1E1HB

Crystal structure of recombinant botulinum neurotoxin type a light chain, self-inhibiting zn endopeptidase.
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
165
structure length
164
Chain Sequence
EMSGLEVSFEELRTFGGHDAKFIDSLQENEFRLYYYNKFKDVASTLNKAKSIIGTTASLQYMKNVFKEKYLLSEDTSGKFSVDKLKFDKLYKMLTEIYTEDNFVNFFKVINRKTYLNFDKAVFRINIVPDENYTIKDGFNLKANLSTNFNGQNTEINSRNFTRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords BOTULINUM NEUROTOXIN TYPE A LIGHT CHAIN
publication title Crystal Structure of Clostridium Botulinum Neurotoxin Protease in a Product-Bound State: Evidence for Noncanonical Zinc Protease Activity
pubmed doi rcsb
source organism Clostridium botulinum
molecule tags Hydrolase
total genus 47
structure length 164
sequence length 165
chains with identical sequence D
ec nomenclature ec 3.4.24.69: Bontoxilysin.
pdb deposition date 2000-05-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.540 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 1e1hB01
4.10.1280.10 Few Secondary Structures Irregular Metalloproteases ("zincins"), catalytic domain fold Clostridium neurotoxins 1e1hB02
1E1HB 3K3QC
chains in the Genus database with same CATH superfamily
3AA0B 4NPPA 3AVSA 5HAXA 4CXYA 4O2BE 5HWYA 5BR8T 2VKOA 2CXLA 3CK6A 5JDGA 4WBNE 3K1SA 1HTJF 1YW0A 2BKNA 1XZYA 5JRCB 5DJQC 2H89A 4X5TA 4JI6T 4C91A 4QHOA 4COFA 2C5JA 2ZM2A 3NVOA 2UXBT 2BS3A 3ZMZB 5FVKA 5AQQB 3GA8A 1OEDA 3PU3A 4ZEYA 5FXWA 2WS3A 1IBLT 4YTNA 3RLFF 2BS4A 2QRXA 3Q5XA 2KNDA 2NOXA 5ABFA 5HEOA 1J5WA 2WQYA 1N33T 2UXDT 3H37A 4EIWA 1KK7A 3I9YA 5E0OA 3LFMA 3EUHA 3ZYKA 2BG9B 3RI5A 2RPAA 4CXWA 2X66A 1X79A 4QX8B 4U3CA 2IIUA 2AXDS 2QVAA 5JDLA 4EYYR 2J47A 3AAAB 4WBOA 4K0UA 1S94A 1U4QA 2DCFA 3E08A 3UQ7A 5TAOA 1UX4A 4DBQA 1N34T 2G0UA 2KZ7B 1KF6A 4GYRA 4LFCT 4O4JE 3AE2A 3AEAA 1XMQT 4B3TT 2ODVA 1MNDA 2MYSA 3GN5A 4OHFA 4WW0A 4GKJT 2CXDA 1MMAA 2XSAA 3N9OA 1FJGT 2J1DG 5HXRA 3UU4A 5HEUA 3UFGA 3FHNA 5L2LA 2LLYA 3E0ZA 3K8PC 2CWOA 4MBQA 4LF8T 2WDRA 4ZHQE 3P4WA 3K3OA 1VCTA 2BG9C 2W67A 4QXCB 4CXXA 2KINB 4E7SA 2BS2A 3ZT5A 2JQHA 1WCRA 3EDUA 4O2AE 1BR2A 4AIUA 4IIJE 2XQ9A 1N32T 2BVLA 3AEEA 3QK6A 4KHZF 1IJ6A 4IE7A 1UUSA 5FVLA 3MKDA 4HEAA 3T1HT 3RYIE 3UUXB 4EZ4A 2DWGA 5HXHA 4UF0B 4ZI7E 5L4EA 3K3NA 2CM0A 2FUPA 5AQRB 2V26A 2FBWA 3VKGA 3L3PA 2CBIA 5LJNA 3PUAA 1HNZT 5L3CB 1JNZA 2FJAA 3UUNA 3RQWA 1FIOA 4YSYA 4U33A 5HXSA 4U7YA 4JI7T 4TV8E 1SA0E 2N2NA 5HCMA 3KBUA 3AE7A 1ZKEA 2UUCT 4YXDA 4AQGA 1MIWA 3TLVA 3RX6A 3HKEE 2W63A 2BVMA 2HN1A 4PJJA 3MA9A 2WDQA 2XQ6A 3CX8B 4IDOA 2IMLA 4J2CA 1IBMT 5L4HA 2C0SA 2WSSV 4HWCA 4ILCA 1HG2A 3ZJ1A 5AQNB 3IBPA 4TV9E 1E1HB 1B7TA 3KV6A 2X51A 3IEEA 3AE3A 5HCJA 3SS1A 4ZI3D 3O1IA 2H3RA 3O1HA 4L5GA 2RA1A 4WNKA 2CRBA 4DV5T 2J4GA 3CQGB 1CUNA 2WZIA 3CPZA 2NW7A 3PJAJ 3ZCJA 4DUYT 4EAHA 4YLHA 2W66A 3AE5A 2XQ5A 1WR0A 1Y01A 5LMUT 4TUYE 3CIRA 2CLYC 1LVKA 4U74A 3QUJA 5CGMA 4JEUB 5EK4A 5LMNT 3CX7B 5HXEA 2LOPA 2E5LT 1BR1A 4IGUA 3TLSA 2XTLA 4JI2T 3AXJA 1U5PA 4O4IE 4YSZA 5JR9A 1XDOA 2ACXA 1UURA 4YSXA 2W61A 4U31A 5JDHA 4DR4T 4QXBB 2V7KA 5IYZE 5FL0A 2WM9A 4JYAT 4EXTA 4PAGA 3JAEA 4L9IA 4KI0F 4PK4A 5EZYE 4XAXB 2Z6EA 3ZYLA 4JI0T 3VR9A 4A98A 2M67A 3BK9A 3ZMUB 2LSKA 3V5SA 3ANWB 2NW8A 5C8YE 4IL4A 3LK3B 4X1YE 5L3DB 2LJLA 4HGAA 4EEDA 4ILUA 2UU9T 5CA1E 2IC9A 5AQSB 2ACZA 3LSVA 4OX9T 5JR9C 4B6XA 5AQKB 3ZSSA 4CI1B 3FXEB 3FBLA 4UELA 3AE4A 3SRZA 5FXXA 1YD8G 3LK42 1IJ5A 2IUBA 4H9QC 4JEHB 3EVYA 2B76A 5J1GA 4F8HA 5HEHA 2DHRA 5H6RB 2XY8B 3OBVE 3KFWX 2UXXB 3VU7H 2V1DB 4TN7B 4EGWA 4E7ZA 5C3JA 4ILBA 1W0BA 4QKNA 3Q5EA 3N2GE 2D0TA 2D9DA 1LKXA 1HG5A 4YT0A 1H7CA 4AKRB 2XQ8A 3RC8A 3KDSE 1YQ3A 2QA7A 5LGUB 2XAHB 3L09A 2WU5A 3NRYA 3RF1A 3ZYMA 3AEDA 2E2AA 3NBXX 3UTKA 2Q9QD 4NXNT 1D1BA 5LGTB 2V7IA 3Q5DA 2V6YB 5L3FB 4H63H 4BAYB 1D1CA 2JMKA 3I0OA 3T1YT 3GMIA 4HE8A 3ZC1A 3O1JA 5AQLB 4EB6E 1YKEB 4BJNA 2LHRA 2XASB 3ZLIA 2XZEA 4EOZB 4DV7T 2CXFA 2PFVA 1NAFA 2VKJA 2XM2A 1UGOA 2VB6A 4IDPA 2ODUA 4TX5A 4V1Av 4KUMB 5FY7A 5HWXA 2NTYA 1I6ZA 4O4LE 3P50A 1SHZC 2E9XB 2CMRA 4HWFA 1T8BA 4IT4A 5JRCA 2JPFA 1HF8A 4B3MT 4AISA 1XNQT 2JIWA 4DV0T 4MALA 4TZ4C 3ONXA 2LSJA 4ZI2C 2YKSA 4NUVA 4KBMB 4CI2B 3WI3A 4F6RC 1NENA 1NWMX 4HN9A 5HEGA 4DBRA 2X9XA 4JUYA 2CCQA 3T8OA 4DV4T 5C2TA 2W0GA 3P4PA 3AE6A 4HFEA 5HEJA 2BG9A 2EHOD 4UVAB 3AA1B 1T98A 3C4WA 3C4XA 5CA0E 1AJ3A 5LJMA 3AE9A 2DI4A 5L3GB 5ABHA 2E9XC 2K5BB 2NWBA 5JQGE 3PDYA 2VKHA 2E8IA 2LSIA 4YJ3E 3JC6D 1OWAA 2WWUA 4QH4A 5FKYA 3VRAA 2Y48B 1HX8A 4K0KT 4X1KE 2V5DA 1T72A 4U7IA 2YEVC 3JCFA 5L3BB 2XM1A 3RIFA 3ONLC 2YOEA 5JDMA 5FYMA 3UU6A 5GONE 5AQPB 1G73A 4UXNB 5ETWA 3UFEA 1Z8UA 1QLBA 5F8PA 3FZKB 3HL6A 1ZP0A 2LRKA 2YN6A 4PFOA 5DQWA 4JLEA 5F5WA 1L0VA 4N78D 1D0XA 2D5UA 1LVFA 3AECA 4AXPA 3P7IA 1XNRT 3VR8A 3N9MA 2UUBT 2OLTA 2LE8A 1W0AA 4NIQA 3AB3B 5FY0A 4XBFB 2JMHA 2UUAT 3I9WA 4ZXLA 3U3IA 4GOUA 4I0UA 3N9NA 1EZ3A 1VOMA 2JJ9A 3RGLA 3UUBA 5EK2A 3P8CD 4CN6A 3C64A 3RKGA 2NP9A 2KLQA 4TNWA 2CHNA 4ERRA 4X62T 4UF0A 2NTXA 3IHRA 3PV0F 5A1LA 3CVRA 3AVRA 3UU8A 4ADZA 3ETUA 3I1AA 5KXJA 2WY2A 5LB7B 4Z91A 1YKHB 3FZLB 4TWFA 4AI6A 2Q9QB 2I6HA 4HWIB 5LBQB 3KBTA 4DMVA 4EEBA 3EI0A 4QH1A 3OJAA 2Y6XA 3F2EA 2RP4A 2X9YA 2BKOA 2ZLYA 2X68A 1IZNB 2W00A 1W09A 4LFBT 3P4QA 2E5VA 2C5IT 4UR9A 1UK5A 4IE5A 2MAWA 2LSYA 4Z8XA 4ZZBA 2NR4A 4NUUA 5KX5E 5LBMA 5KDMC 5DABA 2L8KA 5AFUL 2LRLA 3PUSA 4IHJE 2YU1A 3E22E 2D0UA 2V7MA 4DV6T 4LMJA 2IW5B 1QSDA 3SWHA 2XJ7A 5FXVA 2OA5A 4GK5E 5FXZA 5BMVE 2H7OA 3RYFE 5FP3A 4I50E 4LF5T 3PUQA 4GKKT 2IDOB 1IBKT 2KT9A 4YTPA 3LK2B 3QB5A 2WZHA 5CFBA 4H9NC 4I43B 3P4SA 3R6NA 2VVNA 3H3AA 5FNVE 2YK0A 1GQEA 4JI1T 2K24A 3VKHA 1MMDA 3LDQB 3PTRB 1HNWT 4UV9B 3P4RA 4AKHA 4DIDB 3F31A 4UIGA 4KP3C 4PW8A 4H9PC 4JI3T 4ANJA 3B5MA 3O4XE 1US7B 2EHOB 3EDVA 3MACA 2BZBA 1D0ZA 4DV1T 5FY1A 5IHYA 3DJBA 3RYCE 3S4UA 3ZT7A 5IWAT 3QNUA 4AQYT 3VRBA 4DVDA 3BQIA 4DR6T 3PUWF 3AA6B 3LBXB 4JI5T 4UVCB 4DR5T 1DU2A 3CMLA 1ZEEA 1WLXA 3CQCB 2LSGA 5AQTB 2WDVA 3B57A 1E7PA 1QUUA 3ANWA 2X0HA 1MIVA 2XQ4A 3ZT6A 3DTOA 4AKGA 4ILAA 5AQJB 3TKLB 3EAMA 3H3MA 4JI8T 3ZN1B 3OVUA 1HX1B 2CBJA 3HR0A 3KV4A 4O8SA 1OEDE 4CN1A 4IDNA 3IA3A 2XAFB 2XPKA 4DR7T 3SFEA 4H63V 2GK9A 1KNRA 2BBJA 5LXTE 5HYAA 5L3EB 5AQOB 2X67A 3AEFA 3TLTA 3ONJA 2X9HA 3ZSTA 5AQHB 4UV8B 4I4TE 5FMNA 1SUMB 5AQMB 4DUZT 2M6IA 1WRDA 3FBZA 3F57A 3UU3A 1SE7A 4H9OC 2IAKA 2V8SV 1XMOT 3ESLA 3LG7A 1MIYA 2FJDA 4ZZCA 2QYWA 2KWHA 3HI2A 1FEWA 2HHHT 1WYCA 2V7LA 2PJQA 2BKPA 4GIWA 2V6YA 4IE4A 2B1EA 4YJ2E 4UVBB 2KMFA 5JREA 3AE1A 2FJEA 2I0MA 5JDFA 1J5ET 4PFPA 5L47A 3KINB 3UT5E 4ZS2A 3OTOT 4QXHB 2WB5A 4PK5A 4C90A 2UXNB 1KFYA 5JDQA 2A9UA 1D1AA 2CE7A 3QC9A 2VQFT 3BQKA 1HR0T 2X9WA 4KX6A 5LGNB 4P1NA 2XQ3A 4PJMA 3Q5WA 4HFIA 4ASKA 4P09A 2L3LA 3SOLA 3SFDA 5CJ5A 3FZHB 2E9XA 4U2ZA 3ZMTB 2MPKA 3CKDA 5CB4E 5LYJE 2CWYA 2A72A 3A8YC 2A3DA 4GYSA 2OV9A 3C98B 2MBGA 4PNIA 5LOVE 3RYHE 2YU2A 5ABEA 2VQET 1KNPA 2F4VT 4JBWF 5ADXL 4P0BA 3A5XA 1R8IA 4HFDA 3MXZA 4NXMT 4DR1T 3OKQA 4CI3B 4A5XA 3RHWA 1XWMA 4CQIA 5HXCA 4TWDA 3MJXA 4DO0A 4X66T 1OEDB 3CWZB 3J7Yq 4GK0E 5M4YA 5LA6E 2HPJA 3EABA 3RKOA 4X1IE 4HWHA 4DV3T 4BJMA 2H88A 3ZMVB 1VRBA 2A2FX 3CX6B 1UX5A 1X9BA 4YY3T 5ABFB 2VWAA 3L39A 1HS7A 2I59A 4P0AA 1XDPA 4ZI3C 2W2UA 4DR3T 4CN4A 1BR4A 4JI4T 5AQVB 2R6GF 1G8XA 3A7MA 1ZV4X 4YTMA 3RIUA 3AE8A 2YDSA 2WCAA 2V5CA 1WR6A 2H7VC 5LG3A 4YFSA 3WAJA 2XSBA 3JADA 2VASA 2N1GA 4G63A 4X65T 2K48A 3N2OA 2LOSA 4TNVA 1FMVA 1MMNA 3DP7A 2VK9A 3N5LA 1OEDC 3PJAA 3KVAA 3O9XA 2WMNA 3GN5B 5DQVA 2ZM0A 3TLUA 4OYJA 4MLKA 1JNRA 3JAFA 3ETVA 2PTFA 5JH7E 4ISSA 2VL8A 3UQ4A 2IHR1 3Q2MA 1M62A 2YDQA 1ZOYA 4G2AA 5JVDE 5AQUB 2XAGB 4HWDA 2ZM8A 3OYXA 3ZCIA 3RIUC 3RQUA 3KVBA 3U78A 2W4XA 2VURA 1MMGA 5LP6E 4KMCA 1YQ4A 2XHEB 4AKLA 3NZPA 4QX7B 5EK3A 2CA5A 1Y64B 3RRCA 2WWVA 3NWIA 3HKCE 4IDZA 2N9DA 1HCIA 5LCYA 3RRWA 4LF4T 1I94T 4MHCA 3EHZA 4AQFA 4PK6A 4B3ST 2XAJB 1T7SA 4OYKA 2CHOA 2Q9QA 5AQGB 3C4ZA 1KEYA 1CHUA 1VCSA 4EYUA 3OPCA 3FB2A 3PUYF 4JV5T 3ZEFB 2KSRA 2LT3A 4ZI2D 3B13A 3KV5A 3FZFB 4U2YA 4X20E 4HFVA 2LM9A 2JQQA 3IF8B 3AEBA 4FJOA 4PJLA 1D0YA 1WYBA 2CLYB 3NZQA 4H9SE 2MOZA 2PG8A 3HKDE 4IE0A 1WFDA 3W15B 2WU2A 3FXDB 4DNDA 4I55E 3ABVA 4ISTA 2LM2A 2ES0A 2XAQB 4OFZA 4HKAA 3ZMSB 4AQFC 2XQAA 1NEKA 2E9XD 3PUXF 1N36T 3G06A 5LG4A 3ZC0A 3AEGA 2CPTA 2X0YA 2Q9QC 4HFBA 2DNXA 2XUEA 4DR2T 4HFCA 3N9QA 1Z0PA 5LHIB 4LMKA 4LF9T 3N9LA 4DV2T 2W62A 5ABGA 1O3XA 4XZCA 4IDQA 4IREA 1W9RA 2BDEA 3R84B 1UCUA 5JDNA 1HNXT 2NW9A 3LJCA 4H9RC 2WMOA 4EV6A 5JTGA 2CEAA 2EHOA 3QOFA 4DMWA 2QGSA 3RPUA 2DL1A 2PBIA 4BA9A 3ZKRA 1LRZA 3BQLA 3AXJB 5AQIB 5JR9B 5LHGB 2DLRA 3M65A 3LBXA 3L8RA 1OXZA 4UEMA 3PU8A 2MTQA 1BR0A 3OYZA 4L0RA 2LKHA 3N2KE 5LHHB 4YHHT 2HPLA 3AA7B 5J2UE 2C5KT 2IC6A 3UUMA 3VHLA 3KV9A 3X1DA 3NRXA 3PUZF 2HN2A 2HH7A 4IL9A 1M7KA 1V9DA 5IUXA 2LKGA 2XQYA 2XQ7A 1FMWA 2JQKA 4PJNA 3C50A 2UXCT 2L9QA 3RIAA 4LFAT 2LHNA 3NKZA 2LEHA 5J0ZA 2EHOC 3UULA 3PUVF 2VVSA 1YXRA 2ZMAA 3UU5A 3C51A 4A56A 2V6XA 4LF6T 2BG9E 4O4HE 4Q25A 5AQFB 3WAKA 1HFAA 4QH5A 4U72A 3JC6C 4B3RT 5LNKA 4FI5A 2V7JA 2WAUA 2BBHA 4EZHA 2DWKA 4OK0A 4WYVA 1J1JA 2FJBA 3V5UA 3RH3A 4YHJA 2WP9A 2VKDA 2K3WA 3I0QA 4HTEA 2J62A 2KWIB 2P9BA 4ZOLE 3PUGA 4CZZB 3HKBE 4HFHA 3Q9DA 4Z90A 2YINA 4WZXA 4IE6A 3ZJ2A 1KNZA 2KXPB 4LMLA 4LF7T 4KHPT 1MNEA 5FL1A 2Y8DA 5F3JA 3CQXC 4AKIA 3PURA 3TLWA 4X64T 4A97A 3FZMB 5KMGP 2JRKA 3QB5K 1S35A 4TWHA 3GWHA 3ZPOA 3J9X1 2SPCA 3D0TA 2JQ9A 3AAEB 2ZM6T 2AE9A 1ZHCA 2VL0A 3MZKB 3RC3A 3M3ZB 3AAIA 5H6QB 4MFRA 3N9PA 1E2AA 4QWNB 2K9AA 2WBLA 3MK7C 3PE0A 3HA4A 3ZN0B 5J2TE 2X0LB 2M6BA 2D2SA 4ZS3A 3K3QC 2YDRA 4M1PA 1IAPA
chains in the Genus database with same CATH topology
3SWHA 2IC9A 3AA0B 4MLKA 3AVSA 4OYJA 5HAXA 4CXYA 3ETVA 5FXVA 2OA5A 4O2BE 4ISSA 5HWYA 5JH7E 2VL8A 4GK5E 2VKOA 5FXZA 2CXLA 5BMVE 4B6XA 5JR9C 2H7OA 3Q2MA 5JDGA 3RYFE 4WBNE 1HTJF 1YW0A 4CI1B 4G2AA 3FXEB 5FP3A 3FBLA 5JRCB 5JVDE 4UELA 2XAGB 4I50E 3SRZA 5DJQC 3PUQA 5FXXA 1YD8G 3LK42 1IJ5A 2ZM8A 4C91A 3OYXA 4QHOA 4H9QC 3ZCIA 2C5JA 2KT9A 2ZM2A 3LK2B 3EVYA 4JEHB 3KVBA 5J1GA 3ZMZB 3U78A 1MMGA 5LP6E 4KMCA 3GA8A 3PU3A 4H9NC 2DHRA 4I43B 2XHEB 5FXWA 3R6NA 5H6RB 4AKLA 3H3AA 3NZPA 3OBVE 4QX7B 2YK0A 3KFWX 5EK3A 2UXXB 5FNVE 3VU7H 2CA5A 2V1DB 4TN7B 2K24A 1Y64B 4E7ZA 3VKHA 3RRCA 1MMDA 3HKCE 4QKNA 4IDZA 3PTRB 3N2GE 3Q5XA 2N9DA 2D0TA 4UV9B 2KNDA 4AKHA 2NOXA 1LKXA 1HCIA 1HG5A 5CA1E 5LCYA 3F31A 4UIGA 3RRWA 4KP3C 1H7CA 4MHCA 4PW8A 4AKRB 3H37A 4H9PC 3RC8A 4EIWA 4AQFA 1KK7A 3KDSE 4ANJA 3I9YA 2QA7A 3O4XE 4PK6A 5LGUB 1US7B 2XAHB 2XAJB 2EHOB 3EDVA 3LFMA 3L09A 2BZBA 1D0ZA 3EUHA 3MACA 3NRYA 4OYKA 5E0OA 5FY1A 3ZYKA 3ZYMA 5IHYA 3DJBA 3RYCE 2Q9QA 3S4UA 3NBXX 3C4ZA 4CXWA 2X66A 3UTKA 1X79A 2Q9QD 4QX8B 4EYUA 3FB2A 1D1BA 5JDLA 5LGTB 3ZEFB 2V7IA 2LT3A 4EYYR 4ZI2D 4DVDA 5L3FB 3B13A 3BQIA 3KV5A 4H63H 4BAYB 3AAAB 1D1CA 3AA6B 3LBXB 2JMKA 4WBOA 3I0OA 4K0UA 4X20E 1S94A 1U4QA 3GMIA 4UVCB 4HE8A 2DCFA 3CMLA 3ZC1A 1ZEEA 4M1PA 3E08A 4HFVA 1WLXA 3O1JA 3CQCB 2LSGA 5TAOA 4EB6E 1UX4A 2LM9A 4DBQA 2JQQA 3IF8B 4FJOA 1YKEB 3B57A 2G0UA 2KZ7B 4GYRA 3ANWA 1QUUA 4PJLA 1D0YA 4BJNA 4O4JE 1WYBA 1MIVA 2LHRA 2XASB 3ZLIA 3DTOA 2CLYB 3NZQA 4AKGA 2ODVA 1MNDA 4EOZB 4H9SE 3TKLB 2CXFA 2MYSA 2MOZA 2PFVA 2PG8A 3ZN1B 3GN5A 3HKDE 4OHFA 1NAFA 2VKJA 4IE0A 2VB6A 2ODUA 3W15B 4TX5A 4V1Av 3HR0A 3KV4A 4O8SA 4WW0A 2CXDA 4KUMB 3FXDB 5FY7A 1MMAA 3N9OA 4I55E 4DNDA 2J1DG 5HWXA 2NTYA 4ISTA 5HXRA 2XAFB 2ES0A 5L2LA 3FHNA 4O4LE 3E0ZA 2XAQB 1SHZC 3K8PC 2CWOA 4OFZA 4MBQA 4HKAA 3ZMSB 4H63V 2GK9A 2E9XB 5LXTE 4ZHQE 4AQFC 5HYAA 3K3OA 2E9XD 2CMRA 5L3EB 5LG4A 3ZC0A 5JRCA 2JPFA 2X67A 1HF8A 2Q9QC 2X9HA 4QXCB 4MALA 4TZ4C 3ONXA 2DNXA 4CXXA 2LSJA 4ZI2C 4UV8B 4NUVA 2KINB 2XUEA 4I4TE 4E7SA 5FMNA 4KBMB 3N9QA 1Z0PA 5LHIB 3N9LA 3EDUA 1WRDA 4CI2B 3WI3A 3FBZA 2W62A 4O2AE 1BR2A 4F6RC 4HN9A 1NWMX 3F57A 4IIJE 4DBRA 2X9XA 4JUYA 1O3XA 4XZCA 2CCQA 2BVLA 3T8OA 3QK6A 4H9OC 2BDEA 2IAKA 1IJ6A 3R84B 1UCUA 5JDNA 4IE7A 2W0GA 2NW9A 3MKDA 4HEAA 3ESLA 3LJCA 4H9RC 2WMOA 3LG7A 3RYIE 1MIYA 3UUXB 2CEAA 2EHOA 4DMWA 4EZ4A 2DWGA 2QGSA 5HXHA 4UF0B 4ZI7E 2EHOD 3RPUA 4UVAB 2KWHA 2PBIA 3AA1B 1T98A 4BA9A 3HI2A 3C4WA 1FEWA 3K3NA 3C4XA 2CM0A 5CA0E 1AJ3A 5LJMA 1WYCA 2V7LA 1LRZA 2PJQA 3BQLA 4GIWA 2V26A 3VKGA 4IE4A 2DI4A 3L3PA 5L3GB 2B1EA 5JR9B 5LHGB 2E9XC 2K5BB 2DLRA 2NWBA 5JQGE 3M65A 4YJ2E 4UVBB 3LBXA 3PDYA 2VKHA 5LJNA 3PUAA 2E8IA 2KMFA 2LSIA 5JREA 4YJ3E 1OXZA 5L3CB 3JC6D 4UEMA 3PU8A 2MTQA 1OWAA 2WWUA 3OYZA 1BR0A 5JDFA 4L0RA 3UUNA 2Y48B 4PFPA 1HX8A 1FIOA 3KINB 3UT5E 3N2KE 4ZS2A 5HXSA 4QXHB 5LHHB 4TV8E 4PK5A 2HPLA 1SA0E 2N2NA 3AA7B 4X1KE 5J2UE 4C90A 2C5KT 3KBUA 2UXNB 1ZKEA 5JDQA 2IC6A 2YEVC 3UUMA 1D1AA 2CE7A 3QC9A 4AQGA 5L3BB 1MIWA 3VHLA 3BQKA 3KV9A 5JDMA 3RX6A 5FYMA 3HKEE 5GONE 2W63A 3NRXA 2BVMA 2X9WA 1G73A 4UXNB 2HH7A 5ETWA 3UFEA 5LGNB 4PJJA 1V9DA 3MA9A 3CX8B 2XQYA 5F8PA 4PJMA 3Q5WA 3HL6A 4J2CA 4PFOA 1FMWA 4PJNA 5DQWA 3C50A 4JLEA 4ASKA 2L9QA 4N78D 4P09A 1D0XA 2L3LA 3SOLA 2C0SA 2D5UA 2WSSV 1LVFA 2E9XA 2LHNA 3ZMTB 1HG2A 3ZJ1A 2LEHA 3CKDA 3IBPA 4TV9E 1E1HB 4AXPA 1B7TA 2EHOC 3KV6A 3P7IA 5CB4E 5LYJE 3UULA 2X51A 3IEEA 2ZMAA 3N9MA 2CWYA 3SS1A 4ZI3D 3C51A 2A72A 2LE8A 2A3DA 3O1IA 4GYSA 3AB3B 4A56A 2H3RA 3O1HA 4L5GA 3C98B 2RA1A 2MBGA 4PNIA 4WNKA 5LOVE 5FY0A 3RYHE 2YU2A 4O4HE 4XBFB 2JMHA 3WAKA 3I9WA 5ADXL 4P0BA 3U3IA 1HFAA 3CQGB 4GOUA 1CUNA 4U72A 3JC6C 3A5XA 3CPZA 2NW7A 3ZCJA 3N9NA 5LNKA 4FI5A 2V7JA 2WAUA 1EZ3A 1VOMA 2JJ9A 3MXZA 4EZHA 2DWKA 4OK0A 3OKQA 4CI3B 4EAHA 4YLHA 3V5UA 3RH3A 5EK2A 4YHJA 4CQIA 2VKDA 3P8CD 5HXCA 3I0QA 4TUYE 4HTEA 3C64A 2KWIB 3MJXA 2NP9A 2KLQA 4DO0A 2CLYC 2P9BA 1LVKA 3CWZB 3J7Yq 4GK0E 4ZOLE 5LA6E 5M4YA 4U74A 3QUJA 2HPJA 3RKOA 3PUGA 4X1IE 4ERRA 4CZZB 4JEUB 4BJMA 4UF0A 5EK4A 2NTXA 3HKBE 1VRBA 3CX7B 3ZMVB 2A2FX 3CX6B 5HXEA 3IHRA 2LOPA 3Q9DA 1UX5A 5A1LA 3CVRA 3AVRA 1BR1A 2YINA 4IGUA 4IE6A 3ZJ2A 2XTLA 4ADZA 3ETUA 3I1AA 2VWAA 1U5PA 4O4IE 1KNZA 5JR9A 2ACXA 2KXPB 1YKHB 1HS7A 2W61A 1MNEA 2I59A 4P0AA 4AI6A 5JDHA 4ZI3C 2Y8DA 5F3JA 2Q9QB 3CQXC 4AKIA 4QXBB 1BR4A 2V7KA 5IYZE 1G8XA 5LBQB 3PURA 2WM9A 3KBTA 1ZV4X 4DMVA 4EXTA 4PAGA 3OJAA 2Y6XA 4L9IA 5KMGP 3F2EA 1WR6A 4PK4A 2H7VC 2JRKA 5EZYE 1S35A 2RP4A 2X9YA 4XAXB 4YFSA 2Z6EA 3ZYLA 3GWHA 3WAJA 2ZLYA 2X68A 1IZNB 2W00A 2VASA 3ZPOA 2N1GA 4G63A 2SPCA 3J9X1 3D0TA 2M67A 3AAEB 2C5IT 2K48A 3N2OA 2LOSA 3BK9A 1FMVA 1ZHCA 2LSKA 3MZKB 3ZMUB 3V5SA 3ANWB 1MMNA 2NW8A 4IE5A 3RC3A 2LSYA 4Z8XA 3DP7A 5C8YE 3AAIA 4NUUA 5H6QB 2VK9A 5KX5E 4MFRA 5LBMA 3N9PA 5KDMC 5DABA 2L8KA 5AFUL 3N5LA 3PUSA 4QWNB 2K9AA 3LK3B 4X1YE 3KVAA 5L3DB 4IHJE 2LJLA 2WBLA 2WMNA 2YU1A 3MK7C 4HGAA 3O9XA 3PE0A 3HA4A 3GN5B 3ZN0B 5J2TE 5DQVA 3E22E 2D0UA 2X0LB 2D2SA 4ILUA 4ZS3A 2V7MA 3K3QC 2IW5B 2ZM0A 1QSDA 1IAPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E1H B;  3K3Q C; 
#chains in the Genus database with same CATH topology
 3AA0 B;  4NPP A;  3AVS A;  5HAX A;  4CXY A;  4O2B E;  5HWY A;  5BR8 T;  2VKO A;  2CXL A;  3CK6 A;  5JDG A;  4WBN E;  3K1S A;  1HTJ F;  1YW0 A;  2BKN A;  1XZY A;  5JRC B;  5DJQ C;  2H89 A;  4X5T A;  4JI6 T;  4C91 A;  4QHO A;  4COF A;  2C5J A;  2ZM2 A;  3NVO A;  2UXB T;  2BS3 A;  3ZMZ B;  5FVK A;  5AQQ B;  3GA8 A;  1OED A;  3PU3 A;  4ZEY A;  5FXW A;  2WS3 A;  1IBL T;  4YTN A;  3RLF F;  2BS4 A;  2QRX A;  3Q5X A;  2KND A;  2NOX A;  5ABF A;  5HEO A;  1J5W A;  2WQY A;  1N33 T;  2UXD T;  3H37 A;  4EIW A;  1KK7 A;  3I9Y A;  5E0O A;  3LFM A;  3EUH A;  3ZYK A;  2BG9 B;  3RI5 A;  2RPA A;  4CXW A;  2X66 A;  1X79 A;  4QX8 B;  4U3C A;  2IIU A;  2AXD S;  2QVA A;  5JDL A;  4EYY R;  2J47 A;  3AAA B;  4WBO A;  4K0U A;  1S94 A;  1U4Q A;  2DCF A;  3E08 A;  3UQ7 A;  5TAO A;  1UX4 A;  4DBQ A;  1N34 T;  2G0U A;  2KZ7 B;  1KF6 A;  4GYR A;  4LFC T;  4O4J E;  3AE2 A;  3AEA A;  1XMQ T;  4B3T T;  2ODV A;  1MND A;  2MYS A;  3GN5 A;  4OHF A;  4WW0 A;  4GKJ T;  2CXD A;  1MMA A;  2XSA A;  3N9O A;  1FJG T;  2J1D G;  5HXR A;  3UU4 A;  5HEU A;  3UFG A;  3FHN A;  5L2L A;  2LLY A;  3E0Z A;  3K8P C;  2CWO A;  4MBQ A;  4LF8 T;  2WDR A;  4ZHQ E;  3P4W A;  3K3O A;  1VCT A;  2BG9 C;  2W67 A;  4QXC B;  4CXX A;  2KIN B;  4E7S A;  2BS2 A;  3ZT5 A;  2JQH A;  1WCR A;  3EDU A;  4O2A E;  1BR2 A;  4AIU A;  4IIJ E;  2XQ9 A;  1N32 T;  2BVL A;  3AEE A;  3QK6 A;  4KHZ F;  1IJ6 A;  4IE7 A;  1UUS A;  5FVL A;  3MKD A;  4HEA A;  3T1H T;  3RYI E;  3UUX B;  4EZ4 A;  2DWG A;  5HXH A;  4UF0 B;  4ZI7 E;  5L4E A;  3K3N A;  2CM0 A;  2FUP A;  5AQR B;  2V26 A;  2FBW A;  3VKG A;  3L3P A;  2CBI A;  5LJN A;  3PUA A;  1HNZ T;  5L3C B;  1JNZ A;  2FJA A;  3UUN A;  3RQW A;  1FIO A;  4YSY A;  4U33 A;  5HXS A;  4U7Y A;  4JI7 T;  4TV8 E;  1SA0 E;  2N2N A;  5HCM A;  3KBU A;  3AE7 A;  1ZKE A;  2UUC T;  4YXD A;  4AQG A;  1MIW A;  3TLV A;  3RX6 A;  3HKE E;  2W63 A;  2BVM A;  2HN1 A;  4PJJ A;  3MA9 A;  2WDQ A;  2XQ6 A;  3CX8 B;  4IDO A;  2IML A;  4J2C A;  1IBM T;  5L4H A;  2C0S A;  2WSS V;  4HWC A;  4ILC A;  1HG2 A;  3ZJ1 A;  5AQN B;  3IBP A;  4TV9 E;  1E1H B;  1B7T A;  3KV6 A;  2X51 A;  3IEE A;  3AE3 A;  5HCJ A;  3SS1 A;  4ZI3 D;  3O1I A;  2H3R A;  3O1H A;  4L5G A;  2RA1 A;  4WNK A;  2CRB A;  4DV5 T;  2J4G A;  3CQG B;  1CUN A;  2WZI A;  3CPZ A;  2NW7 A;  3PJA J;  3ZCJ A;  4DUY T;  4EAH A;  4YLH A;  2W66 A;  3AE5 A;  2XQ5 A;  1WR0 A;  1Y01 A;  5LMU T;  4TUY E;  3CIR A;  2CLY C;  1LVK A;  4U74 A;  3QUJ A;  5CGM A;  4JEU B;  5EK4 A;  5LMN T;  3CX7 B;  5HXE A;  2LOP A;  2E5L T;  1BR1 A;  4IGU A;  3TLS A;  2XTL A;  4JI2 T;  3AXJ A;  1U5P A;  4O4I E;  4YSZ A;  5JR9 A;  1XDO A;  2ACX A;  1UUR A;  4YSX A;  2W61 A;  4U31 A;  5JDH A;  4DR4 T;  4QXB B;  2V7K A;  5IYZ E;  5FL0 A;  2WM9 A;  4JYA T;  4EXT A;  4PAG A;  3JAE A;  4L9I A;  4KI0 F;  4PK4 A;  5EZY E;  4XAX B;  2Z6E A;  3ZYL A;  4JI0 T;  3VR9 A;  4A98 A;  2M67 A;  3BK9 A;  3ZMU B;  2LSK A;  3V5S A;  3ANW B;  2NW8 A;  5C8Y E;  4IL4 A;  3LK3 B;  4X1Y E;  5L3D B;  2LJL A;  4HGA A;  4EED A;  4ILU A;  2UU9 T;  5CA1 E;  2IC9 A;  5AQS B;  2ACZ A;  3LSV A;  4OX9 T;  5JR9 C;  4B6X A;  5AQK B;  3ZSS A;  4CI1 B;  3FXE B;  3FBL A;  4UEL A;  3AE4 A;  3SRZ A;  5FXX A;  1YD8 G;  3LK4 2;  1IJ5 A;  2IUB A;  4H9Q C;  4JEH B;  3EVY A;  2B76 A;  5J1G A;  4F8H A;  5HEH A;  2DHR A;  5H6R B;  2XY8 B;  3OBV E;  3KFW X;  2UXX B;  3VU7 H;  2V1D B;  4TN7 B;  4EGW A;  4E7Z A;  5C3J A;  4ILB A;  1W0B A;  4QKN A;  3Q5E A;  3N2G E;  2D0T A;  2D9D A;  1LKX A;  1HG5 A;  4YT0 A;  1H7C A;  4AKR B;  2XQ8 A;  3RC8 A;  3KDS E;  1YQ3 A;  2QA7 A;  5LGU B;  2XAH B;  3L09 A;  2WU5 A;  3NRY A;  3RF1 A;  3ZYM A;  3AED A;  2E2A A;  3NBX X;  3UTK A;  2Q9Q D;  4NXN T;  1D1B A;  5LGT B;  2V7I A;  3Q5D A;  2V6Y B;  5L3F B;  4H63 H;  4BAY B;  1D1C A;  2JMK A;  3I0O A;  3T1Y T;  3GMI A;  4HE8 A;  3ZC1 A;  3O1J A;  5AQL B;  4EB6 E;  1YKE B;  4BJN A;  2LHR A;  2XAS B;  3ZLI A;  2XZE A;  4EOZ B;  4DV7 T;  2CXF A;  2PFV A;  1NAF A;  2VKJ A;  2XM2 A;  1UGO A;  2VB6 A;  4IDP A;  2ODU A;  4TX5 A;  4V1A v;  4KUM B;  5FY7 A;  5HWX A;  2NTY A;  1I6Z A;  4O4L E;  3P50 A;  1SHZ C;  2E9X B;  2CMR A;  4HWF A;  1T8B A;  4IT4 A;  5JRC A;  2JPF A;  1HF8 A;  4B3M T;  4AIS A;  1XNQ T;  2JIW A;  4DV0 T;  4MAL A;  4TZ4 C;  3ONX A;  2LSJ A;  4ZI2 C;  2YKS A;  4NUV A;  4KBM B;  4CI2 B;  3WI3 A;  4F6R C;  1NEN A;  1NWM X;  4HN9 A;  5HEG A;  4DBR A;  2X9X A;  4JUY A;  2CCQ A;  3T8O A;  4DV4 T;  5C2T A;  2W0G A;  3P4P A;  3AE6 A;  4HFE A;  5HEJ A;  2BG9 A;  2EHO D;  4UVA B;  3AA1 B;  1T98 A;  3C4W A;  3C4X A;  5CA0 E;  1AJ3 A;  5LJM A;  3AE9 A;  2DI4 A;  5L3G B;  5ABH A;  2E9X C;  2K5B B;  2NWB A;  5JQG E;  3PDY A;  2VKH A;  2E8I A;  2LSI A;  4YJ3 E;  3JC6 D;  1OWA A;  2WWU A;  4QH4 A;  5FKY A;  3VRA A;  2Y48 B;  1HX8 A;  4K0K T;  4X1K E;  2V5D A;  1T72 A;  4U7I A;  2YEV C;  3JCF A;  5L3B B;  2XM1 A;  3RIF A;  3ONL C;  2YOE A;  5JDM A;  5FYM A;  3UU6 A;  5GON E;  5AQP B;  1G73 A;  4UXN B;  5ETW A;  3UFE A;  1Z8U A;  1QLB A;  5F8P A;  3FZK B;  3HL6 A;  1ZP0 A;  2LRK A;  2YN6 A;  4PFO A;  5DQW A;  4JLE A;  5F5W A;  1L0V A;  4N78 D;  1D0X A;  2D5U A;  1LVF A;  3AEC A;  4AXP A;  3P7I A;  1XNR T;  3VR8 A;  3N9M A;  2UUB T;  2OLT A;  2LE8 A;  1W0A A;  4NIQ A;  3AB3 B;  5FY0 A;  4XBF B;  2JMH A;  2UUA T;  3I9W A;  4ZXL A;  3U3I A;  4GOU A;  4I0U A;  3N9N A;  1EZ3 A;  1VOM A;  2JJ9 A;  3RGL A;  3UUB A;  5EK2 A;  3P8C D;  4CN6 A;  3C64 A;  3RKG A;  2NP9 A;  2KLQ A;  4TNW A;  2CHN A;  4ERR A;  4X62 T;  4UF0 A;  2NTX A;  3IHR A;  3PV0 F;  5A1L A;  3CVR A;  3AVR A;  3UU8 A;  4ADZ A;  3ETU A;  3I1A A;  5KXJ A;  2WY2 A;  5LB7 B;  4Z91 A;  1YKH B;  3FZL B;  4TWF A;  4AI6 A;  2Q9Q B;  2I6H A;  4HWI B;  5LBQ B;  3KBT A;  4DMV A;  4EEB A;  3EI0 A;  4QH1 A;  3OJA A;  2Y6X A;  3F2E A;  2RP4 A;  2X9Y A;  2BKO A;  2ZLY A;  2X68 A;  1IZN B;  2W00 A;  1W09 A;  4LFB T;  3P4Q A;  2E5V A;  2C5I T;  4UR9 A;  1UK5 A;  4IE5 A;  2MAW A;  2LSY A;  4Z8X A;  4ZZB A;  2NR4 A;  4NUU A;  5KX5 E;  5LBM A;  5KDM C;  5DAB A;  2L8K A;  5AFU L;  2LRL A;  3PUS A;  4IHJ E;  2YU1 A;  3E22 E;  2D0U A;  2V7M A;  4DV6 T;  4LMJ A;  2IW5 B;  1QSD A;  3SWH A;  2XJ7 A;  5FXV A;  2OA5 A;  4GK5 E;  5FXZ A;  5BMV E;  2H7O A;  3RYF E;  5FP3 A;  4I50 E;  4LF5 T;  3PUQ A;  4GKK T;  2IDO B;  1IBK T;  2KT9 A;  4YTP A;  3LK2 B;  3QB5 A;  2WZH A;  5CFB A;  4H9N C;  4I43 B;  3P4S A;  3R6N A;  2VVN A;  3H3A A;  5FNV E;  2YK0 A;  1GQE A;  4JI1 T;  2K24 A;  3VKH A;  1MMD A;  3LDQ B;  3PTR B;  1HNW T;  4UV9 B;  3P4R A;  4AKH A;  4DID B;  3F31 A;  4UIG A;  4KP3 C;  4PW8 A;  4H9P C;  4JI3 T;  4ANJ A;  3B5M A;  3O4X E;  1US7 B;  2EHO B;  3EDV A;  3MAC A;  2BZB A;  1D0Z A;  4DV1 T;  5FY1 A;  5IHY A;  3DJB A;  3RYC E;  3S4U A;  3ZT7 A;  5IWA T;  3QNU A;  4AQY T;  3VRB A;  4DVD A;  3BQI A;  4DR6 T;  3PUW F;  3AA6 B;  3LBX B;  4JI5 T;  4UVC B;  4DR5 T;  1DU2 A;  3CML A;  1ZEE A;  1WLX A;  3CQC B;  2LSG A;  5AQT B;  2WDV A;  3B57 A;  1E7P A;  1QUU A;  3ANW A;  2X0H A;  1MIV A;  2XQ4 A;  3ZT6 A;  3DTO A;  4AKG A;  4ILA A;  5AQJ B;  3TKL B;  3EAM A;  3H3M A;  4JI8 T;  3ZN1 B;  3OVU A;  1HX1 B;  2CBJ A;  3HR0 A;  3KV4 A;  4O8S A;  1OED E;  4CN1 A;  4IDN A;  3IA3 A;  2XAF B;  2XPK A;  4DR7 T;  3SFE A;  4H63 V;  2GK9 A;  1KNR A;  2BBJ A;  5LXT E;  5HYA A;  5L3E B;  5AQO B;  2X67 A;  3AEF A;  3TLT A;  3ONJ A;  2X9H A;  3ZST A;  5AQH B;  4UV8 B;  4I4T E;  5FMN A;  1SUM B;  5AQM B;  4DUZ T;  2M6I A;  1WRD A;  3FBZ A;  3F57 A;  3UU3 A;  1SE7 A;  4H9O C;  2IAK A;  2V8S V;  1XMO T;  3ESL A;  3LG7 A;  1MIY A;  2FJD A;  4ZZC A;  2QYW A;  2KWH A;  3HI2 A;  1FEW A;  2HHH T;  1WYC A;  2V7L A;  2PJQ A;  2BKP A;  4GIW A;  2V6Y A;  4IE4 A;  2B1E A;  4YJ2 E;  4UVB B;  2KMF A;  5JRE A;  3AE1 A;  2FJE A;  2I0M A;  5JDF A;  1J5E T;  4PFP A;  5L47 A;  3KIN B;  3UT5 E;  4ZS2 A;  3OTO T;  4QXH B;  2WB5 A;  4PK5 A;  4C90 A;  2UXN B;  1KFY A;  5JDQ A;  2A9U A;  1D1A A;  2CE7 A;  3QC9 A;  2VQF T;  3BQK A;  1HR0 T;  2X9W A;  4KX6 A;  5LGN B;  4P1N A;  2XQ3 A;  4PJM A;  3Q5W A;  4HFI A;  4ASK A;  4P09 A;  2L3L A;  3SOL A;  3SFD A;  5CJ5 A;  3FZH B;  2E9X A;  4U2Z A;  3ZMT B;  2MPK A;  3CKD A;  5CB4 E;  5LYJ E;  2CWY A;  2A72 A;  3A8Y C;  2A3D A;  4GYS A;  2OV9 A;  3C98 B;  2MBG A;  4PNI A;  5LOV E;  3RYH E;  2YU2 A;  5ABE A;  2VQE T;  1KNP A;  2F4V T;  4JBW F;  5ADX L;  4P0B A;  3A5X A;  1R8I A;  4HFD A;  3MXZ A;  4NXM T;  4DR1 T;  3OKQ A;  4CI3 B;  4A5X A;  3RHW A;  1XWM A;  4CQI A;  5HXC A;  4TWD A;  3MJX A;  4DO0 A;  4X66 T;  1OED B;  3CWZ B;  3J7Y q;  4GK0 E;  5M4Y A;  5LA6 E;  2HPJ A;  3EAB A;  3RKO A;  4X1I E;  4HWH A;  4DV3 T;  4BJM A;  2H88 A;  3ZMV B;  1VRB A;  2A2F X;  3CX6 B;  1UX5 A;  1X9B A;  4YY3 T;  5ABF B;  2VWA A;  3L39 A;  1HS7 A;  2I59 A;  4P0A A;  1XDP A;  4ZI3 C;  2W2U A;  4DR3 T;  4CN4 A;  1BR4 A;  4JI4 T;  5AQV B;  2R6G F;  1G8X A;  3A7M A;  1ZV4 X;  4YTM A;  3RIU A;  3AE8 A;  2YDS A;  2WCA A;  2V5C A;  1WR6 A;  2H7V C;  5LG3 A;  4YFS A;  3WAJ A;  2XSB A;  3JAD A;  2VAS A;  2N1G A;  4G63 A;  4X65 T;  2K48 A;  3N2O A;  2LOS A;  4TNV A;  1FMV A;  1MMN A;  3DP7 A;  2VK9 A;  3N5L A;  1OED C;  3PJA A;  3KVA A;  3O9X A;  2WMN A;  3GN5 B;  5DQV A;  2ZM0 A;  3TLU A;  4OYJ A;  4MLK A;  1JNR A;  3JAF A;  3ETV A;  2PTF A;  5JH7 E;  4ISS A;  2VL8 A;  3UQ4 A;  2IHR 1;  3Q2M A;  1M62 A;  2YDQ A;  1ZOY A;  4G2A A;  5JVD E;  5AQU B;  2XAG B;  4HWD A;  2ZM8 A;  3OYX A;  3ZCI A;  3RIU C;  3RQU A;  3KVB A;  3U78 A;  2W4X A;  2VUR A;  1MMG A;  5LP6 E;  4KMC A;  1YQ4 A;  2XHE B;  4AKL A;  3NZP A;  4QX7 B;  5EK3 A;  2CA5 A;  1Y64 B;  3RRC A;  2WWV A;  3NWI A;  3HKC E;  4IDZ A;  2N9D A;  1HCI A;  5LCY A;  3RRW A;  4LF4 T;  1I94 T;  4MHC A;  3EHZ A;  4AQF A;  4PK6 A;  4B3S T;  2XAJ B;  1T7S A;  4OYK A;  2CHO A;  2Q9Q A;  5AQG B;  3C4Z A;  1KEY A;  1CHU A;  1VCS A;  4EYU A;  3OPC A;  3FB2 A;  3PUY F;  4JV5 T;  3ZEF B;  2KSR A;  2LT3 A;  4ZI2 D;  3B13 A;  3KV5 A;  3FZF B;  4U2Y A;  4X20 E;  4HFV A;  2LM9 A;  2JQQ A;  3IF8 B;  3AEB A;  4FJO A;  4PJL A;  1D0Y A;  1WYB A;  2CLY B;  3NZQ A;  4H9S E;  2MOZ A;  2PG8 A;  3HKD E;  4IE0 A;  1WFD A;  3W15 B;  2WU2 A;  3FXD B;  4DND A;  4I55 E;  3ABV A;  4IST A;  2LM2 A;  2ES0 A;  2XAQ B;  4OFZ A;  4HKA A;  3ZMS B;  4AQF C;  2XQA A;  1NEK A;  2E9X D;  3PUX F;  1N36 T;  3G06 A;  5LG4 A;  3ZC0 A;  3AEG A;  2CPT A;  2X0Y A;  2Q9Q C;  4HFB A;  2DNX A;  2XUE A;  4DR2 T;  4HFC A;  3N9Q A;  1Z0P A;  5LHI B;  4LMK A;  4LF9 T;  3N9L A;  4DV2 T;  2W62 A;  5ABG A;  1O3X A;  4XZC A;  4IDQ A;  4IRE A;  1W9R A;  2BDE A;  3R84 B;  1UCU A;  5JDN A;  1HNX T;  2NW9 A;  3LJC A;  4H9R C;  2WMO A;  4EV6 A;  5JTG A;  2CEA A;  2EHO A;  3QOF A;  4DMW A;  2QGS A;  3RPU A;  2DL1 A;  2PBI A;  4BA9 A;  3ZKR A;  1LRZ A;  3BQL A;  3AXJ B;  5AQI B;  5JR9 B;  5LHG B;  2DLR A;  3M65 A;  3LBX A;  3L8R A;  1OXZ A;  4UEM A;  3PU8 A;  2MTQ A;  1BR0 A;  3OYZ A;  4L0R A;  2LKH A;  3N2K E;  5LHH B;  4YHH T;  2HPL A;  3AA7 B;  5J2U E;  2C5K T;  2IC6 A;  3UUM A;  3VHL A;  3KV9 A;  3X1D A;  3NRX A;  3PUZ F;  2HN2 A;  2HH7 A;  4IL9 A;  1M7K A;  1V9D A;  5IUX A;  2LKG A;  2XQY A;  2XQ7 A;  1FMW A;  2JQK A;  4PJN A;  3C50 A;  2UXC T;  2L9Q A;  3RIA A;  4LFA T;  2LHN A;  3NKZ A;  2LEH A;  5J0Z A;  2EHO C;  3UUL A;  3PUV F;  2VVS A;  1YXR A;  2ZMA A;  3UU5 A;  3C51 A;  4A56 A;  2V6X A;  4LF6 T;  2BG9 E;  4O4H E;  4Q25 A;  5AQF B;  3WAK A;  1HFA A;  4QH5 A;  4U72 A;  3JC6 C;  4B3R T;  5LNK A;  4FI5 A;  2V7J A;  2WAU A;  2BBH A;  4EZH A;  2DWK A;  4OK0 A;  4WYV A;  1J1J A;  2FJB A;  3V5U A;  3RH3 A;  4YHJ A;  2WP9 A;  2VKD A;  2K3W A;  3I0Q A;  4HTE A;  2J62 A;  2KWI B;  2P9B A;  4ZOL E;  3PUG A;  4CZZ B;  3HKB E;  4HFH A;  3Q9D A;  4Z90 A;  2YIN A;  4WZX A;  4IE6 A;  3ZJ2 A;  1KNZ A;  2KXP B;  4LML A;  4LF7 T;  4KHP T;  1MNE A;  5FL1 A;  2Y8D A;  5F3J A;  3CQX C;  4AKI A;  3PUR A;  3TLW A;  4X64 T;  4A97 A;  3FZM B;  5KMG P;  2JRK A;  3QB5 K;  1S35 A;  4TWH A;  3GWH A;  3ZPO A;  3J9X 1;  2SPC A;  3D0T A;  2JQ9 A;  3AAE B;  2ZM6 T;  2AE9 A;  1ZHC A;  2VL0 A;  3MZK B;  3RC3 A;  3M3Z B;  3AAI A;  5H6Q B;  4MFR A;  3N9P A;  1E2A A;  4QWN B;  2K9A A;  2WBL A;  3MK7 C;  3PE0 A;  3HA4 A;  3ZN0 B;  5J2T E;  2X0L B;  2M6B A;  2D2S A;  4ZS3 A;  3K3Q C;  2YDR A;  4M1P A;  1IAP A; 
#chains in the Genus database with same CATH homology
 3SWH A;  2IC9 A;  3AA0 B;  4MLK A;  3AVS A;  4OYJ A;  5HAX A;  4CXY A;  3ETV A;  5FXV A;  2OA5 A;  4O2B E;  4ISS A;  5HWY A;  5JH7 E;  2VL8 A;  4GK5 E;  2VKO A;  5FXZ A;  2CXL A;  5BMV E;  4B6X A;  5JR9 C;  2H7O A;  3Q2M A;  5JDG A;  3RYF E;  4WBN E;  1HTJ F;  1YW0 A;  4CI1 B;  4G2A A;  3FXE B;  5FP3 A;  3FBL A;  5JRC B;  5JVD E;  4UEL A;  2XAG B;  4I50 E;  3SRZ A;  5DJQ C;  3PUQ A;  5FXX A;  1YD8 G;  3LK4 2;  1IJ5 A;  2ZM8 A;  4C91 A;  3OYX A;  4QHO A;  4H9Q C;  3ZCI A;  2C5J A;  2KT9 A;  2ZM2 A;  3LK2 B;  3EVY A;  4JEH B;  3KVB A;  5J1G A;  3ZMZ B;  3U78 A;  1MMG A;  5LP6 E;  4KMC A;  3GA8 A;  3PU3 A;  4H9N C;  2DHR A;  4I43 B;  2XHE B;  5FXW A;  3R6N A;  5H6R B;  4AKL A;  3H3A A;  3NZP A;  3OBV E;  4QX7 B;  2YK0 A;  3KFW X;  5EK3 A;  2UXX B;  5FNV E;  3VU7 H;  2CA5 A;  2V1D B;  4TN7 B;  2K24 A;  1Y64 B;  4E7Z A;  3VKH A;  3RRC A;  1MMD A;  3HKC E;  4QKN A;  4IDZ A;  3PTR B;  3N2G E;  3Q5X A;  2N9D A;  2D0T A;  4UV9 B;  2KND A;  4AKH A;  2NOX A;  1LKX A;  1HCI A;  1HG5 A;  5CA1 E;  5LCY A;  3F31 A;  4UIG A;  3RRW A;  4KP3 C;  1H7C A;  4MHC A;  4PW8 A;  4AKR B;  3H37 A;  4H9P C;  3RC8 A;  4EIW A;  4AQF A;  1KK7 A;  3KDS E;  4ANJ A;  3I9Y A;  2QA7 A;  3O4X E;  4PK6 A;  5LGU B;  1US7 B;  2XAH B;  2XAJ B;  2EHO B;  3EDV A;  3LFM A;  3L09 A;  2BZB A;  1D0Z A;  3EUH A;  3MAC A;  3NRY A;  4OYK A;  5E0O A;  5FY1 A;  3ZYK A;  3ZYM A;  5IHY A;  3DJB A;  3RYC E;  2Q9Q A;  3S4U A;  3NBX X;  3C4Z A;  4CXW A;  2X66 A;  3UTK A;  1X79 A;  2Q9Q D;  4QX8 B;  4EYU A;  3FB2 A;  1D1B A;  5JDL A;  5LGT B;  3ZEF B;  2V7I A;  2LT3 A;  4EYY R;  4ZI2 D;  4DVD A;  5L3F B;  3B13 A;  3BQI A;  3KV5 A;  4H63 H;  4BAY B;  3AAA B;  1D1C A;  3AA6 B;  3LBX B;  2JMK A;  4WBO A;  3I0O A;  4K0U A;  4X20 E;  1S94 A;  1U4Q A;  3GMI A;  4UVC B;  4HE8 A;  2DCF A;  3CML A;  3ZC1 A;  1ZEE A;  4M1P A;  3E08 A;  4HFV A;  1WLX A;  3O1J A;  3CQC B;  2LSG A;  5TAO A;  4EB6 E;  1UX4 A;  2LM9 A;  4DBQ A;  2JQQ A;  3IF8 B;  4FJO A;  1YKE B;  3B57 A;  2G0U A;  2KZ7 B;  4GYR A;  3ANW A;  1QUU A;  4PJL A;  1D0Y A;  4BJN A;  4O4J E;  1WYB A;  1MIV A;  2LHR A;  2XAS B;  3ZLI A;  3DTO A;  2CLY B;  3NZQ A;  4AKG A;  2ODV A;  1MND A;  4EOZ B;  4H9S E;  3TKL B;  2CXF A;  2MYS A;  2MOZ A;  2PFV A;  2PG8 A;  3ZN1 B;  3GN5 A;  3HKD E;  4OHF A;  1NAF A;  2VKJ A;  4IE0 A;  2VB6 A;  2ODU A;  3W15 B;  4TX5 A;  4V1A v;  3HR0 A;  3KV4 A;  4O8S A;  4WW0 A;  2CXD A;  4KUM B;  3FXD B;  5FY7 A;  1MMA A;  3N9O A;  4I55 E;  4DND A;  2J1D G;  5HWX A;  2NTY A;  4IST A;  5HXR A;  2XAF B;  2ES0 A;  5L2L A;  3FHN A;  4O4L E;  3E0Z A;  2XAQ B;  1SHZ C;  3K8P C;  2CWO A;  4OFZ A;  4MBQ A;  4HKA A;  3ZMS B;  4H63 V;  2GK9 A;  2E9X B;  5LXT E;  4ZHQ E;  4AQF C;  5HYA A;  3K3O A;  2E9X D;  2CMR A;  5L3E B;  5LG4 A;  3ZC0 A;  5JRC A;  2JPF A;  2X67 A;  1HF8 A;  2Q9Q C;  2X9H A;  4QXC B;  4MAL A;  4TZ4 C;  3ONX A;  2DNX A;  4CXX A;  2LSJ A;  4ZI2 C;  4UV8 B;  4NUV A;  2KIN B;  2XUE A;  4I4T E;  4E7S A;  5FMN A;  4KBM B;  3N9Q A;  1Z0P A;  5LHI B;  3N9L A;  3EDU A;  1WRD A;  4CI2 B;  3WI3 A;  3FBZ A;  2W62 A;  4O2A E;  1BR2 A;  4F6R C;  4HN9 A;  1NWM X;  3F57 A;  4IIJ E;  4DBR A;  2X9X A;  4JUY A;  1O3X A;  4XZC A;  2CCQ A;  2BVL A;  3T8O A;  3QK6 A;  4H9O C;  2BDE A;  2IAK A;  1IJ6 A;  3R84 B;  1UCU A;  5JDN A;  4IE7 A;  2W0G A;  2NW9 A;  3MKD A;  4HEA A;  3ESL A;  3LJC A;  4H9R C;  2WMO A;  3LG7 A;  3RYI E;  1MIY A;  3UUX B;  2CEA A;  2EHO A;  4DMW A;  4EZ4 A;  2DWG A;  2QGS A;  5HXH A;  4UF0 B;  4ZI7 E;  2EHO D;  3RPU A;  4UVA B;  2KWH A;  2PBI A;  3AA1 B;  1T98 A;  4BA9 A;  3HI2 A;  3C4W A;  1FEW A;  3K3N A;  3C4X A;  2CM0 A;  5CA0 E;  1AJ3 A;  5LJM A;  1WYC A;  2V7L A;  1LRZ A;  2PJQ A;  3BQL A;  4GIW A;  2V26 A;  3VKG A;  4IE4 A;  2DI4 A;  3L3P A;  5L3G B;  2B1E A;  5JR9 B;  5LHG B;  2E9X C;  2K5B B;  2DLR A;  2NWB A;  5JQG E;  3M65 A;  4YJ2 E;  4UVB B;  3LBX A;  3PDY A;  2VKH A;  5LJN A;  3PUA A;  2E8I A;  2KMF A;  2LSI A;  5JRE A;  4YJ3 E;  1OXZ A;  5L3C B;  3JC6 D;  4UEM A;  3PU8 A;  2MTQ A;  1OWA A;  2WWU A;  3OYZ A;  1BR0 A;  5JDF A;  4L0R A;  3UUN A;  2Y48 B;  4PFP A;  1HX8 A;  1FIO A;  3KIN B;  3UT5 E;  3N2K E;  4ZS2 A;  5HXS A;  4QXH B;  5LHH B;  4TV8 E;  4PK5 A;  2HPL A;  1SA0 E;  2N2N A;  3AA7 B;  4X1K E;  5J2U E;  4C90 A;  2C5K T;  3KBU A;  2UXN B;  1ZKE A;  5JDQ A;  2IC6 A;  2YEV C;  3UUM A;  1D1A A;  2CE7 A;  3QC9 A;  4AQG A;  5L3B B;  1MIW A;  3VHL A;  3BQK A;  3KV9 A;  5JDM A;  3RX6 A;  5FYM A;  3HKE E;  5GON E;  2W63 A;  3NRX A;  2BVM A;  2X9W A;  1G73 A;  4UXN B;  2HH7 A;  5ETW A;  3UFE A;  5LGN B;  4PJJ A;  1V9D A;  3MA9 A;  3CX8 B;  2XQY A;  5F8P A;  4PJM A;  3Q5W A;  3HL6 A;  4J2C A;  4PFO A;  1FMW A;  4PJN A;  5DQW A;  3C50 A;  4JLE A;  4ASK A;  2L9Q A;  4N78 D;  4P09 A;  1D0X A;  2L3L A;  3SOL A;  2C0S A;  2D5U A;  2WSS V;  1LVF A;  2E9X A;  2LHN A;  3ZMT B;  1HG2 A;  3ZJ1 A;  2LEH A;  3CKD A;  3IBP A;  4TV9 E;  1E1H B;  4AXP A;  1B7T A;  2EHO C;  3KV6 A;  3P7I A;  5CB4 E;  5LYJ E;  3UUL A;  2X51 A;  3IEE A;  2ZMA A;  3N9M A;  2CWY A;  3SS1 A;  4ZI3 D;  3C51 A;  2A72 A;  2LE8 A;  2A3D A;  3O1I A;  4GYS A;  3AB3 B;  4A56 A;  2H3R A;  3O1H A;  4L5G A;  3C98 B;  2RA1 A;  2MBG A;  4PNI A;  4WNK A;  5LOV E;  5FY0 A;  3RYH E;  2YU2 A;  4O4H E;  4XBF B;  2JMH A;  3WAK A;  3I9W A;  5ADX L;  4P0B A;  3U3I A;  1HFA A;  3CQG B;  4GOU A;  1CUN A;  4U72 A;  3JC6 C;  3A5X A;  3CPZ A;  2NW7 A;  3ZCJ A;  3N9N A;  5LNK A;  4FI5 A;  2V7J A;  2WAU A;  1EZ3 A;  1VOM A;  2JJ9 A;  3MXZ A;  4EZH A;  2DWK A;  4OK0 A;  3OKQ A;  4CI3 B;  4EAH A;  4YLH A;  3V5U A;  3RH3 A;  5EK2 A;  4YHJ A;  4CQI A;  2VKD A;  3P8C D;  5HXC A;  3I0Q A;  4TUY E;  4HTE A;  3C64 A;  2KWI B;  3MJX A;  2NP9 A;  2KLQ A;  4DO0 A;  2CLY C;  2P9B A;  1LVK A;  3CWZ B;  3J7Y q;  4GK0 E;  4ZOL E;  5LA6 E;  5M4Y A;  4U74 A;  3QUJ A;  2HPJ A;  3RKO A;  3PUG A;  4X1I E;  4ERR A;  4CZZ B;  4JEU B;  4BJM A;  4UF0 A;  5EK4 A;  2NTX A;  3HKB E;  1VRB A;  3CX7 B;  3ZMV B;  2A2F X;  3CX6 B;  5HXE A;  3IHR A;  2LOP A;  3Q9D A;  1UX5 A;  5A1L A;  3CVR A;  3AVR A;  1BR1 A;  2YIN A;  4IGU A;  4IE6 A;  3ZJ2 A;  2XTL A;  4ADZ A;  3ETU A;  3I1A A;  2VWA A;  1U5P A;  4O4I E;  1KNZ A;  5JR9 A;  2ACX A;  2KXP B;  1YKH B;  1HS7 A;  2W61 A;  1MNE A;  2I59 A;  4P0A A;  4AI6 A;  5JDH A;  4ZI3 C;  2Y8D A;  5F3J A;  2Q9Q B;  3CQX C;  4AKI A;  4QXB B;  1BR4 A;  2V7K A;  5IYZ E;  1G8X A;  5LBQ B;  3PUR A;  2WM9 A;  3KBT A;  1ZV4 X;  4DMV A;  4EXT A;  4PAG A;  3OJA A;  2Y6X A;  4L9I A;  5KMG P;  3F2E A;  1WR6 A;  4PK4 A;  2H7V C;  2JRK A;  5EZY E;  1S35 A;  2RP4 A;  2X9Y A;  4XAX B;  4YFS A;  2Z6E A;  3ZYL A;  3GWH A;  3WAJ A;  2ZLY A;  2X68 A;  1IZN B;  2W00 A;  2VAS A;  3ZPO A;  2N1G A;  4G63 A;  2SPC A;  3J9X 1;  3D0T A;  2M67 A;  3AAE B;  2C5I T;  2K48 A;  3N2O A;  2LOS A;  3BK9 A;  1FMV A;  1ZHC A;  2LSK A;  3MZK B;  3ZMU B;  3V5S A;  3ANW B;  1MMN A;  2NW8 A;  4IE5 A;  3RC3 A;  2LSY A;  4Z8X A;  3DP7 A;  5C8Y E;  3AAI A;  4NUU A;  5H6Q B;  2VK9 A;  5KX5 E;  4MFR A;  5LBM A;  3N9P A;  5KDM C;  5DAB A;  2L8K A;  5AFU L;  3N5L A;  3PUS A;  4QWN B;  2K9A A;  3LK3 B;  4X1Y E;  3KVA A;  5L3D B;  4IHJ E;  2LJL A;  2WBL A;  2WMN A;  2YU1 A;  3MK7 C;  4HGA A;  3O9X A;  3PE0 A;  3HA4 A;  3GN5 B;  3ZN0 B;  5J2T E;  5DQV A;  3E22 E;  2D0U A;  2X0L B;  2D2S A;  4ILU A;  4ZS3 A;  2V7M A;  3K3Q C;  2IW5 B;  2ZM0 A;  1QSD A;  1IAP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...