1E1HB

Crystal structure of recombinant botulinum neurotoxin type a light chain, self-inhibiting zn endopeptidase.
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
165
structure length
164
Chain Sequence
b'EMSGLEVSFEELRTFGGHDAKFIDSLQENEFRLYYYNKFKDVASTLNKAKSIIGTTASLQYMKNVFKEKYLLSEDTSGKFSVDKLKFDKLYKMLTEIYTEDNFVNFFKVINRKTYLNFDKAVFRINIVPDENYTIKDGFNLKANLSTNFNGQNTEINSRNFTRL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords BOTULINUM NEUROTOXIN TYPE A LIGHT CHAIN
publication title Crystal Structure of Clostridium Botulinum Neurotoxin Protease in a Product-Bound State: Evidence for Noncanonical Zinc Protease Activity
pubmed doi rcsb
source organism Clostridium botulinum
molecule tags Hydrolase
total genus 47
structure length 164
sequence length 165
chains with identical sequence D
ec nomenclature ec 3.4.24.69: Bontoxilysin.
pdb deposition date 2000-05-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.540 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 1e1hB01
4.10.1280.10 Few Secondary Structures Irregular Metalloproteases ("zincins"), catalytic domain fold Clostridium neurotoxins 1e1hB02
1E1HB 3K3QC
chains in the Genus database with same CATH superfamily
2XQYA 3CK6A 2XSAA 4DR5T 3RRCA 4EEDA 3DTOA 4YLHA 2FBWA 2YN6A 4QH5A 3F2EA 2UXDT 5F5WA 4DUYT 3AB3B 5AQVB 5L4HA 2LSYA 3FHNA 2DHRA 2ES0A 1W9RA 4KX6A 2MOZA 3N9MA 4B3ST 4TUYE 1WCRA 3LBXA 3P4QA 4ZI2D 2WP9A 4IDZA 3O4XE 4WZXA 2RPAA 2DL1A 3H3AA 3KV5A 2UUBT 2AE9A 2WZHA 2MYSA 2XQ8A 2CCQA 2XUEA 3P7IA 1D0ZA 5FYMA 4OYJA 1WRDA 3QUJA 3AA7B 4QKNA 2BKNA 2M67A 2CWYA 4JYAT 2H7VC 4UXNB 2V6YA 5L2LA 3U78A 4BA9A 3OYZA 4JEHB 3V5SA 1N32T 4LF7T 4QX7B 3Q5WA 4DR1T 2WDRA 3R6NA 2W4XA 4HFDA 5JDMA 5AQIB 2XAGB 4FJOA 2PTFA 3RF1A 4IIJE 3KV6A 2V6XA 4LF5T 3A8YC 4LFCT 5H6RB 4NUVA 1I6ZA 2D0UA 4ZI3D 3VKGA 4JI4T 3OVUA 2M6IA 5DQWA 2V6YB 2PBIA 3RQUA 4LF4T 4M1PA 2ODVA 3SRZA 4L9IA 3UUMA 2ACXA 3UU6A 4PAGA 5AQNB 2BBHA 3PJAA 3T8OA 3PU8A 5JDGA 2E5LT 4PW8A 1NWMX 4OHFA 2W66A 4DIDB 2H88A 5AQMB 5J2UE 2N1GA 4X5TA 4A56A 2XZEA 3J7Yq 4I50E 4ZOLE 1ZHCA 1HX1B 3AA1B 3LK2B 1M62A 2CXFA 2V7KA 4GKKT 4CQIA 2LM2A 3MK7C 3NBXX 1HR0T 3QK6A 5CA1E 2D9DA 3H37A 3AE5A 5LP6E 2XAJB 2QRXA 5IUXA 4KHPT 3FB2A 5HEOA 4YTMA 3V5UA 3SWHA 3EDUA 4CXYA 2YDRA 2V7JA 4B3MT 4DBQA 3ZYKA 4O2AE 3AAIA 5FXVA 2IUBA 2CM0A 4UV8B 2VKDA 4GK0E 2LHRA 3P4SA 2FJDA 4HFBA 1BR1A 1FIOA 1MMDA 5DABA 3P4WA 4NUUA 2YINA 4U31A 1KEYA 4QH1A 3TLWA 5ABGA 2LLYA 4ZZBA 3HKEE 4EOZB 3EABA 2H89A 5A1LA 1WYBA 1U5PA 3Q5DA 3ZCIA 3UFEA 1D1CA 5HEGA 4GKJT 3IEEA 2JIWA 5L3GB 3FXEB 2E5VA 2VURA 1KNPA 3UFGA 1VOMA 4DV7T 4ILCA 5LHGB 5M4YA 1QLBA 5IHYA 4IE5A 5FY0A 1OEDB 4DUZT 5HXSA 3ZN0B 4U72A 2J62A 4JI7T 3ZC1A 3G06A 3AE3A 2ZM2A 5CA0E 2XQ7A 2JJ9A 1NAFA 2CWOA 4YT0A 2L8KA 4LMJA 3K8PC 3O1JA 3B5MA 4CXXA 1W0AA 4AXPA 2R6GF 1UCUA 2CLYB 2N2NA 4DR3T 4HWDA 1UK5A 2XSBA 1KNRA 1UX4A 3UT5E 3N9QA 2BZBA 2VL8A 3CWZB 5AQPB 2X9YA 1IJ6A 5AQOB 1FJGT 3KV4A 3UUBA 2FJAA 4NXNT 2C5IT 3KV9A 2W2UA 1BR4A 2KXPB 2B76A 4IDQA 1VCSA 4TZ4C 3FZHB 5FNVE 3CQGB 3M3ZB 3EVYA 4Q25A 1YKEB 3NKZA 4JUYA 2HH7A 1U4QA 4EIWA 3RH3A 5LGTB 5FXXA 5FXWA 3TLVA 5LG3A 4IE4A 3JC6D 3AE2A 4DV5T 3S4UA 1X9BA 1L0VA 4O4JE 4OX9T 2LHNA 2CE7A 5C8YE 5E0OA 2WQYA 3PTRB 2VQET 4I0UA 4DV1T 2HN1A 3VRBA 3ZC0A 4O4IE 2K48A 3VKHA 1SA0E 3PUYF 5LHHB 1JNZA 5L3EB 2LKGA 4YJ3E 4DV2T 1UUSA 5BR8T 3N9LA 3O9XA 2CBJA 3TKLB 3ZEFB 3GA8A 3T1HT 3C98B 5CJ5A 5FY1A 4TWHA 3OBVE 2OLTA 4HN9A 4HEAA 3K3QC 3AE4A 2BVLA 2LEHA 4ASKA 2C5KT 2X0HA 3A5XA 2YU2A 3AEDA 2XAQB 5FVKA 1LVKA 2KWIB 3ETVA 4PJLA 5FMNA 3ZCJA 5LXTE 3I0QA 2VWAA 2MTQA 1D1AA 4IDNA 3EUHA 2ODUA 4K0KT 5LHIB 1YQ3A 5JR9C 1N34T 4HWCA 2ZM0A 5J1GA 3M65A 4DVDA 3OJAA 1ZP0A 4ZEYA 5ABFB 4K0UA 1B7TA 4UV9B 3QNUA 4YSXA 5GONE 2LT3A 2BG9E 4GOUA 2IC9A 4AI6A 3PV0F 1HCIA 2X67A 2CHNA 4ERRA 5LA6E 4Z8XA 3HI2A 3RKGA 2E9XC 4O4LE 2IW5B 4IL9A 3RIAA 5CGMA 3RIFA 1DU2A 3N9PA 3BK9A 3PJAJ 4DR4T 2D2SA 2E9XA 2X9HA 5EK2A 4WBOA 4UVAB 3AAAB 4WW0A 3AEFA 5AQRB 5J2TE 4DV0T 3RRWA 1HG2A 2UXBT 3EDVA 5JRCB 1UURA 3F57A 2CRBA 2JQHA 2UUAT 1H7CA 5LGNB 2LRLA 3KFWX 3ZMUB 5JDNA 3ANWB 3BQIA 1IBKT 2JQKA 1MIWA 5ADXL 5F8PA 4IT4A 4X1KE 4PNIA 4JI8T 2JMHA 2QVAA 3JCFA 3N2GE 2N9DA 4O4HE 2BG9C 4B3TT 1CUNA 1HG5A 4U7YA 2XQ3A 4EZHA 1E1HB 3P4RA 4DR6T 3Q5EA 5AQLB 5HEJA 4UF0B 2EHOD 5AQJB 2BG9A 4AIUA 5ABEA 1YW0A 4NPPA 2VKOA 5FXZA 4IE0A 4GK5E 1EZ3A 2AXDS 4TV9E 2QYWA 3IF8B 2XTLA 3ZJ1A 1XMOT 3W15B 2A3DA 3LG7A 3HKCE 3LSVA 4DV6T 5JREA 2C0SA 2WZIA 2V7LA 3AEBA 4ILBA 4UEMA 4A97A 1MIVA 3PUAA 5EK4A 4H9OC 2CBIA 2BG9B 1WLXA 3RYCE 3VR9A 4BAYB 2ZM6T 1VCTA 4FI5A 3ZPOA 2DCFA 2KNDA 3LBXB 2QA7A 5DJQC 5LG4A 2NP9A 3CMLA 2UXCT 3PUZF 4DR7T 1BR2A 2X9WA 3AE6A 4KP3C 3QB5K 3LJCA 4YXDA 3SFDA 4ZS2A 3RHWA 1ZKEA 3SS1A 3C4XA 2NW9A 1T8BA 2WU2A 1R8IA 3CQXC 4DO0A 1HTJF 4JI2T 4V1Av 5AFUL 2CA5A 4EYYR 3RIUC 4CI2B 3DP7A 4HWIB 4O2BE 4UIGA 2FJEA 3OTOT 2H7OA 3RIUA 3AE8A 4O8SA 3O1IA 3IHRA 1GQEA 4ISTA 4TNVA 4AQYT 4P0AA 4G63A 2CXDA 4IDPA 4YSZA 2H3RA 4LF6T 3RYFE 4QWNB 2Q9QC 2ZMAA 1NEKA 3OYXA 3ABVA 4IE6A 4ZI7E 2UXNB 2CHOA 2Q9QA 5HWYA 3UU3A 4DV4T 2A2FX 2VQFT 3UUNA 3K3NA 3UUXB 3VHLA 1YKHB 2LE8A 2A72A 2YOEA 2LSIA 1IAPA 3FBLA 3HR0A 3OPCA 3L8RA 2VK9A 2BS3A 2J1DG 3VR8A 4L0RA 4JI5T 2VB6A 4TX5A 2SPCA 4CXWA 3ZN1B 3MA9A 1BR0A 3F31A 3PUGA 4ANJA 3RX6A 4AKHA 2G0UA 2NTXA 3Q5XA 4KBMB 3A7MA 5L47A 3DJBA 5IWAT 2L9QA 2MAWA 3SFEA 4U3CA 1X79A 3PUSA 3RYHE 2WWVA 3GN5A 1T72A 4EB6E 2LOSA 3QB5A 4JI0T 2OA5A 4H63H 4HGAA 3AEEA 2CMRA 3C51A 3R84B 3E0ZA 3AE7A 5AQFB 5HCMA 1IBMT 2IIUA 2LM9A 2KLQA 5L3DB 2E8IA 3WAJA 5LGUB 3O1HA 4XAXB 5J0ZA 5LNKA 2KWHA 2VL0A 2Y48B 2M6BA 3L39A 5HEUA 4KHZF 3C4ZA 2CEAA 2X0LB 3GN5B 4OFZA 5KXJA 3QC9A 4GYSA 2Z6EA 3IA3A 4HFVA 4U33A 3AEAA 4U2YA 5LOVE 3C50A 4YTPA 1XDOA 3FZLB 2WWUA 4U74A 1Z0PA 2BVMA 4QH4A 2PJQA 3GWHA 3FZKB 5KMGP 2EHOC 3NWIA 5HYAA 4MLKA 4DR2T 2YEVC 2EHOA 2Y6XA 5EZYE 3OKQA 2XM2A 4ZI2C 5JQGE 4CN1A 3AE9A 1FEWA 3H3MA 2I59A 2J4GA 1J1JA 3ZSTA 4HFCA 2XY8B 2MBGA 5BMVE 3ONLC 2BS2A 4X62T 2W61A 3FZMB 2WB5A 3ZT6A 1LKXA 2YDSA 5JVDE 1MIYA 4AISA 3MKDA 4H63V 4AQGA 2YDQA 2J47A 1AJ3A 4DMVA 1ZV4X 3LDQB 4DBRA 2E2AA 1WYCA 1NENA 3KVBA 3UTKA 5HWXA 4HKAA 4AKLA 4HWHA 4EEBA 4PK5A 3ZMZB 4IGUA 2V1DB 2K3WA 3PUWF 5EK3A 1FMVA 4ZXLA 2BS4A 4ZI3C 2PFVA 3L09A 1KK7A 3N2KE 4PK6A 1T98A 3LK42 5HXRA 2JQ9A 4X64T 3UQ4A 5JR9A 2IDOB 3KBUA 4E7SA 2DNXA 2JMKA 5HXCA 1FMWA 2KMFA 3P50A 4ISSA 5FY7A 2BKOA 2V8SV 3X1DA 3RKOA 5F3JA 1O3XA 3KDSE 4H9SE 4UELA 4AKIA 5AQUB 3AAEB 5AQGB 3N5LA 4LF8T 5JR9B 1I94T 4P1NA 4F8HA 3RI5A 3MACA 3GMIA 3KINB 2XHEB 4IE7A 4DMWA 2I0MA 1ZOYA 4X66T 2X51A 1Z8UA 1T7SA 3P4PA 3ZT7A 5HEHA 2W67A 1S35A 2NWBA 4TV8E 3JAEA 3RGLA 3U3IA 3AE1A 2W63A 4JI3T 2LSKA 2W0GA 2VKHA 4J2CA 4QXCB 3RYIE 3CQCB 1KFYA 2E9XB 2WBLA 3FZFB 4P09A 1D0YA 4WNKA 1US7B 4YTNA 5LMNT 2PG8A 4HTEA 2ZM8A 5LBMA 4EAHA 2W00A 3B57A 1G73A 4IHJE 3ZMSB 3JAFA 4G2AA 3TLUA 5LCYA 3KVAA 2LSJA 4WBNE 4QXHB 4PFPA 3I0OA 3ZSSA 3FBZA 1M7KA 2WMNA 2LKHA 5FL1A 3RC8A 4CN4A 4DV3T 1HF8A 3PURA 3BQLA 3UQ7A 1WR6A 4EZ4A 4X65T 2V26A 3C4WA 1QUUA 2V7MA 1HNZT 3P8CD 2VVNA 3ONJA 1XNRT 1HNXT 4IDOA 5C3JA 4H9RC 5ETWA 4WYVA 3VU7H 2BKPA 4UVCB 2XAHB 3EAMA 3CVRA 1KF6A 4LMLA 5KDMC 4HFHA 4MFRA 4H9NC 5KX5E 1E7PA 4H9PC 1YQ4A 3K1SA 2LSGA 2IHR1 5JDLA 3CIRA 4XZCA 4PFOA 1HS7A 4TWFA 3I1AA 3C64A 3AA0B 2P9BA 4LFBT 2V7IA 2WDQA 4OYKA 3JC6C 2CPTA 5L3FB 4QXBB 3PU3A 1LVFA 5JDQA 2JQQA 5L3CB 4HFIA 4PJMA 4X1YE 4BJNA 1OEDE 5FL0A 4C90A 4YHJA 3ZMVB 3PUQA 4LF9T 1YXRA 1MMNA 3RC3A 3SOLA 4AKGA 2OV9A 2KT9A 2MPKA 3EI0A 4QX8B 2KINB 1CHUA 1W09A 2WAUA 5LB7B 1S94A 2XQ9A 5L4EA 2E9XD 4B6XA 4YY3T 5FKYA 1N36T 3MJXA 3IBPA 2V5DA 2ZLYA 4GYRA 3K3OA 5DQVA 4E7ZA 1D0XA 3L3PA 3MXZA 4CZZB 3AEGA 2VKJA 1WFDA 3T1YT 2K24A 1UGOA 1OXZA 4YJ2E 3CPZA 4Z90A 3NVOA 3N9NA 4A98A 2ACZA 1OEDC 2NR4A 3FXDB 4KUMB 2K9AA 3UU5A 4YSYA 2GK9A 5IYZE 5JTGA 3ETUA 2Y8DA 2XQ5A 2XQ4A 1Y01A 1OEDA 3UU4A 4B3RT 2WY2A 2X66A 5CB4E 1W0BA 3EHZA 2WDVA 2Q9QB 3ZKRA 2B1EA 4IREA 2X0YA 5FP3A 3TLTA 4ADZA 4JBWF 2IMLA 2JRKA 4UVBB 4X1IE 4U2ZA 2CLYC 1SHZC 3CKDA 3CX7B 3ZYLA 1E2AA 4EXTA 3WAKA 2WS3A 2RP4A 3HA4A 3ZLIA 1XNQT 2L3LA 2KSRA 3AA6B 2WU5A 4MALA 3AXJA 2I6HA 5LMUT 5JDFA 3D0TA 5HXHA 3PE0A 2W62A 4YHHT 5LYJE 3ZMTB 4ZHQE 2KZ7B 2YKSA 1IZNB 2DI4A 2VVSA 2WCAA 3AVRA 2NW7A 5HCJA 2UU9T 2LJLA 2YU1A 4ILAA 4COFA 3RLFF 3NRXA 4L5GA 3AXJB 3CX8B 2V5CA 5LBQB 3N9OA 4LMKA 1UX5A 4CI3B 5LJMA 3MZKB 2RA1A 4HWFA 4QHOA 1SUMB 3AVSA 1VRBA 5H6QB 4X20E 3HKBE 2NW8A 2HHHT 4MHCA 3PDYA 3NZPA 4PJNA 5LJNA 4EYUA 3AECA 3PUVF 4ZS3A 1IBLT 1ZEEA 2FUPA 2CXLA 3KBTA 1D1BA 4P0BA 2X68A 4YFSA 1XMQT 2F4VT 4HFEA 3LK3B 4GIWA 1MMAA 2X9XA 4TWDA 4LFAT 2HPLA 2FJBA 4AQFC 3VRAA 2LOPA 4BJMA 5AQSB 4NXMT 1JNRA 3JADA 4AQFA 2XM1A 3I9YA 4N78D 3CX6B 2IAKA 3I9WA 5ABHA 5HAXA 2NTYA 3ZT5A 4PK4A 4C91A 3HL6A 3RPUA 4F6RC 4AKRB 2EHOB 1XWMA 3QOFA 4TN7B 1MMGA 1KNZA 4CN6A 2K5BB 2DWKA 2XQ6A 2YK0A 3NZQA 2C5JA 1IJ5A 2BDEA 2Q9QD 1QSDA 3ZYMA 4ILUA 1MNEA 4H9QC 3LFMA 1SE7A 2WM9A 3ESLA 3UU8A 2DWGA 4A5XA 4UR9A 3E08A 4JLEA 2XPKA 3TLSA 4EGWA 4KI0F 4CI1B 4NIQA 4I43B 1HFAA 5ABFA 1J5ET 2HN2A 2LRKA 5JH7E 5AQTB 1HX8A 3NRYA 3ZJ2A 5JDHA 3Q2MA 3PUXF 1WR0A 5AQHB 2VASA 4ZZCA 5HXEA 2DLRA 2NOXA 3ONXA 4U7IA 2UXXB 4I4TE 3N2OA 5AQKB 4EV6A 3Q9DA 2XJ7A 3UULA 4IL4A 2A9UA 4KMCA 3E22E 3J9X1 3BQKA 3HKDE 5FVLA 4DNDA 4JI1T 1HNWT 4JI6T 2XQAA 5JRCA 1XZYA 2D0TA 2JPFA 1MNDA 1J5WA 1G8XA 2D5UA 5TAOA 4HE8A 5AQQB 2WSSV 4JEUB 4JV5T 4I55E 3ANWA 1Y64B 4TNWA 3RQWA 2WMOA 2XASB 1N33T 2XAFB 1V9DA 4XBFB 2HPJA 2QGSA 1YD8G 1OWAA 5C2TA 4PJJA 2IC6A 4UF0A 1LRZA 2UUCT 4OK0A 4Z91A 4MBQA 2BBJA 1XDPA 5CFBA 3B13A 5L3BB 3WI3A
chains in the Genus database with same CATH topology
3GN5A 2LOSA 2XQYA 1LVFA 5JDQA 2OA5A 4H63H 2JQQA 4HGAA 3N9LA 5L3CB 3O9XA 4PJMA 3TKLB 2CMRA 3RRCA 4X1YE 3DTOA 4YLHA 3C51A 3GA8A 3R84B 4BJNA 3E0ZA 3ZEFB 3C98B 4C90A 4YHJA 3F2EA 5FY1A 3OBVE 4HN9A 2LM9A 2KLQA 4HEAA 3K3QC 5L3DB 2E8IA 3WAJA 5LGUB 2BVLA 3O1HA 3AB3B 3ZMVB 4XAXB 3PUQA 2LEHA 5LNKA 4ASKA 2C5KT 2KWHA 1MMNA 3A5XA 2Y48B 2LSYA 2YU2A 2XAQB 3FHNA 2DHRA 3RC3A 1LVKA 2ES0A 2KWIB 3ETVA 3SOLA 4PJLA 4AKGA 5FMNA 3ZCJA 2KT9A 3C4ZA 2CEAA 2MOZA 2X0LB 3N9MA 4QX8B 5LXTE 2KINB 4TUYE 3I0QA 3GN5B 2WAUA 2VWAA 2MTQA 1S94A 1D1AA 2E9XD 3EUHA 2ODUA 4OFZA 4B6XA 5LHIB 3LBXA 5JR9C 4ZI2D 3QC9A 4GYSA 4IDZA 2Z6EA 3O4XE 4HFVA 2ZM0A 3H3AA 3MJXA 5J1GA 3KV5A 3IBPA 3M65A 5LOVE 3C50A 2ZLYA 4GYRA 3K3OA 5DQVA 2MYSA 4DVDA 2CCQA 2XUEA 3P7IA 4E7ZA 3OJAA 1D0ZA 5FYMA 2WWUA 4K0UA 1D0XA 1B7TA 3L3PA 3MXZA 4OYJA 4UV9B 4U74A 1WRDA 4CZZB 1Z0PA 2BVMA 2VKJA 3QUJA 5GONE 3AA7B 4QKNA 2K24A 2LT3A 4GOUA 1OXZA 2PJQA 2M67A 3GWHA 4YJ2E 3CPZA 5KMGP 2CWYA 2EHOC 2H7VC 2IC9A 3N9NA 5HYAA 4AI6A 4MLKA 3FXDB 4UXNB 1HCIA 2X67A 4KUMB 2K9AA 5L2LA 3U78A 2GK9A 5LA6E 2YEVC 5IYZE 4BA9A 3ETUA 4ERRA 4Z8XA 3OYZA 4JEHB 2Y8DA 3V5SA 3HI2A 2EHOA 2E9XC 4O4LE 2Y6XA 5EZYE 2X66A 3OKQA 5CB4E 2IW5B 4ZI2C 5JQGE 2Q9QB 3N9PA 3Q5WA 4QX7B 3BK9A 1FEWA 2B1EA 2D2SA 2E9XA 3R6NA 2I59A 2X9HA 5EK2A 5JDMA 4WBOA 5FP3A 2MBGA 5BMVE 4UVAB 2XAGB 4ADZA 3AAAB 4FJOA 4WW0A 4IIJE 3KV6A 5J2TE 2JRKA 3RRWA 1HG2A 4UVBB 4X1IE 5H6RB 4NUVA 2W61A 1LKXA 2CLYC 3EDVA 5JVDE 2D0UA 4ZI3D 1MIYA 1SHZC 3CKDA 3VKGA 5JRCB 4EB6E 3CX7B 3ZYLA 3F57A 5DQWA 2PBIA 3MKDA 4H63V 4AQGA 4EXTA 3WAKA 4M1PA 2RP4A 1H7CA 3HA4A 2ODVA 3SRZA 3ZLIA 4L9IA 3UUMA 5LGNB 1AJ3A 3KFWX 3ZMUB 4DMVA 2ACXA 5JDNA 1ZV4X 4PAGA 3ANWB 4DBRA 3BQIA 1WYCA 2L3LA 1MIWA 5ADXL 3AA6B 4MALA 3KVBA 5F8PA 3T8OA 3UTKA 3PU8A 5JDFA 4X1KE 3D0TA 4PNIA 5HWXA 5JDGA 5HXHA 3PE0A 4HKAA 4AKLA 4PW8A 2JMHA 1NWMX 3N2GE 2N9DA 2W62A 4O4HE 4OHFA 1CUNA 1HG5A 4PK5A 4EZHA 1E1HB 5J2UE 5LYJE 3ZMZB 4IGUA 3ZMTB 4UF0B 4ZHQE 2V1DB 2KZ7B 2EHOD 2N1GA 1IZNB 1YW0A 4A56A 3J7Yq 2DI4A 5EK3A 4I50E 4ZOLE 1FMVA 2VKOA 5FXZA 1ZHCA 3AVRA 2NW7A 4IE0A 4ZI3C 3AA1B 2PFVA 3L09A 3LK2B 1KK7A 4GK5E 3N2KE 4PK6A 1T98A 1EZ3A 2CXFA 2LJLA 4TV9E 3LK42 2V7KA 3IF8B 2XTLA 4CQIA 3NBXX 2YU1A 3MK7C 3ZJ1A 3W15B 2A3DA 3NRXA 3LG7A 3QK6A 4L5GA 3CX8B 5HXRA 5LBQB 5CA1E 5JR9A 3N9OA 3H37A 1UX5A 3HKCE 4CI3B 5LJMA 5JREA 3MZKB 2RA1A 3KBUA 2C0SA 4E7SA 4QHOA 5LP6E 2XAJB 2V7LA 3AVSA 3FB2A 1VRBA 5H6QB 4X20E 3V5UA 3HKBE 2DNXA 3EDUA 4UEMA 3SWHA 2NW8A 4CXYA 1MIVA 3PUAA 4MHCA 5EK4A 3PDYA 2JMKA 3NZPA 4PJNA 2V7JA 4H9OC 5LJNA 4EYUA 5HXCA 4DBQA 1WLXA 3RYCE 1FMWA 2KMFA 4ISSA 5FY7A 3ZYKA 4BAYB 4O2AE 4FI5A 3RKOA 3AAIA 5FXVA 4ZS3A 3ZPOA 2CM0A 1ZEEA 4UV8B 5F3JA 2VKDA 2DCFA 4GK0E 2LHRA 2CXLA 1O3XA 2KNDA 3KBTA 3KDSE 4H9SE 4UELA 4AKIA 1D1BA 4P0BA 1FIOA 1BR1A 1MMDA 2X68A 3LBXB 4YFSA 5DABA 4NUUA 2QA7A 2YINA 3AAEB 5DJQC 3LK3B 3N5LA 4GIWA 1MMAA 2X9XA 5LG4A 5JR9B 2NP9A 3CMLA 3MACA 3GMIA 3KINB 2HPLA 3HKEE 4EOZB 2XHEB 1BR2A 2X9WA 4KP3C 4IE7A 4DMWA 5A1LA 1WYBA 1U5PA 4AQFC 2X51A 3LJCA 3ZCIA 2LOPA 4BJMA 3UFEA 1D1CA 4ZS2A 3IEEA 5L3GB 1S35A 3FXEB 2NWBA 4TV8E 4AQFA 1ZKEA 3SS1A 3I9YA 4N78D 3CX6B 2IAKA 3I9WA 3C4XA 5HAXA 2NW9A 1VOMA 2NTYA 3U3IA 4PK4A 4C91A 3HL6A 3RPUA 2W63A 4F6RC 5LHGB 5M4YA 4AKRB 2LSKA 2W0GA 5IHYA 4IE5A 5FY0A 2EHOB 2VKHA 4J2CA 3CQXC 5HXSA 4TN7B 4DO0A 4QXCB 1HTJF 3RYIE 3ZN0B 3CQCB 4U72A 1MMGA 1KNZA 4V1Av 5AFUL 2K5BB 2DWKA 3NZQA 2YK0A 2CA5A 2C5JA 2E9XB 2WBLA 1IJ5A 2BDEA 2Q9QD 4P09A 1QSDA 3ZC1A 3ZYMA 4ILUA 1D0YA 1MNEA 4H9QC 1US7B 4WNKA 3LFMA 2PG8A 4EYYR 4CI2B 3DP7A 4HTEA 2ZM2A 5CA0E 4O2BE 2ZM8A 4UIGA 5LBMA 2WM9A 2JJ9A 1NAFA 2W00A 1G73A 3B57A 3ESLA 4IHJE 2CWOA 4EAHA 3ZMSB 2L8KA 2DWGA 3K8PC 2H7OA 4G2AA 5LCYA 3KVAA 2LSJA 3O1JA 4WBNE 4QXHB 3E08A 4PFPA 4CXXA 4JLEA 3I0OA 4O8SA 4AXPA 3O1IA 3IHRA 4ISTA 3FBZA 4CI1B 1UCUA 2CLYB 2WMNA 2N2NA 4I43B 1HFAA 3RC8A 4P0AA 4G63A 2CXDA 1HF8A 1UX4A 3UT5E 3PURA 5JH7E 1HX8A 3N9QA 2BZBA 2VL8A 3CWZB 3BQLA 3NRYA 2X9YA 3ZJ2A 5JDHA 1IJ6A 2H3RA 3Q2MA 1WR6A 4EZ4A 3KV4A 3RYFE 2V26A 2C5IT 3KV9A 3C4WA 4QWNB 2VASA 5HXEA 1BR4A 2KXPB 1QUUA 2DLRA 4TZ4C 2NOXA 2Q9QC 3ONXA 2V7MA 2ZMAA 5FNVE 3CQGB 3OYXA 3P8CD 4IE6A 2UXXB 3EVYA 4ZI7E 1YKEB 4I4TE 2UXNB 3N2OA 4JUYA 2Q9QA 2HH7A 5HWYA 1U4QA 4H9RC 4EIWA 3Q9DA 5ETWA 2A2FX 3RH3A 3UULA 3VU7H 3UUNA 5LGTB 5FXXA 3K3NA 5FXWA 3UUXB 4UVCB 2XAHB 3VHLA 1YKHB 2LE8A 2A72A 3JC6D 4IE4A 4KMCA 3CVRA 3E22E 3J9X1 3BQKA 3HKDE 2LSIA 4DNDA 1IAPA 3S4UA 3FBLA 4O4JE 3HR0A 5JRCA 2D0TA 2VK9A 2JPFA 2LHNA 5KDMC 2CE7A 1MNDA 1G8XA 2J1DG 2D5UA 4MFRA 5TAOA 4H9NC 4L0RA 5KX5E 4H9PC 2VB6A 4TX5A 2SPCA 4CXWA 4HE8A 5C8YE 3ZN1B 2WSSV 4JEUB 3MA9A 4I55E 1BR0A 3ANWA 3F31A 2LSGA 1Y64B 5E0OA 3PUGA 4ANJA 5JDLA 3RX6A 2WMOA 4XZCA 4PFOA 4AKHA 2XASB 2G0UA 2NTXA 3Q5XA 4KBMB 3PTRB 1HS7A 3DJBA 2XAFB 1V9DA 2L9QA 4XBFB 2HPJA 2QGSA 1YD8G 3ZC0A 3I1AA 1OWAA 3C64A 4O4IE 2K48A 4PJJA 3VKHA 2IC6A 3AA0B 1SA0E 1LRZA 4UF0A 5LHHB 2P9BA 1X79A 2V7IA 4OK0A 3PUSA 4MBQA 4OYKA 3B13A 3JC6C 3RYHE 5L3EB 5L3BB 5L3FB 3WI3A 4YJ3E 4QXBB 3PU3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E1H B;  3K3Q C; 
#chains in the Genus database with same CATH topology
 2XQY A;  3CK6 A;  2XSA A;  4DR5 T;  3RRC A;  4EED A;  3DTO A;  4YLH A;  2FBW A;  2YN6 A;  4QH5 A;  3F2E A;  2UXD T;  5F5W A;  4DUY T;  3AB3 B;  5AQV B;  5L4H A;  2LSY A;  3FHN A;  2DHR A;  2ES0 A;  1W9R A;  4KX6 A;  2MOZ A;  3N9M A;  4B3S T;  4TUY E;  1WCR A;  3LBX A;  3P4Q A;  4ZI2 D;  2WP9 A;  4IDZ A;  3O4X E;  4WZX A;  2RPA A;  2DL1 A;  3H3A A;  3KV5 A;  2UUB T;  2AE9 A;  2WZH A;  2MYS A;  2XQ8 A;  2CCQ A;  2XUE A;  3P7I A;  1D0Z A;  5FYM A;  4OYJ A;  1WRD A;  3QUJ A;  3AA7 B;  4QKN A;  2BKN A;  2M67 A;  2CWY A;  4JYA T;  2H7V C;  4UXN B;  2V6Y A;  5L2L A;  3U78 A;  4BA9 A;  3OYZ A;  4JEH B;  3V5S A;  1N32 T;  4LF7 T;  4QX7 B;  3Q5W A;  4DR1 T;  2WDR A;  3R6N A;  2W4X A;  4HFD A;  5JDM A;  5AQI B;  2XAG B;  4FJO A;  2PTF A;  3RF1 A;  4IIJ E;  3KV6 A;  2V6X A;  4LF5 T;  3A8Y C;  4LFC T;  5H6R B;  4NUV A;  1I6Z A;  2D0U A;  4ZI3 D;  3VKG A;  4JI4 T;  3OVU A;  2M6I A;  5DQW A;  2V6Y B;  2PBI A;  3RQU A;  4LF4 T;  4M1P A;  2ODV A;  3SRZ A;  4L9I A;  3UUM A;  2ACX A;  3UU6 A;  4PAG A;  5AQN B;  2BBH A;  3PJA A;  3T8O A;  3PU8 A;  5JDG A;  2E5L T;  4PW8 A;  1NWM X;  4OHF A;  2W66 A;  4DID B;  2H88 A;  5AQM B;  5J2U E;  2N1G A;  4X5T A;  4A56 A;  2XZE A;  3J7Y q;  4I50 E;  4ZOL E;  1ZHC A;  1HX1 B;  3AA1 B;  3LK2 B;  1M62 A;  2CXF A;  2V7K A;  4GKK T;  4CQI A;  2LM2 A;  3MK7 C;  3NBX X;  1HR0 T;  3QK6 A;  5CA1 E;  2D9D A;  3H37 A;  3AE5 A;  5LP6 E;  2XAJ B;  2QRX A;  5IUX A;  4KHP T;  3FB2 A;  5HEO A;  4YTM A;  3V5U A;  3SWH A;  3EDU A;  4CXY A;  2YDR A;  2V7J A;  4B3M T;  4DBQ A;  3ZYK A;  4O2A E;  3AAI A;  5FXV A;  2IUB A;  2CM0 A;  4UV8 B;  2VKD A;  4GK0 E;  2LHR A;  3P4S A;  2FJD A;  4HFB A;  1BR1 A;  1FIO A;  1MMD A;  5DAB A;  3P4W A;  4NUU A;  2YIN A;  4U31 A;  1KEY A;  4QH1 A;  3TLW A;  5ABG A;  2LLY A;  4ZZB A;  3HKE E;  4EOZ B;  3EAB A;  2H89 A;  5A1L A;  1WYB A;  1U5P A;  3Q5D A;  3ZCI A;  3UFE A;  1D1C A;  5HEG A;  4GKJ T;  3IEE A;  2JIW A;  5L3G B;  3FXE B;  2E5V A;  2VUR A;  1KNP A;  3UFG A;  1VOM A;  4DV7 T;  4ILC A;  5LHG B;  5M4Y A;  1QLB A;  5IHY A;  4IE5 A;  5FY0 A;  1OED B;  4DUZ T;  5HXS A;  3ZN0 B;  4U72 A;  2J62 A;  4JI7 T;  3ZC1 A;  3G06 A;  3AE3 A;  2ZM2 A;  5CA0 E;  2XQ7 A;  2JJ9 A;  1NAF A;  2CWO A;  4YT0 A;  2L8K A;  4LMJ A;  3K8P C;  3O1J A;  3B5M A;  4CXX A;  1W0A A;  4AXP A;  2R6G F;  1UCU A;  2CLY B;  2N2N A;  4DR3 T;  4HWD A;  1UK5 A;  2XSB A;  1KNR A;  1UX4 A;  3UT5 E;  3N9Q A;  2BZB A;  2VL8 A;  3CWZ B;  5AQP B;  2X9Y A;  1IJ6 A;  5AQO B;  1FJG T;  3KV4 A;  3UUB A;  2FJA A;  4NXN T;  2C5I T;  3KV9 A;  2W2U A;  1BR4 A;  2KXP B;  2B76 A;  4IDQ A;  1VCS A;  4TZ4 C;  3FZH B;  5FNV E;  3CQG B;  3M3Z B;  3EVY A;  4Q25 A;  1YKE B;  3NKZ A;  4JUY A;  2HH7 A;  1U4Q A;  4EIW A;  3RH3 A;  5LGT B;  5FXX A;  5FXW A;  3TLV A;  5LG3 A;  4IE4 A;  3JC6 D;  3AE2 A;  4DV5 T;  3S4U A;  1X9B A;  1L0V A;  4O4J E;  4OX9 T;  2LHN A;  2CE7 A;  5C8Y E;  5E0O A;  2WQY A;  3PTR B;  2VQE T;  4I0U A;  4DV1 T;  2HN1 A;  3VRB A;  3ZC0 A;  4O4I E;  2K48 A;  3VKH A;  1SA0 E;  3PUY F;  5LHH B;  1JNZ A;  5L3E B;  2LKG A;  4YJ3 E;  4DV2 T;  1UUS A;  5BR8 T;  3N9L A;  3O9X A;  2CBJ A;  3TKL B;  3ZEF B;  3GA8 A;  3T1H T;  3C98 B;  5CJ5 A;  5FY1 A;  4TWH A;  3OBV E;  2OLT A;  4HN9 A;  4HEA A;  3K3Q C;  3AE4 A;  2BVL A;  2LEH A;  4ASK A;  2C5K T;  2X0H A;  3A5X A;  2YU2 A;  3AED A;  2XAQ B;  5FVK A;  1LVK A;  2KWI B;  3ETV A;  4PJL A;  5FMN A;  3ZCJ A;  5LXT E;  3I0Q A;  2VWA A;  2MTQ A;  1D1A A;  4IDN A;  3EUH A;  2ODU A;  4K0K T;  5LHI B;  1YQ3 A;  5JR9 C;  1N34 T;  4HWC A;  2ZM0 A;  5J1G A;  3M65 A;  4DVD A;  3OJA A;  1ZP0 A;  4ZEY A;  5ABF B;  4K0U A;  1B7T A;  4UV9 B;  3QNU A;  4YSX A;  5GON E;  2LT3 A;  2BG9 E;  4GOU A;  2IC9 A;  4AI6 A;  3PV0 F;  1HCI A;  2X67 A;  2CHN A;  4ERR A;  5LA6 E;  4Z8X A;  3HI2 A;  3RKG A;  2E9X C;  4O4L E;  2IW5 B;  4IL9 A;  3RIA A;  5CGM A;  3RIF A;  1DU2 A;  3N9P A;  3BK9 A;  3PJA J;  4DR4 T;  2D2S A;  2E9X A;  2X9H A;  5EK2 A;  4WBO A;  4UVA B;  3AAA B;  4WW0 A;  3AEF A;  5AQR B;  5J2T E;  4DV0 T;  3RRW A;  1HG2 A;  2UXB T;  3EDV A;  5JRC B;  1UUR A;  3F57 A;  2CRB A;  2JQH A;  2UUA T;  1H7C A;  5LGN B;  2LRL A;  3KFW X;  3ZMU B;  5JDN A;  3ANW B;  3BQI A;  1IBK T;  2JQK A;  1MIW A;  5ADX L;  5F8P A;  4IT4 A;  4X1K E;  4PNI A;  4JI8 T;  2JMH A;  2QVA A;  3JCF A;  3N2G E;  2N9D A;  4O4H E;  2BG9 C;  4B3T T;  1CUN A;  1HG5 A;  4U7Y A;  2XQ3 A;  4EZH A;  1E1H B;  3P4R A;  4DR6 T;  3Q5E A;  5AQL B;  5HEJ A;  4UF0 B;  2EHO D;  5AQJ B;  2BG9 A;  4AIU A;  5ABE A;  1YW0 A;  4NPP A;  2VKO A;  5FXZ A;  4IE0 A;  4GK5 E;  1EZ3 A;  2AXD S;  4TV9 E;  2QYW A;  3IF8 B;  2XTL A;  3ZJ1 A;  1XMO T;  3W15 B;  2A3D A;  3LG7 A;  3HKC E;  3LSV A;  4DV6 T;  5JRE A;  2C0S A;  2WZI A;  2V7L A;  3AEB A;  4ILB A;  4UEM A;  4A97 A;  1MIV A;  3PUA A;  5EK4 A;  4H9O C;  2CBI A;  2BG9 B;  1WLX A;  3RYC E;  3VR9 A;  4BAY B;  2ZM6 T;  1VCT A;  4FI5 A;  3ZPO A;  2DCF A;  2KND A;  3LBX B;  2QA7 A;  5DJQ C;  5LG4 A;  2NP9 A;  3CML A;  2UXC T;  3PUZ F;  4DR7 T;  1BR2 A;  2X9W A;  3AE6 A;  4KP3 C;  3QB5 K;  3LJC A;  4YXD A;  3SFD A;  4ZS2 A;  3RHW A;  1ZKE A;  3SS1 A;  3C4X A;  2NW9 A;  1T8B A;  2WU2 A;  1R8I A;  3CQX C;  4DO0 A;  1HTJ F;  4JI2 T;  4V1A v;  5AFU L;  2CA5 A;  4EYY R;  3RIU C;  4CI2 B;  3DP7 A;  4HWI B;  4O2B E;  4UIG A;  2FJE A;  3OTO T;  2H7O A;  3RIU A;  3AE8 A;  4O8S A;  3O1I A;  3IHR A;  1GQE A;  4IST A;  4TNV A;  4AQY T;  4P0A A;  4G63 A;  2CXD A;  4IDP A;  4YSZ A;  2H3R A;  4LF6 T;  3RYF E;  4QWN B;  2Q9Q C;  2ZMA A;  1NEK A;  3OYX A;  3ABV A;  4IE6 A;  4ZI7 E;  2UXN B;  2CHO A;  2Q9Q A;  5HWY A;  3UU3 A;  4DV4 T;  2A2F X;  2VQF T;  3UUN A;  3K3N A;  3UUX B;  3VHL A;  1YKH B;  2LE8 A;  2A72 A;  2YOE A;  2LSI A;  1IAP A;  3FBL A;  3HR0 A;  3OPC A;  3L8R A;  2VK9 A;  2BS3 A;  2J1D G;  3VR8 A;  4L0R A;  4JI5 T;  2VB6 A;  4TX5 A;  2SPC A;  4CXW A;  3ZN1 B;  3MA9 A;  1BR0 A;  3F31 A;  3PUG A;  4ANJ A;  3RX6 A;  4AKH A;  2G0U A;  2NTX A;  3Q5X A;  4KBM B;  3A7M A;  5L47 A;  3DJB A;  5IWA T;  2L9Q A;  2MAW A;  3SFE A;  4U3C A;  1X79 A;  3PUS A;  3RYH E;  2WWV A;  3GN5 A;  1T72 A;  4EB6 E;  2LOS A;  3QB5 A;  4JI0 T;  2OA5 A;  4H63 H;  4HGA A;  3AEE A;  2CMR A;  3C51 A;  3R84 B;  3E0Z A;  3AE7 A;  5AQF B;  5HCM A;  1IBM T;  2IIU A;  2LM9 A;  2KLQ A;  5L3D B;  2E8I A;  3WAJ A;  5LGU B;  3O1H A;  4XAX B;  5J0Z A;  5LNK A;  2KWH A;  2VL0 A;  2Y48 B;  2M6B A;  3L39 A;  5HEU A;  4KHZ F;  3C4Z A;  2CEA A;  2X0L B;  3GN5 B;  4OFZ A;  5KXJ A;  3QC9 A;  4GYS A;  2Z6E A;  3IA3 A;  4HFV A;  4U33 A;  3AEA A;  4U2Y A;  5LOV E;  3C50 A;  4YTP A;  1XDO A;  3FZL B;  2WWU A;  4U74 A;  1Z0P A;  2BVM A;  4QH4 A;  2PJQ A;  3GWH A;  3FZK B;  5KMG P;  2EHO C;  3NWI A;  5HYA A;  4MLK A;  4DR2 T;  2YEV C;  2EHO A;  2Y6X A;  5EZY E;  3OKQ A;  2XM2 A;  4ZI2 C;  5JQG E;  4CN1 A;  3AE9 A;  1FEW A;  3H3M A;  2I59 A;  2J4G A;  1J1J A;  3ZST A;  4HFC A;  2XY8 B;  2MBG A;  5BMV E;  3ONL C;  2BS2 A;  4X62 T;  2W61 A;  3FZM B;  2WB5 A;  3ZT6 A;  1LKX A;  2YDS A;  5JVD E;  1MIY A;  4AIS A;  3MKD A;  4H63 V;  4AQG A;  2YDQ A;  2J47 A;  1AJ3 A;  4DMV A;  1ZV4 X;  3LDQ B;  4DBR A;  2E2A A;  1WYC A;  1NEN A;  3KVB A;  3UTK A;  5HWX A;  4HKA A;  4AKL A;  4HWH A;  4EEB A;  4PK5 A;  3ZMZ B;  4IGU A;  2V1D B;  2K3W A;  3PUW F;  5EK3 A;  1FMV A;  4ZXL A;  2BS4 A;  4ZI3 C;  2PFV A;  3L09 A;  1KK7 A;  3N2K E;  4PK6 A;  1T98 A;  3LK4 2;  5HXR A;  2JQ9 A;  4X64 T;  3UQ4 A;  5JR9 A;  2IDO B;  3KBU A;  4E7S A;  2DNX A;  2JMK A;  5HXC A;  1FMW A;  2KMF A;  3P50 A;  4ISS A;  5FY7 A;  2BKO A;  2V8S V;  3X1D A;  3RKO A;  5F3J A;  1O3X A;  3KDS E;  4H9S E;  4UEL A;  4AKI A;  5AQU B;  3AAE B;  5AQG B;  3N5L A;  4LF8 T;  5JR9 B;  1I94 T;  4P1N A;  4F8H A;  3RI5 A;  3MAC A;  3GMI A;  3KIN B;  2XHE B;  4IE7 A;  4DMW A;  2I0M A;  1ZOY A;  4X66 T;  2X51 A;  1Z8U A;  1T7S A;  3P4P A;  3ZT7 A;  5HEH A;  2W67 A;  1S35 A;  2NWB A;  4TV8 E;  3JAE A;  3RGL A;  3U3I A;  3AE1 A;  2W63 A;  4JI3 T;  2LSK A;  2W0G A;  2VKH A;  4J2C A;  4QXC B;  3RYI E;  3CQC B;  1KFY A;  2E9X B;  2WBL A;  3FZF B;  4P09 A;  1D0Y A;  4WNK A;  1US7 B;  4YTN A;  5LMN T;  2PG8 A;  4HTE A;  2ZM8 A;  5LBM A;  4EAH A;  2W00 A;  3B57 A;  1G73 A;  4IHJ E;  3ZMS B;  3JAF A;  4G2A A;  3TLU A;  5LCY A;  3KVA A;  2LSJ A;  4WBN E;  4QXH B;  4PFP A;  3I0O A;  3ZSS A;  3FBZ A;  1M7K A;  2WMN A;  2LKH A;  5FL1 A;  3RC8 A;  4CN4 A;  4DV3 T;  1HF8 A;  3PUR A;  3BQL A;  3UQ7 A;  1WR6 A;  4EZ4 A;  4X65 T;  2V26 A;  3C4W A;  1QUU A;  2V7M A;  1HNZ T;  3P8C D;  2VVN A;  3ONJ A;  1XNR T;  1HNX T;  4IDO A;  5C3J A;  4H9R C;  5ETW A;  4WYV A;  3VU7 H;  2BKP A;  4UVC B;  2XAH B;  3EAM A;  3CVR A;  1KF6 A;  4LML A;  5KDM C;  4HFH A;  4MFR A;  4H9N C;  5KX5 E;  1E7P A;  4H9P C;  1YQ4 A;  3K1S A;  2LSG A;  2IHR 1;  5JDL A;  3CIR A;  4XZC A;  4PFO A;  1HS7 A;  4TWF A;  3I1A A;  3C64 A;  3AA0 B;  2P9B A;  4LFB T;  2V7I A;  2WDQ A;  4OYK A;  3JC6 C;  2CPT A;  5L3F B;  4QXB B;  3PU3 A;  1LVF A;  5JDQ A;  2JQQ A;  5L3C B;  4HFI A;  4PJM A;  4X1Y E;  4BJN A;  1OED E;  5FL0 A;  4C90 A;  4YHJ A;  3ZMV B;  3PUQ A;  4LF9 T;  1YXR A;  1MMN A;  3RC3 A;  3SOL A;  4AKG A;  2OV9 A;  2KT9 A;  2MPK A;  3EI0 A;  4QX8 B;  2KIN B;  1CHU A;  1W09 A;  2WAU A;  5LB7 B;  1S94 A;  2XQ9 A;  5L4E A;  2E9X D;  4B6X A;  4YY3 T;  5FKY A;  1N36 T;  3MJX A;  3IBP A;  2V5D A;  2ZLY A;  4GYR A;  3K3O A;  5DQV A;  4E7Z A;  1D0X A;  3L3P A;  3MXZ A;  4CZZ B;  3AEG A;  2VKJ A;  1WFD A;  3T1Y T;  2K24 A;  1UGO A;  1OXZ A;  4YJ2 E;  3CPZ A;  4Z90 A;  3NVO A;  3N9N A;  4A98 A;  2ACZ A;  1OED C;  2NR4 A;  3FXD B;  4KUM B;  2K9A A;  3UU5 A;  4YSY A;  2GK9 A;  5IYZ E;  5JTG A;  3ETU A;  2Y8D A;  2XQ5 A;  2XQ4 A;  1Y01 A;  1OED A;  3UU4 A;  4B3R T;  2WY2 A;  2X66 A;  5CB4 E;  1W0B A;  3EHZ A;  2WDV A;  2Q9Q B;  3ZKR A;  2B1E A;  4IRE A;  2X0Y A;  5FP3 A;  3TLT A;  4ADZ A;  4JBW F;  2IML A;  2JRK A;  4UVB B;  4X1I E;  4U2Z A;  2CLY C;  1SHZ C;  3CKD A;  3CX7 B;  3ZYL A;  1E2A A;  4EXT A;  3WAK A;  2WS3 A;  2RP4 A;  3HA4 A;  3ZLI A;  1XNQ T;  2L3L A;  2KSR A;  3AA6 B;  2WU5 A;  4MAL A;  3AXJ A;  2I6H A;  5LMU T;  5JDF A;  3D0T A;  5HXH A;  3PE0 A;  2W62 A;  4YHH T;  5LYJ E;  3ZMT B;  4ZHQ E;  2KZ7 B;  2YKS A;  1IZN B;  2DI4 A;  2VVS A;  2WCA A;  3AVR A;  2NW7 A;  5HCJ A;  2UU9 T;  2LJL A;  2YU1 A;  4ILA A;  4COF A;  3RLF F;  3NRX A;  4L5G A;  3AXJ B;  3CX8 B;  2V5C A;  5LBQ B;  3N9O A;  4LMK A;  1UX5 A;  4CI3 B;  5LJM A;  3MZK B;  2RA1 A;  4HWF A;  4QHO A;  1SUM B;  3AVS A;  1VRB A;  5H6Q B;  4X20 E;  3HKB E;  2NW8 A;  2HHH T;  4MHC A;  3PDY A;  3NZP A;  4PJN A;  5LJN A;  4EYU A;  3AEC A;  3PUV F;  4ZS3 A;  1IBL T;  1ZEE A;  2FUP A;  2CXL A;  3KBT A;  1D1B A;  4P0B A;  2X68 A;  4YFS A;  1XMQ T;  2F4V T;  4HFE A;  3LK3 B;  4GIW A;  1MMA A;  2X9X A;  4TWD A;  4LFA T;  2HPL A;  2FJB A;  4AQF C;  3VRA A;  2LOP A;  4BJM A;  5AQS B;  4NXM T;  1JNR A;  3JAD A;  4AQF A;  2XM1 A;  3I9Y A;  4N78 D;  3CX6 B;  2IAK A;  3I9W A;  5ABH A;  5HAX A;  2NTY A;  3ZT5 A;  4PK4 A;  4C91 A;  3HL6 A;  3RPU A;  4F6R C;  4AKR B;  2EHO B;  1XWM A;  3QOF A;  4TN7 B;  1MMG A;  1KNZ A;  4CN6 A;  2K5B B;  2DWK A;  2XQ6 A;  2YK0 A;  3NZQ A;  2C5J A;  1IJ5 A;  2BDE A;  2Q9Q D;  1QSD A;  3ZYM A;  4ILU A;  1MNE A;  4H9Q C;  3LFM A;  1SE7 A;  2WM9 A;  3ESL A;  3UU8 A;  2DWG A;  4A5X A;  4UR9 A;  3E08 A;  4JLE A;  2XPK A;  3TLS A;  4EGW A;  4KI0 F;  4CI1 B;  4NIQ A;  4I43 B;  1HFA A;  5ABF A;  1J5E T;  2HN2 A;  2LRK A;  5JH7 E;  5AQT B;  1HX8 A;  3NRY A;  3ZJ2 A;  5JDH A;  3Q2M A;  3PUX F;  1WR0 A;  5AQH B;  2VAS A;  4ZZC A;  5HXE A;  2DLR A;  2NOX A;  3ONX A;  4U7I A;  2UXX B;  4I4T E;  3N2O A;  5AQK B;  4EV6 A;  3Q9D A;  2XJ7 A;  3UUL A;  4IL4 A;  2A9U A;  4KMC A;  3E22 E;  3J9X 1;  3BQK A;  3HKD E;  5FVL A;  4DND A;  4JI1 T;  1HNW T;  4JI6 T;  2XQA A;  5JRC A;  1XZY A;  2D0T A;  2JPF A;  1MND A;  1J5W A;  1G8X A;  2D5U A;  5TAO A;  4HE8 A;  5AQQ B;  2WSS V;  4JEU B;  4JV5 T;  4I55 E;  3ANW A;  1Y64 B;  4TNW A;  3RQW A;  2WMO A;  2XAS B;  1N33 T;  2XAF B;  1V9D A;  4XBF B;  2HPJ A;  2QGS A;  1YD8 G;  1OWA A;  5C2T A;  4PJJ A;  2IC6 A;  4UF0 A;  1LRZ A;  2UUC T;  4OK0 A;  4Z91 A;  4MBQ A;  2BBJ A;  1XDP A;  5CFB A;  3B13 A;  5L3B B;  3WI3 A; 
#chains in the Genus database with same CATH homology
 3GN5 A;  2LOS A;  2XQY A;  1LVF A;  5JDQ A;  2OA5 A;  4H63 H;  2JQQ A;  4HGA A;  3N9L A;  5L3C B;  3O9X A;  4PJM A;  3TKL B;  2CMR A;  3RRC A;  4X1Y E;  3DTO A;  4YLH A;  3C51 A;  3GA8 A;  3R84 B;  4BJN A;  3E0Z A;  3ZEF B;  3C98 B;  4C90 A;  4YHJ A;  3F2E A;  5FY1 A;  3OBV E;  4HN9 A;  2LM9 A;  2KLQ A;  4HEA A;  3K3Q C;  5L3D B;  2E8I A;  3WAJ A;  5LGU B;  2BVL A;  3O1H A;  3AB3 B;  3ZMV B;  4XAX B;  3PUQ A;  2LEH A;  5LNK A;  4ASK A;  2C5K T;  2KWH A;  1MMN A;  3A5X A;  2Y48 B;  2LSY A;  2YU2 A;  2XAQ B;  3FHN A;  2DHR A;  3RC3 A;  1LVK A;  2ES0 A;  2KWI B;  3ETV A;  3SOL A;  4PJL A;  4AKG A;  5FMN A;  3ZCJ A;  2KT9 A;  3C4Z A;  2CEA A;  2MOZ A;  2X0L B;  3N9M A;  4QX8 B;  5LXT E;  2KIN B;  4TUY E;  3I0Q A;  3GN5 B;  2WAU A;  2VWA A;  2MTQ A;  1S94 A;  1D1A A;  2E9X D;  3EUH A;  2ODU A;  4OFZ A;  4B6X A;  5LHI B;  3LBX A;  5JR9 C;  4ZI2 D;  3QC9 A;  4GYS A;  4IDZ A;  2Z6E A;  3O4X E;  4HFV A;  2ZM0 A;  3H3A A;  3MJX A;  5J1G A;  3KV5 A;  3IBP A;  3M65 A;  5LOV E;  3C50 A;  2ZLY A;  4GYR A;  3K3O A;  5DQV A;  2MYS A;  4DVD A;  2CCQ A;  2XUE A;  3P7I A;  4E7Z A;  3OJA A;  1D0Z A;  5FYM A;  2WWU A;  4K0U A;  1D0X A;  1B7T A;  3L3P A;  3MXZ A;  4OYJ A;  4UV9 B;  4U74 A;  1WRD A;  4CZZ B;  1Z0P A;  2BVM A;  2VKJ A;  3QUJ A;  5GON E;  3AA7 B;  4QKN A;  2K24 A;  2LT3 A;  4GOU A;  1OXZ A;  2PJQ A;  2M67 A;  3GWH A;  4YJ2 E;  3CPZ A;  5KMG P;  2CWY A;  2EHO C;  2H7V C;  2IC9 A;  3N9N A;  5HYA A;  4AI6 A;  4MLK A;  3FXD B;  4UXN B;  1HCI A;  2X67 A;  4KUM B;  2K9A A;  5L2L A;  3U78 A;  2GK9 A;  5LA6 E;  2YEV C;  5IYZ E;  4BA9 A;  3ETU A;  4ERR A;  4Z8X A;  3OYZ A;  4JEH B;  2Y8D A;  3V5S A;  3HI2 A;  2EHO A;  2E9X C;  4O4L E;  2Y6X A;  5EZY E;  2X66 A;  3OKQ A;  5CB4 E;  2IW5 B;  4ZI2 C;  5JQG E;  2Q9Q B;  3N9P A;  3Q5W A;  4QX7 B;  3BK9 A;  1FEW A;  2B1E A;  2D2S A;  2E9X A;  3R6N A;  2I59 A;  2X9H A;  5EK2 A;  5JDM A;  4WBO A;  5FP3 A;  2MBG A;  5BMV E;  4UVA B;  2XAG B;  4ADZ A;  3AAA B;  4FJO A;  4WW0 A;  4IIJ E;  3KV6 A;  5J2T E;  2JRK A;  3RRW A;  1HG2 A;  4UVB B;  4X1I E;  5H6R B;  4NUV A;  2W61 A;  1LKX A;  2CLY C;  3EDV A;  5JVD E;  2D0U A;  4ZI3 D;  1MIY A;  1SHZ C;  3CKD A;  3VKG A;  5JRC B;  4EB6 E;  3CX7 B;  3ZYL A;  3F57 A;  5DQW A;  2PBI A;  3MKD A;  4H63 V;  4AQG A;  4EXT A;  3WAK A;  4M1P A;  2RP4 A;  1H7C A;  3HA4 A;  2ODV A;  3SRZ A;  3ZLI A;  4L9I A;  3UUM A;  5LGN B;  1AJ3 A;  3KFW X;  3ZMU B;  4DMV A;  2ACX A;  5JDN A;  1ZV4 X;  4PAG A;  3ANW B;  4DBR A;  3BQI A;  1WYC A;  2L3L A;  1MIW A;  5ADX L;  3AA6 B;  4MAL A;  3KVB A;  5F8P A;  3T8O A;  3UTK A;  3PU8 A;  5JDF A;  4X1K E;  3D0T A;  4PNI A;  5HWX A;  5JDG A;  5HXH A;  3PE0 A;  4HKA A;  4AKL A;  4PW8 A;  2JMH A;  1NWM X;  3N2G E;  2N9D A;  2W62 A;  4O4H E;  4OHF A;  1CUN A;  1HG5 A;  4PK5 A;  4EZH A;  1E1H B;  5J2U E;  5LYJ E;  3ZMZ B;  4IGU A;  3ZMT B;  4UF0 B;  4ZHQ E;  2V1D B;  2KZ7 B;  2EHO D;  2N1G A;  1IZN B;  1YW0 A;  4A56 A;  3J7Y q;  2DI4 A;  5EK3 A;  4I50 E;  4ZOL E;  1FMV A;  2VKO A;  5FXZ A;  1ZHC A;  3AVR A;  2NW7 A;  4IE0 A;  4ZI3 C;  3AA1 B;  2PFV A;  3L09 A;  3LK2 B;  1KK7 A;  4GK5 E;  3N2K E;  4PK6 A;  1T98 A;  1EZ3 A;  2CXF A;  2LJL A;  4TV9 E;  3LK4 2;  2V7K A;  3IF8 B;  2XTL A;  4CQI A;  3NBX X;  2YU1 A;  3MK7 C;  3ZJ1 A;  3W15 B;  2A3D A;  3NRX A;  3LG7 A;  3QK6 A;  4L5G A;  3CX8 B;  5HXR A;  5LBQ B;  5CA1 E;  5JR9 A;  3N9O A;  3H37 A;  1UX5 A;  3HKC E;  4CI3 B;  5LJM A;  5JRE A;  3MZK B;  2RA1 A;  3KBU A;  2C0S A;  4E7S A;  4QHO A;  5LP6 E;  2XAJ B;  2V7L A;  3AVS A;  3FB2 A;  1VRB A;  5H6Q B;  4X20 E;  3V5U A;  3HKB E;  2DNX A;  3EDU A;  4UEM A;  3SWH A;  2NW8 A;  4CXY A;  1MIV A;  3PUA A;  4MHC A;  5EK4 A;  3PDY A;  2JMK A;  3NZP A;  4PJN A;  2V7J A;  4H9O C;  5LJN A;  4EYU A;  5HXC A;  4DBQ A;  1WLX A;  3RYC E;  1FMW A;  2KMF A;  4ISS A;  5FY7 A;  3ZYK A;  4BAY B;  4O2A E;  4FI5 A;  3RKO A;  3AAI A;  5FXV A;  4ZS3 A;  3ZPO A;  2CM0 A;  1ZEE A;  4UV8 B;  5F3J A;  2VKD A;  2DCF A;  4GK0 E;  2LHR A;  2CXL A;  1O3X A;  2KND A;  3KBT A;  3KDS E;  4H9S E;  4UEL A;  4AKI A;  1D1B A;  4P0B A;  1FIO A;  1BR1 A;  1MMD A;  2X68 A;  3LBX B;  4YFS A;  5DAB A;  4NUU A;  2QA7 A;  2YIN A;  3AAE B;  5DJQ C;  3LK3 B;  3N5L A;  4GIW A;  1MMA A;  2X9X A;  5LG4 A;  5JR9 B;  2NP9 A;  3CML A;  3MAC A;  3GMI A;  3KIN B;  2HPL A;  3HKE E;  4EOZ B;  2XHE B;  1BR2 A;  2X9W A;  4KP3 C;  4IE7 A;  4DMW A;  5A1L A;  1WYB A;  1U5P A;  4AQF C;  2X51 A;  3LJC A;  3ZCI A;  2LOP A;  4BJM A;  3UFE A;  1D1C A;  4ZS2 A;  3IEE A;  5L3G B;  1S35 A;  3FXE B;  2NWB A;  4TV8 E;  4AQF A;  1ZKE A;  3SS1 A;  3I9Y A;  4N78 D;  3CX6 B;  2IAK A;  3I9W A;  3C4X A;  5HAX A;  2NW9 A;  1VOM A;  2NTY A;  3U3I A;  4PK4 A;  4C91 A;  3HL6 A;  3RPU A;  2W63 A;  4F6R C;  5LHG B;  5M4Y A;  4AKR B;  2LSK A;  2W0G A;  5IHY A;  4IE5 A;  5FY0 A;  2EHO B;  2VKH A;  4J2C A;  3CQX C;  5HXS A;  4TN7 B;  4DO0 A;  4QXC B;  1HTJ F;  3RYI E;  3ZN0 B;  3CQC B;  4U72 A;  1MMG A;  1KNZ A;  4V1A v;  5AFU L;  2K5B B;  2DWK A;  3NZQ A;  2YK0 A;  2CA5 A;  2C5J A;  2E9X B;  2WBL A;  1IJ5 A;  2BDE A;  2Q9Q D;  4P09 A;  1QSD A;  3ZC1 A;  3ZYM A;  4ILU A;  1D0Y A;  1MNE A;  4H9Q C;  1US7 B;  4WNK A;  3LFM A;  2PG8 A;  4EYY R;  4CI2 B;  3DP7 A;  4HTE A;  2ZM2 A;  5CA0 E;  4O2B E;  2ZM8 A;  4UIG A;  5LBM A;  2WM9 A;  2JJ9 A;  1NAF A;  2W00 A;  1G73 A;  3B57 A;  3ESL A;  4IHJ E;  2CWO A;  4EAH A;  3ZMS B;  2L8K A;  2DWG A;  3K8P C;  2H7O A;  4G2A A;  5LCY A;  3KVA A;  2LSJ A;  3O1J A;  4WBN E;  4QXH B;  3E08 A;  4PFP A;  4CXX A;  4JLE A;  3I0O A;  4O8S A;  4AXP A;  3O1I A;  3IHR A;  4IST A;  3FBZ A;  4CI1 B;  1UCU A;  2CLY B;  2WMN A;  2N2N A;  4I43 B;  1HFA A;  3RC8 A;  4P0A A;  4G63 A;  2CXD A;  1HF8 A;  1UX4 A;  3UT5 E;  3PUR A;  5JH7 E;  1HX8 A;  3N9Q A;  2BZB A;  2VL8 A;  3CWZ B;  3BQL A;  3NRY A;  2X9Y A;  3ZJ2 A;  5JDH A;  1IJ6 A;  2H3R A;  3Q2M A;  1WR6 A;  4EZ4 A;  3KV4 A;  3RYF E;  2V26 A;  2C5I T;  3KV9 A;  3C4W A;  4QWN B;  2VAS A;  5HXE A;  1BR4 A;  2KXP B;  1QUU A;  2DLR A;  4TZ4 C;  2NOX A;  2Q9Q C;  3ONX A;  2V7M A;  2ZMA A;  5FNV E;  3CQG B;  3OYX A;  3P8C D;  4IE6 A;  2UXX B;  3EVY A;  4ZI7 E;  1YKE B;  4I4T E;  2UXN B;  3N2O A;  4JUY A;  2Q9Q A;  2HH7 A;  5HWY A;  1U4Q A;  4H9R C;  4EIW A;  3Q9D A;  5ETW A;  2A2F X;  3RH3 A;  3UUL A;  3VU7 H;  3UUN A;  5LGT B;  5FXX A;  3K3N A;  5FXW A;  3UUX B;  4UVC B;  2XAH B;  3VHL A;  1YKH B;  2LE8 A;  2A72 A;  3JC6 D;  4IE4 A;  4KMC A;  3CVR A;  3E22 E;  3J9X 1;  3BQK A;  3HKD E;  2LSI A;  4DND A;  1IAP A;  3S4U A;  3FBL A;  4O4J E;  3HR0 A;  5JRC A;  2D0T A;  2VK9 A;  2JPF A;  2LHN A;  5KDM C;  2CE7 A;  1MND A;  1G8X A;  2J1D G;  2D5U A;  4MFR A;  5TAO A;  4H9N C;  4L0R A;  5KX5 E;  4H9P C;  2VB6 A;  4TX5 A;  2SPC A;  4CXW A;  4HE8 A;  5C8Y E;  3ZN1 B;  2WSS V;  4JEU B;  3MA9 A;  4I55 E;  1BR0 A;  3ANW A;  3F31 A;  2LSG A;  1Y64 B;  5E0O A;  3PUG A;  4ANJ A;  5JDL A;  3RX6 A;  2WMO A;  4XZC A;  4PFO A;  4AKH A;  2XAS B;  2G0U A;  2NTX A;  3Q5X A;  4KBM B;  3PTR B;  1HS7 A;  3DJB A;  2XAF B;  1V9D A;  2L9Q A;  4XBF B;  2HPJ A;  2QGS A;  1YD8 G;  3ZC0 A;  3I1A A;  1OWA A;  3C64 A;  4O4I E;  2K48 A;  4PJJ A;  3VKH A;  2IC6 A;  3AA0 B;  1SA0 E;  1LRZ A;  4UF0 A;  5LHH B;  2P9B A;  1X79 A;  2V7I A;  4OK0 A;  3PUS A;  4MBQ A;  4OYK A;  3B13 A;  3JC6 C;  3RYH E;  5L3E B;  5L3B B;  5L3F B;  3WI3 A;  4YJ3 E;  4QXB B;  3PU3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...