1E1HB

Crystal structure of recombinant botulinum neurotoxin type a light chain, self-inhibiting zn endopeptidase.
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
165
structure length
164
Chain Sequence
b'EMSGLEVSFEELRTFGGHDAKFIDSLQENEFRLYYYNKFKDVASTLNKAKSIIGTTASLQYMKNVFKEKYLLSEDTSGKFSVDKLKFDKLYKMLTEIYTEDNFVNFFKVINRKTYLNFDKAVFRINIVPDENYTIKDGFNLKANLSTNFNGQNTEINSRNFTRL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords BOTULINUM NEUROTOXIN TYPE A LIGHT CHAIN
molecule tags Hydrolase
source organism Clostridium botulinum
publication title Crystal Structure of Clostridium Botulinum Neurotoxin Protease in a Product-Bound State: Evidence for Noncanonical Zinc Protease Activity
pubmed doi rcsb
total genus 47
structure length 164
sequence length 165
chains with identical sequence D
ec nomenclature ec 3.4.24.69: Bontoxilysin.
pdb deposition date 2000-05-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.540 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 1e1hB01
4.10.1280.10 Few Secondary Structures Irregular Metalloproteases ("zincins"), catalytic domain fold Clostridium neurotoxins 1e1hB02
1E1HB 3K3QC
chains in the Genus database with same CATH superfamily
2WCAA 3OJAA 1MIWA 4AIUA 1XDOA 4GYRA 4WYVA 1D0ZA 4O4HE 4EOZB 4DMWA 4YXDA 2XSBA 5JRCB 3I9WA 1W0BA 4H63V 3AE7A 3G06A 3NRYA 4UV8B 2WZHA 3AE9A 4CXXA 3F57A 2Q9QC 3FZKB 3P4QA 4HWIB 5JDHA 1HF8A 2LHRA 2CHNA 2W00A 2YDQA 2E9XA 4AI6A 4GYSA 3AEFA 3CIRA 1QSDA 4HWHA 2X9WA 2WB5A 5ABGA 4KMCA 2BS2A 2YU1A 1YQ3A 1VRBA 1WFDA 5AFUL 4DVDA 4LFAT 5ABFB 2JRKA 3P4RA 4IT4A 2CWOA 4COFA 1XMQT 2XZEA 2CXDA 3TKLB 3N5LA 3UFGA 4TV8E 4U7YA 2JQ9A 1XDPA 3GMIA 3QB5A 2DNXA 4E7ZA 4AKHA 1CUNA 3CQXC 5KDMC 1HNZT 5L2LA 3JC6C 4KI0F 4YFSA 1YKHB 4LF8T 1MIYA 1VOMA 3RF1A 4IE4A 5KX5E 1XMOT 2XUEA 4IE6A 2MYSA 3NKZA 3P4WA 5F8PA 5CJ5A 4PFPA 3ZSSA 3ZMVB 4AKGA 4KBMB 5L4HA 1I6ZA 5HYAA 2W62A 4U33A 4TX5A 3GN5B 4A5XA 1WCRA 4CN6A 3HKBE 3RYHE 1QUUA 5AQMB 1IBMT 5M4YA 1WR0A 2K5BB 2DWKA 3CX8B 1KNRA 3KVBA 3S4UA 3NVOA 5EK4A 2Q9QD 2L9QA 4L0RA 5FVKA 4EV6A 4DUZT 4H9SE 1ZOYA 2VKOA 2BG9A 3EAMA 4K0UA 4ZOLE 3Q5EA 4WZXA 2YU2A 3UU4A 3KINB 4UV9B 5AQNB 4YHHT 3KV4A 3JAEA 4P0BA 2V5DA 2X51A 2KNDA 3M3ZB 1ZKEA 4TV9E 5LB7B 3SFEA 2BBHA 4X1KE 3TLVA 5L3BB 2UU9T 1W9RA 2WP9A 2NTXA 2XQ4A 3C51A 3GWHA 1M7KA 1V9DA 3FZHB 4EYYR 2K9AA 3RGLA 1BR1A 2EHOD 2ZM8A 2CCQA 2WBLA 4O4JE 5CA1E 1L0VA 1UUSA 5LBMA 2BVLA 2ZLYA 3OYXA 1FIOA 2MPKA 3EVYA 4YJ3E 2H3RA 2N1GA 2FJDA 3UU5A 2NTYA 4JBWF 4TWDA 5DQWA 1WYBA 5JR9A 1CHUA 4O8SA 5HEHA 4A98A 4ZZBA 3FHNA 5LMUT 1MMDA 3RKOA 3RRCA 4U2YA 3L09A 5A1LA 4EIWA 4O2BE 4PJJA 4UELA 4IDOA 5HXSA 1HX1B 4NPPA 4B3RT 1IJ6A 2I6HA 3PU8A 4UVAB 4LF6T 5CB4E 4Q25A 3RI5A 4UF0B 4AQFA 2OA5A 2JQQA 1JNZA 4QXBB 5EK2A 2M6IA 1D1CA 3BQKA 2H7OA 1T98A 2LOPA 4UVBB 4PW8A 2UUAT 2ZMAA 4TZ4C 1VCSA 4JI0T 2VVSA 2WDVA 2X0YA 5HWXA 4ZXLA 2E8IA 3K3OA 4TNWA 5JVDE 4DBQA 5AQHB 3F31A 4YT0A 3RC8A 3MZKB 2WWUA 4TN7B 5C3JA 4FJOA 2DI4A 3VRAA 1OWAA 4O2AE 2R6GF 4PFOA 4DV7T 2H89A 3N9OA 4NXMT 1SUMB 4QX7B 2IC9A 3O4XE 4X62T 4XAXB 3L8RA 3ZEFB 5E0OA 1MMNA 1NENA 3FXDB 4O4IE 3WI3A 4CI2B 1BR2A 5J1GA 5C8YE 3CVRA 2CXLA 3LK3B 5H6RB 3ZT7A 3H3MA 4V1Av 4BA9A 2W63A 3AA1B 3OBVE 2KLQA 4K0KT 2X9YA 2OV9A 3ONJA 2X9HA 5L3EB 5JDQA 4N78D 5JR9C 5JDLA 2UXCT 2L3LA 4J2CA 3W15B 4A97A 2UXNB 2XAQB 1XNRT 1E1HB 3AA7B 3MXZA 3LBXA 2MAWA 3LDQB 3LBXB 3ZPOA 3Q2MA 5LNKA 3M65A 4HEAA 2CLYB 4QH4A 5LHIB 5AQRB 1QLBA 2CEAA 4JUYA 2JJ9A 3FBLA 4UF0A 4CN4A 2QVAA 4DR7T 2YOEA 2NW9A 4A56A 3EI0A 4ZS3A 5AQTB 1IBLT 4LFCT 4H9RC 5FL1A 1XZYA 4TWHA 4P0AA 4YLHA 3U3IA 2WS3A 3AVRA 3UU8A 3J7Yq 2IUBA 2VWAA 4PK4A 3LK42 2VKHA 3ONXA 3PTRB 2ODUA 4BAYB 4FI5A 5LP6E 3KFWX 3AAEB 3TLWA 1E2AA 3ZMSB 5L3CB 1WR6A 3C50A 3PU3A 3JADA 2K48A 1D0YA 4KHZF 2WWVA 5LYJE 4DUYT 1MNDA 2C0SA 4AQGA 4JI8T 2PG8A 2WM9A 3AEBA 1KF6A 3ZJ2A 3HKCE 3LK2B 5KXJA 3MJXA 2VURA 5HXEA 3VU7H 2D5UA 3R6NA 2BG9E 4G63A 1B7TA 4B3TT 2AXDS 3H3AA 3WAKA 2H7VC 2C5KT 4TUYE 3ANWB 3B13A 3R84B 4GK5E 2XAFB 4G2AA 4ZI3C 4JV5T 2IMLA 2YK0A 3AEDA 3P7IA 3MA9A 2LM2A 4OYJA 3RLFF 3TLTA 3ZN0B 1WRDA 3C4WA 4NUUA 5F3JA 1IBKT 5HEJA 1D0XA 1ZHCA 2A72A 3O1HA 5LMNT 4LF5T 2NW8A 3ZMZB 2W61A 3B57A 2CRBA 4JEUB 2MTQA 5DQVA 2J47A 3N9LA 5FMNA 4X20E 3RIAA 2D9DA 1MMGA 3NZQA 3NZPA 4YSYA 1Z0PA 3UUBA 5ETWA 3AAAB 4H9QC 3FBZA 2DL1A 3EDVA 2V8SV 3OYZA 3RRWA 3E0ZA 2D2SA 4MFRA 3AE1A 3QC9A 5JREA 3CMLA 2XQ7A 3O1IA 4AKIA 3K3NA 3VKGA 2UXXB 1HFAA 4KUMB 2DHRA 3K1SA 3P4SA 4QH5A 2WU5A 1GQEA 2NWBA 5AQPB 2LKHA 3A5XA 4HWDA 4YSXA 4ZI2D 4B3ST 3RYFE 3KV9A 4XBFB 3AEEA 4NIQA 4GKJT 4DV6T 2E9XC 1OEDA 4DV2T 2LHNA 4I4TE 5FXZA 5LGUB 2LRLA 1HNWT 2XQ3A 1KNPA 3ZJ1A 5EZYE 2V26A 2L8KA 2G0UA 2M6BA 3AXJA 3P8CD 3SFDA 3ZT5A 1J5WA 3UTKA 5L3DB 1X9BA 1HG2A 1YW0A 4PK6A 1W09A 3GA8A 3ETVA 5FP3A 3RIUC 4F8HA 4GIWA 5F5WA 5ADXL 4ZHQE 5LHHB 4GOUA 5HXHA 1XNQT 2X9XA 2YKSA 5HAXA 1N32T 5LHGB 1FMWA 2YDSA 5J2UE 4X66T 1MIVA 1N34T 5BR8T 1D1BA 3HI2A 4MHCA 3T8OA 5IUXA 4KX6A 4UEMA 3AE4A 2XHEB 3QUJA 1FMVA 2SPCA 3OKQA 1FEWA 4I0UA 4OHFA 2FBWA 4HGAA 3TLUA 3NRXA 1IJ5A 1BR0A 2KWHA 2CWYA 3PUAA 2QA7A 4HFBA 3Q9DA 4DIDB 3HKDE 5L47A 1H7CA 2FJAA 1WLXA 2VB6A 4MLKA 4CI1B 2JMKA 3FZLB 5JDGA 2HHHT 4HFEA 4AISA 4DV3T 2RP4A 4DV1T 5HEOA 3RIUA 1SA0E 2JMHA 4UIGA 3QB5K 4JYAT 4B6XA 2HPJA 2PFVA 4UVCB 2IDOB 2JQKA 3VHLA 4QXCB 4ZEYA 4JI3T 3N9QA 3PE0A 3AECA 5AQQB 5IHYA 2BG9C 2DLRA 3EDUA 2BS3A 4F6RC 1U5PA 2V7JA 2QRXA 2LEHA 2ODVA 3KBUA 4PJNA 2LSGA 4EAHA 2A2FX 4EZ4A 3UQ7A 1HR0T 4X64T 3ZC0A 4X5TA 1JNRA 2LSJA 3AE5A 3FB2A 2WMNA 3JC6D 3HKEE 3L3PA 3LG7A 4IDZA 3HA4A 4DO0A 4X1IE 4U74A 5LG4A 4X65T 4DR1T 4ILUA 2XAJB 4HN9A 5JDMA 3N9MA 2LM9A 5LJMA 4DV4T 2V7IA 1YKEB 2EHOB 2WU2A 4OK0A 2CXFA 1LKXA 2WDQA 1AJ3A 2UXDT 4X1YE 2FUPA 3EHZA 2WDRA 3ANWA 3CKDA 4HFVA 4TNVA 2IAKA 3MK7C 3UFEA 1NAFA 4LF9T 3IA3A 3QK6A 4QXHB 2A3DA 4JLEA 3AVSA 4ERRA 4H9NC 2XQ9A 3K8PC 5CGMA 2XTLA 4NUVA 3PUQA 2IIUA 2LSKA 4U7IA 2BDEA 4DBRA 4YY3T 3VR8A 3SWHA 3L39A 1UURA 2WMOA 4IHJE 3WAJA 3U78A 3ZLIA 2I59A 5LOVE 2E2AA 1UGOA 2LSYA 2WZIA 3CQGB 4PAGA 5FXWA 3RX6A 5J0ZA 4DR6T 1Z8UA 3A8YC 4OFZA 5LGTB 3CX7B 3V5SA 3ZMUB 3J9X1 2PJQA 1YQ4A 2LT3A 4DV5T 5JH7E 4JI7T 4ILBA 4QKNA 3D0TA 3AB3B 5DJQC 2WQYA 3RIFA 2XM2A 2C5IT 2YINA 3PUWF 3ABVA 4IL4A 1S94A 2V7KA 4AKRB 5HEGA 2JQHA 4LMLA 3X1DA 4CQIA 4WW0A 3B5MA 3ZCIA 5AQJB 2ZM6T 3SOLA 2N2NA 2P9BA 2LKGA 3KV5A 5ABEA 5AQKB 1KEYA 3AXJB 2CPTA 2KINB 3LSVA 2J62A 5JDNA 4ZI2C 5HCJA 4YTNA 2MBGA 3VRBA 4P1NA 3ZC1A 3T1YT 2VL8A 5AQOB 2LRKA 2VASA 5J2TE 1E7PA 4H63H 2PBIA 4I50E 1R8IA 5EK3A 5HEUA 5LGNB 2LSIA 4NXNT 3PUYF 1ZP0A 4DR5T 3UUMA 3UU6A 2CMRA 4QHOA 5FYMA 2DCFA 5L3FB 1T8BA 1HG5A 2NW7A 2X67A 2VQFT 1W0AA 3RH3A 2WSSV 4PK5A 1EZ3A 3LJCA 1HS7A 2ZM2A 3RQWA 1Y01A 3OTOT 2V1DB 3IEEA 3RHWA 2J1DG 3C4XA 4E7SA 2N9DA 4DV0T 2BKNA 3HL6A 3VKHA 4BJNA 1X79A 2VKJA 2XY8B 3UUXB 4AXPA 2CM0A 3ZMTB 3ZKRA 2FJEA 3I9YA 3LFMA 1XWMA 3ZN1B 2QYWA 5FXVA 4CN1A 1U4QA 4L5GA 1SHZC 2NR4A 2M67A 3VR9A 4DR3T 3CK6A 3N2OA 4IDNA 2E5LT 4DR2T 3T1HT 4MALA 3PV0F 2X0HA 3QOFA 4HWFA 2VK9A 5IWAT 4GKKT 1MNEA 2EHOA 1HX8A 3KBTA 4H9OC 3SRZA 4EB6E 1D1AA 4LMKA 5LA6E 3GN5A 4Z90A 3PDYA 3N9NA 4I55E 4JI5T 4EYUA 1LVKA 2XASB 5H6QB 2ACZA 1KK7A 4ISSA 1ZV4X 2V6XA 3PUSA 5FY0A 4LF7T 3UT5E 4YTMA 2VKDA 5JRCA 4IE0A 1DU2A 3I0QA 1T72A 2B76A 4PJLA 3RPUA 5JQGE 3QNUA 2UXBT 4IE5A 5HCMA 2Y8DA 3V5UA 2W0GA 4QWNB 5LG3A 2XAGB 5BMVE 4L9IA 5IYZE 3P50A 4DNDA 2XAHB 2NP9A 4IE7A 4Z91A 4ADZA 4CI3B 2HPLA 3ZSTA 4LF4T 3ETUA 2KWIB 3CX6B 5JR9B 3AEGA 4IDQA 3AE6A 1IAPA 2ES0A 2JPFA 1VCTA 3NBXX 3RYIE 1OEDE 2BG9B 2V7LA 4DR4T 4XZCA 2CBJA 2YEVC 5FXXA 2IW5B 2IHR1 1O3XA 2XQYA 4U3CA 1UX4A 2NOXA 2VL0A 3H37A 5FKYA 2UUCT 3ZYMA 3NWIA 5AQSB 3F2EA 4YHJA 2B1EA 2V6YB 4LFBT 2CA5A 2QGSA 2MOZA 4O4LE 1HTJF 2YDRA 4EEDA 2H88A 3FZFB 5L4EA 4KHPT 2V5CA 2D0TA 4P09A 3MKDA 4PNIA 5AQFB 4U72A 1UX5A 3AAIA 1UCUA 1LRZA 3P4PA 2V7MA 3AEAA 4GK0E 2XQ8A 4KP3C 4HFCA 4BJMA 2OLTA 5C2TA 4AKLA 3K3QC 5LXTE 2F4VT 3C98B 2X68A 3PJAA 5JDFA 3ZT6A 4AQFC 1OXZA 4EEBA 5LCYA 3RQUA 4JEHB 3UU3A 2E5VA 5L3GB 1NEKA 1OEDB 3O1JA 2XPKA 1US7B 2JIWA 3KDSE 2BVMA 3TLSA 4JI1T 1N33T 5AQLB 1SE7A 4ILAA 1IZNB 3ZCJA 5LJNA 3O9XA 1HNXT 4WBNE 5HXRA 2DWGA 2I0MA 2LOSA 2HH7A 2BS4A 4HFHA 3AE3A 1KFYA 3SS1A 3ONLC 4M1PA 3Q5DA 2Y48B 1HCIA 4QH1A 4WNKA 5HXCA 3ZYLA 4Z8XA 4EZHA 3AE2A 2W66A 5GONE 3HR0A 3FZMB 3I1AA 4IGUA 4U31A 1NWMX 5DABA 5FL0A 3AA0B 4CZZB 5FY1A 4HTEA 1I94T 4ANJA 4YJ2E 3PURA 2YN6A 2CLYC 3DP7A 4I43B 3UULA 3MACA 2GK9A 3PJAJ 3ZYKA 2X0LB 4ILCA 2VVNA 2LE8A 5FNVE 1MMAA 4IDPA 3ESLA 4HFDA 2BKOA 2CHOA 2KZ7B 3JCFA 3OPCA 4H9PC 3BQLA 4PJMA 3A7MA 5HWYA 2WAUA 2Q9QA 3CPZA 3RC3A 4ZI3D 3IF8B 3PUVF 4JI2T 4ISTA 4EGWA 5CFBA 5KMGP 2HN1A 4C90A 1M62A 2XQ6A 4IIJE 1BR4A 4HE8A 4DMVA 2LLYA 1G8XA 2W2UA 2J4GA 3CWZB 3N9PA 3PUZF 4OYKA 1LVFA 2BKPA 4UR9A 4EXTA 1T7SA 2KXPB 2D0UA 2KT9A 4IL9A 4YSZA 3AA6B 3OVUA 5ABFA 4B3MT 2XSAA 5AQVB 2EHOC 2KSRA 2Y6XA 1UK5A 5JTGA 2BZBA 4JI4T 2K3WA 2E9XB 3AE8A 3FXEB 3KV6A 3CQCB 4IREA 3DJBA 5AQUB 3N2GE 4AQYT 4JI6T 5LBQB 3EABA 4U2ZA 3RKGA 2RPAA 3PUXF 4OX9T 4C91A 3E08A 1OEDC 2ACXA 3E22E 3JAFA 4UXNB 5TAOA 1N36T 1KNZA 2C5JA 3N2KE 2Z6EA 2X66A 3UQ4A 2VQET 2UUBT 2AE9A 3BK9A 3UUNA 3Q5XA 1Y64B 3C64A 3EUHA 1J1JA 4WBOA 2W4XA 2XQAA 2E9XD 4MBQA 4QX8B 4TWFA 4ZI7E 4ZZCA 2LJLA 3RYCE 2RA1A 2A9UA 4YTPA 1ZEEA 2V6YA 4ZS2A 2XM1A 3IHRA 5CA0E 1YXRA 2HN2A 2WY2A 3C4ZA 4LMJA 3I0OA 1G73A 2CE7A 1YD8G 2KMFA 2XJ7A 2ZM0A 3KVAA 5FVLA 5FY7A 5ABHA 2Q9QB 3PUGA 1FJGT 4HFIA 4ASKA 2FJBA 1WYCA 2K24A 1J5ET 3Q5WA 4CXWA 2PTFA 3DTOA 3BQIA 2W67A 2IC6A 5AQIB 2BBJA 5AQGB 4CXYA 2XQ5A 4HKAA 1S35A 4HWCA 3IBPA 2CBIA
chains in the Genus database with same CATH topology
3OJAA 1MIWA 4GYRA 4EOZB 1D0ZA 4O4HE 4DMWA 3I9WA 4H63V 3NRYA 4UV8B 4CXXA 3F57A 2Q9QC 5JDHA 1HF8A 2LHRA 2W00A 2E9XA 4AI6A 4GYSA 1QSDA 2X9WA 4KMCA 5AFUL 2YU1A 1VRBA 4DVDA 2JRKA 2CWOA 2CXDA 3TKLB 3N5LA 4TV8E 3GMIA 4E7ZA 2DNXA 4AKHA 1CUNA 3CQXC 5KDMC 5L2LA 3JC6C 4YFSA 1YKHB 1MIYA 1VOMA 4IE4A 5JRCB 2XUEA 4IE6A 2MYSA 5F8PA 4PFPA 4AKGA 3ZMVB 4KBMB 5HYAA 2W62A 4TX5A 3GN5B 3HKBE 3RYHE 1QUUA 2K5BB 3CX8B 2DWKA 3S4UA 3KVBA 5EK4A 2Q9QD 2L9QA 4L0RA 4H9SE 2VKOA 4K0UA 4ZOLE 2YU2A 3KINB 4UV9B 3KV4A 4P0BA 2X51A 2KNDA 1ZKEA 4TV9E 5L3BB 4X1KE 3C51A 4EYYR 2NTXA 3GWHA 1V9DA 2K9AA 1BR1A 2EHOD 2ZM8A 2CCQA 2WBLA 4O4JE 5CA1E 5LBMA 2BVLA 2ZLYA 3OYXA 1FIOA 3EVYA 4YJ3E 2H3RA 2N1GA 2NTYA 5DQWA 1WYBA 5JR9A 4O8SA 3FHNA 1MMDA 3RKOA 3RRCA 5A1LA 3L09A 4EIWA 4O2BE 4PJJA 4UELA 5HXSA 1IJ6A 4UVAB 3PU8A 5CB4E 4AQFA 4UF0B 2OA5A 2JQQA 4QXBB 5EK2A 1D1CA 3BQKA 2H7OA 1T98A 2LOPA 4UVBB 4PW8A 2ZMAA 4TZ4C 5HWXA 2E8IA 3K3OA 5JVDE 4DBQA 3RC8A 3F31A 3MZKB 2WWUA 4TN7B 4FJOA 2DI4A 1OWAA 4O2AE 4PFOA 3N9OA 4QX7B 2IC9A 3O4XE 4XAXB 3ZEFB 5E0OA 1MMNA 3FXDB 4O4IE 3WI3A 4CI2B 1BR2A 5J1GA 5C8YE 3CVRA 2CXLA 3LK3B 5H6RB 4V1Av 4BA9A 3AA1B 2W63A 3OBVE 2KLQA 2X9YA 5L3EB 2X9HA 5JDQA 4N78D 5JR9C 5JDLA 2L3LA 4J2CA 3W15B 2UXNB 2XAQB 1E1HB 3AA7B 3MXZA 3LBXA 3LBXB 3ZPOA 3Q2MA 3M65A 4HEAA 2CLYB 5LHIB 2CEAA 4JUYA 2JJ9A 3FBLA 4UF0A 2NW9A 4A56A 4ZS3A 4H9RC 4P0AA 4YLHA 3U3IA 3AVRA 3J7Yq 2VWAA 4PK4A 3LK42 2VKHA 3ONXA 3PTRB 2ODUA 4BAYB 4FI5A 5LP6E 3KFWX 3AAEB 5L3CB 3ZMSB 1WR6A 3C50A 3PU3A 5LYJE 2K48A 1D0YA 1MNDA 2C0SA 4AQGA 2PG8A 2WM9A 3ZJ2A 3HKCE 3LK2B 3MJXA 5HXEA 3VU7H 2D5UA 3R6NA 4G63A 1B7TA 3H3AA 3WAKA 2H7VC 2C5KT 4TUYE 3ANWB 3B13A 3R84B 4GK5E 2XAFB 4G2AA 4ZI3C 2YK0A 3P7IA 3MA9A 4OYJA 5M4YA 5F3JA 1WRDA 3C4WA 4NUUA 1D0XA 1ZHCA 2A72A 3O1HA 2NW8A 3ZMZB 2W61A 3B57A 4JEUB 5FMNA 2MTQA 5DQVA 3N9LA 4X20E 1MMGA 3NZQA 3NZPA 1Z0PA 5ETWA 3AAAB 4H9QC 3FBZA 3EDVA 3OYZA 3RRWA 3E0ZA 2D2SA 4MFRA 5JREA 3QC9A 3CMLA 3O1IA 4AKIA 3K3NA 3VKGA 2UXXB 1HFAA 4KUMB 2DHRA 2NWBA 3A5XA 4ZI2D 3RYFE 3KV9A 4XBFB 2E9XC 2LHNA 4I4TE 5FXZA 5LGUB 3ZJ1A 5EZYE 2V26A 2L8KA 2G0UA 3P8CD 3UTKA 5L3DB 1YW0A 1HG2A 4PK6A 3GA8A 3ETVA 5FP3A 4GIWA 5ADXL 4ZHQE 5LHHB 4GOUA 5HXHA 2X9XA 5HAXA 5LHGB 1FMWA 5J2UE 1MIVA 1D1BA 3HI2A 4MHCA 3T8OA 4UEMA 2XHEB 3QUJA 1FMVA 2SPCA 3OKQA 1FEWA 4OHFA 4HGAA 3NRXA 1IJ5A 1BR0A 2KWHA 2CWYA 3PUAA 2QA7A 3Q9DA 3HKDE 2VB6A 1H7CA 1WLXA 4MLKA 4CI1B 2JMKA 5JDGA 2RP4A 1SA0E 2JMHA 4UIGA 4B6XA 2HPJA 2PFVA 4UVCB 3VHLA 4QXCB 3N9QA 3PE0A 5IHYA 2DLRA 3EDUA 4F6RC 1U5PA 2V7JA 5LNKA 2LEHA 2ODVA 3KBUA 4PJNA 2LSGA 4EAHA 2A2FX 4EZ4A 3ZC0A 2LSJA 3JC6D 3FB2A 3L3PA 2WMNA 3LG7A 3HKEE 4IDZA 4DO0A 3HA4A 4X1IE 4U74A 5LG4A 4ILUA 2XAJB 4HN9A 5JDMA 3N9MA 2LM9A 5LJMA 2V7IA 1YKEB 2EHOB 4OK0A 2CXFA 1LKXA 1AJ3A 4X1YE 4HFVA 3ANWA 3CKDA 3UFEA 2IAKA 3MK7C 1NAFA 4ERRA 3QK6A 4QXHB 2A3DA 4JLEA 3AVSA 4H9NC 3K8PC 2XTLA 4NUVA 3PUQA 2LSKA 4DBRA 2BDEA 3SWHA 4IHJE 2WMOA 3WAJA 3U78A 3ZLIA 2I59A 5LOVE 2LSYA 4PAGA 3CQGB 5FXWA 3RX6A 4OFZA 5LGTB 3CX7B 3V5SA 3ZMUB 3J9X1 2PJQA 2LT3A 5JH7E 1S35A 3D0TA 4QKNA 3AB3B 5DJQC 4AKRB 2C5IT 2YINA 1S94A 2V7KA 4CQIA 4WW0A 3ZCIA 3SOLA 2N2NA 2P9BA 3KV5A 5JDNA 2KINB 4ZI2C 2MBGA 3ZC1A 2VASA 5J2TE 4H63H 2PBIA 4I50E 5EK3A 5LGNB 2LSIA 3UUMA 2CMRA 4QHOA 5FYMA 2DCFA 5L3FB 1HG5A 2NW7A 2X67A 3RH3A 2WSSV 4PK5A 1EZ3A 3LJCA 1HS7A 2ZM2A 2V1DB 3IEEA 4E7SA 2J1DG 3C4XA 2N9DA 3HL6A 3VKHA 4BJNA 1X79A 2VKJA 3UUXB 4AXPA 2CM0A 3ZMTB 3LFMA 3I9YA 3ZN1B 5FXVA 1U4QA 4L5GA 1SHZC 2M67A 3N2OA 4MALA 2VK9A 1MNEA 2EHOA 1HX8A 3KBTA 4H9OC 3SRZA 4EB6E 1D1AA 5LA6E 3GN5A 3PDYA 3N9NA 4I55E 4EYUA 1LVKA 2XASB 5H6QB 1KK7A 4ISSA 1ZV4X 3PUSA 5FY0A 3UT5E 2VKDA 5JRCA 4IE0A 3I0QA 4PJLA 3RPUA 5JQGE 4IE5A 2Y8DA 3V5UA 2W0GA 4QWNB 2XAGB 5BMVE 4L9IA 5IYZE 4DNDA 2XAHB 2NP9A 4IE7A 4CI3B 4ADZA 2HPLA 3ETUA 2KWIB 3CX6B 5JR9B 1IAPA 2ES0A 2JPFA 3NBXX 3RYIE 2V7LA 4XZCA 2YEVC 5FXXA 2IW5B 1O3XA 2XQYA 1UX4A 2NOXA 3H37A 3ZYMA 3F2EA 4YHJA 2B1EA 2CA5A 2QGSA 2MOZA 4O4LE 1HTJF 4PNIA 2D0TA 4P09A 3MKDA 4U72A 1UX5A 3AAIA 1UCUA 1LRZA 2V7MA 4GK0E 4KP3C 4BJMA 4AKLA 3K3QC 5LXTE 3C98B 2X68A 5JDFA 4AQFC 1OXZA 5LCYA 4JEHB 5L3GB 3O1JA 1US7B 3KDSE 2BVMA 1IZNB 3ZCJA 5LJNA 3O9XA 4WBNE 5HXRA 2DWGA 2LOSA 2HH7A 3SS1A 4C90A 4M1PA 2Y48B 1HCIA 4WNKA 3ZYLA 5HXCA 4EZHA 4Z8XA 5GONE 3HR0A 3I1AA 4IGUA 5DABA 1NWMX 4CZZB 3AA0B 5FY1A 4HTEA 4ANJA 4YJ2E 3PURA 3DP7A 2CLYC 4I43B 3UULA 3MACA 2GK9A 3ZYKA 2X0LB 2LE8A 5FNVE 1MMAA 3ESLA 5KX5E 4PJMA 2KZ7B 3ZN0B 4H9PC 3BQLA 3RC3A 5HWYA 2WAUA 2Q9QA 3CPZA 4ZI3D 3IF8B 4ISTA 5KMGP 4IIJE 1BR4A 4HE8A 4DMVA 1G8XA 3CWZB 3N9PA 4OYKA 1LVFA 4EXTA 2KXPB 2D0UA 2KT9A 3AA6B 2EHOC 2Y6XA 2BZBA 2E9XB 3FXEB 3KV6A 3CQCB 3DJBA 3N2GE 5LBQB 4C91A 3E08A 2ACXA 3E22E 4UXNB 5TAOA 1KNZA 2C5JA 3N2KE 2Z6EA 2X66A 3BK9A 3UUNA 3Q5XA 1Y64B 3C64A 3EUHA 4WBOA 2E9XD 4MBQA 4QX8B 4ZI7E 2LJLA 3RYCE 2RA1A 1ZEEA 4ZS2A 3IHRA 5CA0E 3C4ZA 3I0OA 1G73A 2CE7A 1YD8G 2KMFA 2ZM0A 3KVAA 5FY7A 2Q9QB 3PUGA 4ASKA 1WYCA 2K24A 3Q5WA 4CXWA 3DTOA 3BQIA 2IC6A 4CXYA 4HKAA 2VL8A 3IBPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E1H B;  3K3Q C; 
#chains in the Genus database with same CATH topology
 2WCA A;  3OJA A;  1MIW A;  4AIU A;  1XDO A;  4GYR A;  4WYV A;  1D0Z A;  4O4H E;  4EOZ B;  4DMW A;  4YXD A;  2XSB A;  5JRC B;  3I9W A;  1W0B A;  4H63 V;  3AE7 A;  3G06 A;  3NRY A;  4UV8 B;  2WZH A;  3AE9 A;  4CXX A;  3F57 A;  2Q9Q C;  3FZK B;  3P4Q A;  4HWI B;  5JDH A;  1HF8 A;  2LHR A;  2CHN A;  2W00 A;  2YDQ A;  2E9X A;  4AI6 A;  4GYS A;  3AEF A;  3CIR A;  1QSD A;  4HWH A;  2X9W A;  2WB5 A;  5ABG A;  4KMC A;  2BS2 A;  2YU1 A;  1YQ3 A;  1VRB A;  1WFD A;  5AFU L;  4DVD A;  4LFA T;  5ABF B;  2JRK A;  3P4R A;  4IT4 A;  2CWO A;  4COF A;  1XMQ T;  2XZE A;  2CXD A;  3TKL B;  3N5L A;  3UFG A;  4TV8 E;  4U7Y A;  2JQ9 A;  1XDP A;  3GMI A;  3QB5 A;  2DNX A;  4E7Z A;  4AKH A;  1CUN A;  3CQX C;  5KDM C;  1HNZ T;  5L2L A;  3JC6 C;  4KI0 F;  4YFS A;  1YKH B;  4LF8 T;  1MIY A;  1VOM A;  3RF1 A;  4IE4 A;  5KX5 E;  1XMO T;  2XUE A;  4IE6 A;  2MYS A;  3NKZ A;  3P4W A;  5F8P A;  5CJ5 A;  4PFP A;  3ZSS A;  3ZMV B;  4AKG A;  4KBM B;  5L4H A;  1I6Z A;  5HYA A;  2W62 A;  4U33 A;  4TX5 A;  3GN5 B;  4A5X A;  1WCR A;  4CN6 A;  3HKB E;  3RYH E;  1QUU A;  5AQM B;  1IBM T;  5M4Y A;  1WR0 A;  2K5B B;  2DWK A;  3CX8 B;  1KNR A;  3KVB A;  3S4U A;  3NVO A;  5EK4 A;  2Q9Q D;  2L9Q A;  4L0R A;  5FVK A;  4EV6 A;  4DUZ T;  4H9S E;  1ZOY A;  2VKO A;  2BG9 A;  3EAM A;  4K0U A;  4ZOL E;  3Q5E A;  4WZX A;  2YU2 A;  3UU4 A;  3KIN B;  4UV9 B;  5AQN B;  4YHH T;  3KV4 A;  3JAE A;  4P0B A;  2V5D A;  2X51 A;  2KND A;  3M3Z B;  1ZKE A;  4TV9 E;  5LB7 B;  3SFE A;  2BBH A;  4X1K E;  3TLV A;  5L3B B;  2UU9 T;  1W9R A;  2WP9 A;  2NTX A;  2XQ4 A;  3C51 A;  3GWH A;  1M7K A;  1V9D A;  3FZH B;  4EYY R;  2K9A A;  3RGL A;  1BR1 A;  2EHO D;  2ZM8 A;  2CCQ A;  2WBL A;  4O4J E;  5CA1 E;  1L0V A;  1UUS A;  5LBM A;  2BVL A;  2ZLY A;  3OYX A;  1FIO A;  2MPK A;  3EVY A;  4YJ3 E;  2H3R A;  2N1G A;  2FJD A;  3UU5 A;  2NTY A;  4JBW F;  4TWD A;  5DQW A;  1WYB A;  5JR9 A;  1CHU A;  4O8S A;  5HEH A;  4A98 A;  4ZZB A;  3FHN A;  5LMU T;  1MMD A;  3RKO A;  3RRC A;  4U2Y A;  3L09 A;  5A1L A;  4EIW A;  4O2B E;  4PJJ A;  4UEL A;  4IDO A;  5HXS A;  1HX1 B;  4NPP A;  4B3R T;  1IJ6 A;  2I6H A;  3PU8 A;  4UVA B;  4LF6 T;  5CB4 E;  4Q25 A;  3RI5 A;  4UF0 B;  4AQF A;  2OA5 A;  2JQQ A;  1JNZ A;  4QXB B;  5EK2 A;  2M6I A;  1D1C A;  3BQK A;  2H7O A;  1T98 A;  2LOP A;  4UVB B;  4PW8 A;  2UUA T;  2ZMA A;  4TZ4 C;  1VCS A;  4JI0 T;  2VVS A;  2WDV A;  2X0Y A;  5HWX A;  4ZXL A;  2E8I A;  3K3O A;  4TNW A;  5JVD E;  4DBQ A;  5AQH B;  3F31 A;  4YT0 A;  3RC8 A;  3MZK B;  2WWU A;  4TN7 B;  5C3J A;  4FJO A;  2DI4 A;  3VRA A;  1OWA A;  4O2A E;  2R6G F;  4PFO A;  4DV7 T;  2H89 A;  3N9O A;  4NXM T;  1SUM B;  4QX7 B;  2IC9 A;  3O4X E;  4X62 T;  4XAX B;  3L8R A;  3ZEF B;  5E0O A;  1MMN A;  1NEN A;  3FXD B;  4O4I E;  3WI3 A;  4CI2 B;  1BR2 A;  5J1G A;  5C8Y E;  3CVR A;  2CXL A;  3LK3 B;  5H6R B;  3ZT7 A;  3H3M A;  4V1A v;  4BA9 A;  2W63 A;  3AA1 B;  3OBV E;  2KLQ A;  4K0K T;  2X9Y A;  2OV9 A;  3ONJ A;  2X9H A;  5L3E B;  5JDQ A;  4N78 D;  5JR9 C;  5JDL A;  2UXC T;  2L3L A;  4J2C A;  3W15 B;  4A97 A;  2UXN B;  2XAQ B;  1XNR T;  1E1H B;  3AA7 B;  3MXZ A;  3LBX A;  2MAW A;  3LDQ B;  3LBX B;  3ZPO A;  3Q2M A;  5LNK A;  3M65 A;  4HEA A;  2CLY B;  4QH4 A;  5LHI B;  5AQR B;  1QLB A;  2CEA A;  4JUY A;  2JJ9 A;  3FBL A;  4UF0 A;  4CN4 A;  2QVA A;  4DR7 T;  2YOE A;  2NW9 A;  4A56 A;  3EI0 A;  4ZS3 A;  5AQT B;  1IBL T;  4LFC T;  4H9R C;  5FL1 A;  1XZY A;  4TWH A;  4P0A A;  4YLH A;  3U3I A;  2WS3 A;  3AVR A;  3UU8 A;  3J7Y q;  2IUB A;  2VWA A;  4PK4 A;  3LK4 2;  2VKH A;  3ONX A;  3PTR B;  2ODU A;  4BAY B;  4FI5 A;  5LP6 E;  3KFW X;  3AAE B;  3TLW A;  1E2A A;  3ZMS B;  5L3C B;  1WR6 A;  3C50 A;  3PU3 A;  3JAD A;  2K48 A;  1D0Y A;  4KHZ F;  2WWV A;  5LYJ E;  4DUY T;  1MND A;  2C0S A;  4AQG A;  4JI8 T;  2PG8 A;  2WM9 A;  3AEB A;  1KF6 A;  3ZJ2 A;  3HKC E;  3LK2 B;  5KXJ A;  3MJX A;  2VUR A;  5HXE A;  3VU7 H;  2D5U A;  3R6N A;  2BG9 E;  4G63 A;  1B7T A;  4B3T T;  2AXD S;  3H3A A;  3WAK A;  2H7V C;  2C5K T;  4TUY E;  3ANW B;  3B13 A;  3R84 B;  4GK5 E;  2XAF B;  4G2A A;  4ZI3 C;  4JV5 T;  2IML A;  2YK0 A;  3AED A;  3P7I A;  3MA9 A;  2LM2 A;  4OYJ A;  3RLF F;  3TLT A;  3ZN0 B;  1WRD A;  3C4W A;  4NUU A;  5F3J A;  1IBK T;  5HEJ A;  1D0X A;  1ZHC A;  2A72 A;  3O1H A;  5LMN T;  4LF5 T;  2NW8 A;  3ZMZ B;  2W61 A;  3B57 A;  2CRB A;  4JEU B;  2MTQ A;  5DQV A;  2J47 A;  3N9L A;  5FMN A;  4X20 E;  3RIA A;  2D9D A;  1MMG A;  3NZQ A;  3NZP A;  4YSY A;  1Z0P A;  3UUB A;  5ETW A;  3AAA B;  4H9Q C;  3FBZ A;  2DL1 A;  3EDV A;  2V8S V;  3OYZ A;  3RRW A;  3E0Z A;  2D2S A;  4MFR A;  3AE1 A;  3QC9 A;  5JRE A;  3CML A;  2XQ7 A;  3O1I A;  4AKI A;  3K3N A;  3VKG A;  2UXX B;  1HFA A;  4KUM B;  2DHR A;  3K1S A;  3P4S A;  4QH5 A;  2WU5 A;  1GQE A;  2NWB A;  5AQP B;  2LKH A;  3A5X A;  4HWD A;  4YSX A;  4ZI2 D;  4B3S T;  3RYF E;  3KV9 A;  4XBF B;  3AEE A;  4NIQ A;  4GKJ T;  4DV6 T;  2E9X C;  1OED A;  4DV2 T;  2LHN A;  4I4T E;  5FXZ A;  5LGU B;  2LRL A;  1HNW T;  2XQ3 A;  1KNP A;  3ZJ1 A;  5EZY E;  2V26 A;  2L8K A;  2G0U A;  2M6B A;  3AXJ A;  3P8C D;  3SFD A;  3ZT5 A;  1J5W A;  3UTK A;  5L3D B;  1X9B A;  1HG2 A;  1YW0 A;  4PK6 A;  1W09 A;  3GA8 A;  3ETV A;  5FP3 A;  3RIU C;  4F8H A;  4GIW A;  5F5W A;  5ADX L;  4ZHQ E;  5LHH B;  4GOU A;  5HXH A;  1XNQ T;  2X9X A;  2YKS A;  5HAX A;  1N32 T;  5LHG B;  1FMW A;  2YDS A;  5J2U E;  4X66 T;  1MIV A;  1N34 T;  5BR8 T;  1D1B A;  3HI2 A;  4MHC A;  3T8O A;  5IUX A;  4KX6 A;  4UEM A;  3AE4 A;  2XHE B;  3QUJ A;  1FMV A;  2SPC A;  3OKQ A;  1FEW A;  4I0U A;  4OHF A;  2FBW A;  4HGA A;  3TLU A;  3NRX A;  1IJ5 A;  1BR0 A;  2KWH A;  2CWY A;  3PUA A;  2QA7 A;  4HFB A;  3Q9D A;  4DID B;  3HKD E;  5L47 A;  1H7C A;  2FJA A;  1WLX A;  2VB6 A;  4MLK A;  4CI1 B;  2JMK A;  3FZL B;  5JDG A;  2HHH T;  4HFE A;  4AIS A;  4DV3 T;  2RP4 A;  4DV1 T;  5HEO A;  3RIU A;  1SA0 E;  2JMH A;  4UIG A;  3QB5 K;  4JYA T;  4B6X A;  2HPJ A;  2PFV A;  4UVC B;  2IDO B;  2JQK A;  3VHL A;  4QXC B;  4ZEY A;  4JI3 T;  3N9Q A;  3PE0 A;  3AEC A;  5AQQ B;  5IHY A;  2BG9 C;  2DLR A;  3EDU A;  2BS3 A;  4F6R C;  1U5P A;  2V7J A;  2QRX A;  2LEH A;  2ODV A;  3KBU A;  4PJN A;  2LSG A;  4EAH A;  2A2F X;  4EZ4 A;  3UQ7 A;  1HR0 T;  4X64 T;  3ZC0 A;  4X5T A;  1JNR A;  2LSJ A;  3AE5 A;  3FB2 A;  2WMN A;  3JC6 D;  3HKE E;  3L3P A;  3LG7 A;  4IDZ A;  3HA4 A;  4DO0 A;  4X1I E;  4U74 A;  5LG4 A;  4X65 T;  4DR1 T;  4ILU A;  2XAJ B;  4HN9 A;  5JDM A;  3N9M A;  2LM9 A;  5LJM A;  4DV4 T;  2V7I A;  1YKE B;  2EHO B;  2WU2 A;  4OK0 A;  2CXF A;  1LKX A;  2WDQ A;  1AJ3 A;  2UXD T;  4X1Y E;  2FUP A;  3EHZ A;  2WDR A;  3ANW A;  3CKD A;  4HFV A;  4TNV A;  2IAK A;  3MK7 C;  3UFE A;  1NAF A;  4LF9 T;  3IA3 A;  3QK6 A;  4QXH B;  2A3D A;  4JLE A;  3AVS A;  4ERR A;  4H9N C;  2XQ9 A;  3K8P C;  5CGM A;  2XTL A;  4NUV A;  3PUQ A;  2IIU A;  2LSK A;  4U7I A;  2BDE A;  4DBR A;  4YY3 T;  3VR8 A;  3SWH A;  3L39 A;  1UUR A;  2WMO A;  4IHJ E;  3WAJ A;  3U78 A;  3ZLI A;  2I59 A;  5LOV E;  2E2A A;  1UGO A;  2LSY A;  2WZI A;  3CQG B;  4PAG A;  5FXW A;  3RX6 A;  5J0Z A;  4DR6 T;  1Z8U A;  3A8Y C;  4OFZ A;  5LGT B;  3CX7 B;  3V5S A;  3ZMU B;  3J9X 1;  2PJQ A;  1YQ4 A;  2LT3 A;  4DV5 T;  5JH7 E;  4JI7 T;  4ILB A;  4QKN A;  3D0T A;  3AB3 B;  5DJQ C;  2WQY A;  3RIF A;  2XM2 A;  2C5I T;  2YIN A;  3PUW F;  3ABV A;  4IL4 A;  1S94 A;  2V7K A;  4AKR B;  5HEG A;  2JQH A;  4LML A;  3X1D A;  4CQI A;  4WW0 A;  3B5M A;  3ZCI A;  5AQJ B;  2ZM6 T;  3SOL A;  2N2N A;  2P9B A;  2LKG A;  3KV5 A;  5ABE A;  5AQK B;  1KEY A;  3AXJ B;  2CPT A;  2KIN B;  3LSV A;  2J62 A;  5JDN A;  4ZI2 C;  5HCJ A;  4YTN A;  2MBG A;  3VRB A;  4P1N A;  3ZC1 A;  3T1Y T;  2VL8 A;  5AQO B;  2LRK A;  2VAS A;  5J2T E;  1E7P A;  4H63 H;  2PBI A;  4I50 E;  1R8I A;  5EK3 A;  5HEU A;  5LGN B;  2LSI A;  4NXN T;  3PUY F;  1ZP0 A;  4DR5 T;  3UUM A;  3UU6 A;  2CMR A;  4QHO A;  5FYM A;  2DCF A;  5L3F B;  1T8B A;  1HG5 A;  2NW7 A;  2X67 A;  2VQF T;  1W0A A;  3RH3 A;  2WSS V;  4PK5 A;  1EZ3 A;  3LJC A;  1HS7 A;  2ZM2 A;  3RQW A;  1Y01 A;  3OTO T;  2V1D B;  3IEE A;  3RHW A;  2J1D G;  3C4X A;  4E7S A;  2N9D A;  4DV0 T;  2BKN A;  3HL6 A;  3VKH A;  4BJN A;  1X79 A;  2VKJ A;  2XY8 B;  3UUX B;  4AXP A;  2CM0 A;  3ZMT B;  3ZKR A;  2FJE A;  3I9Y A;  3LFM A;  1XWM A;  3ZN1 B;  2QYW A;  5FXV A;  4CN1 A;  1U4Q A;  4L5G A;  1SHZ C;  2NR4 A;  2M67 A;  3VR9 A;  4DR3 T;  3CK6 A;  3N2O A;  4IDN A;  2E5L T;  4DR2 T;  3T1H T;  4MAL A;  3PV0 F;  2X0H A;  3QOF A;  4HWF A;  2VK9 A;  5IWA T;  4GKK T;  1MNE A;  2EHO A;  1HX8 A;  3KBT A;  4H9O C;  3SRZ A;  4EB6 E;  1D1A A;  4LMK A;  5LA6 E;  3GN5 A;  4Z90 A;  3PDY A;  3N9N A;  4I55 E;  4JI5 T;  4EYU A;  1LVK A;  2XAS B;  5H6Q B;  2ACZ A;  1KK7 A;  4ISS A;  1ZV4 X;  2V6X A;  3PUS A;  5FY0 A;  4LF7 T;  3UT5 E;  4YTM A;  2VKD A;  5JRC A;  4IE0 A;  1DU2 A;  3I0Q A;  1T72 A;  2B76 A;  4PJL A;  3RPU A;  5JQG E;  3QNU A;  2UXB T;  4IE5 A;  5HCM A;  2Y8D A;  3V5U A;  2W0G A;  4QWN B;  5LG3 A;  2XAG B;  5BMV E;  4L9I A;  5IYZ E;  3P50 A;  4DND A;  2XAH B;  2NP9 A;  4IE7 A;  4Z91 A;  4ADZ A;  4CI3 B;  2HPL A;  3ZST A;  4LF4 T;  3ETU A;  2KWI B;  3CX6 B;  5JR9 B;  3AEG A;  4IDQ A;  3AE6 A;  1IAP A;  2ES0 A;  2JPF A;  1VCT A;  3NBX X;  3RYI E;  1OED E;  2BG9 B;  2V7L A;  4DR4 T;  4XZC A;  2CBJ A;  2YEV C;  5FXX A;  2IW5 B;  2IHR 1;  1O3X A;  2XQY A;  4U3C A;  1UX4 A;  2NOX A;  2VL0 A;  3H37 A;  5FKY A;  2UUC T;  3ZYM A;  3NWI A;  5AQS B;  3F2E A;  4YHJ A;  2B1E A;  2V6Y B;  4LFB T;  2CA5 A;  2QGS A;  2MOZ A;  4O4L E;  1HTJ F;  2YDR A;  4EED A;  2H88 A;  3FZF B;  5L4E A;  4KHP T;  2V5C A;  2D0T A;  4P09 A;  3MKD A;  4PNI A;  5AQF B;  4U72 A;  1UX5 A;  3AAI A;  1UCU A;  1LRZ A;  3P4P A;  2V7M A;  3AEA A;  4GK0 E;  2XQ8 A;  4KP3 C;  4HFC A;  4BJM A;  2OLT A;  5C2T A;  4AKL A;  3K3Q C;  5LXT E;  2F4V T;  3C98 B;  2X68 A;  3PJA A;  5JDF A;  3ZT6 A;  4AQF C;  1OXZ A;  4EEB A;  5LCY A;  3RQU A;  4JEH B;  3UU3 A;  2E5V A;  5L3G B;  1NEK A;  1OED B;  3O1J A;  2XPK A;  1US7 B;  2JIW A;  3KDS E;  2BVM A;  3TLS A;  4JI1 T;  1N33 T;  5AQL B;  1SE7 A;  4ILA A;  1IZN B;  3ZCJ A;  5LJN A;  3O9X A;  1HNX T;  4WBN E;  5HXR A;  2DWG A;  2I0M A;  2LOS A;  2HH7 A;  2BS4 A;  4HFH A;  3AE3 A;  1KFY A;  3SS1 A;  3ONL C;  4M1P A;  3Q5D A;  2Y48 B;  1HCI A;  4QH1 A;  4WNK A;  5HXC A;  3ZYL A;  4Z8X A;  4EZH A;  3AE2 A;  2W66 A;  5GON E;  3HR0 A;  3FZM B;  3I1A A;  4IGU A;  4U31 A;  1NWM X;  5DAB A;  5FL0 A;  3AA0 B;  4CZZ B;  5FY1 A;  4HTE A;  1I94 T;  4ANJ A;  4YJ2 E;  3PUR A;  2YN6 A;  2CLY C;  3DP7 A;  4I43 B;  3UUL A;  3MAC A;  2GK9 A;  3PJA J;  3ZYK A;  2X0L B;  4ILC A;  2VVN A;  2LE8 A;  5FNV E;  1MMA A;  4IDP A;  3ESL A;  4HFD A;  2BKO A;  2CHO A;  2KZ7 B;  3JCF A;  3OPC A;  4H9P C;  3BQL A;  4PJM A;  3A7M A;  5HWY A;  2WAU A;  2Q9Q A;  3CPZ A;  3RC3 A;  4ZI3 D;  3IF8 B;  3PUV F;  4JI2 T;  4IST A;  4EGW A;  5CFB A;  5KMG P;  2HN1 A;  4C90 A;  1M62 A;  2XQ6 A;  4IIJ E;  1BR4 A;  4HE8 A;  4DMV A;  2LLY A;  1G8X A;  2W2U A;  2J4G A;  3CWZ B;  3N9P A;  3PUZ F;  4OYK A;  1LVF A;  2BKP A;  4UR9 A;  4EXT A;  1T7S A;  2KXP B;  2D0U A;  2KT9 A;  4IL9 A;  4YSZ A;  3AA6 B;  3OVU A;  5ABF A;  4B3M T;  2XSA A;  5AQV B;  2EHO C;  2KSR A;  2Y6X A;  1UK5 A;  5JTG A;  2BZB A;  4JI4 T;  2K3W A;  2E9X B;  3AE8 A;  3FXE B;  3KV6 A;  3CQC B;  4IRE A;  3DJB A;  5AQU B;  3N2G E;  4AQY T;  4JI6 T;  5LBQ B;  3EAB A;  4U2Z A;  3RKG A;  2RPA A;  3PUX F;  4OX9 T;  4C91 A;  3E08 A;  1OED C;  2ACX A;  3E22 E;  3JAF A;  4UXN B;  5TAO A;  1N36 T;  1KNZ A;  2C5J A;  3N2K E;  2Z6E A;  2X66 A;  3UQ4 A;  2VQE T;  2UUB T;  2AE9 A;  3BK9 A;  3UUN A;  3Q5X A;  1Y64 B;  3C64 A;  3EUH A;  1J1J A;  4WBO A;  2W4X A;  2XQA A;  2E9X D;  4MBQ A;  4QX8 B;  4TWF A;  4ZI7 E;  4ZZC A;  2LJL A;  3RYC E;  2RA1 A;  2A9U A;  4YTP A;  1ZEE A;  2V6Y A;  4ZS2 A;  2XM1 A;  3IHR A;  5CA0 E;  1YXR A;  2HN2 A;  2WY2 A;  3C4Z A;  4LMJ A;  3I0O A;  1G73 A;  2CE7 A;  1YD8 G;  2KMF A;  2XJ7 A;  2ZM0 A;  3KVA A;  5FVL A;  5FY7 A;  5ABH A;  2Q9Q B;  3PUG A;  1FJG T;  4HFI A;  4ASK A;  2FJB A;  1WYC A;  2K24 A;  1J5E T;  3Q5W A;  4CXW A;  2PTF A;  3DTO A;  3BQI A;  2W67 A;  2IC6 A;  5AQI B;  2BBJ A;  5AQG B;  4CXY A;  2XQ5 A;  4HKA A;  1S35 A;  4HWC A;  3IBP A;  2CBI A; 
#chains in the Genus database with same CATH homology
 3OJA A;  1MIW A;  4GYR A;  4EOZ B;  1D0Z A;  4O4H E;  4DMW A;  3I9W A;  4H63 V;  3NRY A;  4UV8 B;  4CXX A;  3F57 A;  2Q9Q C;  5JDH A;  1HF8 A;  2LHR A;  2W00 A;  2E9X A;  4AI6 A;  4GYS A;  1QSD A;  2X9W A;  4KMC A;  5AFU L;  2YU1 A;  1VRB A;  4DVD A;  2JRK A;  2CWO A;  2CXD A;  3TKL B;  3N5L A;  4TV8 E;  3GMI A;  4E7Z A;  2DNX A;  4AKH A;  1CUN A;  3CQX C;  5KDM C;  5L2L A;  3JC6 C;  4YFS A;  1YKH B;  1MIY A;  1VOM A;  4IE4 A;  5JRC B;  2XUE A;  4IE6 A;  2MYS A;  5F8P A;  4PFP A;  4AKG A;  3ZMV B;  4KBM B;  5HYA A;  2W62 A;  4TX5 A;  3GN5 B;  3HKB E;  3RYH E;  1QUU A;  2K5B B;  3CX8 B;  2DWK A;  3S4U A;  3KVB A;  5EK4 A;  2Q9Q D;  2L9Q A;  4L0R A;  4H9S E;  2VKO A;  4K0U A;  4ZOL E;  2YU2 A;  3KIN B;  4UV9 B;  3KV4 A;  4P0B A;  2X51 A;  2KND A;  1ZKE A;  4TV9 E;  5L3B B;  4X1K E;  3C51 A;  4EYY R;  2NTX A;  3GWH A;  1V9D A;  2K9A A;  1BR1 A;  2EHO D;  2ZM8 A;  2CCQ A;  2WBL A;  4O4J E;  5CA1 E;  5LBM A;  2BVL A;  2ZLY A;  3OYX A;  1FIO A;  3EVY A;  4YJ3 E;  2H3R A;  2N1G A;  2NTY A;  5DQW A;  1WYB A;  5JR9 A;  4O8S A;  3FHN A;  1MMD A;  3RKO A;  3RRC A;  5A1L A;  3L09 A;  4EIW A;  4O2B E;  4PJJ A;  4UEL A;  5HXS A;  1IJ6 A;  4UVA B;  3PU8 A;  5CB4 E;  4AQF A;  4UF0 B;  2OA5 A;  2JQQ A;  4QXB B;  5EK2 A;  1D1C A;  3BQK A;  2H7O A;  1T98 A;  2LOP A;  4UVB B;  4PW8 A;  2ZMA A;  4TZ4 C;  5HWX A;  2E8I A;  3K3O A;  5JVD E;  4DBQ A;  3RC8 A;  3F31 A;  3MZK B;  2WWU A;  4TN7 B;  4FJO A;  2DI4 A;  1OWA A;  4O2A E;  4PFO A;  3N9O A;  4QX7 B;  2IC9 A;  3O4X E;  4XAX B;  3ZEF B;  5E0O A;  1MMN A;  3FXD B;  4O4I E;  3WI3 A;  4CI2 B;  1BR2 A;  5J1G A;  5C8Y E;  3CVR A;  2CXL A;  3LK3 B;  5H6R B;  4V1A v;  4BA9 A;  3AA1 B;  2W63 A;  3OBV E;  2KLQ A;  2X9Y A;  5L3E B;  2X9H A;  5JDQ A;  4N78 D;  5JR9 C;  5JDL A;  2L3L A;  4J2C A;  3W15 B;  2UXN B;  2XAQ B;  1E1H B;  3AA7 B;  3MXZ A;  3LBX A;  3LBX B;  3ZPO A;  3Q2M A;  3M65 A;  4HEA A;  2CLY B;  5LHI B;  2CEA A;  4JUY A;  2JJ9 A;  3FBL A;  4UF0 A;  2NW9 A;  4A56 A;  4ZS3 A;  4H9R C;  4P0A A;  4YLH A;  3U3I A;  3AVR A;  3J7Y q;  2VWA A;  4PK4 A;  3LK4 2;  2VKH A;  3ONX A;  3PTR B;  2ODU A;  4BAY B;  4FI5 A;  5LP6 E;  3KFW X;  3AAE B;  5L3C B;  3ZMS B;  1WR6 A;  3C50 A;  3PU3 A;  5LYJ E;  2K48 A;  1D0Y A;  1MND A;  2C0S A;  4AQG A;  2PG8 A;  2WM9 A;  3ZJ2 A;  3HKC E;  3LK2 B;  3MJX A;  5HXE A;  3VU7 H;  2D5U A;  3R6N A;  4G63 A;  1B7T A;  3H3A A;  3WAK A;  2H7V C;  2C5K T;  4TUY E;  3ANW B;  3B13 A;  3R84 B;  4GK5 E;  2XAF B;  4G2A A;  4ZI3 C;  2YK0 A;  3P7I A;  3MA9 A;  4OYJ A;  5M4Y A;  5F3J A;  1WRD A;  3C4W A;  4NUU A;  1D0X A;  1ZHC A;  2A72 A;  3O1H A;  2NW8 A;  3ZMZ B;  2W61 A;  3B57 A;  4JEU B;  5FMN A;  2MTQ A;  5DQV A;  3N9L A;  4X20 E;  1MMG A;  3NZQ A;  3NZP A;  1Z0P A;  5ETW A;  3AAA B;  4H9Q C;  3FBZ A;  3EDV A;  3OYZ A;  3RRW A;  3E0Z A;  2D2S A;  4MFR A;  5JRE A;  3QC9 A;  3CML A;  3O1I A;  4AKI A;  3K3N A;  3VKG A;  2UXX B;  1HFA A;  4KUM B;  2DHR A;  2NWB A;  3A5X A;  4ZI2 D;  3RYF E;  3KV9 A;  4XBF B;  2E9X C;  2LHN A;  4I4T E;  5FXZ A;  5LGU B;  3ZJ1 A;  5EZY E;  2V26 A;  2L8K A;  2G0U A;  3P8C D;  3UTK A;  5L3D B;  1YW0 A;  1HG2 A;  4PK6 A;  3GA8 A;  3ETV A;  5FP3 A;  4GIW A;  5ADX L;  4ZHQ E;  5LHH B;  4GOU A;  5HXH A;  2X9X A;  5HAX A;  5LHG B;  1FMW A;  5J2U E;  1MIV A;  1D1B A;  3HI2 A;  4MHC A;  3T8O A;  4UEM A;  2XHE B;  3QUJ A;  1FMV A;  2SPC A;  3OKQ A;  1FEW A;  4OHF A;  4HGA A;  3NRX A;  1IJ5 A;  1BR0 A;  2KWH A;  2CWY A;  3PUA A;  2QA7 A;  3Q9D A;  3HKD E;  2VB6 A;  1H7C A;  1WLX A;  4MLK A;  4CI1 B;  2JMK A;  5JDG A;  2RP4 A;  1SA0 E;  2JMH A;  4UIG A;  4B6X A;  2HPJ A;  2PFV A;  4UVC B;  3VHL A;  4QXC B;  3N9Q A;  3PE0 A;  5IHY A;  2DLR A;  3EDU A;  4F6R C;  1U5P A;  2V7J A;  5LNK A;  2LEH A;  2ODV A;  3KBU A;  4PJN A;  2LSG A;  4EAH A;  2A2F X;  4EZ4 A;  3ZC0 A;  2LSJ A;  3JC6 D;  3FB2 A;  3L3P A;  2WMN A;  3LG7 A;  3HKE E;  4IDZ A;  4DO0 A;  3HA4 A;  4X1I E;  4U74 A;  5LG4 A;  4ILU A;  2XAJ B;  4HN9 A;  5JDM A;  3N9M A;  2LM9 A;  5LJM A;  2V7I A;  1YKE B;  2EHO B;  4OK0 A;  2CXF A;  1LKX A;  1AJ3 A;  4X1Y E;  4HFV A;  3ANW A;  3CKD A;  3UFE A;  2IAK A;  3MK7 C;  1NAF A;  4ERR A;  3QK6 A;  4QXH B;  2A3D A;  4JLE A;  3AVS A;  4H9N C;  3K8P C;  2XTL A;  4NUV A;  3PUQ A;  2LSK A;  4DBR A;  2BDE A;  3SWH A;  4IHJ E;  2WMO A;  3WAJ A;  3U78 A;  3ZLI A;  2I59 A;  5LOV E;  2LSY A;  4PAG A;  3CQG B;  5FXW A;  3RX6 A;  4OFZ A;  5LGT B;  3CX7 B;  3V5S A;  3ZMU B;  3J9X 1;  2PJQ A;  2LT3 A;  5JH7 E;  1S35 A;  3D0T A;  4QKN A;  3AB3 B;  5DJQ C;  4AKR B;  2C5I T;  2YIN A;  1S94 A;  2V7K A;  4CQI A;  4WW0 A;  3ZCI A;  3SOL A;  2N2N A;  2P9B A;  3KV5 A;  5JDN A;  2KIN B;  4ZI2 C;  2MBG A;  3ZC1 A;  2VAS A;  5J2T E;  4H63 H;  2PBI A;  4I50 E;  5EK3 A;  5LGN B;  2LSI A;  3UUM A;  2CMR A;  4QHO A;  5FYM A;  2DCF A;  5L3F B;  1HG5 A;  2NW7 A;  2X67 A;  3RH3 A;  2WSS V;  4PK5 A;  1EZ3 A;  3LJC A;  1HS7 A;  2ZM2 A;  2V1D B;  3IEE A;  4E7S A;  2J1D G;  3C4X A;  2N9D A;  3HL6 A;  3VKH A;  4BJN A;  1X79 A;  2VKJ A;  3UUX B;  4AXP A;  2CM0 A;  3ZMT B;  3LFM A;  3I9Y A;  3ZN1 B;  5FXV A;  1U4Q A;  4L5G A;  1SHZ C;  2M67 A;  3N2O A;  4MAL A;  2VK9 A;  1MNE A;  2EHO A;  1HX8 A;  3KBT A;  4H9O C;  3SRZ A;  4EB6 E;  1D1A A;  5LA6 E;  3GN5 A;  3PDY A;  3N9N A;  4I55 E;  4EYU A;  1LVK A;  2XAS B;  5H6Q B;  1KK7 A;  4ISS A;  1ZV4 X;  3PUS A;  5FY0 A;  3UT5 E;  2VKD A;  5JRC A;  4IE0 A;  3I0Q A;  4PJL A;  3RPU A;  5JQG E;  4IE5 A;  2Y8D A;  3V5U A;  2W0G A;  4QWN B;  2XAG B;  5BMV E;  4L9I A;  5IYZ E;  4DND A;  2XAH B;  2NP9 A;  4IE7 A;  4CI3 B;  4ADZ A;  2HPL A;  3ETU A;  2KWI B;  3CX6 B;  5JR9 B;  1IAP A;  2ES0 A;  2JPF A;  3NBX X;  3RYI E;  2V7L A;  4XZC A;  2YEV C;  5FXX A;  2IW5 B;  1O3X A;  2XQY A;  1UX4 A;  2NOX A;  3H37 A;  3ZYM A;  3F2E A;  4YHJ A;  2B1E A;  2CA5 A;  2QGS A;  2MOZ A;  4O4L E;  1HTJ F;  4PNI A;  2D0T A;  4P09 A;  3MKD A;  4U72 A;  1UX5 A;  3AAI A;  1UCU A;  1LRZ A;  2V7M A;  4GK0 E;  4KP3 C;  4BJM A;  4AKL A;  3K3Q C;  5LXT E;  3C98 B;  2X68 A;  5JDF A;  4AQF C;  1OXZ A;  5LCY A;  4JEH B;  5L3G B;  3O1J A;  1US7 B;  3KDS E;  2BVM A;  1IZN B;  3ZCJ A;  5LJN A;  3O9X A;  4WBN E;  5HXR A;  2DWG A;  2LOS A;  2HH7 A;  3SS1 A;  4C90 A;  4M1P A;  2Y48 B;  1HCI A;  4WNK A;  3ZYL A;  5HXC A;  4EZH A;  4Z8X A;  5GON E;  3HR0 A;  3I1A A;  4IGU A;  5DAB A;  1NWM X;  4CZZ B;  3AA0 B;  5FY1 A;  4HTE A;  4ANJ A;  4YJ2 E;  3PUR A;  3DP7 A;  2CLY C;  4I43 B;  3UUL A;  3MAC A;  2GK9 A;  3ZYK A;  2X0L B;  2LE8 A;  5FNV E;  1MMA A;  3ESL A;  5KX5 E;  4PJM A;  2KZ7 B;  3ZN0 B;  4H9P C;  3BQL A;  3RC3 A;  5HWY A;  2WAU A;  2Q9Q A;  3CPZ A;  4ZI3 D;  3IF8 B;  4IST A;  5KMG P;  4IIJ E;  1BR4 A;  4HE8 A;  4DMV A;  1G8X A;  3CWZ B;  3N9P A;  4OYK A;  1LVF A;  4EXT A;  2KXP B;  2D0U A;  2KT9 A;  3AA6 B;  2EHO C;  2Y6X A;  2BZB A;  2E9X B;  3FXE B;  3KV6 A;  3CQC B;  3DJB A;  3N2G E;  5LBQ B;  4C91 A;  3E08 A;  2ACX A;  3E22 E;  4UXN B;  5TAO A;  1KNZ A;  2C5J A;  3N2K E;  2Z6E A;  2X66 A;  3BK9 A;  3UUN A;  3Q5X A;  1Y64 B;  3C64 A;  3EUH A;  4WBO A;  2E9X D;  4MBQ A;  4QX8 B;  4ZI7 E;  2LJL A;  3RYC E;  2RA1 A;  1ZEE A;  4ZS2 A;  3IHR A;  5CA0 E;  3C4Z A;  3I0O A;  1G73 A;  2CE7 A;  1YD8 G;  2KMF A;  2ZM0 A;  3KVA A;  5FY7 A;  2Q9Q B;  3PUG A;  4ASK A;  1WYC A;  2K24 A;  3Q5W A;  4CXW A;  3DTO A;  3BQI A;  2IC6 A;  4CXY A;  4HKA A;  2VL8 A;  3IBP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...