2VKOA

Structure of the soluble domain of the membrane protein tm1634 from thermotoga maritima
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
104
structure length
104
Chain Sequence
HMNLAVKLTRMEKTLKAYELYIFSDYENFENYVKKEGLKIEGMELLKEKKARSLIAEGKDLFETANYGEALVFFEKALNLSDNEEIKKIASFYLEECRKKLAGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords TM1634
publication title Structure and Ligand Binding of the Soluble Domain of a Thermotoga Maritima Membrane Protein of Unknown Function Tm1634.
pubmed doi rcsb
source organism Thermotoga maritima
total genus 44
structure length 104
sequence length 104
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-12-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.2030 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2vkoA00
2VKOA 2VKJA
chains in the Genus database with same CATH superfamily
3AE5A 2WCAA 4PJLA 4TWDA 2XUEA 3HL6A 5KXJA 1MMAA 4O4IE 3EHZA 4COFA 2V7KA 4ZI2D 5JDQA 2I6HA 1JNRA 2N2NA 4JYAT 1Z8UA 4LF4T 4IDOA 2YOEA 1I6ZA 5DQWA 3UU8A 2JJ9A 2LSGA 4YSZA 3RI5A 5CB4E 1WYBA 2VB6A 2ZM0A 4UVBB 5HWXA 2VKHA 3BQKA 4TV8E 5HEJA 4GYSA 4ZZCA 5FXVA 5DABA 1ZHCA 2NW9A 3N9PA 2XHEB 1FMVA 3KVAA 4IL4A 4C90A 3AA7B 3EVYA 2OLTA 3C50A 3BK9A 1XDPA 4UEMA 5AQSB 1HG5A 2RP4A 4JI5T 4PFPA 3K8PC 1V9DA 4DMVA 3AE6A 4G2AA 2IC9A 3MACA 2BG9C 2BS2A 3FZKB 3GA8A 4CXXA 3HKCE 5LMUT 4HFEA 5JDNA 3F31A 4PAGA 2E5VA 4N78D 3JAFA 2MPKA 1G8XA 3ANWA 3WI3A 1W09A 3TLVA 3FBZA 5CJ5A 3DJBA 4I55E 2YK0A 3F2EA 4O4LE 2W4XA 4TWFA 2BS4A 3PJAA 4GIWA 3R6NA 1D0XA 2CWYA 2NTYA 2L9QA 4AKHA 4IDNA 2W00A 3M65A 5JH7E 3J7Yq 2Q9QD 4LF8T 2K24A 3TLTA 4ILBA 2CLYC 3OYZA 2E5LT 2IIUA 3A7MA 3C4WA 5FY1A 4JI2T 5KMGP 3PU8A 2C5JA 2V1DB 4IL9A 3FZFB 1UCUA 4JI7T 5H6QB 2WBLA 3HI2A 3ETVA 4I4TE 2B1EA 5M4YA 3AE1A 1XWMA 4P1NA 2AE9A 3V5SA 5HCMA 4B3ST 4U2YA 4HFVA 3RPUA 2XQ6A 5F5WA 2J4GA 2V26A 3UUNA 1NWMX 2EHOB 5LBQB 5C2TA 2UXCT 3L8RA 3K3QC 4WNKA 1WCRA 3UULA 4DV0T 2BG9A 4YT0A 2X9XA 2ODVA 2VWAA 1MMGA 1D1BA 3T8OA 5EK2A 1D0ZA 2XQ4A 3ZYMA 3VRBA 3N5LA 3ZJ2A 4EOZB 2KMFA 1T8BA 3CQXC 4L0RA 4WBNE 3KVBA 4U2ZA 2JQ9A 1IBKT 2XASB 3PUGA 4U74A 4I50E 1W0AA 4NUUA 3N9LA 2M6BA 2E9XA 4ISSA 2X68A 4HN9A 2CE7A 4PJMA 3ZMZB 2CXLA 4ZOLE 5JRCB 3UQ4A 1Y64B 3GN5A 2V7IA 5LOVE 4Z91A 2C5KT 2WDQA 1N33T 4DBRA 4HFHA 3LK2B 1U5PA 3NRYA 3ZSTA 4DR5T 3HKBE 5JRCA 1DU2A 3LBXB 3C4ZA 3SRZA 1HNXT 2A3DA 2MBGA 3UQ7A 3BQIA 5AQJB 3NZQA 3ZSSA 2F4VT 3TLUA 1HX1B 4M1PA 3N2KE 2DLRA 3MJXA 2YDRA 5ETWA 4ZHQE 1I94T 4EEDA 1US7B 2W2UA 2A9UA 5ABFB 1MIWA 3ZT6A 3KV5A 1YW0A 2BKOA 2WM9A 2LM2A 1YD8G 4HFIA 2WSSV 2XY8B 1NAFA 5AQLB 2LT3A 3C4XA 3ZEFB 3B57A 1W9RA 4HEAA 2NTXA 3C64A 5FY7A 3QB5K 5CFBA 2MAWA 4GKKT 4BJNA 4DMWA 4UV8B 2UXBT 2IMLA 4YTPA 1UGOA 1J1JA 3OYXA 2FJBA 2VK9A 4OK0A 2H88A 2CXFA 3JC6C 3C98B 4YSYA 3R84B 4HGAA 5JDFA 1HG2A 3C51A 4HWIB 3B5MA 2IC6A 2LSIA 3KV9A 3LK42 4B6XA 1Y01A 2WY2A 2X9WA 1E2AA 3ZC0A 5HXEA 2ODUA 2G0UA 1FIOA 2Y6XA 3P50A 1T7SA 4JUYA 5LMNT 4DV1T 4JI0T 2KINB 4CI1B 2L8KA 4CI3B 4ASKA 4WBOA 3ZYKA 2Y48B 4O2AE 2HN2A 3K3OA 4YFSA 2R6GF 2PJQA 1Z0PA 5H6RB 5L3DB 3ZKRA 2UXXB 4EIWA 5JTGA 2HPLA 1UX4A 5DJQC 5JR9B 5FL1A 4AQGA 3L3PA 5FXWA 2XAQB 3W15B 3UU3A 2I0MA 2XPKA 4GYRA 4ILUA 5JDHA 3P4RA 2NW8A 3UU6A 4YY3T 3PUZF 3AEFA 3ZT7A 1BR1A 2XM2A 4CN1A 4LF5T 5KX5E 2PTFA 4KUMB 3OPCA 3ESLA 5HYAA 3PURA 1CHUA 3CK6A 4CI2B 1X79A 4I0UA 3UTKA 2BBHA 1VOMA 3TLWA 5J0ZA 4P09A 4U7IA 3FXEB 3EI0A 5C3JA 3EDUA 4X1KE 1MIYA 2V6YA 4IHJE 3RYIE 4BAYB 1IAPA 1SUMB 3CX8B 3WAKA 3G06A 3RIAA 4LF9T 1J5ET 3H37A 5FVKA 2UUBT 2UXDT 4ZI7E 3ZCIA 4OHFA 2VQET 3QC9A 4O8SA 4C91A 3NKZA 2V6XA 4HFBA 5EZYE 4FI5A 5L4HA 2C0SA 2JQKA 3P8CD 4DV4T 4A98A 2LJLA 5LNKA 5CA1E 3PUAA 2MOZA 3RRWA 3OKQA 2LM9A 3QUJA 2VKDA 2PBIA 5HXHA 5LP6E 2ES0A 3A5XA 3MA9A 3ZC1A 2H3RA 5FKYA 3Q5EA 4ISTA 4HWCA 5AQKB 2CM0A 2H7VC 2WZHA 3PDYA 3E0ZA 5ABHA 3J9X1 3L39A 2DWKA 3SFEA 4JI6T 3ZMUB 2KT9A 4X20E 4OYJA 4Q25A 1FEWA 4TNWA 2DNXA 2WWVA 5LA6E 2H7OA 5FXZA 2XQ8A 5JDLA 1U4QA 1EZ3A 2JRKA 4IE5A 4GKJT 4KHPT 1BR4A 4QX7B 2CXDA 3RKGA 4WW0A 2LHRA 2WZIA 2EHOC 1J5WA 4GK5E 5JREA 5AQMB 2QRXA 2X67A 4GOUA 4YLHA 4EGWA 4YXDA 2DL1A 5HEUA 2XSAA 3RF1A 3ZMSB 4AXPA 5HXRA 4JBWF 3RIUC 5IHYA 5TAOA 4B3MT 1LKXA 3JADA 4JI8T 2IW5B 4MBQA 2ZM8A 3KBUA 2J62A 3RC8A 3LJCA 5ABEA 1IJ6A 4U7YA 2LSJA 4ZI2C 2CBJA 2IUBA 4IDQA 3CX7B 4QH4A 1OXZA 5FVLA 2D0TA 1XZYA 2VKOA 2FJEA 2VVSA 4XBFB 5LYJE 2LKGA 3I9WA 1KNZA 1XMOT 3U78A 2YU2A 1WYCA 3AA0B 2CHOA 1UUSA 4ZS2A 3Q5WA 4TX5A 2K5BB 3ONLC 1UURA 2BDEA 4DR7T 3KDSE 4HE8A 4L9IA 2BVMA 5HEHA 1BR0A 5IWAT 3QB5A 4YTMA 4IE4A 3AAIA 2V7JA 5HCJA 1YXRA 2IAKA 4DVDA 3EUHA 2KLQA 3JAEA 5LBMA 2LOPA 2NWBA 1S35A 2W61A 1LRZA 4QXHB 2WU5A 2W63A 4EYUA 3CPZA 4LF6T 2GK9A 3ONXA 4BA9A 3RYFE 1KNRA 3RLFF 5FL0A 3AE3A 4JI1T 4KX6A 1HCIA 2DHRA 4UVAB 2EHOA 5LB7B 2WS3A 2PG8A 4DUYT 5LG3A 1YQ3A 4E7SA 3I1AA 1ZEEA 2Y8DA 4DV2T 4U33A 3NVOA 4AQFC 1IBLT 4HWDA 4NUVA 4TZ4C 1VCTA 3IA3A 5HXSA 1T72A 3PE0A 3V5UA 2ZLYA 4XZCA 1HNZT 4GK0E 4U72A 4HWFA 3AA1B 5LCYA 1YKHB 5KDMC 4FJOA 2Q9QC 4JI4T 2VL0A 2YINA 2PFVA 5HEOA 1ZP0A 1XDOA 1OEDE 5AQTB 4H9PC 3AXJB 2WMOA 2CBIA 4ZI3D 3MK7C 3OJAA 4H9NC 2VURA 3O1HA 3ZPOA 3O9XA 5L2LA 3CIRA 4YJ3E 4IE0A 3UUMA 3DP7A 4AI6A 4MLKA 3PUQA 3LBXA 2V7LA 4A56A 4IDPA 3RGLA 2X0YA 5LHIB 3AVRA 3VKHA 2M67A 4ZS3A 1LVFA 4HTEA 1UK5A 1OEDB 4DR1T 3QNUA 4DO0A 3KINB 3TKLB 3P4PA 3RIFA 3OBVE 4AISA 4YHJA 3AAEB 2NR4A 3M3ZB 3DTOA 4BJMA 4X5TA 4K0UA 1X9BA 3FZLB 3ZCJA 5ABFA 4LFCT 5AQUB 5JR9C 3BQLA 3ZMVB 4TWHA 2XJ7A 3RQWA 3UFEA 1M62A 3AEBA 5FNVE 3KBTA 4AQFA 2XQAA 2QA7A 2KWIB 4UXNB 4JEUB 1KF6A 1HTJF 3ZT5A 1ZV4X 2Q9QB 5C8YE 1OWAA 4OYKA 3NBXX 1KFYA 5FXXA 4YTNA 4H9OC 2DCFA 1JNZA 1HNWT 3LG7A 2B76A 3AE9A 1FJGT 5AQOB 1NENA 4QKNA 4IIJE 2WB5A 2Q9QA 3PUYF 4MHCA 3FBLA 4YHHT 3UUXB 1E7PA 1G73A 4X66T 4B3TT 4A5XA 4QHOA 3S4UA 2X0LB 2LSKA 2CRBA 3HR0A 1T98A 3U3IA 4PK4A 4CN6A 5AQFB 2XM1A 3E22E 3PV0F 4MFRA 1HF8A 2XSBA 4CXWA 3UT5E 5L47A 3KV6A 3FHNA 5J2UE 1MNDA 2XQ9A 3AVSA 4MALA 2SPCA 4EYYR 1W0BA 2CMRA 2K48A 3F57A 4H9SE 4DV7T 5JR9A 2V7MA 5EK3A 3T1YT 2LE8A 5DQVA 1NEKA 2YDQA 2NW7A 4ADZA 2ACZA 2BBJA 5J1GA 3VHLA 3HA4A 4CQIA 2P9BA 4PJJA 2XAHB 3ZN1B 2LRLA 2W62A 2JMHA 3NZPA 3P4QA 2C5IT 4H9RC 1WFDA 2W0GA 4JEHB 3GMIA 3HKDE 1D1AA 3PTRB 3SOLA 1KK7A 3UUBA 3GWHA 3PUXF 2M6IA 4CZZB 4P0BA 2W67A 2YN6A 5HEGA 3Q2MA 4J2CA 3UU5A 4Z8XA 1SE7A 3NRXA 3ZLIA 4LMLA 1D1CA 2L3LA 2KNDA 4AIUA 1VCSA 2WAUA 3AE4A 2A2FX 4LFBT 3NWIA 5J2TE 4O2BE 2VQFT 1CUNA 3OTOT 1YQ4A 5AQPB 5LJMA 2BZBA 2E9XD 4PK6A 2WDVA 2XAJB 3RX6A 3VR9A 3AECA 4P0AA 1BR2A 2FUPA 4H63H 5AQGB 2VVNA 5L3FB 4IGUA 1D0YA 4L5GA 2N9DA 3MXZA 3PUVF 5FP3A 2LKHA 1ZKEA 2VKJA 3I0QA 2A72A 3QOFA 4DBQA 3CQCB 5AQRB 3P7IA 4LMKA 3RYHE 2WU2A 2XTLA 2DWGA 2CA5A 2YDSA 3N9QA 2DI4A 2LHNA 5LG4A 3EDVA 4YSXA 4NXNT 2UUAT 2KSRA 2KXPB 3CQGB 3WAJA 3RHWA 1XNRT 5HXCA 1AJ3A 1GQEA 1SA0E 3VKGA 5HWYA 3AE8A 3PUSA 2K9AA 2BVLA 5L3CB 3RYCE 3P4WA 3MZKB 4PW8A 3N9MA 3O4XE 3RH3A 2NP9A 4EEBA 3PU3A 4DR2T 3CKDA 4EZHA 1O3XA 2LEHA 3CVRA 1KNPA 3ANWB 4NPPA 4ILAA 4ERRA 3VR8A 2CHNA 3KFWX 4UV9B 5L4EA 1N34T 4EAHA 1WR6A 2BKNA 5JDMA 2J1DG 2I59A 4KBMB 5ADXL 3IEEA 4IE6A 3EAMA 4DV5T 5LXTE 5AQHB 3ONJA 1XNQT 4QX8B 2XQ3A 2IDOB 2XQ7A 3AEAA 4HFCA 4QH1A 3N2OA 4UF0B 1MIVA 3AAAB 3IF8B 4JV5T 2E9XC 2ZM2A 2CEAA 1WR0A 1YKEB 4LF7T 2XAGB 2BG9E 4KHZF 2E2AA 2KWHA 3KV4A 3RC3A 2LOSA 4F6RC 3LFMA 5BR8T 3RKOA 4DV6T 2LSYA 4H9QC 4UF0A 4HFDA 2XQ5A 2ZMAA 5JDGA 2FJAA 2UUCT 4I43B 3VU7H 4ANJA 1MNEA 3E08A 2D0UA 3L09A 4ZZBA 4AKRB 3ZYLA 3D0TA 5ABGA 3PUWF 3ZJ1A 2BG9B 2WQYA 1LVKA 2ACXA 4O4HE 2X9HA 3SWHA 4OX9T 2FBWA 3FZMB 4X65T 2H89A 4UELA 3TLSA 2E8IA 2MYSA 4V1Av 2W66A 2WP9A 4NXMT 4DR3T 4AQYT 3AEDA 2J47A 2QGSA 1FMWA 1WLXA 3N9OA 4DIDB 1OEDC 3ETUA 3EABA 4UR9A 1HX8A 3T1HT 3ZN0B 3I0OA 4QXBB 5E0OA 3RIUA 2X51A 2HHHT 3FB2A 3N9NA 2OV9A 2XAFB 5JVDE 2E9XB 2LRKA 3JC6D 5EK4A 4IDZA 3ZMTB 1QLBA 5IUXA 1IZNB 5LJNA 2XQYA 4KI0F 4EZ4A 2YKSA 3ABVA 2UU9T 3AE2A 5AFUL 3GN5B 3Q9DA 1H7CA 4UVCB 4ZXLA 4O4JE 1XMQT 1L0VA 2CLYB 4KP3C 3QK6A 5FYMA 2IHR1 4YJ2E 2HH7A 4TV9E 2JQHA 3AE7A 5HAXA 5A1LA 1KEYA 3SS1A 4DV3T 3UU4A 4TN7B 5CGMA 4HWHA 2RPAA 4X1IE 2CWOA 5AQVB 3H3MA 3MKDA 1UX5A 1IJ5A 4B3RT 5JQGE 4U3CA 5FY0A 3IBPA 5FMNA 1R8IA 2X66A 2N1GA 2JIWA 2LLYA 4IE7A 3AXJA 5L3BB 4QWNB 3LDQB 4TUYE 4CN4A 2CCQA 5IYZE 2D5UA 5LGUB 3K3NA 4XAXB 5F8PA 1WRDA 4IT4A 3CWZB 2YEVC 5LHHB 1OEDA 4WZXA 4TNVA 3IHRA 2NOXA 3PJAJ 3I9YA 1SHZC 2V5DA 2JQQA 3AEEA 2FJDA 2OA5A 4ILCA 3FXDB 4A97A 4DUZT 3UFGA 5CA0E 5GONE 4E7ZA 3CMLA 4H63V 2AXDS 4QXCB 3LSVA 2D2SA 4NIQA 4G63A 4LMJA 5F3JA 2WDRA 4EB6E 1B7TA 2QVAA 2BS3A 4LFAT 1E1HB 2WMNA 4KMCA 4DR6T 3A8YC 5AQNB 4F8HA 3FZHB 4PNIA 1MMDA 4X1YE 1M7KA 2JMKA 2YU1A 4IREA 4ZI3C 1HFAA 1VRBA 4Z90A 5LGTB 2X9YA 4U31A 5AQIB 2WWUA 4QH5A 5LHGB 3X1DA 4EXTA 4PJNA 3K1SA 2Z6EA 1MMNA 1QUUA 3AEGA 3HKEE 3AB3B 3H3AA 4CXYA 4OFZA 2CPTA 4WYVA 4AKLA 1HR0T 4DNDA 3B13A 2ZM6T 1HS7A 1N32T 4AKGA 5AQQB 3RQUA 3VRAA 2D9DA 3N2GE 4UIGA 1S94A 4DR4T 3O1JA 5L3GB 3O1IA 3P4SA 2MTQA 3OVUA 3Q5DA 5LGNB 2KZ7B 4X62T 2RA1A 2V5CA 3SFDA 4JI3T 2HPJA 3JCFA 4PFOA 3AA6B 4X64T 4AKIA 1ZOYA 3RRCA 2HN1A 2K3WA 3LK3B 1N36T 4PK5A 2V6YB 2JPFA 1QSDA 1IBMT 2UXNB 2EHOD 5L3EB 4JLEA 2QYWA 2BKPA 2VL8A 2V8SV 3CX6B 2X0HA 4EV6A 4HKAA 2VASA 2XZEA 5BMVE 4K0KT 3Q5XA 4ZEYA
chains in the Genus database with same CATH topology
4GK0E 4U72A 5HXEA 4QX8B 3AA1B 4PJLA 2ODUA 2XUEA 2G0UA 1FIOA 2Y6XA 3HL6A 5LCYA 1YKHB 4JUYA 1MMAA 5KDMC 3N2OA 4O4IE 4UF0B 4FJOA 2Q9QC 1MIVA 2V7KA 3AAAB 3IF8B 2YINA 4ZI2D 5JDQA 2E9XC 2KINB 2ZM2A 2N2NA 2PFVA 4CI1B 2CEAA 2L8KA 1YKEB 2XAGB 4CI3B 4H9PC 2KWHA 3KV4A 4ASKA 3RC3A 2LOSA 4WBOA 2WMOA 4F6RC 3ZYKA 3LFMA 2Y48B 4ZI3D 4O2AE 5DQWA 2JJ9A 3K3OA 2LSGA 3MK7C 3RKOA 4YFSA 2LSYA 2PJQA 1Z0PA 3OJAA 4H9NC 4H9QC 4UF0A 5H6RB 5CB4E 3O1HA 2ZMAA 1WYBA 3ZPOA 5JDGA 5L3DB 2VB6A 2ZM0A 4UVBB 4EIWA 2UXXB 5HWXA 5L2LA 3O9XA 2VKHA 4YJ3E 2HPLA 4I43B 1UX4A 3BQKA 4TV8E 3VU7H 4ANJA 1MNEA 4IE0A 4GYSA 3UUMA 3DP7A 4AI6A 4MLKA 3PUQA 3E08A 5DJQC 2D0UA 5FXVA 3L09A 3LBXA 2V7LA 5DABA 5JR9B 4A56A 4AQGA 3VKHA 5LHIB 3AVRA 4AKRB 2M67A 4ZS3A 3ZYLA 3L3PA 3D0TA 1ZHCA 5FXWA 1LVFA 4HTEA 2XAQB 3ZJ1A 2NW9A 4DO0A 3KINB 3TKLB 3N9PA 3W15B 2XHEB 3OBVE 1FMVA 1LVKA 2ACXA 4YHJA 3AAEB 4GYRA 4ILUA 2X9HA 3KVAA 4O4HE 3SWHA 4C90A 5JDHA 2NW8A 3AA7B 4UELA 3EVYA 3C50A 2E8IA 2MYSA 3BK9A 3DTOA 4UEMA 4V1Av 4BJMA 4K0UA 1HG5A 2RP4A 1BR1A 3ZCJA 4PFPA 5KX5E 5JR9C 3BQLA 3K8PC 3ZMVB 1V9DA 4DMVA 2QGSA 1FMWA 1WLXA 4G2AA 4KUMB 3N9OA 2IC9A 3UFEA 3MACA 3ETUA 3ESLA 5FNVE 3KBTA 1HX8A 5HYAA 3ZN0B 3I0OA 4QXBB 4AQFA 5E0OA 2X51A 3GA8A 3FB2A 4CXXA 2QA7A 3HKCE 2KWIB 3PURA 4UXNB 4JEUB 1HTJF 3N9NA 2XAFB 4CI2B 1ZV4X 1X79A 5JVDE 5JDNA 3F31A 2Q9QB 5C8YE 1OWAA 4OYKA 3NBXX 4PAGA 3UTKA 4N78D 5FXXA 2E9XB 3JC6D 4H9OC 2DCFA 5EK4A 4IDZA 1VOMA 4P09A 3ZMTB 3FXEB 1IZNB 5LJNA 2XQYA 1G8XA 3EDUA 4X1KE 1MIYA 3LG7A 4EZ4A 5AFUL 3GN5B 3Q9DA 1H7CA 3ANWA 4IHJE 4UVCB 3WI3A 3RYIE 4QKNA 1IAPA 4O4JE 4IIJE 4BAYB 3FBZA 3DJBA 3CX8B 2CLYB 3WAKA 4KP3C 4I55E 2YK0A 3QK6A 3F2EA 4O4LE 5FYMA 4YJ2E 2Q9QA 2HH7A 3H37A 4TV9E 4MHCA 3FBLA 5HAXA 5A1LA 4GIWA 4ZI7E 3ZCIA 4OHFA 3R6NA 1D0XA 3UUXB 3QC9A 2CWYA 2NTYA 3SS1A 4O8SA 4TN7B 1G73A 4C91A 2L9QA 4AKHA 5EZYE 2W00A 4FI5A 4X1IE 2CWOA 3M65A 5JH7E 3J7Yq 2C0SA 2Q9QD 4QHOA 3MKDA 2K24A 1UX5A 3S4UA 2X0LB 2CLYC 3P8CD 3OYZA 1IJ5A 2LJLA 5JQGE 3C4WA 5FY1A 2LSKA 5LNKA 5FY0A 3HR0A 5CA1E 3PUAA 3IBPA 5FMNA 2MOZA 5KMGP 3RRWA 1T98A 3U3IA 3PU8A 3OKQA 4PK4A 2C5JA 2V1DB 2N1GA 2X66A 2LM9A 1UCUA 3QUJA 5H6QB 3E22E 2VKDA 2PBIA 5HXHA 2WBLA 3HI2A 4IE7A 4MFRA 1HF8A 3ETVA 5L3BB 4I4TE 5LP6E 2B1EA 2ES0A 3A5XA 3MA9A 3ZC1A 4CXWA 5M4YA 3UT5E 4QWNB 2H3RA 3V5SA 4ISTA 3KV6A 4TUYE 3FHNA 5J2UE 1MNDA 2CCQA 5IYZE 2D5UA 3AVSA 5LGUB 2CM0A 4MALA 4HFVA 2H7VC 2SPCA 4EYYR 3RPUA 3PDYA 3E0ZA 3K3NA 2CMRA 2K48A 3F57A 2V26A 3UUNA 1NWMX 4H9SE 3J9X1 2EHOB 4XAXB 5LBQB 2DWKA 5JR9A 2V7MA 5F8PA 1WRDA 5EK3A 3ZMUB 3CWZB 2KT9A 2YEVC 5LHHB 4X20E 3K3QC 2LE8A 4OYJA 4WNKA 5DQVA 3UULA 2NW7A 4ADZA 1FEWA 3IHRA 2NOXA 2DNXA 3I9YA 5J1GA 3VHLA 1SHZC 2X9XA 5LA6E 2H7OA 5FXZA 3HA4A 2ODVA 2P9BA 4PJJA 2XAHB 4CQIA 3ZN1B 2JQQA 5JDLA 1U4QA 1EZ3A 2W62A 2VWAA 1MMGA 2JMHA 1D1BA 2JRKA 2OA5A 3NZPA 2C5IT 4H9RC 3T8OA 3FXDB 4IE5A 2W0GA 1BR4A 5EK2A 4JEHB 1D0ZA 2CXDA 4QX7B 3ZYMA 3GMIA 4WW0A 2LHRA 3HKDE 2EHOC 1D1AA 3N5LA 3ZJ2A 4EOZB 3PTRB 2KMFA 4GK5E 5JREA 3SOLA 1KK7A 2X67A 5CA0E 4GOUA 5GONE 4YLHA 4E7ZA 3GWHA 3CMLA 3CQXC 4H63V 4L0RA 4QXCB 4CZZB 4P0BA 4WBNE 3KVBA 3ZMSB 4AXPA 5HXRA 2D2SA 3Q2MA 2XASB 4J2CA 3PUGA 4G63A 5IHYA 5F3JA 5TAOA 4U74A 4I50E 1LKXA 4NUUA 3N9LA 4Z8XA 4EB6E 3NRXA 1B7TA 2IW5B 4MBQA 3ZLIA 2ZM8A 3KBUA 1D1CA 1E1HB 2E9XA 3LJCA 2X68A 4HN9A 4ISSA 2L3LA 3RC8A 2CE7A 2KNDA 4PJMA 2WMNA 3ZMZB 1IJ6A 2CXLA 4KMCA 4ZOLE 5JRCB 2LSJA 2WAUA 1Y64B 4ZI2C 3GN5A 3CX7B 2V7IA 1OXZA 2D0TA 2A2FX 5LOVE 2VKOA 2C5KT 4PNIA 5J2TE 4O2BE 1MMDA 1CUNA 4X1YE 2JMKA 4DBRA 5LJMA 2BZBA 2YU1A 4ZI3C 2E9XD 3LK2B 4PK6A 1U5PA 4XBFB 5LYJE 1HFAA 3NRYA 2XAJB 1VRBA 3I9WA 3RX6A 1KNZA 5LGTB 2X9YA 4P0AA 3HKBE 5JRCA 1BR2A 4H63H 3U78A 2YU2A 1WYCA 3AA0B 2WWUA 3LBXB 5LHGB 5L3FB 3C4ZA 3SRZA 4IGUA 1D0YA 4ZS2A 4EXTA 3Q5WA 4TX5A 4L5GA 2K5BB 2A3DA 2N9DA 2MBGA 3BQIA 3MXZA 2BDEA 4PJNA 3NZQA 2Z6EA 3KDSE 5FP3A 1MMNA 1QUUA 4HE8A 4L9IA 4M1PA 2BVMA 1BR0A 3N2KE 2DLRA 3HKEE 1ZKEA 2VKJA 3AB3B 3H3AA 3I0QA 4CXYA 2A72A 3MJXA 4OFZA 4AKLA 4IE4A 5ETWA 3AAIA 4ZHQE 4DBQA 2V7JA 3CQCB 4DNDA 3B13A 1HS7A 3P7IA 2IAKA 4AKGA 1US7B 4DVDA 3RYHE 1MIWA 3EUHA 2KLQA 2XTLA 3KV5A 5LBMA 1YW0A 2LOPA 2DWGA 2CA5A 2NWBA 3N2GE 3N9QA 4UIGA 1S35A 2DI4A 2LHNA 2W61A 2WM9A 5LG4A 1YD8G 3EDVA 1LRZA 4QXHB 1S94A 2W63A 2KXPB 3CQGB 3O1JA 2WSSV 3WAJA 5L3GB 1NAFA 4EYUA 2LT3A 3C4XA 3CPZA 3O1IA 3ZEFB 2GK9A 5HXCA 3ONXA 1AJ3A 4BA9A 3B57A 3RYFE 1SA0E 2MTQA 4HEAA 3VKGA 5HWYA 2NTXA 3C64A 2KZ7B 5LGNB 2RA1A 5FY7A 3PUSA 1HCIA 2K9AA 2BVLA 2DHRA 5L3CB 3RYCE 4UVAB 2HPJA 3MZKB 2EHOA 4BJNA 4PFOA 4DMWA 4PW8A 3N9MA 3AA6B 3O4XE 2PG8A 4UV8B 3RH3A 2NP9A 3OYXA 2VK9A 3PU3A 4OK0A 4AKIA 3CKDA 3RRCA 4EZHA 1O3XA 2CXFA 3JC6C 3LK3B 3C98B 4E7SA 4PK5A 2LEHA 3CVRA 3I1AA 1ZEEA 3R84B 3ANWB 2JPFA 2Y8DA 1QSDA 4ERRA 4HGAA 2UXNB 2EHOD 5JDFA 4AQFC 5L3EB 1HG2A 3C51A 4NUVA 3KFWX 4UV9B 4JLEA 4TZ4C 5HXSA 2VL8A 4EAHA 2IC6A 1WR6A 3CX6B 5JDMA 2LSIA 3KV9A 2J1DG 3PE0A 2I59A 3LK42 4KBMB 5ADXL 3IEEA 4B6XA 4HKAA 2VASA 4IE6A 3V5UA 5BMVE 2X9WA 3ZC0A 2ZLYA 5LXTE 3Q5XA 4XZCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VKO A;  2VKJ A; 
#chains in the Genus database with same CATH topology
 3AE5 A;  2WCA A;  4PJL A;  4TWD A;  2XUE A;  3HL6 A;  5KXJ A;  1MMA A;  4O4I E;  3EHZ A;  4COF A;  2V7K A;  4ZI2 D;  5JDQ A;  2I6H A;  1JNR A;  2N2N A;  4JYA T;  1Z8U A;  4LF4 T;  4IDO A;  2YOE A;  1I6Z A;  5DQW A;  3UU8 A;  2JJ9 A;  2LSG A;  4YSZ A;  3RI5 A;  5CB4 E;  1WYB A;  2VB6 A;  2ZM0 A;  4UVB B;  5HWX A;  2VKH A;  3BQK A;  4TV8 E;  5HEJ A;  4GYS A;  4ZZC A;  5FXV A;  5DAB A;  1ZHC A;  2NW9 A;  3N9P A;  2XHE B;  1FMV A;  3KVA A;  4IL4 A;  4C90 A;  3AA7 B;  3EVY A;  2OLT A;  3C50 A;  3BK9 A;  1XDP A;  4UEM A;  5AQS B;  1HG5 A;  2RP4 A;  4JI5 T;  4PFP A;  3K8P C;  1V9D A;  4DMV A;  3AE6 A;  4G2A A;  2IC9 A;  3MAC A;  2BG9 C;  2BS2 A;  3FZK B;  3GA8 A;  4CXX A;  3HKC E;  5LMU T;  4HFE A;  5JDN A;  3F31 A;  4PAG A;  2E5V A;  4N78 D;  3JAF A;  2MPK A;  1G8X A;  3ANW A;  3WI3 A;  1W09 A;  3TLV A;  3FBZ A;  5CJ5 A;  3DJB A;  4I55 E;  2YK0 A;  3F2E A;  4O4L E;  2W4X A;  4TWF A;  2BS4 A;  3PJA A;  4GIW A;  3R6N A;  1D0X A;  2CWY A;  2NTY A;  2L9Q A;  4AKH A;  4IDN A;  2W00 A;  3M65 A;  5JH7 E;  3J7Y q;  2Q9Q D;  4LF8 T;  2K24 A;  3TLT A;  4ILB A;  2CLY C;  3OYZ A;  2E5L T;  2IIU A;  3A7M A;  3C4W A;  5FY1 A;  4JI2 T;  5KMG P;  3PU8 A;  2C5J A;  2V1D B;  4IL9 A;  3FZF B;  1UCU A;  4JI7 T;  5H6Q B;  2WBL A;  3HI2 A;  3ETV A;  4I4T E;  2B1E A;  5M4Y A;  3AE1 A;  1XWM A;  4P1N A;  2AE9 A;  3V5S A;  5HCM A;  4B3S T;  4U2Y A;  4HFV A;  3RPU A;  2XQ6 A;  5F5W A;  2J4G A;  2V26 A;  3UUN A;  1NWM X;  2EHO B;  5LBQ B;  5C2T A;  2UXC T;  3L8R A;  3K3Q C;  4WNK A;  1WCR A;  3UUL A;  4DV0 T;  2BG9 A;  4YT0 A;  2X9X A;  2ODV A;  2VWA A;  1MMG A;  1D1B A;  3T8O A;  5EK2 A;  1D0Z A;  2XQ4 A;  3ZYM A;  3VRB A;  3N5L A;  3ZJ2 A;  4EOZ B;  2KMF A;  1T8B A;  3CQX C;  4L0R A;  4WBN E;  3KVB A;  4U2Z A;  2JQ9 A;  1IBK T;  2XAS B;  3PUG A;  4U74 A;  4I50 E;  1W0A A;  4NUU A;  3N9L A;  2M6B A;  2E9X A;  4ISS A;  2X68 A;  4HN9 A;  2CE7 A;  4PJM A;  3ZMZ B;  2CXL A;  4ZOL E;  5JRC B;  3UQ4 A;  1Y64 B;  3GN5 A;  2V7I A;  5LOV E;  4Z91 A;  2C5K T;  2WDQ A;  1N33 T;  4DBR A;  4HFH A;  3LK2 B;  1U5P A;  3NRY A;  3ZST A;  4DR5 T;  3HKB E;  5JRC A;  1DU2 A;  3LBX B;  3C4Z A;  3SRZ A;  1HNX T;  2A3D A;  2MBG A;  3UQ7 A;  3BQI A;  5AQJ B;  3NZQ A;  3ZSS A;  2F4V T;  3TLU A;  1HX1 B;  4M1P A;  3N2K E;  2DLR A;  3MJX A;  2YDR A;  5ETW A;  4ZHQ E;  1I94 T;  4EED A;  1US7 B;  2W2U A;  2A9U A;  5ABF B;  1MIW A;  3ZT6 A;  3KV5 A;  1YW0 A;  2BKO A;  2WM9 A;  2LM2 A;  1YD8 G;  4HFI A;  2WSS V;  2XY8 B;  1NAF A;  5AQL B;  2LT3 A;  3C4X A;  3ZEF B;  3B57 A;  1W9R A;  4HEA A;  2NTX A;  3C64 A;  5FY7 A;  3QB5 K;  5CFB A;  2MAW A;  4GKK T;  4BJN A;  4DMW A;  4UV8 B;  2UXB T;  2IML A;  4YTP A;  1UGO A;  1J1J A;  3OYX A;  2FJB A;  2VK9 A;  4OK0 A;  2H88 A;  2CXF A;  3JC6 C;  3C98 B;  4YSY A;  3R84 B;  4HGA A;  5JDF A;  1HG2 A;  3C51 A;  4HWI B;  3B5M A;  2IC6 A;  2LSI A;  3KV9 A;  3LK4 2;  4B6X A;  1Y01 A;  2WY2 A;  2X9W A;  1E2A A;  3ZC0 A;  5HXE A;  2ODU A;  2G0U A;  1FIO A;  2Y6X A;  3P50 A;  1T7S A;  4JUY A;  5LMN T;  4DV1 T;  4JI0 T;  2KIN B;  4CI1 B;  2L8K A;  4CI3 B;  4ASK A;  4WBO A;  3ZYK A;  2Y48 B;  4O2A E;  2HN2 A;  3K3O A;  4YFS A;  2R6G F;  2PJQ A;  1Z0P A;  5H6R B;  5L3D B;  3ZKR A;  2UXX B;  4EIW A;  5JTG A;  2HPL A;  1UX4 A;  5DJQ C;  5JR9 B;  5FL1 A;  4AQG A;  3L3P A;  5FXW A;  2XAQ B;  3W15 B;  3UU3 A;  2I0M A;  2XPK A;  4GYR A;  4ILU A;  5JDH A;  3P4R A;  2NW8 A;  3UU6 A;  4YY3 T;  3PUZ F;  3AEF A;  3ZT7 A;  1BR1 A;  2XM2 A;  4CN1 A;  4LF5 T;  5KX5 E;  2PTF A;  4KUM B;  3OPC A;  3ESL A;  5HYA A;  3PUR A;  1CHU A;  3CK6 A;  4CI2 B;  1X79 A;  4I0U A;  3UTK A;  2BBH A;  1VOM A;  3TLW A;  5J0Z A;  4P09 A;  4U7I A;  3FXE B;  3EI0 A;  5C3J A;  3EDU A;  4X1K E;  1MIY A;  2V6Y A;  4IHJ E;  3RYI E;  4BAY B;  1IAP A;  1SUM B;  3CX8 B;  3WAK A;  3G06 A;  3RIA A;  4LF9 T;  1J5E T;  3H37 A;  5FVK A;  2UUB T;  2UXD T;  4ZI7 E;  3ZCI A;  4OHF A;  2VQE T;  3QC9 A;  4O8S A;  4C91 A;  3NKZ A;  2V6X A;  4HFB A;  5EZY E;  4FI5 A;  5L4H A;  2C0S A;  2JQK A;  3P8C D;  4DV4 T;  4A98 A;  2LJL A;  5LNK A;  5CA1 E;  3PUA A;  2MOZ A;  3RRW A;  3OKQ A;  2LM9 A;  3QUJ A;  2VKD A;  2PBI A;  5HXH A;  5LP6 E;  2ES0 A;  3A5X A;  3MA9 A;  3ZC1 A;  2H3R A;  5FKY A;  3Q5E A;  4IST A;  4HWC A;  5AQK B;  2CM0 A;  2H7V C;  2WZH A;  3PDY A;  3E0Z A;  5ABH A;  3J9X 1;  3L39 A;  2DWK A;  3SFE A;  4JI6 T;  3ZMU B;  2KT9 A;  4X20 E;  4OYJ A;  4Q25 A;  1FEW A;  4TNW A;  2DNX A;  2WWV A;  5LA6 E;  2H7O A;  5FXZ A;  2XQ8 A;  5JDL A;  1U4Q A;  1EZ3 A;  2JRK A;  4IE5 A;  4GKJ T;  4KHP T;  1BR4 A;  4QX7 B;  2CXD A;  3RKG A;  4WW0 A;  2LHR A;  2WZI A;  2EHO C;  1J5W A;  4GK5 E;  5JRE A;  5AQM B;  2QRX A;  2X67 A;  4GOU A;  4YLH A;  4EGW A;  4YXD A;  2DL1 A;  5HEU A;  2XSA A;  3RF1 A;  3ZMS B;  4AXP A;  5HXR A;  4JBW F;  3RIU C;  5IHY A;  5TAO A;  4B3M T;  1LKX A;  3JAD A;  4JI8 T;  2IW5 B;  4MBQ A;  2ZM8 A;  3KBU A;  2J62 A;  3RC8 A;  3LJC A;  5ABE A;  1IJ6 A;  4U7Y A;  2LSJ A;  4ZI2 C;  2CBJ A;  2IUB A;  4IDQ A;  3CX7 B;  4QH4 A;  1OXZ A;  5FVL A;  2D0T A;  1XZY A;  2VKO A;  2FJE A;  2VVS A;  4XBF B;  5LYJ E;  2LKG A;  3I9W A;  1KNZ A;  1XMO T;  3U78 A;  2YU2 A;  1WYC A;  3AA0 B;  2CHO A;  1UUS A;  4ZS2 A;  3Q5W A;  4TX5 A;  2K5B B;  3ONL C;  1UUR A;  2BDE A;  4DR7 T;  3KDS E;  4HE8 A;  4L9I A;  2BVM A;  5HEH A;  1BR0 A;  5IWA T;  3QB5 A;  4YTM A;  4IE4 A;  3AAI A;  2V7J A;  5HCJ A;  1YXR A;  2IAK A;  4DVD A;  3EUH A;  2KLQ A;  3JAE A;  5LBM A;  2LOP A;  2NWB A;  1S35 A;  2W61 A;  1LRZ A;  4QXH B;  2WU5 A;  2W63 A;  4EYU A;  3CPZ A;  4LF6 T;  2GK9 A;  3ONX A;  4BA9 A;  3RYF E;  1KNR A;  3RLF F;  5FL0 A;  3AE3 A;  4JI1 T;  4KX6 A;  1HCI A;  2DHR A;  4UVA B;  2EHO A;  5LB7 B;  2WS3 A;  2PG8 A;  4DUY T;  5LG3 A;  1YQ3 A;  4E7S A;  3I1A A;  1ZEE A;  2Y8D A;  4DV2 T;  4U33 A;  3NVO A;  4AQF C;  1IBL T;  4HWD A;  4NUV A;  4TZ4 C;  1VCT A;  3IA3 A;  5HXS A;  1T72 A;  3PE0 A;  3V5U A;  2ZLY A;  4XZC A;  1HNZ T;  4GK0 E;  4U72 A;  4HWF A;  3AA1 B;  5LCY A;  1YKH B;  5KDM C;  4FJO A;  2Q9Q C;  4JI4 T;  2VL0 A;  2YIN A;  2PFV A;  5HEO A;  1ZP0 A;  1XDO A;  1OED E;  5AQT B;  4H9P C;  3AXJ B;  2WMO A;  2CBI A;  4ZI3 D;  3MK7 C;  3OJA A;  4H9N C;  2VUR A;  3O1H A;  3ZPO A;  3O9X A;  5L2L A;  3CIR A;  4YJ3 E;  4IE0 A;  3UUM A;  3DP7 A;  4AI6 A;  4MLK A;  3PUQ A;  3LBX A;  2V7L A;  4A56 A;  4IDP A;  3RGL A;  2X0Y A;  5LHI B;  3AVR A;  3VKH A;  2M67 A;  4ZS3 A;  1LVF A;  4HTE A;  1UK5 A;  1OED B;  4DR1 T;  3QNU A;  4DO0 A;  3KIN B;  3TKL B;  3P4P A;  3RIF A;  3OBV E;  4AIS A;  4YHJ A;  3AAE B;  2NR4 A;  3M3Z B;  3DTO A;  4BJM A;  4X5T A;  4K0U A;  1X9B A;  3FZL B;  3ZCJ A;  5ABF A;  4LFC T;  5AQU B;  5JR9 C;  3BQL A;  3ZMV B;  4TWH A;  2XJ7 A;  3RQW A;  3UFE A;  1M62 A;  3AEB A;  5FNV E;  3KBT A;  4AQF A;  2XQA A;  2QA7 A;  2KWI B;  4UXN B;  4JEU B;  1KF6 A;  1HTJ F;  3ZT5 A;  1ZV4 X;  2Q9Q B;  5C8Y E;  1OWA A;  4OYK A;  3NBX X;  1KFY A;  5FXX A;  4YTN A;  4H9O C;  2DCF A;  1JNZ A;  1HNW T;  3LG7 A;  2B76 A;  3AE9 A;  1FJG T;  5AQO B;  1NEN A;  4QKN A;  4IIJ E;  2WB5 A;  2Q9Q A;  3PUY F;  4MHC A;  3FBL A;  4YHH T;  3UUX B;  1E7P A;  1G73 A;  4X66 T;  4B3T T;  4A5X A;  4QHO A;  3S4U A;  2X0L B;  2LSK A;  2CRB A;  3HR0 A;  1T98 A;  3U3I A;  4PK4 A;  4CN6 A;  5AQF B;  2XM1 A;  3E22 E;  3PV0 F;  4MFR A;  1HF8 A;  2XSB A;  4CXW A;  3UT5 E;  5L47 A;  3KV6 A;  3FHN A;  5J2U E;  1MND A;  2XQ9 A;  3AVS A;  4MAL A;  2SPC A;  4EYY R;  1W0B A;  2CMR A;  2K48 A;  3F57 A;  4H9S E;  4DV7 T;  5JR9 A;  2V7M A;  5EK3 A;  3T1Y T;  2LE8 A;  5DQV A;  1NEK A;  2YDQ A;  2NW7 A;  4ADZ A;  2ACZ A;  2BBJ A;  5J1G A;  3VHL A;  3HA4 A;  4CQI A;  2P9B A;  4PJJ A;  2XAH B;  3ZN1 B;  2LRL A;  2W62 A;  2JMH A;  3NZP A;  3P4Q A;  2C5I T;  4H9R C;  1WFD A;  2W0G A;  4JEH B;  3GMI A;  3HKD E;  1D1A A;  3PTR B;  3SOL A;  1KK7 A;  3UUB A;  3GWH A;  3PUX F;  2M6I A;  4CZZ B;  4P0B A;  2W67 A;  2YN6 A;  5HEG A;  3Q2M A;  4J2C A;  3UU5 A;  4Z8X A;  1SE7 A;  3NRX A;  3ZLI A;  4LML A;  1D1C A;  2L3L A;  2KND A;  4AIU A;  1VCS A;  2WAU A;  3AE4 A;  2A2F X;  4LFB T;  3NWI A;  5J2T E;  4O2B E;  2VQF T;  1CUN A;  3OTO T;  1YQ4 A;  5AQP B;  5LJM A;  2BZB A;  2E9X D;  4PK6 A;  2WDV A;  2XAJ B;  3RX6 A;  3VR9 A;  3AEC A;  4P0A A;  1BR2 A;  2FUP A;  4H63 H;  5AQG B;  2VVN A;  5L3F B;  4IGU A;  1D0Y A;  4L5G A;  2N9D A;  3MXZ A;  3PUV F;  5FP3 A;  2LKH A;  1ZKE A;  2VKJ A;  3I0Q A;  2A72 A;  3QOF A;  4DBQ A;  3CQC B;  5AQR B;  3P7I A;  4LMK A;  3RYH E;  2WU2 A;  2XTL A;  2DWG A;  2CA5 A;  2YDS A;  3N9Q A;  2DI4 A;  2LHN A;  5LG4 A;  3EDV A;  4YSX A;  4NXN T;  2UUA T;  2KSR A;  2KXP B;  3CQG B;  3WAJ A;  3RHW A;  1XNR T;  5HXC A;  1AJ3 A;  1GQE A;  1SA0 E;  3VKG A;  5HWY A;  3AE8 A;  3PUS A;  2K9A A;  2BVL A;  5L3C B;  3RYC E;  3P4W A;  3MZK B;  4PW8 A;  3N9M A;  3O4X E;  3RH3 A;  2NP9 A;  4EEB A;  3PU3 A;  4DR2 T;  3CKD A;  4EZH A;  1O3X A;  2LEH A;  3CVR A;  1KNP A;  3ANW B;  4NPP A;  4ILA A;  4ERR A;  3VR8 A;  2CHN A;  3KFW X;  4UV9 B;  5L4E A;  1N34 T;  4EAH A;  1WR6 A;  2BKN A;  5JDM A;  2J1D G;  2I59 A;  4KBM B;  5ADX L;  3IEE A;  4IE6 A;  3EAM A;  4DV5 T;  5LXT E;  5AQH B;  3ONJ A;  1XNQ T;  4QX8 B;  2XQ3 A;  2IDO B;  2XQ7 A;  3AEA A;  4HFC A;  4QH1 A;  3N2O A;  4UF0 B;  1MIV A;  3AAA B;  3IF8 B;  4JV5 T;  2E9X C;  2ZM2 A;  2CEA A;  1WR0 A;  1YKE B;  4LF7 T;  2XAG B;  2BG9 E;  4KHZ F;  2E2A A;  2KWH A;  3KV4 A;  3RC3 A;  2LOS A;  4F6R C;  3LFM A;  5BR8 T;  3RKO A;  4DV6 T;  2LSY A;  4H9Q C;  4UF0 A;  4HFD A;  2XQ5 A;  2ZMA A;  5JDG A;  2FJA A;  2UUC T;  4I43 B;  3VU7 H;  4ANJ A;  1MNE A;  3E08 A;  2D0U A;  3L09 A;  4ZZB A;  4AKR B;  3ZYL A;  3D0T A;  5ABG A;  3PUW F;  3ZJ1 A;  2BG9 B;  2WQY A;  1LVK A;  2ACX A;  4O4H E;  2X9H A;  3SWH A;  4OX9 T;  2FBW A;  3FZM B;  4X65 T;  2H89 A;  4UEL A;  3TLS A;  2E8I A;  2MYS A;  4V1A v;  2W66 A;  2WP9 A;  4NXM T;  4DR3 T;  4AQY T;  3AED A;  2J47 A;  2QGS A;  1FMW A;  1WLX A;  3N9O A;  4DID B;  1OED C;  3ETU A;  3EAB A;  4UR9 A;  1HX8 A;  3T1H T;  3ZN0 B;  3I0O A;  4QXB B;  5E0O A;  3RIU A;  2X51 A;  2HHH T;  3FB2 A;  3N9N A;  2OV9 A;  2XAF B;  5JVD E;  2E9X B;  2LRK A;  3JC6 D;  5EK4 A;  4IDZ A;  3ZMT B;  1QLB A;  5IUX A;  1IZN B;  5LJN A;  2XQY A;  4KI0 F;  4EZ4 A;  2YKS A;  3ABV A;  2UU9 T;  3AE2 A;  5AFU L;  3GN5 B;  3Q9D A;  1H7C A;  4UVC B;  4ZXL A;  4O4J E;  1XMQ T;  1L0V A;  2CLY B;  4KP3 C;  3QK6 A;  5FYM A;  2IHR 1;  4YJ2 E;  2HH7 A;  4TV9 E;  2JQH A;  3AE7 A;  5HAX A;  5A1L A;  1KEY A;  3SS1 A;  4DV3 T;  3UU4 A;  4TN7 B;  5CGM A;  4HWH A;  2RPA A;  4X1I E;  2CWO A;  5AQV B;  3H3M A;  3MKD A;  1UX5 A;  1IJ5 A;  4B3R T;  5JQG E;  4U3C A;  5FY0 A;  3IBP A;  5FMN A;  1R8I A;  2X66 A;  2N1G A;  2JIW A;  2LLY A;  4IE7 A;  3AXJ A;  5L3B B;  4QWN B;  3LDQ B;  4TUY E;  4CN4 A;  2CCQ A;  5IYZ E;  2D5U A;  5LGU B;  3K3N A;  4XAX B;  5F8P A;  1WRD A;  4IT4 A;  3CWZ B;  2YEV C;  5LHH B;  1OED A;  4WZX A;  4TNV A;  3IHR A;  2NOX A;  3PJA J;  3I9Y A;  1SHZ C;  2V5D A;  2JQQ A;  3AEE A;  2FJD A;  2OA5 A;  4ILC A;  3FXD B;  4A97 A;  4DUZ T;  3UFG A;  5CA0 E;  5GON E;  4E7Z A;  3CML A;  4H63 V;  2AXD S;  4QXC B;  3LSV A;  2D2S A;  4NIQ A;  4G63 A;  4LMJ A;  5F3J A;  2WDR A;  4EB6 E;  1B7T A;  2QVA A;  2BS3 A;  4LFA T;  1E1H B;  2WMN A;  4KMC A;  4DR6 T;  3A8Y C;  5AQN B;  4F8H A;  3FZH B;  4PNI A;  1MMD A;  4X1Y E;  1M7K A;  2JMK A;  2YU1 A;  4IRE A;  4ZI3 C;  1HFA A;  1VRB A;  4Z90 A;  5LGT B;  2X9Y A;  4U31 A;  5AQI B;  2WWU A;  4QH5 A;  5LHG B;  3X1D A;  4EXT A;  4PJN A;  3K1S A;  2Z6E A;  1MMN A;  1QUU A;  3AEG A;  3HKE E;  3AB3 B;  3H3A A;  4CXY A;  4OFZ A;  2CPT A;  4WYV A;  4AKL A;  1HR0 T;  4DND A;  3B13 A;  2ZM6 T;  1HS7 A;  1N32 T;  4AKG A;  5AQQ B;  3RQU A;  3VRA A;  2D9D A;  3N2G E;  4UIG A;  1S94 A;  4DR4 T;  3O1J A;  5L3G B;  3O1I A;  3P4S A;  2MTQ A;  3OVU A;  3Q5D A;  5LGN B;  2KZ7 B;  4X62 T;  2RA1 A;  2V5C A;  3SFD A;  4JI3 T;  2HPJ A;  3JCF A;  4PFO A;  3AA6 B;  4X64 T;  4AKI A;  1ZOY A;  3RRC A;  2HN1 A;  2K3W A;  3LK3 B;  1N36 T;  4PK5 A;  2V6Y B;  2JPF A;  1QSD A;  1IBM T;  2UXN B;  2EHO D;  5L3E B;  4JLE A;  2QYW A;  2BKP A;  2VL8 A;  2V8S V;  3CX6 B;  2X0H A;  4EV6 A;  4HKA A;  2VAS A;  2XZE A;  5BMV E;  4K0K T;  3Q5X A;  4ZEY A; 
#chains in the Genus database with same CATH homology
 4GK0 E;  4U72 A;  5HXE A;  4QX8 B;  3AA1 B;  4PJL A;  2ODU A;  2XUE A;  2G0U A;  1FIO A;  2Y6X A;  3HL6 A;  5LCY A;  1YKH B;  4JUY A;  1MMA A;  5KDM C;  3N2O A;  4O4I E;  4UF0 B;  4FJO A;  2Q9Q C;  1MIV A;  2V7K A;  3AAA B;  3IF8 B;  2YIN A;  4ZI2 D;  5JDQ A;  2E9X C;  2KIN B;  2ZM2 A;  2N2N A;  2PFV A;  4CI1 B;  2CEA A;  2L8K A;  1YKE B;  2XAG B;  4CI3 B;  4H9P C;  2KWH A;  3KV4 A;  4ASK A;  3RC3 A;  2LOS A;  4WBO A;  2WMO A;  4F6R C;  3ZYK A;  3LFM A;  2Y48 B;  4ZI3 D;  4O2A E;  5DQW A;  2JJ9 A;  3K3O A;  2LSG A;  3MK7 C;  3RKO A;  4YFS A;  2LSY A;  2PJQ A;  1Z0P A;  3OJA A;  4H9N C;  4H9Q C;  4UF0 A;  5H6R B;  5CB4 E;  3O1H A;  2ZMA A;  1WYB A;  3ZPO A;  5JDG A;  5L3D B;  2VB6 A;  2ZM0 A;  4UVB B;  4EIW A;  2UXX B;  5HWX A;  5L2L A;  3O9X A;  2VKH A;  4YJ3 E;  2HPL A;  4I43 B;  1UX4 A;  3BQK A;  4TV8 E;  3VU7 H;  4ANJ A;  1MNE A;  4IE0 A;  4GYS A;  3UUM A;  3DP7 A;  4AI6 A;  4MLK A;  3PUQ A;  3E08 A;  5DJQ C;  2D0U A;  5FXV A;  3L09 A;  3LBX A;  2V7L A;  5DAB A;  5JR9 B;  4A56 A;  4AQG A;  3VKH A;  5LHI B;  3AVR A;  4AKR B;  2M67 A;  4ZS3 A;  3ZYL A;  3L3P A;  3D0T A;  1ZHC A;  5FXW A;  1LVF A;  4HTE A;  2XAQ B;  3ZJ1 A;  2NW9 A;  4DO0 A;  3KIN B;  3TKL B;  3N9P A;  3W15 B;  2XHE B;  3OBV E;  1FMV A;  1LVK A;  2ACX A;  4YHJ A;  3AAE B;  4GYR A;  4ILU A;  2X9H A;  3KVA A;  4O4H E;  3SWH A;  4C90 A;  5JDH A;  2NW8 A;  3AA7 B;  4UEL A;  3EVY A;  3C50 A;  2E8I A;  2MYS A;  3BK9 A;  3DTO A;  4UEM A;  4V1A v;  4BJM A;  4K0U A;  1HG5 A;  2RP4 A;  1BR1 A;  3ZCJ A;  4PFP A;  5KX5 E;  5JR9 C;  3BQL A;  3K8P C;  3ZMV B;  1V9D A;  4DMV A;  2QGS A;  1FMW A;  1WLX A;  4G2A A;  4KUM B;  3N9O A;  2IC9 A;  3UFE A;  3MAC A;  3ETU A;  3ESL A;  5FNV E;  3KBT A;  1HX8 A;  5HYA A;  3ZN0 B;  3I0O A;  4QXB B;  4AQF A;  5E0O A;  2X51 A;  3GA8 A;  3FB2 A;  4CXX A;  2QA7 A;  3HKC E;  2KWI B;  3PUR A;  4UXN B;  4JEU B;  1HTJ F;  3N9N A;  2XAF B;  4CI2 B;  1ZV4 X;  1X79 A;  5JVD E;  5JDN A;  3F31 A;  2Q9Q B;  5C8Y E;  1OWA A;  4OYK A;  3NBX X;  4PAG A;  3UTK A;  4N78 D;  5FXX A;  2E9X B;  3JC6 D;  4H9O C;  2DCF A;  5EK4 A;  4IDZ A;  1VOM A;  4P09 A;  3ZMT B;  3FXE B;  1IZN B;  5LJN A;  2XQY A;  1G8X A;  3EDU A;  4X1K E;  1MIY A;  3LG7 A;  4EZ4 A;  5AFU L;  3GN5 B;  3Q9D A;  1H7C A;  3ANW A;  4IHJ E;  4UVC B;  3WI3 A;  3RYI E;  4QKN A;  1IAP A;  4O4J E;  4IIJ E;  4BAY B;  3FBZ A;  3DJB A;  3CX8 B;  2CLY B;  3WAK A;  4KP3 C;  4I55 E;  2YK0 A;  3QK6 A;  3F2E A;  4O4L E;  5FYM A;  4YJ2 E;  2Q9Q A;  2HH7 A;  3H37 A;  4TV9 E;  4MHC A;  3FBL A;  5HAX A;  5A1L A;  4GIW A;  4ZI7 E;  3ZCI A;  4OHF A;  3R6N A;  1D0X A;  3UUX B;  3QC9 A;  2CWY A;  2NTY A;  3SS1 A;  4O8S A;  4TN7 B;  1G73 A;  4C91 A;  2L9Q A;  4AKH A;  5EZY E;  2W00 A;  4FI5 A;  4X1I E;  2CWO A;  3M65 A;  5JH7 E;  3J7Y q;  2C0S A;  2Q9Q D;  4QHO A;  3MKD A;  2K24 A;  1UX5 A;  3S4U A;  2X0L B;  2CLY C;  3P8C D;  3OYZ A;  1IJ5 A;  2LJL A;  5JQG E;  3C4W A;  5FY1 A;  2LSK A;  5LNK A;  5FY0 A;  3HR0 A;  5CA1 E;  3PUA A;  3IBP A;  5FMN A;  2MOZ A;  5KMG P;  3RRW A;  1T98 A;  3U3I A;  3PU8 A;  3OKQ A;  4PK4 A;  2C5J A;  2V1D B;  2N1G A;  2X66 A;  2LM9 A;  1UCU A;  3QUJ A;  5H6Q B;  3E22 E;  2VKD A;  2PBI A;  5HXH A;  2WBL A;  3HI2 A;  4IE7 A;  4MFR A;  1HF8 A;  3ETV A;  5L3B B;  4I4T E;  5LP6 E;  2B1E A;  2ES0 A;  3A5X A;  3MA9 A;  3ZC1 A;  4CXW A;  5M4Y A;  3UT5 E;  4QWN B;  2H3R A;  3V5S A;  4IST A;  3KV6 A;  4TUY E;  3FHN A;  5J2U E;  1MND A;  2CCQ A;  5IYZ E;  2D5U A;  3AVS A;  5LGU B;  2CM0 A;  4MAL A;  4HFV A;  2H7V C;  2SPC A;  4EYY R;  3RPU A;  3PDY A;  3E0Z A;  3K3N A;  2CMR A;  2K48 A;  3F57 A;  2V26 A;  3UUN A;  1NWM X;  4H9S E;  3J9X 1;  2EHO B;  4XAX B;  5LBQ B;  2DWK A;  5JR9 A;  2V7M A;  5F8P A;  1WRD A;  5EK3 A;  3ZMU B;  3CWZ B;  2KT9 A;  2YEV C;  5LHH B;  4X20 E;  3K3Q C;  2LE8 A;  4OYJ A;  4WNK A;  5DQV A;  3UUL A;  2NW7 A;  4ADZ A;  1FEW A;  3IHR A;  2NOX A;  2DNX A;  3I9Y A;  5J1G A;  3VHL A;  1SHZ C;  2X9X A;  5LA6 E;  2H7O A;  5FXZ A;  3HA4 A;  2ODV A;  2P9B A;  4PJJ A;  2XAH B;  4CQI A;  3ZN1 B;  2JQQ A;  5JDL A;  1U4Q A;  1EZ3 A;  2W62 A;  2VWA A;  1MMG A;  2JMH A;  1D1B A;  2JRK A;  2OA5 A;  3NZP A;  2C5I T;  4H9R C;  3T8O A;  3FXD B;  4IE5 A;  2W0G A;  1BR4 A;  5EK2 A;  4JEH B;  1D0Z A;  2CXD A;  4QX7 B;  3ZYM A;  3GMI A;  4WW0 A;  2LHR A;  3HKD E;  2EHO C;  1D1A A;  3N5L A;  3ZJ2 A;  4EOZ B;  3PTR B;  2KMF A;  4GK5 E;  5JRE A;  3SOL A;  1KK7 A;  2X67 A;  5CA0 E;  4GOU A;  5GON E;  4YLH A;  4E7Z A;  3GWH A;  3CML A;  3CQX C;  4H63 V;  4L0R A;  4QXC B;  4CZZ B;  4P0B A;  4WBN E;  3KVB A;  3ZMS B;  4AXP A;  5HXR A;  2D2S A;  3Q2M A;  2XAS B;  4J2C A;  3PUG A;  4G63 A;  5IHY A;  5F3J A;  5TAO A;  4U74 A;  4I50 E;  1LKX A;  4NUU A;  3N9L A;  4Z8X A;  4EB6 E;  3NRX A;  1B7T A;  2IW5 B;  4MBQ A;  3ZLI A;  2ZM8 A;  3KBU A;  1D1C A;  1E1H B;  2E9X A;  3LJC A;  2X68 A;  4HN9 A;  4ISS A;  2L3L A;  3RC8 A;  2CE7 A;  2KND A;  4PJM A;  2WMN A;  3ZMZ B;  1IJ6 A;  2CXL A;  4KMC A;  4ZOL E;  5JRC B;  2LSJ A;  2WAU A;  1Y64 B;  4ZI2 C;  3GN5 A;  3CX7 B;  2V7I A;  1OXZ A;  2D0T A;  2A2F X;  5LOV E;  2VKO A;  2C5K T;  4PNI A;  5J2T E;  4O2B E;  1MMD A;  1CUN A;  4X1Y E;  2JMK A;  4DBR A;  5LJM A;  2BZB A;  2YU1 A;  4ZI3 C;  2E9X D;  3LK2 B;  4PK6 A;  1U5P A;  4XBF B;  5LYJ E;  1HFA A;  3NRY A;  2XAJ B;  1VRB A;  3I9W A;  3RX6 A;  1KNZ A;  5LGT B;  2X9Y A;  4P0A A;  3HKB E;  5JRC A;  1BR2 A;  4H63 H;  3U78 A;  2YU2 A;  1WYC A;  3AA0 B;  2WWU A;  3LBX B;  5LHG B;  5L3F B;  3C4Z A;  3SRZ A;  4IGU A;  1D0Y A;  4ZS2 A;  4EXT A;  3Q5W A;  4TX5 A;  4L5G A;  2K5B B;  2A3D A;  2N9D A;  2MBG A;  3BQI A;  3MXZ A;  2BDE A;  4PJN A;  3NZQ A;  2Z6E A;  3KDS E;  5FP3 A;  1MMN A;  1QUU A;  4HE8 A;  4L9I A;  4M1P A;  2BVM A;  1BR0 A;  3N2K E;  2DLR A;  3HKE E;  1ZKE A;  2VKJ A;  3AB3 B;  3H3A A;  3I0Q A;  4CXY A;  2A72 A;  3MJX A;  4OFZ A;  4AKL A;  4IE4 A;  5ETW A;  3AAI A;  4ZHQ E;  4DBQ A;  2V7J A;  3CQC B;  4DND A;  3B13 A;  1HS7 A;  3P7I A;  2IAK A;  4AKG A;  1US7 B;  4DVD A;  3RYH E;  1MIW A;  3EUH A;  2KLQ A;  2XTL A;  3KV5 A;  5LBM A;  1YW0 A;  2LOP A;  2DWG A;  2CA5 A;  2NWB A;  3N2G E;  3N9Q A;  4UIG A;  1S35 A;  2DI4 A;  2LHN A;  2W61 A;  2WM9 A;  5LG4 A;  1YD8 G;  3EDV A;  1LRZ A;  4QXH B;  1S94 A;  2W63 A;  2KXP B;  3CQG B;  3O1J A;  2WSS V;  3WAJ A;  5L3G B;  1NAF A;  4EYU A;  2LT3 A;  3C4X A;  3CPZ A;  3O1I A;  3ZEF B;  2GK9 A;  5HXC A;  3ONX A;  1AJ3 A;  4BA9 A;  3B57 A;  3RYF E;  1SA0 E;  2MTQ A;  4HEA A;  3VKG A;  5HWY A;  2NTX A;  3C64 A;  2KZ7 B;  5LGN B;  2RA1 A;  5FY7 A;  3PUS A;  1HCI A;  2K9A A;  2BVL A;  2DHR A;  5L3C B;  3RYC E;  4UVA B;  2HPJ A;  3MZK B;  2EHO A;  4BJN A;  4PFO A;  4DMW A;  4PW8 A;  3N9M A;  3AA6 B;  3O4X E;  2PG8 A;  4UV8 B;  3RH3 A;  2NP9 A;  3OYX A;  2VK9 A;  3PU3 A;  4OK0 A;  4AKI A;  3CKD A;  3RRC A;  4EZH A;  1O3X A;  2CXF A;  3JC6 C;  3LK3 B;  3C98 B;  4E7S A;  4PK5 A;  2LEH A;  3CVR A;  3I1A A;  1ZEE A;  3R84 B;  3ANW B;  2JPF A;  2Y8D A;  1QSD A;  4ERR A;  4HGA A;  2UXN B;  2EHO D;  5JDF A;  4AQF C;  5L3E B;  1HG2 A;  3C51 A;  4NUV A;  3KFW X;  4UV9 B;  4JLE A;  4TZ4 C;  5HXS A;  2VL8 A;  4EAH A;  2IC6 A;  1WR6 A;  3CX6 B;  5JDM A;  2LSI A;  3KV9 A;  2J1D G;  3PE0 A;  2I59 A;  3LK4 2;  4KBM B;  5ADX L;  3IEE A;  4B6X A;  4HKA A;  2VAS A;  4IE6 A;  3V5U A;  5BMV E;  2X9W A;  3ZC0 A;  2ZLY A;  5LXT E;  3Q5X A;  4XZC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...