A;  4A5X A;  2NOX A;  2YEV C;  2UXB T;  2V5D A;  2XQA A;  1YQ4 A;  2XUE A;  3FZM B;  2KZ7 B;  3RIF A;  3TLV A;  4GK5 E;  4YJ2 E;  3Q2M A;  2NW7 A;  1KF6 A;  3PJA A;  5LOV E;  1U5P A;  2V7L A;  4CI3 B;  3P4S A;  2WBL A;  5AQP B;  5FYM A;  2A9U A;  2WB5 A;  3JCF A;  3P7I A;  2JPF A;  4WZX A;  4ZS2 A;  5KMG P;  1OXZ A;  1MND A;  2DWG A;  5ETW A;  3C98 B;  2BZB A;  5JDF A;  4CQI A;  5CA0 E;  2F4V T;  4DR4 T;  2BVL A;  5CGM A;  5LYJ E;  1YW0 A;  1DU2 A;  2VVS A;  3ZSS A;  4OK0 A;  4TZ4 C;  1WFD A;  1T7S A;  4JI7 T;  3ONX A;  4AXP A;  5FXV A;  3VRB A;  3O9X A;  4WNK A;  2K48 A;  4UF0 B;  2FUP A;  3ABV A;  3C4W A;  3L09 A;  5IUX A;  3JAD A;  1XNR T;  2WWV A;  4UR9 A;  4EV6 A;  4HFD A;  3RKG A;  3CWZ B;  3ZC1 A;  1D0Z A;  5TAO A;  4EAH A;  5AQG B;  3DTO A;  3RPU A;  4CXW A;  4LFC T;  3IA3 A;  2QVA A;  3DJB A;  3QUJ A;  4DV6 T;  3MXZ A;  3N9Q A;  2CXD A;  1UUS A;  3CK6 A;  3RC8 A;  2H88 A;  4AKI A;  2IDO B;  1XWM A;  2ACX A;  3N9M A;  3N2O A;  5AQQ B;  4CZZ B;  2D9D A;  2WWU A;  2UXN B;  2K5B B;  2XAG B;  1T8B A;  3H3M A;  3CVR A;  4PK5 A;  5L3F B;  1QLB A;  5JQG E;  2SPC A;  4PK4 A;  4Z91 A;  3R6N A;  3FHN A;  4QH4 A;  5IWA T;  1N36 T;  4PJM A;  1YXR A;  1WRD A;  4JI1 T;  3AEE A;  4HTE A;  4LFA T;  2IIU A;  4QX8 B;  3RF1 A;  1M62 A;  5HXE A;  2LRL A;  2IC9 A;  4YLH A;  3RIU A;  3NKZ A;  2X68 A;  3AVR A;  4UEL A;  4E7S A;  2CPT A;  2ZLY A;  5JR9 A;  4CN4 A;  2X0L B;  2JRK A;  2JIW A;  3AE7 A;  4NUV A;  5HAX A;  3BQI A;  3PU3 A;  4G63 A;  2LSG A;  4PJN A;  4TWF A;  4YTN A;  3NBX X;  5KDM C;  4F6R C;  2IHR 1;  4LMJ A;  1XDP A;  1S94 A;  2DCF A;  3N9P A;  3ZJ2 A;  4HGA A;  5DQV A;  4X5T A;  4PJL A;  5JDQ A;  1UX4 A;  2M6I A;  2XTL A;  3RRC A;  5J1G A;  4DMW A;  4O2A E;  1E7P A;  5H6R B;  4AQF C;  3RI5 A;  2P9B A;  2WDV A;  2WZI A;  3UFE A;  4XAX B;  1JNZ A;  1BR2 A;  3OPC A;  1FEW A;  1H7C A;  4KI0 F;  4EIW A;  1IJ6 A;  2E2A A;  3SWH A;  3BQK A;  5JR9 C;  1KNR A;  2AXD S;  2XQ6 A;  3HL6 A;  4YY3 T;  4U72 A;  5AFU L;  1Z0P A;  2X9Y A;  4GKJ T;  2M6B A;  4O2B E;  4QX7 B;  3CQG B;  5L3D B;  4YT0 A;  3EVY A;  2HHH T;  3ZC0 A;  4ZHQ E;  4HFV A;  4EYY R;  1HF8 A;  5HXH A;  4U33 A;  4AKG A;  3E0Z A;  5JDL A;  4U7Y A;  3LG7 A;  3AXJ B;  3PUV F;  1UUR A;  4X20 E;  5FVL A;  2YDR A;  4XBF B;  1E2A A;  2CBI A;  2ACZ A;  2VKD A;  2XAQ B;  2DI4 A;  4GYS A;  5L3E B;  4LF5 T;  5LBQ B;  1ZOY A;  2LT3 A;  1D0X A;  1FMV A;  2CXF A;  2JQQ A;  1LVF A;  3Q5W A;  4H63 V;  3PUA A;  4FJO A;  3C50 A;  4H9O C;  3RX6 A;  1ZHC A;  4L5G A;  3RYH E;  2VVN A;  2L3L A;  3S4U A;  5JTG A;  5HEG A;  3UUX B;  1W0B A;  3UUB A;  4ZI2 D;  3FBL A;  4DR2 T;  3LBX A;  3E08 A;  5DJQ C;  3PV0 F;  3VKG A;  5FL0 A;  3HKC E;  5LCY A;  5HEO A;  1J5E T;  1HTJ F;  4ILC A;  2XHE B;  1FJG T;  4BJN A;  2QGS A;  4JUY A;  5AQR B;  4QXH B;  1SHZ C;  3LK3 B;  4C90 A;  3WI3 A;  5EK2 A;  3CX8 B;  1QUU A;  3VHL A;  2VWA A;  4O4L E;  2WQY A;  2WDR A;  3A5X A;  2HH7 A;  1XMQ T;  1HNZ T;  2V1D B;  4ILA A;  3ZYM A;  3HR0 A;  5CFB A;  1X9B A;  2J47 A;  2WU5 A;  3F57 A;  2UXD T;  3O1H A;  4H9R C;  5GON E;  2R6G F;  5HEH A;  3CQX C;  5ABE A;  4JI6 T;  4MBQ A;  4IIJ E;  4KBM B;  4ZI3 D;  3C64 A;  2QA7 A;  4M1P A;  4DUY T;  5FNV E;  2D2S A;  2KMF A;  3AEF A;  5JDH A;  4X62 T;  2BKN A;  3FB2 A;  2PG8 A;  3UTK A;  2M67 A;  3FXE B;  2XZE A;  4IDN A;  3CML A;  3U78 A;  5IHY A;  1WYC A;  1J5W A;  3AE8 A;  2VKH A;  4GK0 E;  4IHJ E;  5H6Q B;  4ZXL A;  5HEJ A;  2VK9 A;  5JDN A;  5J0Z A;  2LHR A;  2N9D A;  1D1A A;  2RA1 A;  2X0Y A;  4QKN A;  4MFR A;  4AQF A;  3PUX F;  3UUM A;  2DNX A;  4NXN T;  5AQL B;  3K3Q C;  3C4X A;  3PUQ A;  4A56 A;  4IDQ A;  3PUW F;  2J62 A;  2NTY A;  4CN6 A;  3Q5D A;  3ZLI A;  5JDG A;  2WMO A;  4UIG A;  2E9X D;  3AED A;  3ZT6 A;  2KLQ A;  2XM1 A;  4WYV A;  4A98 A;  3P4R A;  3A8Y C;  3OVU A;  3N2K E;  4C91 A;  5FP3 A;  2MPK A;  1D1C A;  4I0U A;  4DV0 T;  3FXD B;  1IBM T;  5LA6 E;  4LFB T;  4ZI2 C;  1M7K A;  4E7Z A;  4HKA A;  2KSR A;  3ONL C;  1EZ3 A;  4MAL A;  4LF9 T;  3NZP A;  4PAG A;  5LXT E;  2PTF A;  2YN6 A;  4OYJ A;  4DR3 T;  2Z6E A;  2ES0 A;  4GKK T;  3PTR B;  4HFC A;  2LRK A;  2VKJ A;  3AEC A;  4P09 A;  3HKE E;  2H89 A;  3M3Z B;  3RHW A;  3AE2 A;  2IUB A;  3KV4 A;  4TNW A;  4WBO A;  2LKH A;  4DID B;  5FKY A;  2V7I A;  4K0K T;  1Z8U A;  5L47 A;  3RH3 A;  3RYF E;  4TNV A;  1BR0 A;  1WR6 A;  2LOS A;  4ZEY A;  4QH1 A;  1S35 A;  4PNI A;  3TKL B;  1YKE B;  3UU8 A;  1I6Z A;  2Q9Q B;  2FJA A;  2PBI A;  4HWC A;  1HR0 T;  2WM9 A;  3ZN0 B;  3LBX B;  1LKX A;  3M65 A;  1G8X A;  4JEU B;  4PFP A;  4UV9 B;  4ZOL E;  2IW5 B;  4U2Z A;  3RLF F;  4EXT A;  2MBG A;  2EHO B;  3K1S A;  3AE4 A;  3R84 B;  3CPZ A;  4YSY A;  2RPA A;  3MKD A;  1Y64 B;  3N2G E;  4ZI7 E;  2VQF T;  2E9X A;  3ZJ1 A;  2VL0 A;  3ZMZ B;  1OED B;  2W2U A;  3H37 A;  3UQ4 A;  1R8I A;  3FBZ A;  5JDM A;  2Q9Q D;  3AA1 B;  2XAF B;  5FMN A;  4DBR A;  3AEB A;  5LB7 B;  2W62 A;  3AE3 A;  2NTX A;  5L2L A;  3FZK B;  3U3I A;  2XQ8 A;  3RYC E;  3RKO A;  2A72 A;  2JQK A;  2YDS A;  3ZMV B;  4ZZC A;  2VL8 A;  3CIR A;  3FZH B;  2KT9 A;  4TX5 A;  5HYA A;  3ANW B;  5C2T A;  2XQ4 A;  3K8P C;  4AIS A;  5M4Y A;  5KX5 E;  1IBL T;  4GYR A;  3RIU C;  4UVC B;  2ZM8 A;  2ZM2 A;  4AQY T;  5FY1 A;  3O1I A;  5LHG B;  2JQH A;  1IBK T;  5CB4 E;  2X66 A;  4CI1 B;  1XZY A;  3P4Q A;  1IJ5 A;  2XQ9 A;  4YTM A;  4YSX A;  2KWI B;  1KFY A;  2CHO A;  4DR6 T;  2BG9 B;  2VAS A;  2V6Y A;  4WBN E;  5F8P A;  4ERR A;  5BR8 T;  4IE5 A;  1HG2 A;  4YXD A;  3OBV E;  3PDY A;  3VU7 H;  1YD8 G;  3AB3 B;  5EK4 A;  2N2N A;  3EDV A;  4LF7 T;  5L4E A;  2LHN A;  4DV3 T;  2IML A;  2VB6 A;  3PJA J;  1OED C;  4P0A A;  2OA5 A;  3H3A A;  2QRX A;  3KBU A;  2XQY A;  5AQV B;  5AQK B;  5FXW A;  4B3S T;  3CKD A;  5JR9 B;  3CX7 B;  4ILU A;  1CHU A;  1W9R A;  2E5V A;  2LKG A;  3I9W A;  4HFB A;  4U31 A;  5AQS B;  5HCJ A;  5L4H A;  3PUZ F;  2LSI A;  3J9X 1;  5AQT B;  3VRA A;  4CI2 B;  3UQ7 A;  5JRC B;  1BR1 A;  2G0U A;  3GN5 B;  3ZCI A;  4EYU A;  2K9A A;  1ZKE A;  3GN5 A;  4AKH A;  4U2Y A;  3PUG A;  2V5C A;  4DV2 T;  1NWM X;  3SFE A;  5HEU A;  4JI4 T;  2GK9 A;  2XSB A;  3QB5 A;  4G2A A;  5LGN B;  1Y01 A;  2XM2 A;  5LP6 E;  5ABG A;  3RGL A;  4DR5 T;  5HXC A;  3JC6 C;  3C51 A;  2VQE T;  3FZF B;  2HPL A;  4NPP A;  1US7 B;  3EDU A;  3PUR A;  5LHH B;  3SRZ A;  2WY2 A;  2YU2 A;  3B57 A;  4I50 E;  2LJL A;  3V5U A;  2WCA A;  2FJE A;  3MAC A;  3ZST A;  4BA9 A;  3JC6 D;  1UK5 A;  4TWH A;  3PUS A;  3P8C D;  3AEG A;  1ZV4 X;  5AQO B;  1MMN A;  3DP7 A;  2X9X A;  3AEA A;  4AIU A;  2LLY A;  4U7I A;  3B13 A;  2CLY C;  3EAB A;  3SS1 A;  1LVK A;  2ODV A;  5CJ5 A;  3K3O A;  3W15 B;  4DV1 T;  4L0R A;  4DUZ T;  4X1K E;  4JI0 T;  2CWO A;  4NXM T;  1I94 T;  3PE0 A;  4TWD A;  3ANW A;  2WAU A;  3AE9 A;  3KV6 A;  1NAF A;  4X1I E;  3ZMU B;  1O3X A;  2L9Q A;  2YOE A;  4COF A;  4O4I E;  5J2T E;  3F2E A;  3TLS A;  3AVS A;  2UXC T;  2CXL A;  2V7M A;  2LSJ A;  3Q5X A;  1T98 A; 
#chains in the Genus database with same CATH homology
 1UCU A;  2EHO D;  2BVM A;  2V7K A;  2Y6X A;  3I0Q A;  1LRZ A;  3V5S A;  2E9X B;  1U4Q A;  1AJ3 A;  3IF8 B;  5ADX L;  3NRY A;  2CWY A;  2Q9Q A;  4IE0 A;  3GWH A;  3KVB A;  1FIO A;  1WLX A;  3ZYL A;  2V7J A;  4Z8X A;  4GIW A;  4DND A;  4IST A;  4DBQ A;  5FXZ A;  4BAY B;  3I0O A;  4L9I A;  4UF0 A;  3N5L A;  4YHJ A;  3LK4 2;  3IEE A;  2LM9 A;  4FI5 A;  2LSK A;  1B7T A;  2W61 A;  4IE4 A;  4KMC A;  2CMR A;  3LFM A;  4TV9 E;  4J2C A;  3UT5 E;  3E22 E;  5JRE A;  4EZH A;  4IDZ A;  2ZMA A;  3RRW A;  4B6X A;  1MMD A;  3ZMT B;  2RP4 A;  2L8K A;  4HE8 A;  4GOU A;  2D0U A;  2MOZ A;  1SA0 E;  2K24 A;  4PK6 A;  4QXC B;  1BR4 A;  3ZMS B;  4YJ3 E;  3UUL A;  4HEA A;  1OWA A;  5EZY E;  1D1B A;  2C5J A;  2EHO A;  3GA8 A;  3MJX A;  3O1J A;  4IE6 A;  5FXX A;  5LBM A;  1HS7 A;  3HKB E;  5FY7 A;  2H3R A;  1HX8 A;  2H7O A;  4K0U A;  4JLE A;  4MHC A;  2X51 A;  4H9N C;  5LHI B;  2EHO C;  2A2F X;  2YK0 A;  3WAJ A;  2E8I A;  1G73 A;  2I59 A;  3CX6 B;  4QWN B;  4WW0 A;  5LG4 A;  1HCI A;  2XAS B;  3PU8 A;  2HPJ A;  3ZN1 B;  1MIV A;  2N1G A;  5DQW A;  5IYZ E;  3HA4 A;  3AAI A;  3D0T A;  2KND A;  2LE8 A;  4QHO A;  4ZI3 C;  3VKH A;  2DLR A;  5LGT B;  2DWK A;  1CUN A;  4ISS A;  4AKR B;  2ZM0 A;  4UV8 B;  3MK7 C;  5HXS A;  4ZS3 A;  2J1D G;  2C5K T;  2CM0 A;  3KBT A;  3KVA A;  2JMK A;  3KIN B;  1WYB A;  3ESL A;  1HG5 A;  1MIW A;  4AI6 A;  4PJJ A;  5C8Y E;  2XAJ B;  2NWB A;  4OFZ A;  4UVA B;  4EB6 E;  3QC9 A;  2ODU A;  1E1H B;  2CE7 A;  3SOL A;  2CEA A;  3O4X E;  3AAE B;  4H63 H;  4CXY A;  4KUM B;  1IAP A;  2CCQ A;  3WAK A;  4AQG A;  1MIY A;  3NRX A;  4I55 E;  2JMH A;  5LGU B;  3KDS E;  3ETV A;  3LK2 B;  2E9X C;  4TUY E;  2H7V C;  5L3G B;  3KV5 A;  2NW8 A;  1D0Y A;  4H9Q C;  2WMN A;  4YFS A;  3MA9 A;  4HN9 A;  5DAB A;  2Y48 B;  5HWY A;  2V26 A;  5LNK A;  3OKQ A;  3ZEF B;  5L3B B;  4O4H E;  4O8S A;  3F31 A;  4I4T E;  2YU1 A;  5JH7 E;  5BMV E;  4H9P C;  2JJ9 A;  3AAA B;  3BK9 A;  4V1A v;  2LSY A;  3BQL A;  1KNZ A;  2DHR A;  2KIN B;  3HKD E;  4ASK A;  3J7Y q;  5HWX A;  4UXN B;  1VRB A;  1YKH B;  3ZCJ A;  2A3D A;  1VOM A;  2BDE A;  2MYS A;  2C0S A;  3I9Y A;  3LJC A;  2W00 A;  1IZN B;  4DVD A;  2KXP B;  1MNE A;  3OYX A;  4BJM A;  5FY0 A;  2W0G A;  5F3J A;  1KK7 A;  3KFW X;  3I1A A;  4NUU A;  2PFV A;  4KP3 C;  5EK3 A;  2X9H A;  4TN7 B;  5LJN A;  3AA7 B;  2B1E A;  1X79 A;  4PW8 A;  4U74 A;  4UEM A;  4DMV A;  1UX5 A;  3OJA A;  4AKL A;  3CQC B;  3QK6 A;  5A1L A;  4MLK A;  4EZ4 A;  5L3C B;  2X9W A;  4H9S E;  5E0O A;  3IBP A;  2LEH A;  4IE7 A;  2C5I T;  4JEH B;  4TV8 E;  1QSD A;  3AA6 B;  1ZEE A;  3N9L A;  2Q9Q C;  3ZPO A;  3AA0 B;  2WSS V;  2NW9 A;  1MMA A;  3N9O A;  3NZQ A;  5CA1 E;  4OHF A;  4OYK A;  2PJQ A;  4ADZ A;  4P0B A;  4CXX A;  4IGU A;  3HI2 A;  2KWH A;  1V9D A;  3K3N A;  4ANJ A;  3MZK B;  4I43 B;  2MTQ A;  3C4Z A;  1FMW A;  4QXB B;  1MMG A;  4UVB B;  2IC6 A;  3OYZ A;  3N9N A;  3KV9 A;  2D0T A;  3RYI E;  4DO0 A;  2D5U A;  4O4J E;  2IAK A;  2YIN A;  3T8O A;  2W63 A;  2CLY B;  2Y8D A;  3UUN A;  2NP9 A;  3EUH A;  3Q9D A;  2UXX B;  3RC3 A;  3ZYK A;  2CA5 A;  3L3P A;  2XAH B;  4N78 D;  2VKO A;  4EOZ B;  3GMI A;  4PFO A;  2X67 A;  3IHR A;  5LJM A;  4X1Y E;  4XZC A;  5JVD E;  1HFA A;  5J2U E;  5HXR A;  3ETU A;  2LOP A;  2NOX A;  2YEV C;  2XUE A;  2KZ7 B;  4GK5 E;  4YJ2 E;  3Q2M A;  2NW7 A;  5LOV E;  1U5P A;  2V7L A;  4CI3 B;  2WBL A;  5FYM A;  3P7I A;  4ZS2 A;  2JPF A;  5KMG P;  1OXZ A;  1MND A;  2DWG A;  5ETW A;  3C98 B;  2BZB A;  5JDF A;  5CA0 E;  2BVL A;  5LYJ E;  1YW0 A;  4OK0 A;  4TZ4 C;  3ONX A;  4AXP A;  5FXV A;  3O9X A;  4WNK A;  2K48 A;  4UF0 B;  3C4W A;  3L09 A;  3CWZ B;  3ZC1 A;  1D0Z A;  5TAO A;  4EAH A;  3DTO A;  3RPU A;  4CXW A;  3DJB A;  3QUJ A;  3MXZ A;  3N9Q A;  2CXD A;  3RC8 A;  4AKI A;  3N9M A;  2ACX A;  3N2O A;  4CZZ B;  4PK5 A;  2WWU A;  2UXN B;  2K5B B;  2XAG B;  5L3F B;  3CVR A;  2SPC A;  4PK4 A;  3R6N A;  3FHN A;  4PJM A;  1WRD A;  4HTE A;  4QX8 B;  5HXE A;  2IC9 A;  4YLH A;  4E7S A;  2X68 A;  3AVR A;  4UEL A;  2ZLY A;  5JR9 A;  2X0L B;  2JRK A;  5HAX A;  4NUV A;  3BQI A;  3PU3 A;  4G63 A;  2LSG A;  4PJN A;  5KDM C;  3NBX X;  4F6R C;  1S94 A;  2DCF A;  3N9P A;  3ZJ2 A;  4HGA A;  5DQV A;  5JDQ A;  4PJL A;  1UX4 A;  3RRC A;  2XTL A;  5J1G A;  4DMW A;  4O2A E;  5H6R B;  4AQF C;  2P9B A;  3UFE A;  5JQG E;  4XAX B;  1BR2 A;  4EIW A;  1FEW A;  1H7C A;  1IJ6 A;  3SWH A;  3BQK A;  5JR9 C;  3HL6 A;  4U72 A;  5AFU L;  1Z0P A;  2X9Y A;  4O2B E;  4QX7 B;  3CQG B;  5L3D B;  3EVY A;  3ZC0 A;  4ZHQ E;  4HFV A;  4EYY R;  1HF8 A;  5HXH A;  4AKG A;  3E0Z A;  5JDL A;  3LG7 A;  4X20 E;  4XBF B;  2VKD A;  2XAQ B;  2DI4 A;  4GYS A;  5L3E B;  5LBQ B;  1D0X A;  2LT3 A;  1FMV A;  2CXF A;  2JQQ A;  1LVF A;  3Q5W A;  4H63 V;  3PUA A;  4FJO A;  3C50 A;  4H9O C;  3RX6 A;  1ZHC A;  4L5G A;  3RYH E;  3S4U A;  2L3L A;  3UUX B;  4ZI2 D;  3FBL A;  3LBX A;  3E08 A;  5DJQ C;  3VKG A;  3HKC E;  5LCY A;  1HTJ F;  2XHE B;  4BJN A;  2QGS A;  4JUY A;  4C90 A;  4QXH B;  1SHZ C;  3LK3 B;  3WI3 A;  5EK2 A;  3CX8 B;  1QUU A;  3VHL A;  2VWA A;  4O4L E;  3A5X A;  2HH7 A;  2V1D B;  3ZYM A;  3HR0 A;  3F57 A;  3O1H A;  4H9R C;  5GON E;  3CQX C;  4MBQ A;  4IIJ E;  4KBM B;  4ZI3 D;  3C64 A;  2QA7 A;  4M1P A;  5FNV E;  2D2S A;  2KMF A;  5JDH A;  3FB2 A;  2PG8 A;  3UTK A;  2M67 A;  3FXE B;  3CML A;  3U78 A;  5IHY A;  1WYC A;  2VKH A;  4GK0 E;  4IHJ E;  5H6Q B;  2VK9 A;  5JDN A;  2LHR A;  2N9D A;  1D1A A;  2RA1 A;  4QKN A;  4MFR A;  4AQF A;  3UUM A;  2DNX A;  3K3Q C;  3C4X A;  3PUQ A;  4A56 A;  2NTY A;  3ZLI A;  5JDG A;  2WMO A;  4UIG A;  2E9X D;  2KLQ A;  4C91 A;  3N2K E;  5FP3 A;  1D1C A;  3FXD B;  5LA6 E;  4ZI2 C;  4E7Z A;  4HKA A;  1EZ3 A;  4MAL A;  3NZP A;  4PAG A;  5LXT E;  4OYJ A;  2Z6E A;  2ES0 A;  3PTR B;  4P09 A;  2VKJ A;  3HKE E;  3KV4 A;  4WBO A;  2V7I A;  3RH3 A;  3RYF E;  1BR0 A;  1WR6 A;  2LOS A;  1S35 A;  4PNI A;  3TKL B;  1YKE B;  2Q9Q B;  2PBI A;  2WM9 A;  3ZN0 B;  3LBX B;  1LKX A;  3M65 A;  1G8X A;  4JEU B;  4PFP A;  4UV9 B;  4ZOL E;  2IW5 B;  4EXT A;  2MBG A;  2EHO B;  3R84 B;  3CPZ A;  3MKD A;  1Y64 B;  3N2G E;  4ZI7 E;  2E9X A;  3ZJ1 A;  3ZMZ B;  3H37 A;  3FBZ A;  5JDM A;  2Q9Q D;  3AA1 B;  2XAF B;  5FMN A;  4DBR A;  2W62 A;  2NTX A;  5L2L A;  3U3I A;  3RYC E;  3RKO A;  2A72 A;  3ZMV B;  2VL8 A;  4TX5 A;  2KT9 A;  5HYA A;  3ANW B;  3K8P C;  5M4Y A;  5KX5 E;  4GYR A;  4UVC B;  2ZM8 A;  2ZM2 A;  5FY1 A;  3O1I A;  5LHG B;  5CB4 E;  2X66 A;  4CI1 B;  1IJ5 A;  2KWI B;  2VAS A;  4WBN E;  5F8P A;  4ERR A;  4IE5 A;  1HG2 A;  3OBV E;  3PDY A;  3VU7 H;  1YD8 G;  3AB3 B;  5EK4 A;  2N2N A;  3EDV A;  2LHN A;  2VB6 A;  4P0A A;  2OA5 A;  3H3A A;  3KBU A;  2XQY A;  5FXW A;  3CKD A;  5JR9 B;  3CX7 B;  4ILU A;  3I9W A;  4CQI A;  5JRC A;  3J9X 1;  4CI2 B;  2LSI A;  5JRC B;  4AKH A;  3GN5 B;  1BR1 A;  2G0U A;  3ZCI A;  4EYU A;  3GN5 A;  2K9A A;  1ZKE A;  3PUG A;  1NWM X;  2GK9 A;  4G2A A;  5LGN B;  5LP6 E;  5HXC A;  3JC6 C;  3C51 A;  2HPL A;  5LHH B;  3EDU A;  1US7 B;  3PUR A;  3SRZ A;  2YU2 A;  3B57 A;  4I50 E;  2LJL A;  3V5U A;  3MAC A;  4BA9 A;  3JC6 D;  3PUS A;  3P8C D;  1ZV4 X;  1MMN A;  3DP7 A;  2X9X A;  3B13 A;  2CLY C;  3SS1 A;  1LVK A;  2ODV A;  3K3O A;  3W15 B;  4L0R A;  4X1K E;  2CWO A;  3PE0 A;  3ZMU B;  3ANW A;  2WAU A;  3KV6 A;  4X1I E;  1NAF A;  1O3X A;  2L9Q A;  5J2T E;  4O4I E;  3F2E A;  3AVS A;  2CXL A;  2V7M A;  2LSJ A;  3Q5X A;  1T98 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...