2VKOA

Structure of the soluble domain of the membrane protein tm1634 from thermotoga maritima
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
104
structure length
104
Chain Sequence
HMNLAVKLTRMEKTLKAYELYIFSDYENFENYVKKEGLKIEGMELLKEKKARSLIAEGKDLFETANYGEALVFFEKALNLSDNEEIKKIASFYLEECRKKLAGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TM1634
publication title Structure and Ligand Binding of the Soluble Domain of a Thermotoga Maritima Membrane Protein of Unknown Function Tm1634.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Membrane protein
total genus 44
structure length 104
sequence length 104
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-12-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.2030 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2vkoA00
2VKOA 2VKJA
chains in the Genus database with same CATH superfamily
3H3MA 3V5SA 4PJMA 4MBQA 3PTRB 4WW0A 5HXCA 3SS1A 2E9XA 2KMFA 5KXJA 1YQ3A 3ONXA 5LP6E 2E9XC 3ZN0B 2LLYA 2J62A 2X9YA 3LBXB 2H89A 2UUCT 3PUZF 3I1AA 4H9SE 3UUNA 4IE0A 4JLEA 4KP3C 3NRYA 3RRWA 3ZCJA 4TNWA 4UIGA 3RYCE 3IEEA 4IGUA 5JVDE 2BZBA 2WBLA 2W4XA 3OKQA 1Z8UA 3J7Yq 3PURA 4LFBT 3BQLA 5AQQB 1WRDA 4DMWA 1D1CA 3HA4A 3NWIA 3QC9A 3DP7A 5KDMC 1V9DA 2WU5A 4JI2T 2XY8B 2LT3A 2YU2A 2KSRA 5FNVE 5BMVE 2VL0A 2XQ6A 3T1YT 2WDQA 5LMNT 2W63A 4AKHA 4AKRB 4AKGA 3A5XA 4GKJT 5AQJB 3N9QA 4YSYA 1OEDA 1XMOT 1MNEA 3AA6B 2BBHA 4XAXB 1FMWA 1OEDC 1B7TA 2X9XA 2H7VC 4U74A 4U72A 3CQCB 2X68A 2DCFA 1YQ4A 3ZC0A 5HEOA 2I59A 2B1EA 2CLYC 3CX6B 3AAEB 3FBLA 3TLUA 4CI2B 4I50E 3UUXB 1X9BA 2XQYA 1WR6A 4C90A 3CVRA 2Y6XA 2PTFA 4ZS2A 3CX7B 4JUYA 2BG9A 5EK2A 4TN7B 2YINA 2BG9C 3P8CD 3NRXA 1EZ3A 3ZMUB 4QX8B 2E5VA 2VKDA 4LMLA 4UV9B 4IE4A 4N78D 4PW8A 3RRCA 4UV8B 4AIUA 2W0GA 2YDSA 1HNXT 3CPZA 3TLWA 1WCRA 3ZYLA 3UT5E 4A5XA 2X66A 3IF8B 4DNDA 3DTOA 5HEHA 3C64A 5C2TA 5CJ5A 4O2BE 2YDRA 3ZYMA 1FMVA 4HFDA 1UX5A 3MJXA 3O4XE 3ONLC 4X65T 2K48A 3ZMTB 1Y01A 1YXRA 2WB5A 2WWVA 5J1GA 1UX4A 2EHOB 4ZXLA 3K8PC 3UU4A 3RGLA 4EXTA 4U33A 5DQVA 3C4ZA 4F6RC 2BS3A 4PJLA 3VRAA 4U2ZA 2SPCA 2KWHA 1LKXA 4HFBA 2BBJA 2VB6A 3LBXA 4IREA 4PFOA 4I55E 5CFBA 3FZFB 2QA7A 4PK6A 2L9QA 4JI1T 4OYKA 2ACXA 2D2SA 3AEFA 3KINB 2JMKA 3AEDA 4LF5T 4H9OC 2LSKA 3LFMA 3OPCA 2NTYA 3AEEA 3EDUA 5LA6E 4P1NA 2A2FX 3KDSE 4DV1T 5EZYE 1HNZT 3RIAA 4IT4A 2ES0A 3Q5EA 3AXJA 3C98B 1UK5A 5HEGA 3AE5A 2E5LT 2AXDS 3FBZA 4DVDA 2RP4A 2H7OA 2XAFB 4LFAT 1T72A 5IWAT 5FKYA 2YN6A 4DR5T 3Q5WA 3T8OA 1MIVA 4JV5T 3WAKA 4IDNA 2V8SV 3ZMZB 3ABVA 5JQGE 3RC8A 2UXNB 2HPJA 3RLFF 2W67A 1S35A 5ABEA 2V6YB 3RX6A 4ANJA 3ESLA 3TLVA 1VCSA 4EZ4A 3VR9A 2JRKA 2WMNA 2CPTA 2WCAA 2LRLA 4AI6A 2D0UA 2DHRA 1XZYA 3KV9A 3MXZA 3NVOA 1BR1A 1IJ5A 1M7KA 2CE7A 3O1IA 3PUXF 1T7SA 4XBFB 3BQIA 3MA9A 4Z91A 4GIWA 5C3JA 1JNZA 2LE8A 2JPFA 3PUQA 2XQ7A 4IDZA 3Q5XA 2QYWA 2VK9A 4A56A 2ZM2A 5AQNB 2X9HA 4LF9T 3PUGA 4EGWA 2Y8DA 3OYXA 4ZOLE 4HE8A 5JH7E 4NIQA 3O9XA 4PJNA 2NTXA 3CMLA 5J0ZA 4YSXA 1HG2A 3I0QA 2XQ5A 1MIWA 2VURA 4WZXA 4YHHT 4M1PA 2FBWA 4HKAA 4AQFA 4YJ2E 5M4YA 3HKBE 4AQFC 5IHYA 3PUAA 3ETVA 2AE9A 4I43B 4U3CA 5ETWA 3ZN1B 5HAXA 4DO0A 3VKHA 4UF0B 3RH3A 1J1JA 2K24A 3PUVF 4YJ3E 4ZI2C 3IBPA 2V7JA 3FXDB 3ZLIA 3ANWB 4NXMT 2MAWA 1XDOA 2UU9T 5L4EA 2X51A 5L3FB 1HS7A 4DV3T 5FYMA 5L3DB 5LHHB 1NAFA 2C5IT 4TV9E 1ZEEA 3TLTA 2M6IA 5AQPB 4X1IE 3AVSA 4AKIA 2JJ9A 3AE9A 4NUVA 4ISSA 1XWMA 2E9XD 2E2AA 1D0ZA 1XNQT 4H63V 3HR0A 4WBNE 1I6ZA 4X1KE 4HWCA 5LJNA 2LKGA 2D9DA 2C5JA 5LGUB 2UUBT 2WAUA 4G2AA 1W0BA 3SFEA 2W00A 2CEAA 1XDPA 4Z8XA 4ZZBA 3JAEA 4YY3T 1KF6A 1O3XA 3ZKRA 3AE4A 2V7MA 2HPLA 4PK4A 3RYIE 1T98A 2V6YA 2WMOA 3O1HA 3LK2B 2UUAT 4OX9T 3QB5K 4DV7T 4HWDA 1VRBA 5FXWA 3KBTA 4YFSA 1IBMT 5JR9B 2MOZA 4JI3T 4L5GA 3S4UA 2FJDA 1N32T 2ODVA 4IE5A 5HXSA 3N2GE 2OLTA 4B3ST 2QGSA 3AEBA 3NZQA 1SHZC 4LF7T 2XPKA 5ABFA 4IDPA 2A9UA 1XNRT 4JEUB 3AE6A 5LHIB 4CZZB 3I0OA 3OVUA 1ZP0A 5L3GB 2Q9QB 4DBRA 5H6RB 1E7PA 3BK9A 1UGOA 2DLRA 3HKDE 2XQ9A 2V1DB 1KK7A 4EOZB 4TNVA 3EABA 2ZM0A 4P0BA 2LSIA 2KNDA 1KNZA 2NP9A 3CQGB 5AQIB 2GK9A 5GONE 4PNIA 5HCMA 1SUMB 4HFEA 4IL4A 4H63H 2XAQB 3PJAA 2CXDA 1WR0A 1FIOA 2K9AA 4QXCB 5H6QB 1W0AA 4UF0A 4EB6E 4I4TE 5FMNA 5AQKB 4X62T 2N9DA 3P4WA 2BS4A 3CWZB 5LMUT 4TWFA 2JQQA 3B5MA 2BVMA 1IAPA 1U5PA 2UXXB 2CBIA 2XM1A 4JI5T 1MIYA 1LRZA 3ANWA 4KBMB 3FHNA 5FXVA 2LOSA 3QK6A 2KWIB 3QUJA 3O1JA 2H3RA 4BA9A 5JDQA 5AQLB 4OFZA 1NWMX 1S94A 4U7IA 2ACZA 4QH4A 5JRCB 4EV6A 1BR4A 4IE7A 5HXEA 2VL8A 5AQVB 2X0HA 4C91A 2DL1A 4ZS3A 4IDOA 4YLHA 1H7CA 2LSYA 5F5WA 1UURA 1YW0A 3FB2A 2XQ8A 2NR4A 1US7B 2LM2A 4O4LE 2IIUA 3N9PA 5L4HA 2KINB 2ZLYA 4B6XA 3N2KE 4LMJA 5DQWA 4PK5A 4LFCT 3MKDA 1U4QA 3WI3A 1MMDA 1ZV4X 1HX8A 4AQGA 4DR1T 4CXXA 1Z0PA 2VASA 2UXBT 4YHJA 2CHOA 3DJBA 3AE3A 5FY1A 4PJJA 1N33T 4EEDA 2JIWA 5F3JA 2WS3A 3VKGA 5J2TE 3ZMVB 3EVYA 3UQ4A 2LEHA 3IA3A 1SE7A 3FZMB 1T8BA 4KMCA 2VQFT 4ADZA 2XSBA 2R6GF 4NPPA 3KV5A 4X5TA 1HCIA 2CHNA 4I0UA 4ISTA 2WU2A 3EDVA 3NKZA 4AKLA 2MYSA 3N9LA 2JMHA 2XAGB 5AQUB 1YKEB 1DU2A 4AQYT 3M3ZB 2KT9A 5L3EB 3N2OA 2LRKA 4HFCA 3VR8A 2X0LB 4TX5A 4CN4A 3VU7H 3RYFE 3KBUA 3MACA 2Q9QA 1YD8G 1MMAA 2I6HA 5FXZA 3F2EA 2V5DA 2Q9QC 1WYBA 4K0UA 3GA8A 4LF4T 5JDGA 2D5UA 2L3LA 3L09A 2N1GA 4E7SA 2NW8A 1IBKT 4E7ZA 3LJCA 3PJAJ 3AA0B 2XQAA 4X66T 2UXDT 3N9MA 4UR9A 4LF6T 3Q5DA 4BJMA 3U3IA 1VOMA 5AQMB 2QVAA 3IHRA 4KX6A 3EAMA 1QUUA 3H3AA 5ADXL 4ZHQE 4DUYT 3N5LA 2N2NA 4QXBB 3LSVA 2WZIA 3UU5A 4EAHA 2BDEA 3AA1B 3LG7A 4JI6T 3C50A 1CUNA 3PU3A 4O4JE 4EYYR 2NWBA 4CN1A 5LG3A 2CWOA 4HFVA 5LYJE 4FJOA 2VWAA 2V26A 5LGNB 5JDNA 3K3NA 3PUYF 2J1DG 1QLBA 5JRCA 3CK6A 4DR7T 5FP3A 3J9X1 4ZI2D 4QKNA 1ZKEA 3K3OA 3RIFA 4JBWF 1D0YA 2A72A 2JQKA 2YU1A 4DV6T 1MMGA 4DV5T 3KV4A 5HCJA 3PU8A 2KXPB 4KHZF 4QHOA 3LK42 1NENA 2K3WA 3P7IA 4DIDB 5JDLA 3H37A 2DWGA 5CGMA 5JREA 2EHOA 2J47A 1CHUA 2CA5A 2FUPA 4LMKA 4DV4T 4X64T 4H9RC 2EHOC 4JI4T 4UEMA 5HWYA 2KZ7B 1X79A 2CLYB 4A97A 3FZHB 2XTLA 4OYJA 2V7LA 2CBJA 2HHHT 2ODUA 1HG5A 2BVLA 4Q25A 5BR8T 1YKHB 3K1SA 3L3PA 3MZKB 5L3CB 3L39A 1KFYA 2FJAA 1G8XA 4HFIA 2IDOB 2W66A 5EK3A 4O4HE 2VKHA 4H9QC 3ZSTA 4PAGA 4L9IA 4H9NC 3RKGA 1WFDA 2VQET 5IYZE 5AQOB 1GQEA 3NBXX 1W09A 1MNDA 5F8PA 1KNPA 2BG9B 1I94T 4ZI3C 4WYVA 2HN1A 3E0ZA 4GK0E 2XHEB 3A8YC 4K0KT 4O8SA 2YOEA 3EI0A 3RF1A 2G0UA 4IDQA 3ZPOA 2IC9A 2C0SA 3AE1A 3Q9DA 5A1LA 5KX5E 4CXYA 3JCFA 5JTGA 4DV2T 2OA5A 5J2UE 2V7KA 2X67A 3PE0A 2FJEA 3N9OA 4YT0A 4CI3B 2P9BA 1KEYA 2ZMAA 4DR4T 4U2YA 3RQWA 2WSSV 2V5CA 1LVKA 2RA1A 2IHR1 4ILCA 3E22E 5EK4A 5LGTB 5FY0A 2PFVA 2HH7A 5HXHA 4OK0A 2WDVA 5AQTB 3RYHE 2Y48B 3ZJ2A 3VRBA 3JC6C 3UTKA 3HI2A 1Y64B 3UQ7A 3CKDA 4HWHA 1UCUA 3U78A 4UXNB 3HKCE 1IBLT 3P50A 4L0RA 3P4QA 3ZJ1A 5L3BB 4GYRA 3B13A 4QX7B 4QH5A 1HFAA 4IIJE 3PUWF 4GOUA 4KI0F 2F4VT 5TAOA 4GKKT 1G73A 2QRXA 3X1DA 4YTNA 1J5WA 2W62A 1OEDE 2PG8A 4JI0T 5ABGA 2WZHA 4GYSA 2YDQA 5HWXA 3AXJB 3KFWX 2V7IA 5FL0A 1BR0A 4Z90A 4J2CA 4TWDA 3AB3B 2XQ3A 4DR6T 5C8YE 2CCQA 4AISA 3UU3A 1HNWT 4MFRA 3GN5B 4MALA 2XAJB 2B76A 4JI8T 3SRZA 3ZC1A 3ZT5A 2WM9A 3PDYA 5FY7A 5IUXA 2PJQA 1HTJF 4NXNT 4HTEA 4XZCA 3OTOT 1WLXA 2BG9E 2YK0A 3P4RA 5AQSB 1D1AA 1R8IA 3I9YA 1D1BA 5JDMA 5DJQC 3RIUA 2NOXA 1BR2A 4ZZCA 2FJBA 1UUSA 3RKOA 3RIUC 4MLKA 2NW9A 4KUMB 4P09A 4DMVA 4H9PC 1KNRA 3SOLA 2C5KT 1QSDA 2WY2A 3KV6A 2VKOA 4HWIB 3AE8A 2LJLA 1FJGT 5DABA 4DV0T 3D0TA 4U31A 4JYAT 2LOPA 3C4WA 3T1HT 2NW7A 4BJNA 4DR2T 3QB5A 4UVAB 2IW5B 3PV0F 3ZYKA 5AFUL 4DBQA 1IZNB 2WQYA 4EEBA 5LBQB 1LVFA 4TUYE 4EIWA 4A98A 2H88A 1HR0T 5L47A 2IMLA 2CRBA 5HEUA 2X0YA 3SFDA 5AQRB 2JQHA 3AECA 4IE6A 2J4GA 2HN2A 3F57A 2VKJA 2KLQA 1FEWA 5AQFB 5LNKA 2L8KA 2BKPA 2JQ9A 2WDRA 3QOFA 3V5UA 3F31A 2M67A 2LSJA 5KMGP 3OBVE 4V1Av 1ZHCA 3VHLA 2Q9QD 1AJ3A 2E8IA 2LSGA 1HX1B 2MBGA 5JR9A 4X1YE 1E2AA 4TZ4C 3WAJA 5JDFA 4IHJE 2A3DA 2UXCT 3ZT7A 4ZEYA 4CXWA 5JR9C 3RHWA 2IAKA 2DNXA 4ASKA 5LHGB 2RPAA 3AAAB 4CI1B 3UUMA 2W2UA 4O2AE 3PUSA 3UFEA 4EYUA 5FXXA 3CQXC 3RQUA 2XASB 1VCTA 1ZOYA 1WYCA 3N9NA 3E08A 1JNRA 2LKHA 4ERRA 4EZHA 3MK7C 4B3MT 3OJAA 2ZM8A 5JDHA 2WP9A 3AE7A 3ZCIA 3HKEE 1IJ6A 2XM2A 3TKLB 4TV8E 3AVRA 2CMRA 4HN9A 3HL6A 3KVBA 5L2LA 3GN5A 4B3TT 3Q2MA 2WWUA 3R6NA 3R84B 4HWFA 2CM0A 3UUBA 3AEAA 2LHRA 3EHZA 3AAIA 5LCYA 1L0VA 2K5BB 4P0AA 3TLSA 2E9XB 3AEGA 1NEKA 5AQGB 3M65A 5CA1E 4BAYB 1OWAA 3SWHA 4AXPA 3UU8A 2YKSA 4LF8T 2LHNA 2BKOA 4G63A 3P4SA 3QNUA 3BQKA 4OHFA 3LDQB 3UULA 4QXHB 3L8RA 2YEVC 5LXTE 3RC3A 3RPUA 2MPKA 3FXEB 2EHOD 5ABFB 3CX8B 4GK5E 2XSAA 4YTPA 4KHPT 4UVBB 4UVCB 4MHCA 2CXLA 5HXRA 2XUEA 5CB4E 2OV9A 3ONJA 4ILUA 3ZT6A 5FVLA 4TWHA 4QH1A 1J5ET 1N36T 4CN6A 3GWHA 1XMQT 4B3RT 4CQIA 4X20E 1D0XA 3KVAA 4HGAA 4WNKA 3A7MA 1OEDB 4JEHB 3UFGA 2IUBA 4WBOA 3P4PA 4HEAA 4ZI3D 4IL9A 2W61A 4YSZA 1E1HB 3B57A 2DI4A 3CIRA 2D0TA 4QWNB 2I0MA 4O4IE 3GMIA 2X9WA 4COFA 2PBIA 4YTMA 1HF8A 4ILBA 4YXDA 5LG4A 3I9WA 5FL1A 3AA7B 2V6XA 2VVNA 3G06A 3NZPA 4UELA 3FZLB 2M6BA 5LOVE 4ILAA 2XZEA 3C51A 5HYAA 1W9RA 4U7YA 4F8HA 1SA0E 2VVSA 5LBMA 3K3QC 3JADA 5ABHA 1N34T 4JI7T 3ETUA 5LJMA 2MTQA 1OXZA 3JC6D 3OYZA 2DWKA 3UU6A 5LB7B 2CWYA 4NUUA 2XQ4A 2BS2A 3AE2A 5HEJA 2CXFA 3RI5A 3EUHA 5CA0E 3ZEFB 2IC6A 3LK3B 5E0OA 3ZSSA 2BKNA 3ZMSB 5AQHB 5FVKA 3FZKB 4DUZT 4PFPA 1M62A 2ZM6T 3W15B 2XAHB 2XJ7A 3JAFA 4ZI7E 2LM9A 3C4XA 4HFHA 2Z6EA 4FI5A 4DR3T 1MMNA
chains in the Genus database with same CATH topology
3V5SA 4HKAA 4P09A 4AQFA 4PJMA 4TX5A 4DMVA 4MBQA 3PTRB 4WW0A 5HXCA 4H9PC 3SOLA 3SS1A 4YJ2E 2E9XA 2KMFA 3VU7H 2C5KT 1QSDA 3RYFE 5M4YA 3KBUA 3MACA 2Q9QA 3HKBE 3ONXA 4AQFC 5LP6E 1YD8G 5IHYA 3KV6A 1MMAA 3PUAA 5FXZA 2E9XC 3F2EA 2VKOA 3ETVA 3ZN0B 4I43B 2Q9QC 2LJLA 1WYBA 4K0UA 5ETWA 3ZN1B 3LBXB 2X9YA 5DABA 3GA8A 3D0TA 5HAXA 4DO0A 5JDGA 2LOPA 4UF0B 3VKHA 2D5UA 3I1AA 3C4WA 4H9SE 3RH3A 2L3LA 2K24A 3L09A 3UUNA 4IE0A 2N1GA 4JLEA 2NW7A 4E7SA 4BJNA 4YJ3E 2NW8A 4KP3C 4E7ZA 4ZI2C 3IBPA 3LJCA 2V7JA 3NRYA 4UVAB 3RRWA 2IW5B 3AA0B 3ZYKA 5AFUL 3ZCJA 3FXDB 4DBQA 4UIGA 1IZNB 3ZLIA 3N9MA 3RYCE 3IEEA 4IGUA 5JVDE 5LBQB 4BJMA 3U3IA 1LVFA 1VOMA 4TUYE 3ANWB 2BZBA 4EIWA 2WBLA 3IHRA 1QUUA 3H3AA 5ADXL 3OKQA 4ZHQE 3N5LA 3J7Yq 2N2NA 2X51A 3PURA 5L3FB 4QXBB 1HS7A 5FYMA 3BQLA 5L3DB 5LHHB 1NAFA 2C5IT 1WRDA 4DMWA 1D1CA 3HA4A 3QC9A 4EAHA 4TV9E 3DP7A 4IE6A 1ZEEA 2BDEA 5KDMC 3F57A 1V9DA 3AA1B 3LG7A 2LT3A 2YU2A 2VKJA 5FNVE 2KLQA 4X1IE 5BMVE 1FEWA 3AVSA 4AKIA 3C50A 2JJ9A 5LNKA 2L8KA 1CUNA 3PU3A 4NUVA 2W63A 4O4JE 4ISSA 4EYYR 3V5UA 3F31A 2NWBA 4AKHA 2M67A 2LSJA 5KMGP 4AKRB 3OBVE 3A5XA 4AKGA 2CWOA 4V1Av 4HFVA 2E9XD 1ZHCA 5LYJE 3N9QA 1D0ZA 2VWAA 2Q9QD 2V26A 4FJOA 3VHLA 1AJ3A 5LGNB 2E8IA 5JDNA 4H63V 1MNEA 3HR0A 3K3NA 2LSGA 4WBNE 3AA6B 4X1KE 2J1DG 2MBGA 5JRCA 5JR9A 4XAXB 1FMWA 4X1YE 4TZ4C 5LJNA 1B7TA 3WAJA 5FP3A 3J9X1 5JDFA 2X9XA 2H7VC 2C5JA 4U74A 5LGUB 4U72A 3CQCB 2X68A 2A3DA 4IHJE 2WAUA 4ZI2D 4G2AA 4CXWA 4QKNA 5JR9C 1ZKEA 3K3OA 2DCFA 2W00A 2IAKA 2CEAA 1D0YA 4Z8XA 3ZC0A 2DNXA 2A72A 2I59A 2YU1A 2B1EA 2CLYC 3CX6B 4ASKA 5LHGB 1MMGA 3KV4A 1O3XA 3AAEB 3FBLA 3PU8A 2V7MA 3AAAB 4CI1B 2HPLA 4PK4A 3RYIE 4CI2B 2KXPB 1T98A 3UUMA 4QHOA 4O2AE 3PUSA 3UFEA 2WMOA 4I50E 3UUXB 4EYUA 2XQYA 5FXXA 3LK42 3CQXC 1WR6A 4C90A 2XASB 3CVRA 3O1HA 2Y6XA 3P7IA 3LK2B 4ZS2A 3CX7B 5JDLA 3H37A 1WYCA 2DWGA 4JUYA 5JREA 5EK2A 2EHOA 1VRBA 3N9NA 4TN7B 2YINA 5FXWA 3E08A 2CA5A 4ERRA 4EZHA 3MK7C 3KBTA 4YFSA 3OJAA 4H9RC 5JR9B 2MOZA 2EHOC 2ZM8A 4UEMA 5HWYA 4L5GA 5JDHA 3P8CD 3NRXA 2KZ7B 3S4UA 3ZCIA 1X79A 1EZ3A 3ZMUB 3HKEE 1IJ6A 2ODVA 2CLYB 4IE5A 4QX8B 2VKDA 3N2GE 5HXSA 4UV9B 3TKLB 2XTLA 4IE4A 3AVRA 2CMRA 4HN9A 4OYJA 4TV8E 2QGSA 4N78D 4PW8A 3RRCA 4UV8B 3HL6A 3KVBA 5L2LA 2W0GA 3NZQA 3CPZA 1SHZC 2V7LA 3GN5A 3ZYLA 3UT5E 3Q2MA 2WWUA 2ODUA 3R6NA 2X66A 3R84B 2CM0A 1HG5A 2BVLA 3IF8B 1YKHB 4DNDA 2LHRA 3DTOA 3AAIA 4JEUB 5LCYA 3L3PA 3MZKB 5LHIB 3C64A 5L3CB 4CZZB 2K5BB 4O2BE 4P0AA 3I0OA 3ZYMA 2E9XB 1G8XA 5L3GB 1FMVA 2Q9QB 5EK3A 4DBRA 4O4HE 5H6RB 1UX5A 2VKHA 4H9QC 3MJXA 3O4XE 3BK9A 3M65A 5CA1E 2DLRA 2K48A 3HKDE 4PAGA 4BAYB 2V1DB 1OWAA 1KK7A 4H9NC 4L9IA 3ZMTB 4EOZB 5IYZE 3SWHA 4AXPA 3NBXX 1MNDA 5F8PA 5J1GA 2ZM0A 4P0BA 1UX4A 2EHOB 2LSIA 4ZI3C 2KNDA 1KNZA 2LHNA 3K8PC 3E0ZA 4GK0E 2NP9A 3CQGB 4EXTA 4G63A 2GK9A 5GONE 3BQKA 4PNIA 5DQVA 4OHFA 2XHEB 3C4ZA 3UULA 4QXHB 4F6RC 4O8SA 2YEVC 4H63H 4PJLA 2XAQB 5LXTE 2G0UA 2SPCA 2CXDA 2K9AA 1FIOA 2KWHA 3ZPOA 2IC9A 1LKXA 3RC3A 2C0SA 3RPUA 4QXCB 3Q9DA 5H6QB 5A1LA 5KX5E 4CXYA 3FXEB 2VB6A 3LBXA 2EHOD 4I55E 4PFOA 2OA5A 3CX8B 5J2UE 4GK5E 4UF0A 4EB6E 4I4TE 2V7KA 5FMNA 2X67A 3PE0A 3N9OA 2N9DA 2QA7A 4PK6A 4CI3B 2P9BA 4UVBB 3CWZB 4UVCB 2JQQA 4MHCA 2L9QA 2ZMAA 2CXLA 4OYKA 2BVMA 2ACXA 1IAPA 2WSSV 2D2SA 1U5PA 5HXRA 2UXXB 2XUEA 5CB4E 1LVKA 3KINB 2RA1A 2JMKA 1MIYA 1LRZA 4ILUA 4H9OC 2LSKA 3ANWA 4KBMB 3LFMA 3FHNA 5FXVA 2LOSA 2NTYA 3E22E 3GWHA 3EDUA 3QK6A 5LA6E 4CQIA 2KWIB 5EK4A 2A2FX 3KDSE 5LGTB 3QUJA 5FY0A 4X20E 3O1JA 1D0XA 3KVAA 4HGAA 5EZYE 2PFVA 2H3RA 2HH7A 4BA9A 4OK0A 4WNKA 5HXHA 5JDQA 4OFZA 3RYHE 2ES0A 2Y48B 1NWMX 1S94A 3ZJ2A 3JC6C 4JEHB 3UTKA 3HI2A 3C98B 4WBOA 1Y64B 4HEAA 3CKDA 5JRCB 4ZI3D 1BR4A 4IE7A 5HXEA 2VL8A 4C91A 1UCUA 3FBZA 2W61A 4DVDA 1E1HB 3U78A 2RP4A 2H7OA 4ZS3A 3B57A 4UXNB 2XAFB 3HKCE 4YLHA 1H7CA 2LSYA 2DI4A 1YW0A 3FB2A 4L0RA 2D0TA 3ZJ1A 5L3BB 4GYRA 4QWNB 3B13A 4QX7B 3Q5WA 3T8OA 1US7B 1HFAA 1MIVA 4IIJE 4O4IE 3GMIA 2X9WA 4GOUA 4O4LE 3WAKA 3ZMZB 3N9PA 2PBIA 2KINB 2ZLYA 5TAOA 1HF8A 1G73A 4B6XA 5JQGE 3RC8A 2UXNB 5LG4A 3I9WA 3N2KE 5DQWA 4PK5A 2HPJA 3AA7B 3MKDA 1S35A 3RX6A 2W62A 4ANJA 3ESLA 3NZPA 4UELA 2PG8A 4EZ4A 2JRKA 2WMNA 1U4QA 3WI3A 4GYSA 4AI6A 5LOVE 2D0UA 2DHRA 5HWXA 3C51A 5HYAA 3KV9A 3KFWX 1MMDA 2V7IA 1ZV4X 1HX8A 4AQGA 3MXZA 4CXXA 1Z0PA 1SA0E 1BR1A 1IJ5A 2VASA 2CE7A 3O1IA 1BR0A 5LBMA 4YHJA 4J2CA 4XBFB 3BQIA 3K3QC 3DJBA 3MA9A 3AB3B 4GIWA 5FY1A 5C8YE 2CCQA 4PJJA 3ETUA 2LE8A 5F3JA 5LJMA 2JPFA 2MTQA 3PUQA 5J2TE 1OXZA 3ZMVB 3VKGA 3JC6D 3EVYA 4IDZA 3GN5B 3Q5XA 3OYZA 2XAJB 4MALA 2LEHA 4MFRA 2DWKA 2VK9A 3SRZA 3ZC1A 2CWYA 4A56A 4KMCA 2WM9A 3PDYA 4NUUA 5FY7A 4ADZA 2ZM2A 2PJQA 1HTJF 2X9HA 3KV5A 2CXFA 3EUHA 5CA0E 3ZEFB 2IC6A 3PUGA 3LK3B 4HTEA 5E0OA 1HCIA 2Y8DA 4XZCA 3OYXA 4ISTA 1WLXA 3ZMSB 4ZOLE 4HE8A 2YK0A 5JH7E 3EDVA 4AKLA 3O9XA 1D1AA 2MYSA 4PJNA 3I9YA 3N9LA 1D1BA 4PFPA 2JMHA 2XAGB 5JDMA 1YKEB 2NTXA 3W15B 5DJQC 3CMLA 2NOXA 2XAHB 4ZI7E 1HG2A 2LM9A 3C4XA 1BR2A 2KT9A 5L3EB 3N2OA 3I0QA 3RKOA 1MIWA 2Z6EA 4MLKA 4FI5A 2NW9A 2X0LB 4KUMB 1MMNA 4M1PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VKO A;  2VKJ A; 
#chains in the Genus database with same CATH topology
 3H3M A;  3V5S A;  4PJM A;  4MBQ A;  3PTR B;  4WW0 A;  5HXC A;  3SS1 A;  2E9X A;  2KMF A;  5KXJ A;  1YQ3 A;  3ONX A;  5LP6 E;  2E9X C;  3ZN0 B;  2LLY A;  2J62 A;  2X9Y A;  3LBX B;  2H89 A;  2UUC T;  3PUZ F;  3I1A A;  4H9S E;  3UUN A;  4IE0 A;  4JLE A;  4KP3 C;  3NRY A;  3RRW A;  3ZCJ A;  4TNW A;  4UIG A;  3RYC E;  3IEE A;  4IGU A;  5JVD E;  2BZB A;  2WBL A;  2W4X A;  3OKQ A;  1Z8U A;  3J7Y q;  3PUR A;  4LFB T;  3BQL A;  5AQQ B;  1WRD A;  4DMW A;  1D1C A;  3HA4 A;  3NWI A;  3QC9 A;  3DP7 A;  5KDM C;  1V9D A;  2WU5 A;  4JI2 T;  2XY8 B;  2LT3 A;  2YU2 A;  2KSR A;  5FNV E;  5BMV E;  2VL0 A;  2XQ6 A;  3T1Y T;  2WDQ A;  5LMN T;  2W63 A;  4AKH A;  4AKR B;  4AKG A;  3A5X A;  4GKJ T;  5AQJ B;  3N9Q A;  4YSY A;  1OED A;  1XMO T;  1MNE A;  3AA6 B;  2BBH A;  4XAX B;  1FMW A;  1OED C;  1B7T A;  2X9X A;  2H7V C;  4U74 A;  4U72 A;  3CQC B;  2X68 A;  2DCF A;  1YQ4 A;  3ZC0 A;  5HEO A;  2I59 A;  2B1E A;  2CLY C;  3CX6 B;  3AAE B;  3FBL A;  3TLU A;  4CI2 B;  4I50 E;  3UUX B;  1X9B A;  2XQY A;  1WR6 A;  4C90 A;  3CVR A;  2Y6X A;  2PTF A;  4ZS2 A;  3CX7 B;  4JUY A;  2BG9 A;  5EK2 A;  4TN7 B;  2YIN A;  2BG9 C;  3P8C D;  3NRX A;  1EZ3 A;  3ZMU B;  4QX8 B;  2E5V A;  2VKD A;  4LML A;  4UV9 B;  4IE4 A;  4N78 D;  4PW8 A;  3RRC A;  4UV8 B;  4AIU A;  2W0G A;  2YDS A;  1HNX T;  3CPZ A;  3TLW A;  1WCR A;  3ZYL A;  3UT5 E;  4A5X A;  2X66 A;  3IF8 B;  4DND A;  3DTO A;  5HEH A;  3C64 A;  5C2T A;  5CJ5 A;  4O2B E;  2YDR A;  3ZYM A;  1FMV A;  4HFD A;  1UX5 A;  3MJX A;  3O4X E;  3ONL C;  4X65 T;  2K48 A;  3ZMT B;  1Y01 A;  1YXR A;  2WB5 A;  2WWV A;  5J1G A;  1UX4 A;  2EHO B;  4ZXL A;  3K8P C;  3UU4 A;  3RGL A;  4EXT A;  4U33 A;  5DQV A;  3C4Z A;  4F6R C;  2BS3 A;  4PJL A;  3VRA A;  4U2Z A;  2SPC A;  2KWH A;  1LKX A;  4HFB A;  2BBJ A;  2VB6 A;  3LBX A;  4IRE A;  4PFO A;  4I55 E;  5CFB A;  3FZF B;  2QA7 A;  4PK6 A;  2L9Q A;  4JI1 T;  4OYK A;  2ACX A;  2D2S A;  3AEF A;  3KIN B;  2JMK A;  3AED A;  4LF5 T;  4H9O C;  2LSK A;  3LFM A;  3OPC A;  2NTY A;  3AEE A;  3EDU A;  5LA6 E;  4P1N A;  2A2F X;  3KDS E;  4DV1 T;  5EZY E;  1HNZ T;  3RIA A;  4IT4 A;  2ES0 A;  3Q5E A;  3AXJ A;  3C98 B;  1UK5 A;  5HEG A;  3AE5 A;  2E5L T;  2AXD S;  3FBZ A;  4DVD A;  2RP4 A;  2H7O A;  2XAF B;  4LFA T;  1T72 A;  5IWA T;  5FKY A;  2YN6 A;  4DR5 T;  3Q5W A;  3T8O A;  1MIV A;  4JV5 T;  3WAK A;  4IDN A;  2V8S V;  3ZMZ B;  3ABV A;  5JQG E;  3RC8 A;  2UXN B;  2HPJ A;  3RLF F;  2W67 A;  1S35 A;  5ABE A;  2V6Y B;  3RX6 A;  4ANJ A;  3ESL A;  3TLV A;  1VCS A;  4EZ4 A;  3VR9 A;  2JRK A;  2WMN A;  2CPT A;  2WCA A;  2LRL A;  4AI6 A;  2D0U A;  2DHR A;  1XZY A;  3KV9 A;  3MXZ A;  3NVO A;  1BR1 A;  1IJ5 A;  1M7K A;  2CE7 A;  3O1I A;  3PUX F;  1T7S A;  4XBF B;  3BQI A;  3MA9 A;  4Z91 A;  4GIW A;  5C3J A;  1JNZ A;  2LE8 A;  2JPF A;  3PUQ A;  2XQ7 A;  4IDZ A;  3Q5X A;  2QYW A;  2VK9 A;  4A56 A;  2ZM2 A;  5AQN B;  2X9H A;  4LF9 T;  3PUG A;  4EGW A;  2Y8D A;  3OYX A;  4ZOL E;  4HE8 A;  5JH7 E;  4NIQ A;  3O9X A;  4PJN A;  2NTX A;  3CML A;  5J0Z A;  4YSX A;  1HG2 A;  3I0Q A;  2XQ5 A;  1MIW A;  2VUR A;  4WZX A;  4YHH T;  4M1P A;  2FBW A;  4HKA A;  4AQF A;  4YJ2 E;  5M4Y A;  3HKB E;  4AQF C;  5IHY A;  3PUA A;  3ETV A;  2AE9 A;  4I43 B;  4U3C A;  5ETW A;  3ZN1 B;  5HAX A;  4DO0 A;  3VKH A;  4UF0 B;  3RH3 A;  1J1J A;  2K24 A;  3PUV F;  4YJ3 E;  4ZI2 C;  3IBP A;  2V7J A;  3FXD B;  3ZLI A;  3ANW B;  4NXM T;  2MAW A;  1XDO A;  2UU9 T;  5L4E A;  2X51 A;  5L3F B;  1HS7 A;  4DV3 T;  5FYM A;  5L3D B;  5LHH B;  1NAF A;  2C5I T;  4TV9 E;  1ZEE A;  3TLT A;  2M6I A;  5AQP B;  4X1I E;  3AVS A;  4AKI A;  2JJ9 A;  3AE9 A;  4NUV A;  4ISS A;  1XWM A;  2E9X D;  2E2A A;  1D0Z A;  1XNQ T;  4H63 V;  3HR0 A;  4WBN E;  1I6Z A;  4X1K E;  4HWC A;  5LJN A;  2LKG A;  2D9D A;  2C5J A;  5LGU B;  2UUB T;  2WAU A;  4G2A A;  1W0B A;  3SFE A;  2W00 A;  2CEA A;  1XDP A;  4Z8X A;  4ZZB A;  3JAE A;  4YY3 T;  1KF6 A;  1O3X A;  3ZKR A;  3AE4 A;  2V7M A;  2HPL A;  4PK4 A;  3RYI E;  1T98 A;  2V6Y A;  2WMO A;  3O1H A;  3LK2 B;  2UUA T;  4OX9 T;  3QB5 K;  4DV7 T;  4HWD A;  1VRB A;  5FXW A;  3KBT A;  4YFS A;  1IBM T;  5JR9 B;  2MOZ A;  4JI3 T;  4L5G A;  3S4U A;  2FJD A;  1N32 T;  2ODV A;  4IE5 A;  5HXS A;  3N2G E;  2OLT A;  4B3S T;  2QGS A;  3AEB A;  3NZQ A;  1SHZ C;  4LF7 T;  2XPK A;  5ABF A;  4IDP A;  2A9U A;  1XNR T;  4JEU B;  3AE6 A;  5LHI B;  4CZZ B;  3I0O A;  3OVU A;  1ZP0 A;  5L3G B;  2Q9Q B;  4DBR A;  5H6R B;  1E7P A;  3BK9 A;  1UGO A;  2DLR A;  3HKD E;  2XQ9 A;  2V1D B;  1KK7 A;  4EOZ B;  4TNV A;  3EAB A;  2ZM0 A;  4P0B A;  2LSI A;  2KND A;  1KNZ A;  2NP9 A;  3CQG B;  5AQI B;  2GK9 A;  5GON E;  4PNI A;  5HCM A;  1SUM B;  4HFE A;  4IL4 A;  4H63 H;  2XAQ B;  3PJA A;  2CXD A;  1WR0 A;  1FIO A;  2K9A A;  4QXC B;  5H6Q B;  1W0A A;  4UF0 A;  4EB6 E;  4I4T E;  5FMN A;  5AQK B;  4X62 T;  2N9D A;  3P4W A;  2BS4 A;  3CWZ B;  5LMU T;  4TWF A;  2JQQ A;  3B5M A;  2BVM A;  1IAP A;  1U5P A;  2UXX B;  2CBI A;  2XM1 A;  4JI5 T;  1MIY A;  1LRZ A;  3ANW A;  4KBM B;  3FHN A;  5FXV A;  2LOS A;  3QK6 A;  2KWI B;  3QUJ A;  3O1J A;  2H3R A;  4BA9 A;  5JDQ A;  5AQL B;  4OFZ A;  1NWM X;  1S94 A;  4U7I A;  2ACZ A;  4QH4 A;  5JRC B;  4EV6 A;  1BR4 A;  4IE7 A;  5HXE A;  2VL8 A;  5AQV B;  2X0H A;  4C91 A;  2DL1 A;  4ZS3 A;  4IDO A;  4YLH A;  1H7C A;  2LSY A;  5F5W A;  1UUR A;  1YW0 A;  3FB2 A;  2XQ8 A;  2NR4 A;  1US7 B;  2LM2 A;  4O4L E;  2IIU A;  3N9P A;  5L4H A;  2KIN B;  2ZLY A;  4B6X A;  3N2K E;  4LMJ A;  5DQW A;  4PK5 A;  4LFC T;  3MKD A;  1U4Q A;  3WI3 A;  1MMD A;  1ZV4 X;  1HX8 A;  4AQG A;  4DR1 T;  4CXX A;  1Z0P A;  2VAS A;  2UXB T;  4YHJ A;  2CHO A;  3DJB A;  3AE3 A;  5FY1 A;  4PJJ A;  1N33 T;  4EED A;  2JIW A;  5F3J A;  2WS3 A;  3VKG A;  5J2T E;  3ZMV B;  3EVY A;  3UQ4 A;  2LEH A;  3IA3 A;  1SE7 A;  3FZM B;  1T8B A;  4KMC A;  2VQF T;  4ADZ A;  2XSB A;  2R6G F;  4NPP A;  3KV5 A;  4X5T A;  1HCI A;  2CHN A;  4I0U A;  4IST A;  2WU2 A;  3EDV A;  3NKZ A;  4AKL A;  2MYS A;  3N9L A;  2JMH A;  2XAG B;  5AQU B;  1YKE B;  1DU2 A;  4AQY T;  3M3Z B;  2KT9 A;  5L3E B;  3N2O A;  2LRK A;  4HFC A;  3VR8 A;  2X0L B;  4TX5 A;  4CN4 A;  3VU7 H;  3RYF E;  3KBU A;  3MAC A;  2Q9Q A;  1YD8 G;  1MMA A;  2I6H A;  5FXZ A;  3F2E A;  2V5D A;  2Q9Q C;  1WYB A;  4K0U A;  3GA8 A;  4LF4 T;  5JDG A;  2D5U A;  2L3L A;  3L09 A;  2N1G A;  4E7S A;  2NW8 A;  1IBK T;  4E7Z A;  3LJC A;  3PJA J;  3AA0 B;  2XQA A;  4X66 T;  2UXD T;  3N9M A;  4UR9 A;  4LF6 T;  3Q5D A;  4BJM A;  3U3I A;  1VOM A;  5AQM B;  2QVA A;  3IHR A;  4KX6 A;  3EAM A;  1QUU A;  3H3A A;  5ADX L;  4ZHQ E;  4DUY T;  3N5L A;  2N2N A;  4QXB B;  3LSV A;  2WZI A;  3UU5 A;  4EAH A;  2BDE A;  3AA1 B;  3LG7 A;  4JI6 T;  3C50 A;  1CUN A;  3PU3 A;  4O4J E;  4EYY R;  2NWB A;  4CN1 A;  5LG3 A;  2CWO A;  4HFV A;  5LYJ E;  4FJO A;  2VWA A;  2V26 A;  5LGN B;  5JDN A;  3K3N A;  3PUY F;  2J1D G;  1QLB A;  5JRC A;  3CK6 A;  4DR7 T;  5FP3 A;  3J9X 1;  4ZI2 D;  4QKN A;  1ZKE A;  3K3O A;  3RIF A;  4JBW F;  1D0Y A;  2A72 A;  2JQK A;  2YU1 A;  4DV6 T;  1MMG A;  4DV5 T;  3KV4 A;  5HCJ A;  3PU8 A;  2KXP B;  4KHZ F;  4QHO A;  3LK4 2;  1NEN A;  2K3W A;  3P7I A;  4DID B;  5JDL A;  3H37 A;  2DWG A;  5CGM A;  5JRE A;  2EHO A;  2J47 A;  1CHU A;  2CA5 A;  2FUP A;  4LMK A;  4DV4 T;  4X64 T;  4H9R C;  2EHO C;  4JI4 T;  4UEM A;  5HWY A;  2KZ7 B;  1X79 A;  2CLY B;  4A97 A;  3FZH B;  2XTL A;  4OYJ A;  2V7L A;  2CBJ A;  2HHH T;  2ODU A;  1HG5 A;  2BVL A;  4Q25 A;  5BR8 T;  1YKH B;  3K1S A;  3L3P A;  3MZK B;  5L3C B;  3L39 A;  1KFY A;  2FJA A;  1G8X A;  4HFI A;  2IDO B;  2W66 A;  5EK3 A;  4O4H E;  2VKH A;  4H9Q C;  3ZST A;  4PAG A;  4L9I A;  4H9N C;  3RKG A;  1WFD A;  2VQE T;  5IYZ E;  5AQO B;  1GQE A;  3NBX X;  1W09 A;  1MND A;  5F8P A;  1KNP A;  2BG9 B;  1I94 T;  4ZI3 C;  4WYV A;  2HN1 A;  3E0Z A;  4GK0 E;  2XHE B;  3A8Y C;  4K0K T;  4O8S A;  2YOE A;  3EI0 A;  3RF1 A;  2G0U A;  4IDQ A;  3ZPO A;  2IC9 A;  2C0S A;  3AE1 A;  3Q9D A;  5A1L A;  5KX5 E;  4CXY A;  3JCF A;  5JTG A;  4DV2 T;  2OA5 A;  5J2U E;  2V7K A;  2X67 A;  3PE0 A;  2FJE A;  3N9O A;  4YT0 A;  4CI3 B;  2P9B A;  1KEY A;  2ZMA A;  4DR4 T;  4U2Y A;  3RQW A;  2WSS V;  2V5C A;  1LVK A;  2RA1 A;  2IHR 1;  4ILC A;  3E22 E;  5EK4 A;  5LGT B;  5FY0 A;  2PFV A;  2HH7 A;  5HXH A;  4OK0 A;  2WDV A;  5AQT B;  3RYH E;  2Y48 B;  3ZJ2 A;  3VRB A;  3JC6 C;  3UTK A;  3HI2 A;  1Y64 B;  3UQ7 A;  3CKD A;  4HWH A;  1UCU A;  3U78 A;  4UXN B;  3HKC E;  1IBL T;  3P50 A;  4L0R A;  3P4Q A;  3ZJ1 A;  5L3B B;  4GYR A;  3B13 A;  4QX7 B;  4QH5 A;  1HFA A;  4IIJ E;  3PUW F;  4GOU A;  4KI0 F;  2F4V T;  5TAO A;  4GKK T;  1G73 A;  2QRX A;  3X1D A;  4YTN A;  1J5W A;  2W62 A;  1OED E;  2PG8 A;  4JI0 T;  5ABG A;  2WZH A;  4GYS A;  2YDQ A;  5HWX A;  3AXJ B;  3KFW X;  2V7I A;  5FL0 A;  1BR0 A;  4Z90 A;  4J2C A;  4TWD A;  3AB3 B;  2XQ3 A;  4DR6 T;  5C8Y E;  2CCQ A;  4AIS A;  3UU3 A;  1HNW T;  4MFR A;  3GN5 B;  4MAL A;  2XAJ B;  2B76 A;  4JI8 T;  3SRZ A;  3ZC1 A;  3ZT5 A;  2WM9 A;  3PDY A;  5FY7 A;  5IUX A;  2PJQ A;  1HTJ F;  4NXN T;  4HTE A;  4XZC A;  3OTO T;  1WLX A;  2BG9 E;  2YK0 A;  3P4R A;  5AQS B;  1D1A A;  1R8I A;  3I9Y A;  1D1B A;  5JDM A;  5DJQ C;  3RIU A;  2NOX A;  1BR2 A;  4ZZC A;  2FJB A;  1UUS A;  3RKO A;  3RIU C;  4MLK A;  2NW9 A;  4KUM B;  4P09 A;  4DMV A;  4H9P C;  1KNR A;  3SOL A;  2C5K T;  1QSD A;  2WY2 A;  3KV6 A;  2VKO A;  4HWI B;  3AE8 A;  2LJL A;  1FJG T;  5DAB A;  4DV0 T;  3D0T A;  4U31 A;  4JYA T;  2LOP A;  3C4W A;  3T1H T;  2NW7 A;  4BJN A;  4DR2 T;  3QB5 A;  4UVA B;  2IW5 B;  3PV0 F;  3ZYK A;  5AFU L;  4DBQ A;  1IZN B;  2WQY A;  4EEB A;  5LBQ B;  1LVF A;  4TUY E;  4EIW A;  4A98 A;  2H88 A;  1HR0 T;  5L47 A;  2IML A;  2CRB A;  5HEU A;  2X0Y A;  3SFD A;  5AQR B;  2JQH A;  3AEC A;  4IE6 A;  2J4G A;  2HN2 A;  3F57 A;  2VKJ A;  2KLQ A;  1FEW A;  5AQF B;  5LNK A;  2L8K A;  2BKP A;  2JQ9 A;  2WDR A;  3QOF A;  3V5U A;  3F31 A;  2M67 A;  2LSJ A;  5KMG P;  3OBV E;  4V1A v;  1ZHC A;  3VHL A;  2Q9Q D;  1AJ3 A;  2E8I A;  2LSG A;  1HX1 B;  2MBG A;  5JR9 A;  4X1Y E;  1E2A A;  4TZ4 C;  3WAJ A;  5JDF A;  4IHJ E;  2A3D A;  2UXC T;  3ZT7 A;  4ZEY A;  4CXW A;  5JR9 C;  3RHW A;  2IAK A;  2DNX A;  4ASK A;  5LHG B;  2RPA A;  3AAA B;  4CI1 B;  3UUM A;  2W2U A;  4O2A E;  3PUS A;  3UFE A;  4EYU A;  5FXX A;  3CQX C;  3RQU A;  2XAS B;  1VCT A;  1ZOY A;  1WYC A;  3N9N A;  3E08 A;  1JNR A;  2LKH A;  4ERR A;  4EZH A;  3MK7 C;  4B3M T;  3OJA A;  2ZM8 A;  5JDH A;  2WP9 A;  3AE7 A;  3ZCI A;  3HKE E;  1IJ6 A;  2XM2 A;  3TKL B;  4TV8 E;  3AVR A;  2CMR A;  4HN9 A;  3HL6 A;  3KVB A;  5L2L A;  3GN5 A;  4B3T T;  3Q2M A;  2WWU A;  3R6N A;  3R84 B;  4HWF A;  2CM0 A;  3UUB A;  3AEA A;  2LHR A;  3EHZ A;  3AAI A;  5LCY A;  1L0V A;  2K5B B;  4P0A A;  3TLS A;  2E9X B;  3AEG A;  1NEK A;  5AQG B;  3M65 A;  5CA1 E;  4BAY B;  1OWA A;  3SWH A;  4AXP A;  3UU8 A;  2YKS A;  4LF8 T;  2LHN A;  2BKO A;  4G63 A;  3P4S A;  3QNU A;  3BQK A;  4OHF A;  3LDQ B;  3UUL A;  4QXH B;  3L8R A;  2YEV C;  5LXT E;  3RC3 A;  3RPU A;  2MPK A;  3FXE B;  2EHO D;  5ABF B;  3CX8 B;  4GK5 E;  2XSA A;  4YTP A;  4KHP T;  4UVB B;  4UVC B;  4MHC A;  2CXL A;  5HXR A;  2XUE A;  5CB4 E;  2OV9 A;  3ONJ A;  4ILU A;  3ZT6 A;  5FVL A;  4TWH A;  4QH1 A;  1J5E T;  1N36 T;  4CN6 A;  3GWH A;  1XMQ T;  4B3R T;  4CQI A;  4X20 E;  1D0X A;  3KVA A;  4HGA A;  4WNK A;  3A7M A;  1OED B;  4JEH B;  3UFG A;  2IUB A;  4WBO A;  3P4P A;  4HEA A;  4ZI3 D;  4IL9 A;  2W61 A;  4YSZ A;  1E1H B;  3B57 A;  2DI4 A;  3CIR A;  2D0T A;  4QWN B;  2I0M A;  4O4I E;  3GMI A;  2X9W A;  4COF A;  2PBI A;  4YTM A;  1HF8 A;  4ILB A;  4YXD A;  5LG4 A;  3I9W A;  5FL1 A;  3AA7 B;  2V6X A;  2VVN A;  3G06 A;  3NZP A;  4UEL A;  3FZL B;  2M6B A;  5LOV E;  4ILA A;  2XZE A;  3C51 A;  5HYA A;  1W9R A;  4U7Y A;  4F8H A;  1SA0 E;  2VVS A;  5LBM A;  3K3Q C;  3JAD A;  5ABH A;  1N34 T;  4JI7 T;  3ETU A;  5LJM A;  2MTQ A;  1OXZ A;  3JC6 D;  3OYZ A;  2DWK A;  3UU6 A;  5LB7 B;  2CWY A;  4NUU A;  2XQ4 A;  2BS2 A;  3AE2 A;  5HEJ A;  2CXF A;  3RI5 A;  3EUH A;  5CA0 E;  3ZEF B;  2IC6 A;  3LK3 B;  5E0O A;  3ZSS A;  2BKN A;  3ZMS B;  5AQH B;  5FVK A;  3FZK B;  4DUZ T;  4PFP A;  1M62 A;  2ZM6 T;  3W15 B;  2XAH B;  2XJ7 A;  3JAF A;  4ZI7 E;  2LM9 A;  3C4X A;  4HFH A;  2Z6E A;  4FI5 A;  4DR3 T;  1MMN A; 
#chains in the Genus database with same CATH homology
 3V5S A;  4HKA A;  4P09 A;  4AQF A;  4PJM A;  4TX5 A;  4DMV A;  4MBQ A;  3PTR B;  4WW0 A;  5HXC A;  4H9P C;  3SOL A;  3SS1 A;  4YJ2 E;  2E9X A;  2KMF A;  3VU7 H;  2C5K T;  1QSD A;  3RYF E;  5M4Y A;  3KBU A;  3MAC A;  2Q9Q A;  3HKB E;  3ONX A;  4AQF C;  5LP6 E;  1YD8 G;  5IHY A;  3KV6 A;  1MMA A;  3PUA A;  5FXZ A;  2E9X C;  3F2E A;  2VKO A;  3ETV A;  3ZN0 B;  4I43 B;  2Q9Q C;  2LJL A;  1WYB A;  4K0U A;  5ETW A;  3ZN1 B;  3LBX B;  2X9Y A;  5DAB A;  3GA8 A;  3D0T A;  5HAX A;  4DO0 A;  5JDG A;  2LOP A;  4UF0 B;  3VKH A;  2D5U A;  3I1A A;  3C4W A;  4H9S E;  3RH3 A;  2L3L A;  2K24 A;  3L09 A;  3UUN A;  4IE0 A;  2N1G A;  4JLE A;  2NW7 A;  4E7S A;  4BJN A;  4YJ3 E;  2NW8 A;  4KP3 C;  4E7Z A;  4ZI2 C;  3IBP A;  3LJC A;  2V7J A;  3NRY A;  4UVA B;  3RRW A;  2IW5 B;  3AA0 B;  3ZYK A;  5AFU L;  3ZCJ A;  3FXD B;  4DBQ A;  4UIG A;  1IZN B;  3ZLI A;  3N9M A;  3RYC E;  3IEE A;  4IGU A;  5JVD E;  5LBQ B;  4BJM A;  3U3I A;  1LVF A;  1VOM A;  4TUY E;  3ANW B;  2BZB A;  4EIW A;  2WBL A;  3IHR A;  1QUU A;  3H3A A;  5ADX L;  3OKQ A;  4ZHQ E;  3N5L A;  3J7Y q;  2N2N A;  2X51 A;  3PUR A;  5L3F B;  4QXB B;  1HS7 A;  5FYM A;  3BQL A;  5L3D B;  5LHH B;  1NAF A;  2C5I T;  1WRD A;  4DMW A;  1D1C A;  3HA4 A;  3QC9 A;  4EAH A;  4TV9 E;  3DP7 A;  4IE6 A;  1ZEE A;  2BDE A;  5KDM C;  3F57 A;  1V9D A;  3AA1 B;  3LG7 A;  2LT3 A;  2YU2 A;  2VKJ A;  5FNV E;  2KLQ A;  4X1I E;  5BMV E;  1FEW A;  3AVS A;  4AKI A;  3C50 A;  2JJ9 A;  5LNK A;  2L8K A;  1CUN A;  3PU3 A;  4NUV A;  2W63 A;  4O4J E;  4ISS A;  4EYY R;  3V5U A;  3F31 A;  2NWB A;  4AKH A;  2M67 A;  2LSJ A;  5KMG P;  4AKR B;  3OBV E;  3A5X A;  4AKG A;  2CWO A;  4V1A v;  4HFV A;  2E9X D;  1ZHC A;  5LYJ E;  3N9Q A;  1D0Z A;  2VWA A;  2Q9Q D;  2V26 A;  4FJO A;  3VHL A;  1AJ3 A;  5LGN B;  2E8I A;  5JDN A;  4H63 V;  1MNE A;  3HR0 A;  3K3N A;  2LSG A;  4WBN E;  3AA6 B;  4X1K E;  2J1D G;  2MBG A;  5JRC A;  5JR9 A;  4XAX B;  1FMW A;  4X1Y E;  4TZ4 C;  5LJN A;  1B7T A;  3WAJ A;  5FP3 A;  3J9X 1;  5JDF A;  2X9X A;  2H7V C;  2C5J A;  4U74 A;  5LGU B;  4U72 A;  3CQC B;  2X68 A;  2A3D A;  4IHJ E;  2WAU A;  4ZI2 D;  4G2A A;  4CXW A;  4QKN A;  5JR9 C;  1ZKE A;  3K3O A;  2DCF A;  2W00 A;  2IAK A;  2CEA A;  1D0Y A;  4Z8X A;  3ZC0 A;  2DNX A;  2A72 A;  2I59 A;  2YU1 A;  2B1E A;  2CLY C;  3CX6 B;  4ASK A;  5LHG B;  1MMG A;  3KV4 A;  1O3X A;  3AAE B;  3FBL A;  3PU8 A;  2V7M A;  3AAA B;  4CI1 B;  2HPL A;  4PK4 A;  3RYI E;  4CI2 B;  2KXP B;  1T98 A;  3UUM A;  4QHO A;  4O2A E;  3PUS A;  3UFE A;  2WMO A;  4I50 E;  3UUX B;  4EYU A;  2XQY A;  5FXX A;  3LK4 2;  3CQX C;  1WR6 A;  4C90 A;  2XAS B;  3CVR A;  3O1H A;  2Y6X A;  3P7I A;  3LK2 B;  4ZS2 A;  3CX7 B;  5JDL A;  3H37 A;  1WYC A;  2DWG A;  4JUY A;  5JRE A;  5EK2 A;  2EHO A;  1VRB A;  3N9N A;  4TN7 B;  2YIN A;  5FXW A;  3E08 A;  2CA5 A;  4ERR A;  4EZH A;  3MK7 C;  3KBT A;  4YFS A;  3OJA A;  4H9R C;  5JR9 B;  2MOZ A;  2EHO C;  2ZM8 A;  4UEM A;  5HWY A;  4L5G A;  5JDH A;  3P8C D;  3NRX A;  2KZ7 B;  3S4U A;  3ZCI A;  1X79 A;  1EZ3 A;  3ZMU B;  3HKE E;  1IJ6 A;  2ODV A;  2CLY B;  4IE5 A;  4QX8 B;  2VKD A;  3N2G E;  5HXS A;  4UV9 B;  3TKL B;  2XTL A;  4IE4 A;  3AVR A;  2CMR A;  4HN9 A;  4OYJ A;  4TV8 E;  2QGS A;  4N78 D;  4PW8 A;  3RRC A;  4UV8 B;  3HL6 A;  3KVB A;  5L2L A;  2W0G A;  3NZQ A;  3CPZ A;  1SHZ C;  2V7L A;  3GN5 A;  3ZYL A;  3UT5 E;  3Q2M A;  2WWU A;  2ODU A;  3R6N A;  2X66 A;  3R84 B;  2CM0 A;  1HG5 A;  2BVL A;  3IF8 B;  1YKH B;  4DND A;  2LHR A;  3DTO A;  3AAI A;  4JEU B;  5LCY A;  3L3P A;  3MZK B;  5LHI B;  3C64 A;  5L3C B;  4CZZ B;  2K5B B;  4O2B E;  4P0A A;  3I0O A;  3ZYM A;  2E9X B;  1G8X A;  5L3G B;  1FMV A;  2Q9Q B;  5EK3 A;  4DBR A;  4O4H E;  5H6R B;  1UX5 A;  2VKH A;  4H9Q C;  3MJX A;  3O4X E;  3BK9 A;  3M65 A;  5CA1 E;  2DLR A;  2K48 A;  3HKD E;  4PAG A;  4BAY B;  2V1D B;  1OWA A;  1KK7 A;  4H9N C;  4L9I A;  3ZMT B;  4EOZ B;  5IYZ E;  3SWH A;  4AXP A;  3NBX X;  1MND A;  5F8P A;  5J1G A;  2ZM0 A;  4P0B A;  1UX4 A;  2EHO B;  2LSI A;  4ZI3 C;  2KND A;  1KNZ A;  2LHN A;  3K8P C;  3E0Z A;  4GK0 E;  2NP9 A;  3CQG B;  4EXT A;  4G63 A;  2GK9 A;  5GON E;  3BQK A;  4PNI A;  5DQV A;  4OHF A;  2XHE B;  3C4Z A;  3UUL A;  4QXH B;  4F6R C;  4O8S A;  2YEV C;  4H63 H;  4PJL A;  2XAQ B;  5LXT E;  2G0U A;  2SPC A;  2CXD A;  2K9A A;  1FIO A;  2KWH A;  3ZPO A;  2IC9 A;  1LKX A;  3RC3 A;  2C0S A;  3RPU A;  4QXC B;  3Q9D A;  5H6Q B;  5A1L A;  5KX5 E;  4CXY A;  3FXE B;  2VB6 A;  3LBX A;  2EHO D;  4I55 E;  4PFO A;  2OA5 A;  3CX8 B;  5J2U E;  4GK5 E;  4UF0 A;  4EB6 E;  4I4T E;  2V7K A;  5FMN A;  2X67 A;  3PE0 A;  3N9O A;  2N9D A;  2QA7 A;  4PK6 A;  4CI3 B;  2P9B A;  4UVB B;  3CWZ B;  4UVC B;  2JQQ A;  4MHC A;  2L9Q A;  2ZMA A;  2CXL A;  4OYK A;  2BVM A;  2ACX A;  1IAP A;  2WSS V;  2D2S A;  1U5P A;  5HXR A;  2UXX B;  2XUE A;  5CB4 E;  1LVK A;  3KIN B;  2RA1 A;  2JMK A;  1MIY A;  1LRZ A;  4ILU A;  4H9O C;  2LSK A;  3ANW A;  4KBM B;  3LFM A;  3FHN A;  5FXV A;  2LOS A;  2NTY A;  3E22 E;  3GWH A;  3EDU A;  3QK6 A;  5LA6 E;  4CQI A;  2KWI B;  5EK4 A;  2A2F X;  3KDS E;  5LGT B;  3QUJ A;  5FY0 A;  4X20 E;  3O1J A;  1D0X A;  3KVA A;  4HGA A;  5EZY E;  2PFV A;  2H3R A;  2HH7 A;  4BA9 A;  4OK0 A;  4WNK A;  5HXH A;  5JDQ A;  4OFZ A;  3RYH E;  2ES0 A;  2Y48 B;  1NWM X;  1S94 A;  3ZJ2 A;  3JC6 C;  4JEH B;  3UTK A;  3HI2 A;  3C98 B;  4WBO A;  1Y64 B;  4HEA A;  3CKD A;  5JRC B;  4ZI3 D;  1BR4 A;  4IE7 A;  5HXE A;  2VL8 A;  4C91 A;  1UCU A;  3FBZ A;  2W61 A;  4DVD A;  1E1H B;  3U78 A;  2RP4 A;  2H7O A;  4ZS3 A;  3B57 A;  4UXN B;  2XAF B;  3HKC E;  4YLH A;  1H7C A;  2LSY A;  2DI4 A;  1YW0 A;  3FB2 A;  4L0R A;  2D0T A;  3ZJ1 A;  5L3B B;  4GYR A;  4QWN B;  3B13 A;  4QX7 B;  3Q5W A;  3T8O A;  1US7 B;  1HFA A;  1MIV A;  4IIJ E;  4O4I E;  3GMI A;  2X9W A;  4GOU A;  4O4L E;  3WAK A;  3ZMZ B;  3N9P A;  2PBI A;  2KIN B;  2ZLY A;  5TAO A;  1HF8 A;  1G73 A;  4B6X A;  5JQG E;  3RC8 A;  2UXN B;  5LG4 A;  3I9W A;  3N2K E;  5DQW A;  4PK5 A;  2HPJ A;  3AA7 B;  3MKD A;  1S35 A;  3RX6 A;  2W62 A;  4ANJ A;  3ESL A;  3NZP A;  4UEL A;  2PG8 A;  4EZ4 A;  2JRK A;  2WMN A;  1U4Q A;  3WI3 A;  4GYS A;  4AI6 A;  5LOV E;  2D0U A;  2DHR A;  5HWX A;  3C51 A;  5HYA A;  3KV9 A;  3KFW X;  1MMD A;  2V7I A;  1ZV4 X;  1HX8 A;  4AQG A;  3MXZ A;  4CXX A;  1Z0P A;  1SA0 E;  1BR1 A;  1IJ5 A;  2VAS A;  2CE7 A;  3O1I A;  1BR0 A;  5LBM A;  4YHJ A;  4J2C A;  4XBF B;  3BQI A;  3K3Q C;  3DJB A;  3MA9 A;  3AB3 B;  4GIW A;  5FY1 A;  5C8Y E;  2CCQ A;  4PJJ A;  3ETU A;  2LE8 A;  5F3J A;  5LJM A;  2JPF A;  2MTQ A;  3PUQ A;  5J2T E;  1OXZ A;  3ZMV B;  3VKG A;  3JC6 D;  3EVY A;  4IDZ A;  3GN5 B;  3Q5X A;  3OYZ A;  2XAJ B;  4MAL A;  2LEH A;  4MFR A;  2DWK A;  2VK9 A;  3SRZ A;  3ZC1 A;  2CWY A;  4A56 A;  4KMC A;  2WM9 A;  3PDY A;  4NUU A;  5FY7 A;  4ADZ A;  2ZM2 A;  2PJQ A;  1HTJ F;  2X9H A;  3KV5 A;  2CXF A;  3EUH A;  5CA0 E;  3ZEF B;  2IC6 A;  3PUG A;  3LK3 B;  4HTE A;  5E0O A;  1HCI A;  2Y8D A;  4XZC A;  3OYX A;  4IST A;  1WLX A;  3ZMS B;  4ZOL E;  4HE8 A;  2YK0 A;  5JH7 E;  3EDV A;  4AKL A;  3O9X A;  1D1A A;  2MYS A;  4PJN A;  3I9Y A;  3N9L A;  1D1B A;  4PFP A;  2JMH A;  2XAG B;  5JDM A;  1YKE B;  2NTX A;  3W15 B;  5DJQ C;  3CML A;  2NOX A;  2XAH B;  4ZI7 E;  1HG2 A;  2LM9 A;  3C4X A;  1BR2 A;  2KT9 A;  5L3E B;  3N2O A;  3I0Q A;  3RKO A;  1MIW A;  2Z6E A;  4MLK A;  4FI5 A;  2NW9 A;  2X0L B;  4KUM B;  1MMN A;  4M1P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...