1E1HB

Crystal structure of recombinant botulinum neurotoxin type a light chain, self-inhibiting zn endopeptidase.
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
165
structure length
164
Chain Sequence
EMSGLEVSFEELRTFGGHDAKFIDSLQENEFRLYYYNKFKDVASTLNKAKSIIGTTASLQYMKNVFKEKYLLSEDTSGKFSVDKLKFDKLYKMLTEIYTEDNFVNFFKVINRKTYLNFDKAVFRINIVPDENYTIKDGFNLKANLSTNFNGQNTEINSRNFTRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords BOTULINUM NEUROTOXIN TYPE A LIGHT CHAIN
publication title Crystal Structure of Clostridium Botulinum Neurotoxin Protease in a Product-Bound State: Evidence for Noncanonical Zinc Protease Activity
pubmed doi rcsb
source organism Clostridium botulinum
total genus 47
structure length 164
sequence length 165
chains with identical sequence D
ec nomenclature ec 3.4.24.69: Bontoxilysin.
pdb deposition date 2000-05-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.540 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 1e1hB01
4.10.1280.10 Few Secondary Structures Irregular Metalloproteases ("zincins"), catalytic domain fold Clostridium neurotoxins 1e1hB02
1E1HB 3K3QC
chains in the Genus database with same CATH superfamily
3RIFA 3AXJA 2WY2A 4ZI2D 5FXZA 1MMDA 3AE3A 3GMIA 3Q5DA 3AE4A 2E9XC 3NZQA 3E22E 4ZEYA 5HEUA 3NVOA 1Z0PA 5F3JA 4LF8T 2BG9E 2I0MA 4CN1A 3IHRA 3UU4A 5L3BB 2JPFA 4IDZA 4DO0A 3TLTA 5AQNB 3CQXC 3PUWF 3J9X1 2LHNA 5AQLB 4ZZCA 5J1GA 5LXTE 2DHRA 3FZHB 2X9WA 1HG2A 2XAHB 2CPTA 1CUNA 3RC3A 3WAJA 4K0KT 5JR9A 4DR6T 1G73A 4QXCB 4EEDA 5FXXA 4QH5A 1WFDA 2RA1A 2W62A 2BKPA 2NTXA 2XM2A 3WI3A 2KNDA 4HFIA 4JI0T 4LMLA 2AXDS 3KV5A 3O9XA 4NXNT 2H88A 3LJCA 5LHGB 4ZHQE 5HXRA 5EZYE 4AQYT 3IF8B 3UQ4A 2UUAT 3O1JA 3ZMZB 2V7KA 1FIOA 3ONXA 5CA0E 1W9RA 3I0QA 3N9MA 3P4RA 4HEAA 1I6ZA 3RI5A 3VHLA 5C2TA 3PUQA 3CK6A 2WDRA 1H7CA 2LE8A 2W0GA 2BS2A 2I59A 3QUJA 4B3MT 3FZMB 2DCFA 5LYJE 5LGUB 4CN4A 3NWIA 4DR4T 4U74A 4QH4A 2HN1A 4LF7T 2QA7A 3PUZF 3FZKB 2MYSA 2CWOA 3HKCE 3ZJ2A 3KFWX 2V7IA 5LMNT 4HFEA 3GN5B 3UFGA 3VKGA 4H9SE 3AE7A 2OLTA 3UU5A 2WB5A 4U33A 2JQ9A 2JMHA 3ZSSA 4X62T 1HF8A 1JNZA 1QSDA 1S35A 3E0ZA 4PNIA 4E7SA 4LMJA 2HH7A 4ADZA 3AXJB 2XQYA 2ZMAA 5L4EA 3GA8A 4L5GA 2V7JA 5A1LA 5AQVB 5L3FB 3SWHA 4LMKA 3K8PC 4QH1A 4JI8T 4YTNA 4JI2T 1IJ5A 4HTEA 5L47A 4TWDA 1CHUA 1KEYA 4EV6A 2CM0A 3B5MA 4IHJE 5LGTB 2XQ3A 4KP3C 2WAUA 2IDOB 4ZS2A 5HCJA 2VL8A 2AE9A 5JR9B 2C5IT 4FI5A 5AQGB 3LK42 2QYWA 4Z91A 2WWVA 5AQIB 4DBQA 4O2BE 1XZYA 3L8RA 4X64T 1D0ZA 4LFCT 1YQ3A 2OA5A 3ZKRA 4KHZF 4H9QC 4DV6T 5FXVA 3AE8A 2WMOA 4YLHA 2XY8B 5LOVE 1U5PA 4UXNB 3QB5A 2KINB 2YOEA 1UK5A 3BQIA 3ONJA 1O3XA 3PURA 4GYSA 4X66T 4LF4T 2CCQA 4B3RT 4MLKA 5L3GB 1WYBA 4CXXA 4X65T 4A97A 1YKHB 4ILCA 3DTOA 2K3WA 4U31A 2UUBT 1L0VA 3AEEA 5LB7B 1IZNB 2V8SV 2V5DA 5LJMA 4QXHB 1VRBA 1T98A 5E0OA 3MK7C 2WP9A 3L09A 3ZMVB 3D0TA 2WZIA 3N9QA 1ZOYA 4KX6A 5J2TE 2FJBA 5JDNA 3AVSA 2D2SA 3N9LA 4YTPA 2M6IA 4O4LE 3F2EA 3ZN1B 5LA6E 4WBOA 4GYRA 3ANWA 1MNDA 2XJ7A 2DWKA 5FY1A 1NENA 4A98A 1ZP0A 4TZ4C 5FMNA 1E7PA 2IC6A 3ETUA 1MMGA 4DIDB 4B3ST 2ZLYA 4K0UA 2BVLA 4JI1T 4GKJT 4O4IE 5FL0A 2WSSV 1WCRA 2JQHA 1XDOA 2H7VC 3HKEE 1QUUA 1N34T 4P0BA 3T8OA 4CXWA 4IL9A 4IIJE 3J7Yq 2LOPA 1OWAA 2EHOC 1HG5A 2FJAA 4WZXA 2CEAA 5L3EB 4XZCA 3P4WA 1HX8A 2PJQA 3KVBA 3F31A 2YK0A 2MPKA 3RIUC 3RHWA 2PBIA 4DUYT 2L8KA 4X1YE 2ACZA 5FKYA 1D1AA 3HKDE 2YINA 4YY3T 3DJBA 3FXDB 2CMRA 2BG9B 3UU8A 3RIAA 5JDMA 2H89A 4KUMB 3EDVA 3UFEA 2KMFA 2MAWA 3AEBA 1HX1B 1HNXT 4AQFC 2N9DA 4OHFA 4FJOA 2ODVA 4F6RC 4CQIA 4H9RC 4UELA 5DQVA 1SHZC 4UVAB 1NAFA 2JQKA 1NWMX 3PUGA 3TKLB 2VL0A 4L0RA 1WRDA 4DR1T 5LMUT 3PUXF 5LJNA 3RYHE 4HWCA 2PTFA 2YDRA 2LSYA 3O1IA 2X9HA 3SS1A 1OEDC 3RC8A 3EI0A 2W66A 4ZXLA 4XBFB 3H3MA 3N9NA 3V5UA 3LFMA 4MBQA 1LRZA 3VRAA 2CLYC 4B6XA 2DLRA 2MBGA 5ETWA 3MZKB 1Z8UA 2BDEA 3I0OA 4AIUA 3ZT7A 4JI4T 2IW5B 2UU9T 3ZN0B 1UUSA 5IYZE 1WYCA 3ANWB 2XQ4A 4OFZA 4JEUB 3IEEA 4U2YA 3PUSA 3ZT5A 3MA9A 3O4XE 5JDLA 2XSBA 5LG3A 2VKJA 4O8SA 3Q5EA 1LKXA 4EAHA 3NBXX 4X20E 4TV8E 3UUBA 3AA0B 2VVSA 1J5WA 3G06A 1M62A 3LDQB 2LRLA 2VASA 4JEHB 4TNWA 4PFPA 1WR6A 5BMVE 2QVAA 3F57A 4I50E 4ZI2C 1BR4A 2KT9A 2GK9A 2K24A 3N2GE 5AQRB 2LJLA 3RYIE 3AE6A 4X1KE 2YN6A 3C51A 3EDUA 3MXZA 2ZM0A 2X68A 4I4TE 3TLUA 2D0TA 1T72A 1LVKA 4UV8B 2W4XA 1DU2A 2NP9A 3UULA 2D9DA 2E5LT 4TN7B 2DI4A 1LVFA 3VR8A 2YKSA 2CE7A 2E5VA 4HFDA 2BS3A 2CA5A 2UXDT 4CN6A 3C4WA 2BBJA 2XSAA 3KBUA 2DNXA 3RKGA 4AKHA 5ABGA 2J4GA 4LF5T 2WCAA 3LSVA 1B7TA 4YT0A 4DV4T 1FMVA 1KNRA 3VKHA 2RPAA 5HWXA 2MOZA 4WBNE 4J2CA 4N78D 2E8IA 2NOXA 1YW0A 5AQOB 5CJ5A 3RH3A 4PK4A 4ZI3D 3K3OA 3UU3A 1S94A 1XWMA 1D0YA 4YFSA 2BKNA 4DV1T 5F8PA 1D0XA 4Z90A 4UEMA 4AISA 4AKIA 3ZMTB 4ZOLE 3ABVA 5HEHA 1I94T 4H9NC 4DBRA 1HR0T 3N2KE 2V26A 4M1PA 5JDQA 3RQWA 4IDOA 4V1Av 4COFA 3KV4A 2FBWA 1W0BA 5TAOA 5AQMB 5L3CB 2VKOA 3PV0F 2LSGA 2LSIA 2E9XA 3IBPA 3GWHA 3CKDA 5JVDE 4KBMB 4L9IA 5DQWA 3BK9A 3Q5XA 3Q5WA 2VB6A 3ZCJA 3L3PA 4JI3T 2NWBA 3ZYMA 4HFCA 5JDGA 2X0YA 4AI6A 3ONLC 5EK3A 2PG8A 2Q9QC 3OVUA 2K48A 5ADXL 4LFAT 3MACA 2DL1A 2Y8DA 5AQTB 4EB6E 3P4QA 2CRBA 4IDQA 5HXSA 3C4ZA 3AE2A 5JRCA 4JI5T 4PJJA 2K5BB 4GOUA 1R8IA 4TV9E 2Y6XA 1IBKT 3ZMSB 5J2UE 3P8CD 4U72A 4IE6A 2IAKA 2NR4A 2YU2A 3BQKA 5AQJB 3PJAA 5LHHB 4U7IA 4BAYB 2D5UA 2WWUA 5KXJA 5JDFA 3IA3A 3AEGA 4WNKA 3K3QC 4U3CA 4DR5T 3ZJ1A 2LM9A 5HXEA 3UTKA 5AFUL 2CBJA 1ZKEA 2JJ9A 4CXYA 4ANJA 4QKNA 3PUVF 2QRXA 3JAEA 4Q25A 4JYAT 5CFBA 4DUZT 4JI6T 2SPCA 3FB2A 4EYUA 2FUPA 1OXZA 1VCTA 3FHNA 3ZSTA 4IDPA 5CB4E 2W61A 3RKOA 1HNWT 5IUXA 4CZZB 2M67A 4E7ZA 3NRYA 3JC6C 2IIUA 4NIQA 4P1NA 4QX7B 2XAJB 3C98B 4ERRA 1MMAA 4IL4A 4I43B 3NRXA 2IMLA 4H9OC 2X67A 4YJ3E 1YKEB 2KZ7B 4DNDA 2ZM8A 3KBTA 3L39A 4ILAA 1SA0E 2FJEA 4O2AE 2E9XB 5H6RB 4ZS3A 1MNEA 4TNVA 3U3IA 1N36T 4B3TT 1UX5A 3HI2A 2YDQA 1KFYA 1HTJF 4GKKT 2Q9QA 2I6HA 5LNKA 3H3AA 3CX6B 3QK6A 2ZM2A 3TLVA 4UR9A 4UVBB 3PUAA 2UXCT 4DV7T 2X66A 3CQGB 2XQ6A 3AAEB 4QX8B 2PFVA 1BR2A 4LF9T 3C50A 2LT3A 3P50A 1YD8G 2HN2A 4U7YA 3N9OA 1UURA 1VOMA 3TLWA 3FBLA 4IGUA 2WM9A 3P7IA 2IUBA 5FP3A 4C90A 4BA9A 4JUYA 4DR3T 3TLSA 5L4HA 5KDMC 1OEDE 4DV2T 5M4YA 2A2FX 3AECA 3UU6A 2LOSA 1IBMT 2C5JA 4AKRB 2XM1A 5LGNB 4F8HA 4HKAA 3RPUA 5LBMA 4HFHA 2UXBT 3ZYKA 1IAPA 3OKQA 1MMNA 2HHHT 4EZ4A 1BR0A 2UXNB 2WU2A 2N2NA 2WQYA 4PFOA 3ETVA 4QHOA 3LBXA 5AQSB 4ILUA 2V6XA 4HWIB 5JR9C 2LM2A 1IBLT 3Q2MA 5FL1A 2V1DB 3CX8B 2BBHA 3ZPOA 3SOLA 1WR0A 3S4UA 3KVAA 4KI0F 1ZEEA 3ESLA 2VVNA 2XAQB 1HS7A 2D0UA 1MIWA 4PJLA 2XAGB 3ZCIA 1E1HB 4U2ZA 4WYVA 3P4SA 4LFBT 3VU7H 2CHNA 2VKHA 3KV9A 3ZT6A 4HWHA 4IDNA 3FBZA 2WS3A 5AQPB 2B76A 1MIVA 2OV9A 4I0UA 3X1DA 4ASKA 2LHRA 4MALA 3CWZB 1JNRA 3A8YC 1FJGT 2JRKA 2KLQA 4HGAA 3M65A 3AA7B 5HEGA 2V7MA 3T1YT 2CXFA 3UQ7A 3N2OA 5L2LA 2EHOA 3EUHA 2P9BA 2A9UA 2WZHA 5HWYA 3OYXA 5L3DB 3RQUA 2Q9QB 3RIUA 2J1DG 2V7LA 4P09A 1V9DA 4IREA 4GIWA 2E9XD 5LG4A 2UXXB 5CGMA 2B1EA 2J47A 3HA4A 2Z6EA 2W67A 5AQKB 4X5TA 5ABHA 4WW0A 1QLBA 4YHHT 2LEHA 4DR2T 1SE7A 4AQFA 3PTRB 3T1HT 4DR7T 4AKLA 2WDQA 3AE9A 3RGLA 4YSYA 1FEWA 2XQAA 3W15B 2C5KT 3JADA 5FYMA 3CQCB 3AEAA 3UUNA 2WMNA 2X9XA 3SFEA 2F4VT 4KMCA 5AQHB 5HXCA 3WAKA 5IHYA 1OEDA 1KK7A 1G8XA 2UUCT 2BG9C 3B13A 1HNZT 3LBXB 3AAAB 4ILBA 2MTQA 4PJMA 5JDHA 2LKGA 2VQFT 3EAMA 4O4HE 2XQ9A 4PJNA 2G0UA 3FZFB 4DMWA 3PE0A 2LLYA 3ZC1A 4HN9A 1Y64B 2J62A 3H37A 2JIWA 2K9AA 2XQ8A 2A3DA 3SFDA 4ZI3C 3QNUA 4G63A 1N32T 3AVRA 5C3JA 1BR1A 4NUVA 3VR9A 5EK4A 3QB5K 3HL6A 5AQFB 5AQUB 3I1AA 3UUMA 1U4QA 4EIWA 4C91A 2ODUA 5JTGA 2N1GA 2XQ7A 4AQGA 5ABFA 4YSZA 2XHEB 2NW7A 4TX5A 1AJ3A 3FZLB 3PUYF 1UX4A 1W09A 4OK0A 3OYZA 4PAGA 2EHOB 3R84B 3CPZA 2V6YA 3VRBA 2WU5A 4PW8A 4P0AA 2XASB 4PK5A 3CVRA 3HR0A 4QWNB 4YHJA 3ZC0A 2W2UA 3K3NA 4DMVA 5H6QB 5HAXA 4YTMA 4YXDA 4EXTA 3EHZA 3DP7A 2IC9A 4DV0T 4EEBA 2WBLA 2L3LA 2BVMA 3B57A 2IHR1 3AAIA 3OPCA 5FVLA 4QXBB 4IE0A 1M7KA 5LHIB 2X9YA 2X51A 3OJAA 2Q9QD 2YU1A 4HWFA 4OX9T 2V5CA 4HFVA 3LK2B 4CI1B 2XZEA 4EZHA 3KV6A 3JCFA 5FXWA 5BR8T 2LRKA 3E08A 4NPPA 4ISSA 4H9PC 4LF6T 3FXEB 2BG9A 2H7OA 4TWFA 1VCSA 3OBVE 3NZPA 2XAFB 2DWGA 4IT4A 3PU8A 1KNZA 2FJDA 4JBWF 1X9BA 3AE5A 3AEFA 1OEDB 1Y01A 2YDSA 1KF6A 2KWIB 3R6NA 2NW8A 5FY0A 3AB3B 5LP6E 4I55E 2ZM6T 2XTLA 3MJXA 4DV5T 1X79A 3LK3B 4X1IE 2BS4A 4UF0A 2BKOA 3RYCE 2HPJA 4MHCA 5EK2A 2CLYB 3PDYA 3RF1A 3RLFF 4OYJA 2NW9A 2RP4A 4TUYE 3EVYA 2KWHA 3C4XA 3PU3A 4BJMA 5HCMA 4AKGA 5C8YE 4UVCB 4UIGA 5JH7E 3C64A 1WLXA 4NUUA 3UT5E 4TWHA 1NEKA 4YSXA 2WDVA 4HFBA 4OYKA 2KXPB 5AQQB 3JC6D 4XAXB 1J1JA 4A56A 3RX6A 1T8BA 1XDPA 2YEVC 2CHOA 5F5WA 3KDSE 3LG7A 4DV3T 4JLEA 4EOZB 3AEDA 2C0SA 5ABFB 2CBIA 3CX7B 1FMWA 4ZI7E 3A5XA 2CXDA 2JMKA 2KSRA 2M6BA 4A5XA 1D1BA 4NXMT 2V6YB 3BQLA 5IWAT 4H63H 4O4JE 3ZYLA 1T7SA 5CA1E 4JV5T 3P4PA 4G2AA 3PJAJ 1UGOA 5JQGE 3AA1B 4DVDA 5JREA 2EHOD 2NTYA 4ISTA 2VK9A 1E2AA 2LKHA 1W0AA 4Z8XA 1YQ4A 3QC9A 5KMGP 1EZ3A 4MFRA 4CI2B 1XMOT 5JRCB 3JAFA 3N5LA 3CIRA 3ZMUB 5HYAA 5FNVE 1UCUA 2HPLA 5FY7A 5HEJA 5GONE 5LBQB 5DJQC 3UUXB 3O1HA 2XQ5A 2E2AA 3AE1A 3I9YA 4EGWA 5HXHA 1GQEA 1XNRT 4HE8A 2ACXA 2X0LB 2CWYA 3ZEFB 4H63V 2VQET 1YXRA 1ZHCA 3I9WA 4IE4A 2A72A 3K1SA 4BJNA 4YJ2E 3CMLA 1SUMB 4KHPT 4GK5E 1US7B 4IE5A 2LSJA 5DABA 1IJ6A 5KX5E 3QOFA 3RRCA 2LSKA 4JI7T 1XMQT 3SRZA 4HWDA 1XNQT 4PK6A 4UF0B 4CI3B 2VWAA 2Y48B 2VURA 2ES0A 3RYFE 3U78A 4ZZBA 3A7MA 3NKZA 1N33T 3RRWA 4IE7A 2CXLA 2X0HA 3M3ZB 1HFAA 2H3RA 2W63A 5HEOA 3V5SA 1J5ET 1HCIA 1ZV4X 4UV9B 5LCYA 1D1CA 3OTOT 2XPKA 3EABA 2XUEA 5ABEA 2W00A 4GK0E 2QGSA 3HKBE 4EYYR 3AA6B 2VKDA 5J0ZA 1KNPA 3GN5A 4AXPA 2R6GF 2L9QA 3KINB 3MKDA 3N9PA 2JQQA 1MIYA 3Q9DA 5FVKA 3ZLIA 2BZBA
chains in the Genus database with same CATH topology
3FXDB 2CMRA 5EK4A 3ZJ1A 2LM9A 5JDMA 3HL6A 5HXEA 3UTKA 5AFUL 4ZI2D 5FXZA 3UUMA 1MMDA 3I1AA 1U4QA 1ZKEA 2JJ9A 4KUMB 3GMIA 4CXYA 4EIWA 3EDVA 2E9XC 3NZQA 3E22E 3UFEA 4ANJA 4QKNA 2KMFA 4C91A 2ODUA 1Z0PA 2N1GA 5F3JA 4AQGA 4AQFC 2N9DA 2SPCA 3IHRA 4OHFA 2XHEB 2NW7A 2ODVA 4FJOA 3FB2A 4TX5A 4EYUA 2JPFA 4F6RC 4IDZA 1OXZA 4CQIA 5L3BB 1UX4A 4H9RC 1AJ3A 4DO0A 4UELA 5DQVA 4OK0A 1SHZC 3FHNA 3OYZA 4PAGA 4UVAB 1NAFA 2EHOB 3R84B 3CQXC 5CB4E 3CPZA 2W61A 3RKOA 4PW8A 4P0AA 2XASB 4PK5A 1NWMX 3CVRA 2M67A 3HR0A 3PUGA 2LHNA 4QWNB 3J9X1 4CZZB 4E7ZA 4YHJA 3TKLB 3ZC0A 5J1GA 3K3NA 3NRYA 4L0RA 5LXTE 3JC6C 1WRDA 2DHRA 2X9WA 4DMVA 5H6QB 1HG2A 5HAXA 2XAHB 4QX7B 2XAJB 1CUNA 3RC3A 3C98B 5LJNA 3RYHE 1MMAA 4ERRA 4EXTA 3WAJA 4I43B 3DP7A 2IC9A 3NRXA 2WBLA 4H9OC 2X67A 2LSYA 3O1IA 2L3LA 4YJ3E 2BVMA 5JR9A 3B57A 1G73A 1YKEB 2KZ7B 3AAIA 4DNDA 2X9HA 4QXBB 4IE0A 4QXCB 3SS1A 2ZM8A 3KBTA 3RC8A 5FXXA 2RA1A 5LHIB 1SA0E 2W62A 2X9YA 2X51A 2NTXA 4O2AE 3OJAA 2E9XB 5H6RB 2Q9QD 2YU1A 4ZS3A 1MNEA 3WI3A 2KNDA 3U3IA 4XBFB 4HFVA 3LK2B 3N9NA 3V5UA 3LFMA 4MBQA 1LRZA 4CI1B 3KV5A 1UX5A 2CLYC 3O9XA 3HI2A 4EZHA 3LJCA 4ZHQE 5LHGB 1HTJF 4B6XA 2DLRA 3KV6A 2MBGA 5HXRA 5ETWA 5EZYE 3MZKB 2Q9QA 5FXWA 5LNKA 3H3AA 3IF8B 3E08A 3CX6B 3QK6A 2ZM2A 2BDEA 3I0OA 4ISSA 3O1JA 4H9PC 4UVBB 3FXEB 2IW5B 3ZN0B 3PUAA 5IYZE 3ZMZB 1WYCA 2H7OA 2V7KA 1FIOA 3ANWB 3ONXA 5CA0E 3I0QA 4OFZA 4JEUB 3IEEA 3N9MA 2X66A 3PUSA 3CQGB 3AAEB 4QX8B 3MA9A 3NZPA 2PFVA 1BR2A 3OBVE 2XAFB 3O4XE 4HEAA 5JDLA 3C50A 2DWGA 2VKJA 3VHLA 4O8SA 3PUQA 2LT3A 3PU8A 1KNZA 1YD8G 1LKXA 1H7CA 2LE8A 4EAHA 3NBXX 3N9OA 2W0GA 2KWIB 3R6NA 1VOMA 4X20E 2NW8A 3FBLA 4TV8E 4IGUA 5FY0A 2I59A 3QUJA 2WM9A 3AB3B 3P7IA 3AA0B 4I55E 5LP6E 5FP3A 4C90A 2DCFA 2XTLA 3MJXA 5LYJE 5LGUB 4BA9A 1X79A 3LK3B 4JUYA 4X1IE 4UF0A 3RYCE 2HPJA 4MHCA 4U74A 5EK2A 5KDMC 2VASA 4JEHB 2QA7A 2CLYB 2A2FX 5M4YA 4PFPA 3PDYA 1WR6A 5BMVE 4OYJA 2MYSA 2NW9A 2CWOA 2RP4A 3HKCE 3F57A 3ZJ2A 2LOSA 4TUYE 4I50E 4ZI2C 2C5JA 3EVYA 2KWHA 3C4XA 4AKRB 3KFWX 2V7IA 1BR4A 3PU3A 4BJMA 2KT9A 4AKGA 5LGNB 2GK9A 2K24A 3N2GE 4HKAA 3RPUA 5LBMA 5C8YE 3GN5B 4UVCB 3VKGA 4H9SE 4UIGA 3ZYKA 5JH7E 1IAPA 3OKQA 3C64A 1MMNA 1WLXA 4EZ4A 1BR0A 2JMHA 2UXNB 2LJLA 1HF8A 3RYIE 1QSDA 4NUUA 1S35A 4X1KE 3E0ZA 2N2NA 4PNIA 3UT5E 4PFOA 3ETVA 4QHOA 4E7SA 3LBXA 3C51A 3EDUA 2HH7A 4ILUA 3MXZA 2ZM0A 5JR9C 4ADZA 2X68A 4OYKA 2KXPB 4I4TE 3JC6D 2D0TA 3Q2MA 2V1DB 2XQYA 1LVKA 2ZMAA 4XAXB 3GA8A 4L5GA 4UV8B 2V7JA 4A56A 3CX8B 3ZPOA 2NP9A 5A1LA 3RX6A 3SOLA 5L3FB 2YEVC 3SWHA 3S4UA 3KVAA 1ZEEA 3ESLA 3UULA 3KDSE 3LG7A 3K8PC 2XAQB 1HS7A 2D0UA 4TN7B 2DI4A 4JLEA 1MIWA 1LVFA 4EOZB 4PJLA 2XAGB 3ZCIA 2CE7A 2C0SA 3CX7B 1E1HB 1FMWA 4ZI7E 1IJ5A 4HTEA 3A5XA 2CXDA 2JMKA 2CA5A 3VU7H 1D1BA 2VKHA 3KV9A 3C4WA 3BQLA 3KBUA 3FBZA 2DNXA 2CM0A 4AKHA 1MIVA 4H63H 4IHJE 5LGTB 4O4JE 4KP3C 3ZYLA 2WAUA 4ASKA 2LHRA 4ZS2A 4MALA 3CWZB 5CA1E 1B7TA 2VL8A 1FMVA 2JRKA 4G2AA 5JR9B 2C5IT 3VKHA 5HWXA 5JQGE 3AA1B 4FI5A 2MOZA 3LK42 4DVDA 4WBNE 4J2CA 5JREA 2KLQA 2E8IA 4N78D 2EHOD 4HGAA 2NOXA 1YW0A 4DBQA 4O2BE 2NTYA 3M65A 4ISTA 2VK9A 1D0ZA 3AA7B 2V7MA 2OA5A 3RH3A 4PK4A 2CXFA 4Z8XA 4ZI3D 4H9QC 3QC9A 5KMGP 3K3OA 1EZ3A 3N2OA 5FXVA 2WMOA 4MFRA 1S94A 5L2LA 4YLHA 4CI2B 1D0YA 2EHOA 3EUHA 4YFSA 5JRCB 3N5LA 5LOVE 2P9BA 5F8PA 5HWYA 3OYXA 1U5PA 1D0XA 3ZMUB 4UXNB 4UEMA 5L3DB 2KINB 5HYAA 5FNVE 2Q9QB 4AKIA 3ZMTB 3BQIA 4ZOLE 1O3XA 1UCUA 2HPLA 3PURA 4GYSA 2J1DG 5FY7A 5GONE 5LBQB 5DJQC 2CCQA 3UUXB 4MLKA 2V7LA 3O1HA 5L3GB 4P09A 1V9DA 4GIWA 4H9NC 4DBRA 1WYBA 2E9XD 3I9YA 4CXXA 5LG4A 5HXHA 1YKHB 2UXXB 3N2KE 2V26A 4M1PA 5JDQA 4HE8A 2ACXA 2X0LB 2CWYA 2B1EA 3HA4A 4V1Av 2Z6EA 3DTOA 3ZEFB 4H63V 3KV4A 1ZHCA 1IZNB 3I9WA 5LJMA 5TAOA 4IE4A 2A72A 4BJNA 4YJ2E 5L3CB 3CMLA 2VKOA 1VRBA 4QXHB 2LSGA 2LSIA 4WW0A 2E9XA 3IBPA 2LEHA 1T98A 5E0OA 3GWHA 4GK5E 3CKDA 3MK7C 1US7B 4IE5A 5JVDE 2LSJA 5DABA 1IJ6A 4AQFA 5KX5E 4KBMB 3RRCA 3PTRB 4L9IA 3L09A 2LSKA 3ZMVB 3D0TA 4AKLA 3N9QA 5DQWA 3SRZA 5J2TE 5JDNA 3BK9A 3Q5XA 4PK6A 3Q5WA 2VB6A 4UF0B 4CI3B 3AVSA 2VWAA 3ZCJA 2D2SA 2Y48B 1FEWA 3L3PA 3N9LA 4O4LE 2ES0A 3RYFE 3F2EA 3W15B 3U78A 2C5KT 3ZN1B 2NWBA 3ZYMA 5LA6E 4WBOA 5FYMA 5JDGA 3CQCB 4GYRA 3ANWA 3RRWA 1MNDA 4AI6A 4IE7A 3UUNA 2CXLA 2DWKA 2WMNA 1HFAA 2X9XA 5FY1A 4KMCA 2H3RA 5EK3A 2PG8A 2W63A 2Q9QC 4TZ4C 5FMNA 5HXCA 3WAKA 2IC6A 2K48A 3V5SA 5IHYA 5ADXL 1KK7A 1G8XA 3MACA 1HCIA 1ZV4X 4UV9B 3ETUA 2Y8DA 5LCYA 1D1CA 1MMGA 4EB6E 3B13A 3LBXB 3AAAB 5HXSA 2XUEA 3C4ZA 2MTQA 4PJMA 2ZLYA 5JRCA 2W00A 4K0UA 5JDHA 2BVLA 4O4HE 4PJJA 4GK0E 2K5BB 4O4IE 4GOUA 4PJNA 2WSSV 4TV9E 2Y6XA 2G0UA 2QGSA 2H7VC 3HKEE 1QUUA 3ZMSB 4DMWA 3HKBE 4P0BA 4EYYR 3T8OA 4CXWA 5J2UE 3PE0A 4IIJE 3P8CD 3J7Yq 2LOPA 3AA6B 4U72A 4IE6A 3ZC1A 4HN9A 2IAKA 2VKDA 1Y64B 2YU2A 3H37A 1OWAA 2EHOC 3BQKA 1HG5A 3GN5A 2CEAA 2K9AA 4AXPA 2A3DA 5L3EB 4XZCA 5LHHB 4BAYB 1HX8A 2D5UA 4ZI3C 2WWUA 2PJQA 3KVBA 3F31A 2L9QA 2YK0A 5JDFA 4G63A 3KINB 3MKDA 3N9PA 2PBIA 2JQQA 1MIYA 2L8KA 3AVRA 4X1YE 3Q9DA 4WNKA 1BR1A 1D1AA 3ZLIA 3HKDE 2YINA 2BZBA 4NUVA 3K3QC 3DJBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E1H B;  3K3Q C; 
#chains in the Genus database with same CATH topology
 3RIF A;  3AXJ A;  2WY2 A;  4ZI2 D;  5FXZ A;  1MMD A;  3AE3 A;  3GMI A;  3Q5D A;  3AE4 A;  2E9X C;  3NZQ A;  3E22 E;  4ZEY A;  5HEU A;  3NVO A;  1Z0P A;  5F3J A;  4LF8 T;  2BG9 E;  2I0M A;  4CN1 A;  3IHR A;  3UU4 A;  5L3B B;  2JPF A;  4IDZ A;  4DO0 A;  3TLT A;  5AQN B;  3CQX C;  3PUW F;  3J9X 1;  2LHN A;  5AQL B;  4ZZC A;  5J1G A;  5LXT E;  2DHR A;  3FZH B;  2X9W A;  1HG2 A;  2XAH B;  2CPT A;  1CUN A;  3RC3 A;  3WAJ A;  4K0K T;  5JR9 A;  4DR6 T;  1G73 A;  4QXC B;  4EED A;  5FXX A;  4QH5 A;  1WFD A;  2RA1 A;  2W62 A;  2BKP A;  2NTX A;  2XM2 A;  3WI3 A;  2KND A;  4HFI A;  4JI0 T;  4LML A;  2AXD S;  3KV5 A;  3O9X A;  4NXN T;  2H88 A;  3LJC A;  5LHG B;  4ZHQ E;  5HXR A;  5EZY E;  4AQY T;  3IF8 B;  3UQ4 A;  2UUA T;  3O1J A;  3ZMZ B;  2V7K A;  1FIO A;  3ONX A;  5CA0 E;  1W9R A;  3I0Q A;  3N9M A;  3P4R A;  4HEA A;  1I6Z A;  3RI5 A;  3VHL A;  5C2T A;  3PUQ A;  3CK6 A;  2WDR A;  1H7C A;  2LE8 A;  2W0G A;  2BS2 A;  2I59 A;  3QUJ A;  4B3M T;  3FZM B;  2DCF A;  5LYJ E;  5LGU B;  4CN4 A;  3NWI A;  4DR4 T;  4U74 A;  4QH4 A;  2HN1 A;  4LF7 T;  2QA7 A;  3PUZ F;  3FZK B;  2MYS A;  2CWO A;  3HKC E;  3ZJ2 A;  3KFW X;  2V7I A;  5LMN T;  4HFE A;  3GN5 B;  3UFG A;  3VKG A;  4H9S E;  3AE7 A;  2OLT A;  3UU5 A;  2WB5 A;  4U33 A;  2JQ9 A;  2JMH A;  3ZSS A;  4X62 T;  1HF8 A;  1JNZ A;  1QSD A;  1S35 A;  3E0Z A;  4PNI A;  4E7S A;  4LMJ A;  2HH7 A;  4ADZ A;  3AXJ B;  2XQY A;  2ZMA A;  5L4E A;  3GA8 A;  4L5G A;  2V7J A;  5A1L A;  5AQV B;  5L3F B;  3SWH A;  4LMK A;  3K8P C;  4QH1 A;  4JI8 T;  4YTN A;  4JI2 T;  1IJ5 A;  4HTE A;  5L47 A;  4TWD A;  1CHU A;  1KEY A;  4EV6 A;  2CM0 A;  3B5M A;  4IHJ E;  5LGT B;  2XQ3 A;  4KP3 C;  2WAU A;  2IDO B;  4ZS2 A;  5HCJ A;  2VL8 A;  2AE9 A;  5JR9 B;  2C5I T;  4FI5 A;  5AQG B;  3LK4 2;  2QYW A;  4Z91 A;  2WWV A;  5AQI B;  4DBQ A;  4O2B E;  1XZY A;  3L8R A;  4X64 T;  1D0Z A;  4LFC T;  1YQ3 A;  2OA5 A;  3ZKR A;  4KHZ F;  4H9Q C;  4DV6 T;  5FXV A;  3AE8 A;  2WMO A;  4YLH A;  2XY8 B;  5LOV E;  1U5P A;  4UXN B;  3QB5 A;  2KIN B;  2YOE A;  1UK5 A;  3BQI A;  3ONJ A;  1O3X A;  3PUR A;  4GYS A;  4X66 T;  4LF4 T;  2CCQ A;  4B3R T;  4MLK A;  5L3G B;  1WYB A;  4CXX A;  4X65 T;  4A97 A;  1YKH B;  4ILC A;  3DTO A;  2K3W A;  4U31 A;  2UUB T;  1L0V A;  3AEE A;  5LB7 B;  1IZN B;  2V8S V;  2V5D A;  5LJM A;  4QXH B;  1VRB A;  1T98 A;  5E0O A;  3MK7 C;  2WP9 A;  3L09 A;  3ZMV B;  3D0T A;  2WZI A;  3N9Q A;  1ZOY A;  4KX6 A;  5J2T E;  2FJB A;  5JDN A;  3AVS A;  2D2S A;  3N9L A;  4YTP A;  2M6I A;  4O4L E;  3F2E A;  3ZN1 B;  5LA6 E;  4WBO A;  4GYR A;  3ANW A;  1MND A;  2XJ7 A;  2DWK A;  5FY1 A;  1NEN A;  4A98 A;  1ZP0 A;  4TZ4 C;  5FMN A;  1E7P A;  2IC6 A;  3ETU A;  1MMG A;  4DID B;  4B3S T;  2ZLY A;  4K0U A;  2BVL A;  4JI1 T;  4GKJ T;  4O4I E;  5FL0 A;  2WSS V;  1WCR A;  2JQH A;  1XDO A;  2H7V C;  3HKE E;  1QUU A;  1N34 T;  4P0B A;  3T8O A;  4CXW A;  4IL9 A;  4IIJ E;  3J7Y q;  2LOP A;  1OWA A;  2EHO C;  1HG5 A;  2FJA A;  4WZX A;  2CEA A;  5L3E B;  4XZC A;  3P4W A;  1HX8 A;  2PJQ A;  3KVB A;  3F31 A;  2YK0 A;  2MPK A;  3RIU C;  3RHW A;  2PBI A;  4DUY T;  2L8K A;  4X1Y E;  2ACZ A;  5FKY A;  1D1A A;  3HKD E;  2YIN A;  4YY3 T;  3DJB A;  3FXD B;  2CMR A;  2BG9 B;  3UU8 A;  3RIA A;  5JDM A;  2H89 A;  4KUM B;  3EDV A;  3UFE A;  2KMF A;  2MAW A;  3AEB A;  1HX1 B;  1HNX T;  4AQF C;  2N9D A;  4OHF A;  4FJO A;  2ODV A;  4F6R C;  4CQI A;  4H9R C;  4UEL A;  5DQV A;  1SHZ C;  4UVA B;  1NAF A;  2JQK A;  1NWM X;  3PUG A;  3TKL B;  2VL0 A;  4L0R A;  1WRD A;  4DR1 T;  5LMU T;  3PUX F;  5LJN A;  3RYH E;  4HWC A;  2PTF A;  2YDR A;  2LSY A;  3O1I A;  2X9H A;  3SS1 A;  1OED C;  3RC8 A;  3EI0 A;  2W66 A;  4ZXL A;  4XBF B;  3H3M A;  3N9N A;  3V5U A;  3LFM A;  4MBQ A;  1LRZ A;  3VRA A;  2CLY C;  4B6X A;  2DLR A;  2MBG A;  5ETW A;  3MZK B;  1Z8U A;  2BDE A;  3I0O A;  4AIU A;  3ZT7 A;  4JI4 T;  2IW5 B;  2UU9 T;  3ZN0 B;  1UUS A;  5IYZ E;  1WYC A;  3ANW B;  2XQ4 A;  4OFZ A;  4JEU B;  3IEE A;  4U2Y A;  3PUS A;  3ZT5 A;  3MA9 A;  3O4X E;  5JDL A;  2XSB A;  5LG3 A;  2VKJ A;  4O8S A;  3Q5E A;  1LKX A;  4EAH A;  3NBX X;  4X20 E;  4TV8 E;  3UUB A;  3AA0 B;  2VVS A;  1J5W A;  3G06 A;  1M62 A;  3LDQ B;  2LRL A;  2VAS A;  4JEH B;  4TNW A;  4PFP A;  1WR6 A;  5BMV E;  2QVA A;  3F57 A;  4I50 E;  4ZI2 C;  1BR4 A;  2KT9 A;  2GK9 A;  2K24 A;  3N2G E;  5AQR B;  2LJL A;  3RYI E;  3AE6 A;  4X1K E;  2YN6 A;  3C51 A;  3EDU A;  3MXZ A;  2ZM0 A;  2X68 A;  4I4T E;  3TLU A;  2D0T A;  1T72 A;  1LVK A;  4UV8 B;  2W4X A;  1DU2 A;  2NP9 A;  3UUL A;  2D9D A;  2E5L T;  4TN7 B;  2DI4 A;  1LVF A;  3VR8 A;  2YKS A;  2CE7 A;  2E5V A;  4HFD A;  2BS3 A;  2CA5 A;  2UXD T;  4CN6 A;  3C4W A;  2BBJ A;  2XSA A;  3KBU A;  2DNX A;  3RKG A;  4AKH A;  5ABG A;  2J4G A;  4LF5 T;  2WCA A;  3LSV A;  1B7T A;  4YT0 A;  4DV4 T;  1FMV A;  1KNR A;  3VKH A;  2RPA A;  5HWX A;  2MOZ A;  4WBN E;  4J2C A;  4N78 D;  2E8I A;  2NOX A;  1YW0 A;  5AQO B;  5CJ5 A;  3RH3 A;  4PK4 A;  4ZI3 D;  3K3O A;  3UU3 A;  1S94 A;  1XWM A;  1D0Y A;  4YFS A;  2BKN A;  4DV1 T;  5F8P A;  1D0X A;  4Z90 A;  4UEM A;  4AIS A;  4AKI A;  3ZMT B;  4ZOL E;  3ABV A;  5HEH A;  1I94 T;  4H9N C;  4DBR A;  1HR0 T;  3N2K E;  2V26 A;  4M1P A;  5JDQ A;  3RQW A;  4IDO A;  4V1A v;  4COF A;  3KV4 A;  2FBW A;  1W0B A;  5TAO A;  5AQM B;  5L3C B;  2VKO A;  3PV0 F;  2LSG A;  2LSI A;  2E9X A;  3IBP A;  3GWH A;  3CKD A;  5JVD E;  4KBM B;  4L9I A;  5DQW A;  3BK9 A;  3Q5X A;  3Q5W A;  2VB6 A;  3ZCJ A;  3L3P A;  4JI3 T;  2NWB A;  3ZYM A;  4HFC A;  5JDG A;  2X0Y A;  4AI6 A;  3ONL C;  5EK3 A;  2PG8 A;  2Q9Q C;  3OVU A;  2K48 A;  5ADX L;  4LFA T;  3MAC A;  2DL1 A;  2Y8D A;  5AQT B;  4EB6 E;  3P4Q A;  2CRB A;  4IDQ A;  5HXS A;  3C4Z A;  3AE2 A;  5JRC A;  4JI5 T;  4PJJ A;  2K5B B;  4GOU A;  1R8I A;  4TV9 E;  2Y6X A;  1IBK T;  3ZMS B;  5J2U E;  3P8C D;  4U72 A;  4IE6 A;  2IAK A;  2NR4 A;  2YU2 A;  3BQK A;  5AQJ B;  3PJA A;  5LHH B;  4U7I A;  4BAY B;  2D5U A;  2WWU A;  5KXJ A;  5JDF A;  3IA3 A;  3AEG A;  4WNK A;  3K3Q C;  4U3C A;  4DR5 T;  3ZJ1 A;  2LM9 A;  5HXE A;  3UTK A;  5AFU L;  2CBJ A;  1ZKE A;  2JJ9 A;  4CXY A;  4ANJ A;  4QKN A;  3PUV F;  2QRX A;  3JAE A;  4Q25 A;  4JYA T;  5CFB A;  4DUZ T;  4JI6 T;  2SPC A;  3FB2 A;  4EYU A;  2FUP A;  1OXZ A;  1VCT A;  3FHN A;  3ZST A;  4IDP A;  5CB4 E;  2W61 A;  3RKO A;  1HNW T;  5IUX A;  4CZZ B;  2M67 A;  4E7Z A;  3NRY A;  3JC6 C;  2IIU A;  4NIQ A;  4P1N A;  4QX7 B;  2XAJ B;  3C98 B;  4ERR A;  1MMA A;  4IL4 A;  4I43 B;  3NRX A;  2IML A;  4H9O C;  2X67 A;  4YJ3 E;  1YKE B;  2KZ7 B;  4DND A;  2ZM8 A;  3KBT A;  3L39 A;  4ILA A;  1SA0 E;  2FJE A;  4O2A E;  2E9X B;  5H6R B;  4ZS3 A;  1MNE A;  4TNV A;  3U3I A;  1N36 T;  4B3T T;  1UX5 A;  3HI2 A;  2YDQ A;  1KFY A;  1HTJ F;  4GKK T;  2Q9Q A;  2I6H A;  5LNK A;  3H3A A;  3CX6 B;  3QK6 A;  2ZM2 A;  3TLV A;  4UR9 A;  4UVB B;  3PUA A;  2UXC T;  4DV7 T;  2X66 A;  3CQG B;  2XQ6 A;  3AAE B;  4QX8 B;  2PFV A;  1BR2 A;  4LF9 T;  3C50 A;  2LT3 A;  3P50 A;  1YD8 G;  2HN2 A;  4U7Y A;  3N9O A;  1UUR A;  1VOM A;  3TLW A;  3FBL A;  4IGU A;  2WM9 A;  3P7I A;  2IUB A;  5FP3 A;  4C90 A;  4BA9 A;  4JUY A;  4DR3 T;  3TLS A;  5L4H A;  5KDM C;  1OED E;  4DV2 T;  5M4Y A;  2A2F X;  3AEC A;  3UU6 A;  2LOS A;  1IBM T;  2C5J A;  4AKR B;  2XM1 A;  5LGN B;  4F8H A;  4HKA A;  3RPU A;  5LBM A;  4HFH A;  2UXB T;  3ZYK A;  1IAP A;  3OKQ A;  1MMN A;  2HHH T;  4EZ4 A;  1BR0 A;  2UXN B;  2WU2 A;  2N2N A;  2WQY A;  4PFO A;  3ETV A;  4QHO A;  3LBX A;  5AQS B;  4ILU A;  2V6X A;  4HWI B;  5JR9 C;  2LM2 A;  1IBL T;  3Q2M A;  5FL1 A;  2V1D B;  3CX8 B;  2BBH A;  3ZPO A;  3SOL A;  1WR0 A;  3S4U A;  3KVA A;  4KI0 F;  1ZEE A;  3ESL A;  2VVN A;  2XAQ B;  1HS7 A;  2D0U A;  1MIW A;  4PJL A;  2XAG B;  3ZCI A;  1E1H B;  4U2Z A;  4WYV A;  3P4S A;  4LFB T;  3VU7 H;  2CHN A;  2VKH A;  3KV9 A;  3ZT6 A;  4HWH A;  4IDN A;  3FBZ A;  2WS3 A;  5AQP B;  2B76 A;  1MIV A;  2OV9 A;  4I0U A;  3X1D A;  4ASK A;  2LHR A;  4MAL A;  3CWZ B;  1JNR A;  3A8Y C;  1FJG T;  2JRK A;  2KLQ A;  4HGA A;  3M65 A;  3AA7 B;  5HEG A;  2V7M A;  3T1Y T;  2CXF A;  3UQ7 A;  3N2O A;  5L2L A;  2EHO A;  3EUH A;  2P9B A;  2A9U A;  2WZH A;  5HWY A;  3OYX A;  5L3D B;  3RQU A;  2Q9Q B;  3RIU A;  2J1D G;  2V7L A;  4P09 A;  1V9D A;  4IRE A;  4GIW A;  2E9X D;  5LG4 A;  2UXX B;  5CGM A;  2B1E A;  2J47 A;  3HA4 A;  2Z6E A;  2W67 A;  5AQK B;  4X5T A;  5ABH A;  4WW0 A;  1QLB A;  4YHH T;  2LEH A;  4DR2 T;  1SE7 A;  4AQF A;  3PTR B;  3T1H T;  4DR7 T;  4AKL A;  2WDQ A;  3AE9 A;  3RGL A;  4YSY A;  1FEW A;  2XQA A;  3W15 B;  2C5K T;  3JAD A;  5FYM A;  3CQC B;  3AEA A;  3UUN A;  2WMN A;  2X9X A;  3SFE A;  2F4V T;  4KMC A;  5AQH B;  5HXC A;  3WAK A;  5IHY A;  1OED A;  1KK7 A;  1G8X A;  2UUC T;  2BG9 C;  3B13 A;  1HNZ T;  3LBX B;  3AAA B;  4ILB A;  2MTQ A;  4PJM A;  5JDH A;  2LKG A;  2VQF T;  3EAM A;  4O4H E;  2XQ9 A;  4PJN A;  2G0U A;  3FZF B;  4DMW A;  3PE0 A;  2LLY A;  3ZC1 A;  4HN9 A;  1Y64 B;  2J62 A;  3H37 A;  2JIW A;  2K9A A;  2XQ8 A;  2A3D A;  3SFD A;  4ZI3 C;  3QNU A;  4G63 A;  1N32 T;  3AVR A;  5C3J A;  1BR1 A;  4NUV A;  3VR9 A;  5EK4 A;  3QB5 K;  3HL6 A;  5AQF B;  5AQU B;  3I1A A;  3UUM A;  1U4Q A;  4EIW A;  4C91 A;  2ODU A;  5JTG A;  2N1G A;  2XQ7 A;  4AQG A;  5ABF A;  4YSZ A;  2XHE B;  2NW7 A;  4TX5 A;  1AJ3 A;  3FZL B;  3PUY F;  1UX4 A;  1W09 A;  4OK0 A;  3OYZ A;  4PAG A;  2EHO B;  3R84 B;  3CPZ A;  2V6Y A;  3VRB A;  2WU5 A;  4PW8 A;  4P0A A;  2XAS B;  4PK5 A;  3CVR A;  3HR0 A;  4QWN B;  4YHJ A;  3ZC0 A;  2W2U A;  3K3N A;  4DMV A;  5H6Q B;  5HAX A;  4YTM A;  4YXD A;  4EXT A;  3EHZ A;  3DP7 A;  2IC9 A;  4DV0 T;  4EEB A;  2WBL A;  2L3L A;  2BVM A;  3B57 A;  2IHR 1;  3AAI A;  3OPC A;  5FVL A;  4QXB B;  4IE0 A;  1M7K A;  5LHI B;  2X9Y A;  2X51 A;  3OJA A;  2Q9Q D;  2YU1 A;  4HWF A;  4OX9 T;  2V5C A;  4HFV A;  3LK2 B;  4CI1 B;  2XZE A;  4EZH A;  3KV6 A;  3JCF A;  5FXW A;  5BR8 T;  2LRK A;  3E08 A;  4NPP A;  4ISS A;  4H9P C;  4LF6 T;  3FXE B;  2BG9 A;  2H7O A;  4TWF A;  1VCS A;  3OBV E;  3NZP A;  2XAF B;  2DWG A;  4IT4 A;  3PU8 A;  1KNZ A;  2FJD A;  4JBW F;  1X9B A;  3AE5 A;  3AEF A;  1OED B;  1Y01 A;  2YDS A;  1KF6 A;  2KWI B;  3R6N A;  2NW8 A;  5FY0 A;  3AB3 B;  5LP6 E;  4I55 E;  2ZM6 T;  2XTL A;  3MJX A;  4DV5 T;  1X79 A;  3LK3 B;  4X1I E;  2BS4 A;  4UF0 A;  2BKO A;  3RYC E;  2HPJ A;  4MHC A;  5EK2 A;  2CLY B;  3PDY A;  3RF1 A;  3RLF F;  4OYJ A;  2NW9 A;  2RP4 A;  4TUY E;  3EVY A;  2KWH A;  3C4X A;  3PU3 A;  4BJM A;  5HCM A;  4AKG A;  5C8Y E;  4UVC B;  4UIG A;  5JH7 E;  3C64 A;  1WLX A;  4NUU A;  3UT5 E;  4TWH A;  1NEK A;  4YSX A;  2WDV A;  4HFB A;  4OYK A;  2KXP B;  5AQQ B;  3JC6 D;  4XAX B;  1J1J A;  4A56 A;  3RX6 A;  1T8B A;  1XDP A;  2YEV C;  2CHO A;  5F5W A;  3KDS E;  3LG7 A;  4DV3 T;  4JLE A;  4EOZ B;  3AED A;  2C0S A;  5ABF B;  2CBI A;  3CX7 B;  1FMW A;  4ZI7 E;  3A5X A;  2CXD A;  2JMK A;  2KSR A;  2M6B A;  4A5X A;  1D1B A;  4NXM T;  2V6Y B;  3BQL A;  5IWA T;  4H63 H;  4O4J E;  3ZYL A;  1T7S A;  5CA1 E;  4JV5 T;  3P4P A;  4G2A A;  3PJA J;  1UGO A;  5JQG E;  3AA1 B;  4DVD A;  5JRE A;  2EHO D;  2NTY A;  4IST A;  2VK9 A;  1E2A A;  2LKH A;  1W0A A;  4Z8X A;  1YQ4 A;  3QC9 A;  5KMG P;  1EZ3 A;  4MFR A;  4CI2 B;  1XMO T;  5JRC B;  3JAF A;  3N5L A;  3CIR A;  3ZMU B;  5HYA A;  5FNV E;  1UCU A;  2HPL A;  5FY7 A;  5HEJ A;  5GON E;  5LBQ B;  5DJQ C;  3UUX B;  3O1H A;  2XQ5 A;  2E2A A;  3AE1 A;  3I9Y A;  4EGW A;  5HXH A;  1GQE A;  1XNR T;  4HE8 A;  2ACX A;  2X0L B;  2CWY A;  3ZEF B;  4H63 V;  2VQE T;  1YXR A;  1ZHC A;  3I9W A;  4IE4 A;  2A72 A;  3K1S A;  4BJN A;  4YJ2 E;  3CML A;  1SUM B;  4KHP T;  4GK5 E;  1US7 B;  4IE5 A;  2LSJ A;  5DAB A;  1IJ6 A;  5KX5 E;  3QOF A;  3RRC A;  2LSK A;  4JI7 T;  1XMQ T;  3SRZ A;  4HWD A;  1XNQ T;  4PK6 A;  4UF0 B;  4CI3 B;  2VWA A;  2Y48 B;  2VUR A;  2ES0 A;  3RYF E;  3U78 A;  4ZZB A;  3A7M A;  3NKZ A;  1N33 T;  3RRW A;  4IE7 A;  2CXL A;  2X0H A;  3M3Z B;  1HFA A;  2H3R A;  2W63 A;  5HEO A;  3V5S A;  1J5E T;  1HCI A;  1ZV4 X;  4UV9 B;  5LCY A;  1D1C A;  3OTO T;  2XPK A;  3EAB A;  2XUE A;  5ABE A;  2W00 A;  4GK0 E;  2QGS A;  3HKB E;  4EYY R;  3AA6 B;  2VKD A;  5J0Z A;  1KNP A;  3GN5 A;  4AXP A;  2R6G F;  2L9Q A;  3KIN B;  3MKD A;  3N9P A;  2JQQ A;  1MIY A;  3Q9D A;  5FVK A;  3ZLI A;  2BZB A; 
#chains in the Genus database with same CATH homology
 3FXD B;  2CMR A;  5EK4 A;  3ZJ1 A;  2LM9 A;  5JDM A;  3HL6 A;  5HXE A;  3UTK A;  5AFU L;  4ZI2 D;  5FXZ A;  3UUM A;  1MMD A;  3I1A A;  1U4Q A;  1ZKE A;  2JJ9 A;  4KUM B;  3GMI A;  4CXY A;  4EIW A;  3EDV A;  2E9X C;  3NZQ A;  3E22 E;  3UFE A;  4ANJ A;  4QKN A;  2KMF A;  4C91 A;  2ODU A;  1Z0P A;  2N1G A;  5F3J A;  4AQG A;  4AQF C;  2N9D A;  2SPC A;  3IHR A;  4OHF A;  2XHE B;  2NW7 A;  2ODV A;  4FJO A;  3FB2 A;  4TX5 A;  4EYU A;  2JPF A;  4F6R C;  4IDZ A;  1OXZ A;  4CQI A;  5L3B B;  1UX4 A;  4H9R C;  1AJ3 A;  4DO0 A;  4UEL A;  5DQV A;  4OK0 A;  1SHZ C;  3FHN A;  3OYZ A;  4PAG A;  4UVA B;  1NAF A;  2EHO B;  3R84 B;  3CQX C;  5CB4 E;  3CPZ A;  2W61 A;  3RKO A;  4PW8 A;  4P0A A;  2XAS B;  4PK5 A;  1NWM X;  3CVR A;  2M67 A;  3HR0 A;  3PUG A;  2LHN A;  4QWN B;  3J9X 1;  4CZZ B;  4E7Z A;  4YHJ A;  3TKL B;  3ZC0 A;  5J1G A;  3K3N A;  3NRY A;  4L0R A;  5LXT E;  3JC6 C;  1WRD A;  2DHR A;  2X9W A;  4DMV A;  5H6Q B;  1HG2 A;  5HAX A;  2XAH B;  4QX7 B;  2XAJ B;  1CUN A;  3RC3 A;  3C98 B;  5LJN A;  3RYH E;  1MMA A;  4ERR A;  4EXT A;  3WAJ A;  4I43 B;  3DP7 A;  2IC9 A;  3NRX A;  2WBL A;  4H9O C;  2X67 A;  2LSY A;  3O1I A;  2L3L A;  4YJ3 E;  2BVM A;  5JR9 A;  3B57 A;  1G73 A;  1YKE B;  2KZ7 B;  3AAI A;  4DND A;  2X9H A;  4QXB B;  4IE0 A;  4QXC B;  3SS1 A;  2ZM8 A;  3KBT A;  3RC8 A;  5FXX A;  2RA1 A;  5LHI B;  1SA0 E;  2W62 A;  2X9Y A;  2X51 A;  2NTX A;  4O2A E;  3OJA A;  2E9X B;  5H6R B;  2Q9Q D;  2YU1 A;  4ZS3 A;  1MNE A;  3WI3 A;  2KND A;  3U3I A;  4XBF B;  4HFV A;  3LK2 B;  3N9N A;  3V5U A;  3LFM A;  4MBQ A;  1LRZ A;  4CI1 B;  3KV5 A;  1UX5 A;  2CLY C;  3O9X A;  3HI2 A;  4EZH A;  3LJC A;  4ZHQ E;  5LHG B;  1HTJ F;  4B6X A;  2DLR A;  3KV6 A;  2MBG A;  5HXR A;  5ETW A;  5EZY E;  3MZK B;  2Q9Q A;  5FXW A;  5LNK A;  3H3A A;  3IF8 B;  3E08 A;  3CX6 B;  3QK6 A;  2ZM2 A;  2BDE A;  3I0O A;  4ISS A;  3O1J A;  4H9P C;  4UVB B;  3FXE B;  2IW5 B;  3ZN0 B;  3PUA A;  5IYZ E;  3ZMZ B;  1WYC A;  2H7O A;  2V7K A;  1FIO A;  3ANW B;  3ONX A;  5CA0 E;  3I0Q A;  4OFZ A;  4JEU B;  3IEE A;  3N9M A;  2X66 A;  3PUS A;  3CQG B;  3AAE B;  4QX8 B;  3MA9 A;  3NZP A;  2PFV A;  1BR2 A;  3OBV E;  2XAF B;  3O4X E;  4HEA A;  5JDL A;  3C50 A;  2DWG A;  2VKJ A;  3VHL A;  4O8S A;  3PUQ A;  2LT3 A;  3PU8 A;  1KNZ A;  1YD8 G;  1LKX A;  1H7C A;  2LE8 A;  4EAH A;  3NBX X;  3N9O A;  2W0G A;  2KWI B;  3R6N A;  1VOM A;  4X20 E;  2NW8 A;  3FBL A;  4TV8 E;  4IGU A;  5FY0 A;  2I59 A;  3QUJ A;  2WM9 A;  3AB3 B;  3P7I A;  3AA0 B;  4I55 E;  5LP6 E;  5FP3 A;  4C90 A;  2DCF A;  2XTL A;  3MJX A;  5LYJ E;  5LGU B;  4BA9 A;  1X79 A;  3LK3 B;  4JUY A;  4X1I E;  4UF0 A;  3RYC E;  2HPJ A;  4MHC A;  4U74 A;  5EK2 A;  5KDM C;  2VAS A;  4JEH B;  2QA7 A;  2CLY B;  2A2F X;  5M4Y A;  4PFP A;  3PDY A;  1WR6 A;  5BMV E;  4OYJ A;  2MYS A;  2NW9 A;  2CWO A;  2RP4 A;  3HKC E;  3F57 A;  3ZJ2 A;  2LOS A;  4TUY E;  4I50 E;  4ZI2 C;  2C5J A;  3EVY A;  2KWH A;  3C4X A;  4AKR B;  3KFW X;  2V7I A;  1BR4 A;  3PU3 A;  4BJM A;  2KT9 A;  4AKG A;  5LGN B;  2GK9 A;  2K24 A;  3N2G E;  4HKA A;  3RPU A;  5LBM A;  5C8Y E;  3GN5 B;  4UVC B;  3VKG A;  4H9S E;  4UIG A;  3ZYK A;  5JH7 E;  1IAP A;  3OKQ A;  3C64 A;  1MMN A;  1WLX A;  4EZ4 A;  1BR0 A;  2JMH A;  2UXN B;  2LJL A;  1HF8 A;  3RYI E;  1QSD A;  4NUU A;  1S35 A;  4X1K E;  3E0Z A;  2N2N A;  4PNI A;  3UT5 E;  4PFO A;  3ETV A;  4QHO A;  4E7S A;  3LBX A;  3C51 A;  3EDU A;  2HH7 A;  4ILU A;  3MXZ A;  2ZM0 A;  5JR9 C;  4ADZ A;  2X68 A;  4OYK A;  2KXP B;  4I4T E;  3JC6 D;  2D0T A;  3Q2M A;  2V1D B;  2XQY A;  1LVK A;  2ZMA A;  4XAX B;  3GA8 A;  4L5G A;  4UV8 B;  2V7J A;  4A56 A;  3CX8 B;  3ZPO A;  2NP9 A;  5A1L A;  3RX6 A;  3SOL A;  5L3F B;  2YEV C;  3SWH A;  3S4U A;  3KVA A;  1ZEE A;  3ESL A;  3UUL A;  3KDS E;  3LG7 A;  3K8P C;  2XAQ B;  1HS7 A;  2D0U A;  4TN7 B;  2DI4 A;  4JLE A;  1MIW A;  1LVF A;  4EOZ B;  4PJL A;  2XAG B;  3ZCI A;  2CE7 A;  2C0S A;  3CX7 B;  1E1H B;  1FMW A;  4ZI7 E;  1IJ5 A;  4HTE A;  3A5X A;  2CXD A;  2JMK A;  2CA5 A;  3VU7 H;  1D1B A;  2VKH A;  3KV9 A;  3C4W A;  3BQL A;  3KBU A;  3FBZ A;  2DNX A;  2CM0 A;  4AKH A;  1MIV A;  4H63 H;  4IHJ E;  5LGT B;  4O4J E;  4KP3 C;  3ZYL A;  2WAU A;  4ASK A;  2LHR A;  4ZS2 A;  4MAL A;  3CWZ B;  5CA1 E;  1B7T A;  2VL8 A;  1FMV A;  2JRK A;  4G2A A;  5JR9 B;  2C5I T;  3VKH A;  5HWX A;  5JQG E;  3AA1 B;  4FI5 A;  2MOZ A;  3LK4 2;  4DVD A;  4WBN E;  4J2C A;  5JRE A;  2KLQ A;  2E8I A;  4N78 D;  2EHO D;  4HGA A;  2NOX A;  1YW0 A;  4DBQ A;  4O2B E;  2NTY A;  3M65 A;  4IST A;  2VK9 A;  1D0Z A;  3AA7 B;  2V7M A;  2OA5 A;  3RH3 A;  4PK4 A;  2CXF A;  4Z8X A;  4ZI3 D;  4H9Q C;  3QC9 A;  5KMG P;  3K3O A;  1EZ3 A;  3N2O A;  5FXV A;  2WMO A;  4MFR A;  1S94 A;  5L2L A;  4YLH A;  4CI2 B;  1D0Y A;  2EHO A;  3EUH A;  4YFS A;  5JRC B;  3N5L A;  5LOV E;  2P9B A;  5F8P A;  5HWY A;  3OYX A;  1U5P A;  1D0X A;  3ZMU B;  4UXN B;  4UEM A;  5L3D B;  2KIN B;  5HYA A;  5FNV E;  2Q9Q B;  4AKI A;  3ZMT B;  3BQI A;  4ZOL E;  1O3X A;  1UCU A;  2HPL A;  3PUR A;  4GYS A;  2J1D G;  5FY7 A;  5GON E;  5LBQ B;  5DJQ C;  2CCQ A;  3UUX B;  4MLK A;  2V7L A;  3O1H A;  5L3G B;  4P09 A;  1V9D A;  4GIW A;  4H9N C;  4DBR A;  1WYB A;  2E9X D;  3I9Y A;  4CXX A;  5LG4 A;  5HXH A;  1YKH B;  2UXX B;  3N2K E;  2V26 A;  4M1P A;  5JDQ A;  4HE8 A;  2ACX A;  2X0L B;  2CWY A;  2B1E A;  3HA4 A;  4V1A v;  2Z6E A;  3DTO A;  3ZEF B;  4H63 V;  3KV4 A;  1ZHC A;  1IZN B;  3I9W A;  5LJM A;  5TAO A;  4IE4 A;  2A72 A;  4BJN A;  4YJ2 E;  5L3C B;  3CML A;  2VKO A;  1VRB A;  4QXH B;  2LSG A;  2LSI A;  4WW0 A;  2E9X A;  3IBP A;  2LEH A;  1T98 A;  5E0O A;  3GWH A;  4GK5 E;  3CKD A;  3MK7 C;  1US7 B;  4IE5 A;  5JVD E;  2LSJ A;  5DAB A;  1IJ6 A;  4AQF A;  5KX5 E;  4KBM B;  3RRC A;  3PTR B;  4L9I A;  3L09 A;  2LSK A;  3ZMV B;  3D0T A;  4AKL A;  3N9Q A;  5DQW A;  3SRZ A;  5J2T E;  5JDN A;  3BK9 A;  3Q5X A;  4PK6 A;  3Q5W A;  2VB6 A;  4UF0 B;  4CI3 B;  3AVS A;  2VWA A;  3ZCJ A;  2D2S A;  2Y48 B;  1FEW A;  3L3P A;  3N9L A;  4O4L E;  2ES0 A;  3RYF E;  3F2E A;  3W15 B;  3U78 A;  2C5K T;  3ZN1 B;  2NWB A;  3ZYM A;  5LA6 E;  4WBO A;  5FYM A;  5JDG A;  3CQC B;  4GYR A;  3ANW A;  3RRW A;  1MND A;  4AI6 A;  4IE7 A;  3UUN A;  2CXL A;  2DWK A;  2WMN A;  1HFA A;  2X9X A;  5FY1 A;  4KMC A;  2H3R A;  5EK3 A;  2PG8 A;  2W63 A;  2Q9Q C;  4TZ4 C;  5FMN A;  5HXC A;  3WAK A;  2IC6 A;  2K48 A;  3V5S A;  5IHY A;  5ADX L;  1KK7 A;  1G8X A;  3MAC A;  1HCI A;  1ZV4 X;  4UV9 B;  3ETU A;  2Y8D A;  5LCY A;  1D1C A;  1MMG A;  4EB6 E;  3B13 A;  3LBX B;  3AAA B;  5HXS A;  2XUE A;  3C4Z A;  2MTQ A;  4PJM A;  2ZLY A;  5JRC A;  2W00 A;  4K0U A;  5JDH A;  2BVL A;  4O4H E;  4PJJ A;  4GK0 E;  2K5B B;  4O4I E;  4GOU A;  4PJN A;  2WSS V;  4TV9 E;  2Y6X A;  2G0U A;  2QGS A;  2H7V C;  3HKE E;  1QUU A;  3ZMS B;  4DMW A;  3HKB E;  4P0B A;  4EYY R;  3T8O A;  4CXW A;  5J2U E;  3PE0 A;  4IIJ E;  3P8C D;  3J7Y q;  2LOP A;  3AA6 B;  4U72 A;  4IE6 A;  3ZC1 A;  4HN9 A;  2IAK A;  2VKD A;  1Y64 B;  2YU2 A;  3H37 A;  1OWA A;  2EHO C;  3BQK A;  1HG5 A;  3GN5 A;  2CEA A;  2K9A A;  4AXP A;  2A3D A;  5L3E B;  4XZC A;  5LHH B;  4BAY B;  1HX8 A;  2D5U A;  4ZI3 C;  2WWU A;  2PJQ A;  3KVB A;  3F31 A;  2L9Q A;  2YK0 A;  5JDF A;  4G63 A;  3KIN B;  3MKD A;  3N9P A;  2PBI A;  2JQQ A;  1MIY A;  2L8K A;  3AVR A;  4X1Y E;  3Q9D A;  4WNK A;  1BR1 A;  1D1A A;  3ZLI A;  3HKD E;  2YIN A;  2BZB A;  4NUV A;  3K3Q C;  3DJB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...