2K24A

Automated nmr structure of the ta0956 by fapsy
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
110
structure length
110
Chain Sequence
MTLCAMYNISMAGSHPTTICVVMDRFLESFSELYDIIDENDTDVMMDFISRFARTDEIMPEDKTVGFVVVNADKKLMSVSFSDIDENMKKVIKATAEKFKNKGFKVETDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords Putative uncharacterized protein Ta0956
publication title Automated NMR Structure of the TA0956 by FAPSY
rcsb
source organism Thermoplasma acidophilum
total genus 28
structure length 110
sequence length 110
ec nomenclature
pdb deposition date 2008-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11513 TA0956 Thermoplasma acidophilum protein TA0956
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1010 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2k24A00
2K24A 2JMKA
chains in the Genus database with same CATH superfamily
3H3AA 2WBLA 3SS1A 2UUBT 4EEDA 3FB2A 1OXZA 3N2OA 3UUMA 1E7PA 4UR9A 4EYYR 2JRKA 3K1SA 3OYZA 2DWGA 1KK7A 5H6RB 4HFVA 2CRBA 1OEDB 4OYKA 2CBIA 2CMRA 4DMWA 2LSKA 4Z90A 3Q5WA 2MBGA 4E7ZA 4HFHA 2X0HA 5CA1E 3C4ZA 2LKHA 1V9DA 4DR2T 4LF4T 5FY1A 5IUXA 1HX1B 4AIUA 2ZM0A 1UUSA 1VCSA 5JR9B 4TN7B 2LSYA 3PJAJ 2E5LT 3SFEA 3AE3A 2C0SA 2K24A 3GA8A 5EZYE 4AKGA 3VHLA 2B1EA 3LG7A 3BQLA 5IYZE 4TZ4C 4DV5T 5KXJA 3C98B 1NENA 3RYHE 4PK5A 3BQKA 2PFVA 2YEVC 3PV0F 2IW5B 4ANJA 4TNWA 5JREA 4HWCA 4WZXA 1CHUA 2LM2A 4AKRB 5FYMA 3HL6A 3RF1A 3MJXA 2X0YA 2W2UA 4BJNA 5JDNA 1Z0PA 5FL1A 2LLYA 3LK2B 4EGWA 2VURA 2WU2A 4M1PA 2WWVA 2NTYA 3OBVE 3K8PC 4L0RA 1T8BA 3JAEA 3VR9A 4CI2B 5F3JA 3Q5XA 2HPJA 3QB5K 5LGUB 3ZCJA 3AAAB 5EK2A 2IHR1 3RQUA 5CFBA 2WDRA 3RQWA 4A97A 5FY7A 4AI6A 3FHNA 2LOPA 4B6XA 1KFYA 4P0AA 4I50E 5L3EB 3HKDE 2VL0A 1D0ZA 3O9XA 4F8HA 4DV4T 2DL1A 4CXYA 4HKAA 4NUUA 4LMLA 3RRCA 3O1IA 4KBMB 2XJ7A 3PUQA 4ZI7E 2QA7A 3IA3A 5LOVE 4AKHA 5H6QB 3MZKB 5JDFA 3NRXA 1IBMT 1HNXT 1XDPA 4MHCA 4V1Av 4MFRA 4OHFA 3J7Yq 1I94T 4I4TE 3UU3A 1HG2A 5ABGA 1ZV4X 4X20E 1ZOYA 4ADZA 3NZQA 5LMUT 1JNZA 2DCFA 4WBNE 2VKHA 1D1BA 3U78A 2UUCT 1OEDA 2CWOA 5HCMA 2X51A 3RPUA 1D0XA 2CCQA 2XY8B 2X0LB 4PFPA 4AISA 4GK0E 4NXMT 4AKLA 4FI5A 3CQXC 4HE8A 1N32T 2V6YB 4EAHA 5HXEA 1MIVA 4HWIB 5JR9A 5EK4A 3DJBA 2J62A 2N2NA 3KINB 4YSZA 1MMAA 3E08A 1XNRT 4J2CA 4BAYB 1OWAA 2V7MA 3ZEFB 2CLYB 3GMIA 2KT9A 1KNZA 3AB3B 2RP4A 4H9SE 3ZKRA 1NWMX 2VQET 2N9DA 3N9QA 4KHPT 5AQMB 5L3GB 4I55E 4IDNA 1YW0A 2BKNA 1HTJF 4ZZCA 1FIOA 4COFA 5AQVB 4EZHA 2XAQB 2D5UA 2IC9A 5TAOA 3D0TA 2YKSA 2DI4A 4DVDA 4DUZT 3N9OA 2VWAA 2BG9B 4U7YA 4PJMA 2W0GA 5LHIB 3HI2A 3P50A 4CN1A 3FZFB 1X79A 2MYSA 3LSVA 2E9XD 2JQ9A 3KDSE 3RIUA 2XAFB 2VKOA 4H9PC 3FBZA 4DO0A 2VK9A 1W9RA 1IBKT 4AQFC 1OEDC 1T7SA 3SWHA 1IJ5A 5LP6E 1XMOT 1L0VA 1WRDA 4IDZA 4AXPA 3A7MA 2BBHA 1G73A 1XWMA 2NW9A 3F57A 2X9YA 5AQTB 4B3ST 2W66A 4U74A 4QXCB 4DV2T 2IUBA 2N1GA 2ODVA 3K3OA 2WQYA 5JR9C 3AAEB 5LG3A 4ILBA 4PK6A 2K3WA 3VU7H 2XQAA 3GWHA 4EB6E 5HXRA 1W0BA 3EUHA 2YDRA 3P4RA 4KP3C 2ZM6T 2CXDA 4LF8T 4QKNA 2JMHA 5HEUA 1WR6A 3VRBA 4X62T 4PJJA 2WM9A 1XZYA 3L39A 4NXNT 2WCAA 1WYBA 3PUGA 4N78D 3VKHA 1SA0E 4O8SA 1DU2A 4WNKA 1Y64B 5HEOA 5JH7E 2XUEA 5HWYA 1R8IA 4DV1T 2L3LA 3OYXA 4HWDA 4U7IA 3ZLIA 3KBUA 3LBXB 4HFIA 2KXPB 3AVSA 1MIWA 2WU5A 1YQ3A 4PAGA 1E2AA 3RKGA 2E5VA 3VRAA 3IEEA 2YN6A 3WAKA 2WDQA 4C91A 5FY0A 4KI0F 3ZMVB 3ZSTA 3RGLA 3O1JA 2DLRA 3UU5A 4TWDA 5FXXA 2VL8A 4YY3T 2M6BA 1CUNA 3RYCE 5M4YA 4U3CA 2XTLA 3CPZA 3HKBE 4WW0A 5JDLA 4NIQA 2BS2A 2J47A 4IIJE 3EHZA 2K48A 3CVRA 2KNDA 3KVBA 4GOUA 4CXWA 2EHOD 4UXNB 4PJLA 3AE9A 3BQIA 4CI1B 2V7IA 3AEAA 3PUZF 4Z91A 1OEDE 3N2KE 3PE0A 5F8PA 3W15B 3V5UA 5LGNB 4CZZB 2FJEA 4HGAA 2LHRA 3TKLB 5HXCA 3UU8A 4LFAT 5ABHA 3RC3A 4H9OC 2A9UA 4LMJA 4TV8E 2E8IA 1MMGA 3RRWA 2XQ7A 5BR8T 4UF0A 4H9QC 3AAIA 2YDQA 2J1DG 2HN1A 2ZM2A 3ZYKA 4JI1T 1VCTA 3FBLA 4EIWA 5ETWA 4HWHA 2PBIA 2XPKA 2Q9QD 2H89A 5HXHA 2W63A 2PG8A 4O4LE 3I9YA 2QYWA 5J0ZA 5JDQA 1QUUA 3PUSA 4YTPA 3PJAA 4DNDA 4YHJA 1N33T 2QRXA 2E9XA 2BG9C 3CKDA 1W0AA 4ZHQE 3ESLA 2NWBA 5KDMC 3RYIE 3CMLA 2JQHA 2JMKA 1N34T 4DV6T 3LBXA 3Q5EA 4JI7T 3N2GE 2KMFA 2YINA 3UQ4A 5LGTB 4E7SA 5EK3A 2WP9A 2YDSA 4CN4A 4X65T 2UXDT 4PW8A 3AVRA 2HN2A 4NPPA 2HHHT 1YKEB 4IL9A 4IT4A 2XQ8A 3RYFE 2WWUA 5FMNA 4DMVA 3LK3B 2I0MA 3HKEE 3NVOA 5DQVA 2LT3A 4U2YA 3HKCE 5LCYA 5LXTE 2LOSA 3I9WA 5AQLB 4LF6T 2IAKA 2VKJA 2V1DB 4MBQA 5AQUB 1QLBA 2L8KA 4JBWF 2XQ9A 3PUXF 4EXTA 2C5KT 4DBQA 5AQJB 4GYRA 5L3BB 2KLQA 3EDVA 3KV4A 5AQHB 4ZI2C 5BMVE 2MOZA 3KBTA 2SPCA 2ODUA 4YHHT 3WI3A 3R6NA 3P8CD 1GQEA 2ZMAA 4QX8B 2K9AA 3ZMTB 2XM2A 5JTGA 3N9LA 1XNQT 3AA1B 4YJ2E 1JNRA 4EOZB 5HXSA 3ZPOA 5JQGE 2V6XA 3RI5A 4ZI3C 3L3PA 2RPAA 3MACA 3O4XE 2VB6A 5HCJA 4GIWA 4EEBA 4YTMA 3MK7C 5HEHA 3JAFA 5LMNT 2UXXB 4I43B 1HG5A 2A72A 4IDQA 2UXCT 4U2ZA 4P0BA 2XQ6A 2BZBA 3U3IA 2WY2A 2Z6EA 3AE4A 1Y01A 4JEUB 3CX6B 1MNDA 4ZXLA 3LDQB 3CX7B 1B7TA 3RKOA 1KEYA 5L4HA 4CXXA 2IDOB 2LRLA 4GKJT 2GK9A 1QSDA 1ZKEA 4KX6A 4AQGA 3RC8A 2BG9E 1MNEA 2LSJA 3K3NA 1HNWT 2WMNA 4TV9E 5CB4E 3QC9A 3R84B 1E1HB 1S94A 2BKPA 3JADA 5LHGB 2YU2A 4LF9T 2LSGA 5JDGA 2XAHB 2Y48B 2V7JA 2WB5A 4AKIA 3CK6A 4H9RC 2CHNA 2OLTA 3PUVF 2HH7A 4X1IE 3PUAA 4EZ4A 2ACXA 3NBXX 3TLUA 4IE0A 4H63H 2IC6A 1UURA 4BA9A 4HFDA 4LF7T 3V5SA 4LF5T 4DR5T 3X1DA 2V26A 4ASKA 5LJMA 1BR1A 2KINB 3AE1A 3KV6A 5DJQC 4YSYA 4WBOA 4JI3T 2AE9A 3L8RA 5LJNA 1HX8A 3P4PA 4UVBB 3MXZA 4IE5A 2AXDS 2FJDA 4UEMA 1LRZA 5FVKA 3IBPA 4QH1A 3RHWA 2JIWA 5LA6E 3T1YT 4KUMB 4ERRA 3T1HT 5ABFB 5AFUL 1WLXA 4WYVA 3NZPA 2YOEA 4ILCA 4EYUA 3PDYA 2HPLA 5AQIB 4X66T 3QUJA 2WZHA 3UULA 5FKYA 3M65A 3OKQA 2XQ5A 4DIDB 4QXHB 4TNVA 4UF0B 4DV0T 2ZLYA 1IZNB 2XZEA 2NR4A 2X9HA 1X9BA 3VKGA 3LK42 4IE7A 2D0TA 1D1CA 2X67A 5HEJA 4ILUA 3N9NA 2W61A 3CQGB 2VVNA 2E9XB 2OA5A 1D1AA 3Q5DA 1J1JA 1FJGT 4H9NC 2CPTA 2NW7A 4CI3B 2G0UA 3AECA 4KHZF 3AE8A 2MTQA 1XDOA 2CEAA 3KFWX 1EZ3A 4EV6A 4O4HE 3PUWF 3RIUC 2I59A 1YQ4A 3E22E 3T8OA 3G06A 4HFEA 2XAJB 5AQFB 1H7CA 1HS7A 1HR0T 3ZMSB 2XSBA 2R6GF 3ZJ2A 2W4XA 1N36T 4ZEYA 2CXFA 5AQQB 1SE7A 4DR4T 2KWHA 2CE7A 3SFDA 2JQQA 5JDHA 2VVSA 3RLFF 5LG4A 2XSAA 4B3RT 4O2BE 1KF6A 3RH3A 3ZCIA 2QVAA 3ONXA 4PJNA 5J2TE 1FMWA 5LBMA 4MLKA 3A5XA 2Y8DA 2B76A 3B57A 4JI8T 1U5PA 4PFOA 2DHRA 3FZLB 2A3DA 3AEFA 4YSXA 1VRBA 3DP7A 4OYJA 3I0OA 2YK0A 2W67A 3C64A 3BK9A 5DABA 3UUBA 4HFCA 3AEEA 5ABFA 4DBRA 5FNVE 4C90A 3HA4A 3ZYLA 4MALA 2CLYC 3NRYA 4YT0A 3KV9A 3WAJA 4X1KE 5L3DB 2C5JA 2UXNB 4PNIA 2XASB 1J5ET 4O4JE 2V8SV 2CXLA 4O2AE 4X64T 2WDVA 2LHNA 5IWAT 1D0YA 4P1NA 1YKHB 1UCUA 3FXDB 3HR0A 5JDMA 3MKDA 1S35A 2W00A 2FJBA 1WCRA 2I6HA 2V5CA 1I6ZA 3Q9DA 4AQYT 3UU4A 1IAPA 3MA9A 3EDUA 4K0UA 5FVLA 3H3MA 1BR2A 5AQRB 4IDOA 5A1LA 3I0QA 3UT5E 1ZEEA 4XAXB 2MPKA 2CA5A 1LVKA 1AJ3A 4JI5T 3ONJA 2XQYA 4DV3T 2EHOB 3VR8A 2NW8A 4UELA 3ZC1A 3OVUA 3P7IA 1YD8G 5FP3A 2L9QA 5CJ5A 5AQSB 1ZP0A 4HWFA 3UFGA 3ANWA 3C4WA 3ETVA 3P4WA 5FXZA 5E0OA 2IIUA 3ONLC 5AQNB 1UX4A 4JI6T 3UU6A 3E0ZA 3LJCA 1SUMB 4JI2T 3FXEB 3PURA 2V7KA 5C3JA 4A5XA 4IREA 3AE2A 5L4EA 1HCIA 1WR0A 4U33A 2IMLA 4G2AA 4OX9T 2D0UA 1SHZC 1FEWA 1O3XA 2Q9QB 3IHRA 3J9X1 1XMQT 3FZHB 3AEGA 4XBFB 2H88A 3UUXB 4P09A 2JPFA 2NP9A 1FMVA 3OPCA 1NAFA 4QX7B 3I1AA 4O4IE 1LKXA 5IHYA 3AE7A 3M3ZB 1UGOA 2FJAA 1U4QA 4JEHB 2BKOA 2CHOA 2LSIA 3CIRA 3IF8B 5HAXA 4G63A 3OJAA 3ZYMA 3TLTA 2BVMA 4ILAA 4X1YE 4K0KT 2K5BB 5CGMA 4JI4T 2E9XC 3TLWA 1HF8A 3SOLA 2XM1A 4DR6T 4QXBB 4HTEA 5AQPB 4CN6A 4KMCA 2YU1A 2MAWA 3KV5A 3F31A 4L5GA 4YXDA 3F2EA 2LRKA 3K3QC 5ADXL 5AQOB 1T72A 5CA0E 1BR4A 4ZS2A 4QH4A 4ZOLE 1MMDA 2X9WA 4AQFA 3N5LA 2NOXA 4HFBA 3GN5B 1M62A 2ACZA 4JYAT 3QNUA 1G8XA 1UX5A 4FJOA 3DTOA 3LFMA 4DR3T 2BVLA 5HYAA 5LYJE 4UV9B 4UIGA 5LB7B 2PTFA 3FZMB 2UXBT 3EABA 2VASA 3ZMZB 1NEKA 3H37A 2LJLA 4JUYA 4F6RC 3PU8A 4YJ3E 2XQ4A 4QWNB 4YLHA 3AE6A 2XAGB 3CQCB 3JC6C 2NTXA 3ZN1B 2EHOA 4Q25A 4IL4A 3L09A 4LFBT 1ZHCA 1IBLT 3QK6A 4HN9A 5ABEA 2PJQA 1W09A 2H7OA 1WFDA 3ZSSA 5FXWA 3N9MA 3UQ7A 4DR1T 4IGUA 2M67A 4A98A 3ZC0A 3AA0B 2V7LA 4JV5T 4ZI2D 2JJ9A 3FZKB 4TWHA 5C2TA 4HEAA 2BBJA 4TUYE 3PUYF 4Z8XA 2V5DA 3AA7B 4UVCB 5JRCB 4ISSA 2KSRA 3ABVA 4NUVA 5J1GA 2FUPA 5L2LA 1M7KA 3ZN0B 3PTRB 2BDEA 2Q9QA 3Q2MA 4ZS3A 1KNPA 4ZI3D 2UU9T 4ZZBA 2DNXA 3ZT7A 4QH5A 2QGSA 5L3CB 3SRZA 3P4QA 4B3MT 4IHJE 1HFAA 4OFZA 4U31A 2W62A 2FBWA 3CX8B 5FXVA 5L3FB 4LFCT 3AXJB 3NKZA 5KX5E 3AEBA 4GYSA 2C5IT 3TLVA 3ETUA 5GONE 5C8YE 2WS3A 2CM0A 4U72A 3UUNA 2KZ7B 2LE8A 3EAMA 3EI0A 3P4SA 4B3TT 2ES0A 4IE4A 3KVAA 1VOMA 4ISTA 2E2AA 4UVAB 2WZIA 2EHOC 2LKGA 3ZJ1A 3C51A 3S4UA 3CWZB 1J5WA 1UK5A 3B5MA 3GN5A 3N9PA 5L47A 3JC6D 1MMNA 4A56A 1Z8UA 2XQ3A 5FL0A 3C4XA 3PU3A 4H63V 3B13A 2LEHA 2X9XA 5AQKB 2V6YA 2WMOA 3ZMUB 4DR7T 2KWIB 1LVFA 3UTKA 5KMGP 2BS4A 3NWIA 3ZT5A 4PK4A 2DWKA 1YXRA 3ANWB 2M6IA 4BJMA 2ZM8A 2P9BA 5AQGB 3ZT6A 4XZCA 5F5WA 4CQIA 2Y6XA 2Q9QC 1IJ6A 2A2FX 2X68A 4OK0A 2WAUA 2VQFT 4DUYT 4LMKA 3AE5A 1HNZT 5HWXA 2X66A 4GKKT 5DQWA 3O1HA 2UUAT 3EVYA 4QHOA 3JCFA 1MIYA 3RX6A 5JVDE 3AA6B 4DV7T 2D9DA 3QB5A 1KNRA 3OTOT 2BG9A 2JQKA 3RIFA 4YTNA 4IE6A 2D2SA 2J4GA 4TX5A 4YFSA 3UFEA 2F4VT 4IDPA 2H3RA 4UV8B 5JRCA 1US7B 2RA1A 3A8YC 5LHHB 5LBQB 2OV9A 1T98A 4JI0T 3C50A 2CWYA 1WYCA 4L9IA 3TLSA 5LNKA 2VKDA 1BR0A 2WSSV 4X5TA 5HEGA 2LM9A 3QOFA 2CBJA 4JLEA 4I0UA 3AEDA 4GK5E 5J2UE 2H7VC 3RIAA 4TWFA 2BS3A 2XHEB 3AXJA
chains in the Genus database with same CATH topology
2WMNA 1WYBA 2D0UA 4TV9E 1SHZC 3PUGA 1FEWA 1O3XA 5CB4E 4N78D 2Q9QB 3H3AA 3IHRA 3QC9A 3J9X1 3VKHA 2WBLA 1E1HB 3R84B 1S94A 1SA0E 3SS1A 4O8SA 5LHGB 3FB2A 4XBFB 2YU2A 1OXZA 3UUXB 3N2OA 4WNKA 1Y64B 4P09A 2JPFA 2NP9A 1FMVA 2LSGA 5JH7E 3UUMA 2XUEA 1NAFA 4QX7B 5JDGA 2XAHB 2JRKA 2Y48B 3I1AA 4EYYR 4O4IE 3OYZA 2DWGA 5HWYA 1KK7A 2V7JA 1LKXA 5H6RB 4AKIA 4HFVA 5IHYA 4H9RC 2L3LA 2HH7A 4X1IE 4OYKA 3OYXA 3PUAA 1U4QA 4EZ4A 3ZLIA 2CMRA 4JEHB 4DMWA 2LSKA 3KBUA 3LBXB 2LSIA 3IF8B 5HAXA 2ACXA 3Q5WA 4G63A 3OJAA 2MBGA 3ZYMA 4E7ZA 2BVMA 4X1YE 5CA1E 2K5BB 3C4ZA 3NBXX 4IE0A 4H63H 1V9DA 5FY1A 2IC6A 2E9XC 4BA9A 2KXPB 3AVSA 3V5SA 2ZM0A 1MIWA 1HF8A 5JR9B 3SOLA 4TN7B 2V26A 4ASKA 5LJMA 1BR1A 2LSYA 4QXBB 2KINB 4HTEA 3KV6A 5DJQC 4PAGA 4KMCA 2YU1A 4WBOA 2C0SA 2K24A 3GA8A 5EZYE 5LJNA 1HX8A 3IEEA 3F31A 3KV5A 4UVBB 4AKGA 3MXZA 4L5GA 2B1EA 3LG7A 3VHLA 3BQLA 4IE5A 3F2EA 5IYZE 4TZ4C 3WAKA 3K3QC 4UEMA 5ADXL 1LRZA 3C98B 3IBPA 3RYHE 4C91A 1BR4A 3BQKA 4PK5A 4ZS2A 2PFVA 5FY0A 4ZOLE 2YEVC 3ZMVB 1MMDA 3O1JA 2X9WA 2DLRA 5LA6E 2IW5B 4AQFA 4ANJA 3N5LA 2NOXA 3GN5B 5JREA 4KUMB 5FXXA 4ERRA 4AKRB 5FYMA 3HL6A 5AFUL 1WLXA 2VL8A 3MJXA 4BJNA 1G8XA 3NZPA 5JDNA 1UX5A 1Z0PA 4EYUA 3PDYA 1CUNA 4FJOA 3RYCE 2HPLA 3DTOA 3LK2B 5M4YA 3LFMA 3QUJA 2XTLA 3CPZA 3UULA 3HKBE 3M65A 3OKQA 2BVLA 4QXHB 5HYAA 5LYJE 4M1PA 4WW0A 5JDLA 4UF0B 2NTYA 3OBVE 3K8PC 4L0RA 4UV9B 4UIGA 2ZLYA 1IZNB 4CI2B 5F3JA 3Q5XA 2HPJA 4IIJE 2K48A 3CVRA 2VASA 3ZMZB 2X9HA 3H37A 2KNDA 3VKGA 3KVBA 4GOUA 2LJLA 3LK42 4JUYA 4CXWA 4F6RC 5LGUB 3PU8A 2EHOD 3ZCJA 3AAAB 4UXNB 5EK2A 4IE7A 4PJLA 4QWNB 4YJ3E 4YLHA 2D0TA 3BQIA 1D1CA 2V7IA 4CI1B 2X67A 3CQCB 2XAGB 3N2KE 3PE0A 4ILUA 3JC6C 5F8PA 3N9NA 2W61A 3CQGB 3W15B 2NTXA 3ZN1B 3V5UA 2EHOA 5LGNB 4CZZB 4HGAA 5FY7A 4AI6A 2LHRA 3L09A 2E9XB 3TKLB 2OA5A 1D1AA 3FHNA 5HXCA 2LOPA 4B6XA 4P0AA 4I50E 5L3EB 1ZHCA 3HKDE 1D0ZA 3QK6A 3O9XA 4H9NC 3RC3A 4HN9A 4H9OC 2NW7A 4CI3B 2PJQA 4TV8E 2E8IA 1MMGA 2G0UA 2H7OA 3RRWA 4CXYA 4HKAA 5FXWA 2MTQA 4NUUA 3N9MA 3RRCA 2CEAA 3KFWX 3O1IA 1EZ3A 2M67A 4IGUA 4KBMB 4O4HE 3ZC0A 3PUQA 4ZI7E 4UF0A 2QA7A 3AA0B 2V7LA 4ZI2D 4H9QC 2JJ9A 3AAIA 2J1DG 5LOVE 2I59A 2ZM2A 4AKHA 3E22E 3ZYKA 4HEAA 4TUYE 5H6QB 4Z8XA 3AA7B 3MZKB 4UVCB 5JDFA 3FBLA 3T8OA 3NRXA 4EIWA 2XAJB 5ETWA 5JRCB 2PBIA 4ISSA 2Q9QD 4MHCA 4V1Av 4MFRA 5HXHA 4OHFA 3J7Yq 2W63A 2PG8A 4NUVA 1H7CA 5J1GA 5L2LA 4O4LE 4I4TE 3I9YA 1HG2A 1HS7A 3ZN0B 5JDQA 3PTRB 1QUUA 3PUSA 2BDEA 3ZMSB 2Q9QA 1ZV4X 4DNDA 3Q2MA 4X20E 4YHJA 4ZS3A 4ZI3D 3ZJ2A 2E9XA 2DNXA 4ADZA 2QGSA 2CXFA 5L3CB 3CKDA 4ZHQE 3NZQA 3ESLA 3SRZA 4IHJE 1HFAA 4OFZA 2DCFA 2W62A 2NWBA 5KDMC 2KWHA 2CE7A 3RYIE 3CMLA 2VKHA 4WBNE 1D1BA 2JMKA 3U78A 3CX8B 2JQQA 2CWOA 5JDHA 5FXVA 5L3FB 2X51A 5KX5E 3RPUA 1D0XA 4GYSA 5LG4A 4O2BE 2CCQA 3RH3A 2C5IT 3LBXA 3ZCIA 2X0LB 3ETUA 4PFPA 5GONE 4GK0E 5C8YE 3N2GE 2CM0A 4U72A 4AKLA 3ONXA 4PJNA 4FI5A 3UUNA 5J2TE 1FMWA 3CQXC 4HE8A 4MLKA 3A5XA 5LBMA 2KMFA 2KZ7B 2Y8DA 2YINA 4EAHA 2LE8A 5HXEA 1MIVA 5JR9A 5EK4A 5LGTB 4E7SA 2ES0A 3DJBA 5EK3A 2N2NA 3KINB 1MMAA 3E08A 4J2CA 4IE4A 4PW8A 4BAYB 3AVRA 1OWAA 3B57A 2V7MA 3ZEFB 2CLYB 3KVAA 3GMIA 2KT9A 1U5PA 1VOMA 1KNZA 3AB3B 4PFOA 2RP4A 4H9SE 1YKEB 4ISTA 4UVAB 1NWMX 2DHRA 2A3DA 2EHOC 3ZJ1A 1VRBA 3DP7A 4OYJA 3I0OA 2N9DA 3RYFE 2WWUA 3N9QA 5FMNA 2YK0A 3C64A 5L3GB 3C51A 4I55E 3S4UA 3CWZB 4DMVA 3BK9A 3LK3B 1YW0A 1HTJF 3HKEE 1FIOA 5DABA 3GN5A 3N9PA 5DQVA 3JC6D 5CA0E 1MMNA 2LT3A 4DBRA 4A56A 5FNVE 4EZHA 3HKCE 5LCYA 4C90A 5LXTE 2XAQB 3HA4A 2LOSA 3I9WA 3C4XA 3ZYLA 4MALA 2IAKA 2CLYC 2D5UA 3NRYA 2IC9A 2VKJA 3PU3A 3KV9A 2V1DB 3D0TA 4H63V 5TAOA 3WAJA 4X1KE 4MBQA 5L3DB 3B13A 2LEHA 2X9XA 2C5JA 2UXNB 2L8KA 4PNIA 2DI4A 2XASB 4O4JE 4DVDA 3N9OA 2CXLA 2VWAA 4O2AE 4EXTA 2C5KT 2WMOA 3ZMUB 4DBQA 4GYRA 5L3BB 2KWIB 2LHNA 2KLQA 4PJMA 1LVFA 1D0YA 3EDVA 3UTKA 3KV4A 1YKHB 4ZI2C 5BMVE 5KMGP 2W0GA 2MOZA 3KBTA 2SPCA 1UCUA 3FXDB 4PK4A 2DWKA 2ODUA 3HR0A 5JDMA 5LHIB 3ANWB 3HI2A 3MKDA 3WI3A 2ZM8A 4BJMA 2P9BA 1S35A 3R6NA 2W00A 3P8CD 2ZMAA 4QX8B 2K9AA 3ZMTB 4XZCA 1X79A 2MYSA 3N9LA 4CQIA 2Y6XA 2E9XD 3AA1B 2Q9QC 4YJ2E 1IJ6A 2A2FX 2X68A 3KDSE 4OK0A 2WAUA 3Q9DA 2XAFB 4EOZB 5HXSA 3ZPOA 5JQGE 2VKOA 1IAPA 3MA9A 4H9PC 3EDUA 3FBZA 4K0UA 2VK9A 4DO0A 5HWXA 4ZI3C 2X66A 1BR2A 3L3PA 4AQFC 3MACA 5DQWA 3O1HA 3O4XE 2VB6A 5A1LA 3SWHA 1IJ5A 5LP6E 3EVYA 4QHOA 1WRDA 3I0QA 3UT5E 1ZEEA 4GIWA 4XAXB 4IDZA 4AXPA 3MK7C 2UXXB 2CA5A 1LVKA 1G73A 1MIYA 3RX6A 2NW9A 1AJ3A 4I43B 5JVDE 3AA6B 3F57A 2X9YA 1HG5A 2A72A 2XQYA 4U74A 2EHOB 2NW8A 4QXCB 4UELA 4P0BA 3ZC1A 3P7IA 1YD8G 5FP3A 2BZBA 2L9QA 3U3IA 2N1GA 2ODVA 3K3OA 4IE6A 2D2SA 5JR9C 2Z6EA 3AAEB 4TX5A 4YFSA 3UFEA 4JEUB 3ANWA 3CX6B 2H3RA 4UV8B 1MNDA 4PK6A 5JRCA 3CX7B 3C4WA 1US7B 3ETVA 1B7TA 2RA1A 5FXZA 5E0OA 3RKOA 3VU7H 5LHHB 5LBQB 1T98A 1UX4A 3C50A 2CWYA 1WYCA 4L9IA 3GWHA 4EB6E 5HXRA 3E0ZA 3EUHA 5LNKA 3LJCA 4KP3C 4CXXA 2VKDA 1BR0A 3FXEB 2CXDA 3PURA 4QKNA 2WSSV 2JMHA 2LM9A 2GK9A 1QSDA 1ZKEA 2V7KA 4JLEA 4AQGA 3RC8A 1WR6A 4GK5E 1HCIA 5J2UE 2H7VC 4PJJA 2WM9A 1MNEA 2XHEB 2LSJA 4G2AA 3K3NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K24 A;  2JMK A; 
#chains in the Genus database with same CATH topology
 3H3A A;  2WBL A;  3SS1 A;  2UUB T;  4EED A;  3FB2 A;  1OXZ A;  3N2O A;  3UUM A;  1E7P A;  4UR9 A;  4EYY R;  2JRK A;  3K1S A;  3OYZ A;  2DWG A;  1KK7 A;  5H6R B;  4HFV A;  2CRB A;  1OED B;  4OYK A;  2CBI A;  2CMR A;  4DMW A;  2LSK A;  4Z90 A;  3Q5W A;  2MBG A;  4E7Z A;  4HFH A;  2X0H A;  5CA1 E;  3C4Z A;  2LKH A;  1V9D A;  4DR2 T;  4LF4 T;  5FY1 A;  5IUX A;  1HX1 B;  4AIU A;  2ZM0 A;  1UUS A;  1VCS A;  5JR9 B;  4TN7 B;  2LSY A;  3PJA J;  2E5L T;  3SFE A;  3AE3 A;  2C0S A;  2K24 A;  3GA8 A;  5EZY E;  4AKG A;  3VHL A;  2B1E A;  3LG7 A;  3BQL A;  5IYZ E;  4TZ4 C;  4DV5 T;  5KXJ A;  3C98 B;  1NEN A;  3RYH E;  4PK5 A;  3BQK A;  2PFV A;  2YEV C;  3PV0 F;  2IW5 B;  4ANJ A;  4TNW A;  5JRE A;  4HWC A;  4WZX A;  1CHU A;  2LM2 A;  4AKR B;  5FYM A;  3HL6 A;  3RF1 A;  3MJX A;  2X0Y A;  2W2U A;  4BJN A;  5JDN A;  1Z0P A;  5FL1 A;  2LLY A;  3LK2 B;  4EGW A;  2VUR A;  2WU2 A;  4M1P A;  2WWV A;  2NTY A;  3OBV E;  3K8P C;  4L0R A;  1T8B A;  3JAE A;  3VR9 A;  4CI2 B;  5F3J A;  3Q5X A;  2HPJ A;  3QB5 K;  5LGU B;  3ZCJ A;  3AAA B;  5EK2 A;  2IHR 1;  3RQU A;  5CFB A;  2WDR A;  3RQW A;  4A97 A;  5FY7 A;  4AI6 A;  3FHN A;  2LOP A;  4B6X A;  1KFY A;  4P0A A;  4I50 E;  5L3E B;  3HKD E;  2VL0 A;  1D0Z A;  3O9X A;  4F8H A;  4DV4 T;  2DL1 A;  4CXY A;  4HKA A;  4NUU A;  4LML A;  3RRC A;  3O1I A;  4KBM B;  2XJ7 A;  3PUQ A;  4ZI7 E;  2QA7 A;  3IA3 A;  5LOV E;  4AKH A;  5H6Q B;  3MZK B;  5JDF A;  3NRX A;  1IBM T;  1HNX T;  1XDP A;  4MHC A;  4V1A v;  4MFR A;  4OHF A;  3J7Y q;  1I94 T;  4I4T E;  3UU3 A;  1HG2 A;  5ABG A;  1ZV4 X;  4X20 E;  1ZOY A;  4ADZ A;  3NZQ A;  5LMU T;  1JNZ A;  2DCF A;  4WBN E;  2VKH A;  1D1B A;  3U78 A;  2UUC T;  1OED A;  2CWO A;  5HCM A;  2X51 A;  3RPU A;  1D0X A;  2CCQ A;  2XY8 B;  2X0L B;  4PFP A;  4AIS A;  4GK0 E;  4NXM T;  4AKL A;  4FI5 A;  3CQX C;  4HE8 A;  1N32 T;  2V6Y B;  4EAH A;  5HXE A;  1MIV A;  4HWI B;  5JR9 A;  5EK4 A;  3DJB A;  2J62 A;  2N2N A;  3KIN B;  4YSZ A;  1MMA A;  3E08 A;  1XNR T;  4J2C A;  4BAY B;  1OWA A;  2V7M A;  3ZEF B;  2CLY B;  3GMI A;  2KT9 A;  1KNZ A;  3AB3 B;  2RP4 A;  4H9S E;  3ZKR A;  1NWM X;  2VQE T;  2N9D A;  3N9Q A;  4KHP T;  5AQM B;  5L3G B;  4I55 E;  4IDN A;  1YW0 A;  2BKN A;  1HTJ F;  4ZZC A;  1FIO A;  4COF A;  5AQV B;  4EZH A;  2XAQ B;  2D5U A;  2IC9 A;  5TAO A;  3D0T A;  2YKS A;  2DI4 A;  4DVD A;  4DUZ T;  3N9O A;  2VWA A;  2BG9 B;  4U7Y A;  4PJM A;  2W0G A;  5LHI B;  3HI2 A;  3P50 A;  4CN1 A;  3FZF B;  1X79 A;  2MYS A;  3LSV A;  2E9X D;  2JQ9 A;  3KDS E;  3RIU A;  2XAF B;  2VKO A;  4H9P C;  3FBZ A;  4DO0 A;  2VK9 A;  1W9R A;  1IBK T;  4AQF C;  1OED C;  1T7S A;  3SWH A;  1IJ5 A;  5LP6 E;  1XMO T;  1L0V A;  1WRD A;  4IDZ A;  4AXP A;  3A7M A;  2BBH A;  1G73 A;  1XWM A;  2NW9 A;  3F57 A;  2X9Y A;  5AQT B;  4B3S T;  2W66 A;  4U74 A;  4QXC B;  4DV2 T;  2IUB A;  2N1G A;  2ODV A;  3K3O A;  2WQY A;  5JR9 C;  3AAE B;  5LG3 A;  4ILB A;  4PK6 A;  2K3W A;  3VU7 H;  2XQA A;  3GWH A;  4EB6 E;  5HXR A;  1W0B A;  3EUH A;  2YDR A;  3P4R A;  4KP3 C;  2ZM6 T;  2CXD A;  4LF8 T;  4QKN A;  2JMH A;  5HEU A;  1WR6 A;  3VRB A;  4X62 T;  4PJJ A;  2WM9 A;  1XZY A;  3L39 A;  4NXN T;  2WCA A;  1WYB A;  3PUG A;  4N78 D;  3VKH A;  1SA0 E;  4O8S A;  1DU2 A;  4WNK A;  1Y64 B;  5HEO A;  5JH7 E;  2XUE A;  5HWY A;  1R8I A;  4DV1 T;  2L3L A;  3OYX A;  4HWD A;  4U7I A;  3ZLI A;  3KBU A;  3LBX B;  4HFI A;  2KXP B;  3AVS A;  1MIW A;  2WU5 A;  1YQ3 A;  4PAG A;  1E2A A;  3RKG A;  2E5V A;  3VRA A;  3IEE A;  2YN6 A;  3WAK A;  2WDQ A;  4C91 A;  5FY0 A;  4KI0 F;  3ZMV B;  3ZST A;  3RGL A;  3O1J A;  2DLR A;  3UU5 A;  4TWD A;  5FXX A;  2VL8 A;  4YY3 T;  2M6B A;  1CUN A;  3RYC E;  5M4Y A;  4U3C A;  2XTL A;  3CPZ A;  3HKB E;  4WW0 A;  5JDL A;  4NIQ A;  2BS2 A;  2J47 A;  4IIJ E;  3EHZ A;  2K48 A;  3CVR A;  2KND A;  3KVB A;  4GOU A;  4CXW A;  2EHO D;  4UXN B;  4PJL A;  3AE9 A;  3BQI A;  4CI1 B;  2V7I A;  3AEA A;  3PUZ F;  4Z91 A;  1OED E;  3N2K E;  3PE0 A;  5F8P A;  3W15 B;  3V5U A;  5LGN B;  4CZZ B;  2FJE A;  4HGA A;  2LHR A;  3TKL B;  5HXC A;  3UU8 A;  4LFA T;  5ABH A;  3RC3 A;  4H9O C;  2A9U A;  4LMJ A;  4TV8 E;  2E8I A;  1MMG A;  3RRW A;  2XQ7 A;  5BR8 T;  4UF0 A;  4H9Q C;  3AAI A;  2YDQ A;  2J1D G;  2HN1 A;  2ZM2 A;  3ZYK A;  4JI1 T;  1VCT A;  3FBL A;  4EIW A;  5ETW A;  4HWH A;  2PBI A;  2XPK A;  2Q9Q D;  2H89 A;  5HXH A;  2W63 A;  2PG8 A;  4O4L E;  3I9Y A;  2QYW A;  5J0Z A;  5JDQ A;  1QUU A;  3PUS A;  4YTP A;  3PJA A;  4DND A;  4YHJ A;  1N33 T;  2QRX A;  2E9X A;  2BG9 C;  3CKD A;  1W0A A;  4ZHQ E;  3ESL A;  2NWB A;  5KDM C;  3RYI E;  3CML A;  2JQH A;  2JMK A;  1N34 T;  4DV6 T;  3LBX A;  3Q5E A;  4JI7 T;  3N2G E;  2KMF A;  2YIN A;  3UQ4 A;  5LGT B;  4E7S A;  5EK3 A;  2WP9 A;  2YDS A;  4CN4 A;  4X65 T;  2UXD T;  4PW8 A;  3AVR A;  2HN2 A;  4NPP A;  2HHH T;  1YKE B;  4IL9 A;  4IT4 A;  2XQ8 A;  3RYF E;  2WWU A;  5FMN A;  4DMV A;  3LK3 B;  2I0M A;  3HKE E;  3NVO A;  5DQV A;  2LT3 A;  4U2Y A;  3HKC E;  5LCY A;  5LXT E;  2LOS A;  3I9W A;  5AQL B;  4LF6 T;  2IAK A;  2VKJ A;  2V1D B;  4MBQ A;  5AQU B;  1QLB A;  2L8K A;  4JBW F;  2XQ9 A;  3PUX F;  4EXT A;  2C5K T;  4DBQ A;  5AQJ B;  4GYR A;  5L3B B;  2KLQ A;  3EDV A;  3KV4 A;  5AQH B;  4ZI2 C;  5BMV E;  2MOZ A;  3KBT A;  2SPC A;  2ODU A;  4YHH T;  3WI3 A;  3R6N A;  3P8C D;  1GQE A;  2ZMA A;  4QX8 B;  2K9A A;  3ZMT B;  2XM2 A;  5JTG A;  3N9L A;  1XNQ T;  3AA1 B;  4YJ2 E;  1JNR A;  4EOZ B;  5HXS A;  3ZPO A;  5JQG E;  2V6X A;  3RI5 A;  4ZI3 C;  3L3P A;  2RPA A;  3MAC A;  3O4X E;  2VB6 A;  5HCJ A;  4GIW A;  4EEB A;  4YTM A;  3MK7 C;  5HEH A;  3JAF A;  5LMN T;  2UXX B;  4I43 B;  1HG5 A;  2A72 A;  4IDQ A;  2UXC T;  4U2Z A;  4P0B A;  2XQ6 A;  2BZB A;  3U3I A;  2WY2 A;  2Z6E A;  3AE4 A;  1Y01 A;  4JEU B;  3CX6 B;  1MND A;  4ZXL A;  3LDQ B;  3CX7 B;  1B7T A;  3RKO A;  1KEY A;  5L4H A;  4CXX A;  2IDO B;  2LRL A;  4GKJ T;  2GK9 A;  1QSD A;  1ZKE A;  4KX6 A;  4AQG A;  3RC8 A;  2BG9 E;  1MNE A;  2LSJ A;  3K3N A;  1HNW T;  2WMN A;  4TV9 E;  5CB4 E;  3QC9 A;  3R84 B;  1E1H B;  1S94 A;  2BKP A;  3JAD A;  5LHG B;  2YU2 A;  4LF9 T;  2LSG A;  5JDG A;  2XAH B;  2Y48 B;  2V7J A;  2WB5 A;  4AKI A;  3CK6 A;  4H9R C;  2CHN A;  2OLT A;  3PUV F;  2HH7 A;  4X1I E;  3PUA A;  4EZ4 A;  2ACX A;  3NBX X;  3TLU A;  4IE0 A;  4H63 H;  2IC6 A;  1UUR A;  4BA9 A;  4HFD A;  4LF7 T;  3V5S A;  4LF5 T;  4DR5 T;  3X1D A;  2V26 A;  4ASK A;  5LJM A;  1BR1 A;  2KIN B;  3AE1 A;  3KV6 A;  5DJQ C;  4YSY A;  4WBO A;  4JI3 T;  2AE9 A;  3L8R A;  5LJN A;  1HX8 A;  3P4P A;  4UVB B;  3MXZ A;  4IE5 A;  2AXD S;  2FJD A;  4UEM A;  1LRZ A;  5FVK A;  3IBP A;  4QH1 A;  3RHW A;  2JIW A;  5LA6 E;  3T1Y T;  4KUM B;  4ERR A;  3T1H T;  5ABF B;  5AFU L;  1WLX A;  4WYV A;  3NZP A;  2YOE A;  4ILC A;  4EYU A;  3PDY A;  2HPL A;  5AQI B;  4X66 T;  3QUJ A;  2WZH A;  3UUL A;  5FKY A;  3M65 A;  3OKQ A;  2XQ5 A;  4DID B;  4QXH B;  4TNV A;  4UF0 B;  4DV0 T;  2ZLY A;  1IZN B;  2XZE A;  2NR4 A;  2X9H A;  1X9B A;  3VKG A;  3LK4 2;  4IE7 A;  2D0T A;  1D1C A;  2X67 A;  5HEJ A;  4ILU A;  3N9N A;  2W61 A;  3CQG B;  2VVN A;  2E9X B;  2OA5 A;  1D1A A;  3Q5D A;  1J1J A;  1FJG T;  4H9N C;  2CPT A;  2NW7 A;  4CI3 B;  2G0U A;  3AEC A;  4KHZ F;  3AE8 A;  2MTQ A;  1XDO A;  2CEA A;  3KFW X;  1EZ3 A;  4EV6 A;  4O4H E;  3PUW F;  3RIU C;  2I59 A;  1YQ4 A;  3E22 E;  3T8O A;  3G06 A;  4HFE A;  2XAJ B;  5AQF B;  1H7C A;  1HS7 A;  1HR0 T;  3ZMS B;  2XSB A;  2R6G F;  3ZJ2 A;  2W4X A;  1N36 T;  4ZEY A;  2CXF A;  5AQQ B;  1SE7 A;  4DR4 T;  2KWH A;  2CE7 A;  3SFD A;  2JQQ A;  5JDH A;  2VVS A;  3RLF F;  5LG4 A;  2XSA A;  4B3R T;  4O2B E;  1KF6 A;  3RH3 A;  3ZCI A;  2QVA A;  3ONX A;  4PJN A;  5J2T E;  1FMW A;  5LBM A;  4MLK A;  3A5X A;  2Y8D A;  2B76 A;  3B57 A;  4JI8 T;  1U5P A;  4PFO A;  2DHR A;  3FZL B;  2A3D A;  3AEF A;  4YSX A;  1VRB A;  3DP7 A;  4OYJ A;  3I0O A;  2YK0 A;  2W67 A;  3C64 A;  3BK9 A;  5DAB A;  3UUB A;  4HFC A;  3AEE A;  5ABF A;  4DBR A;  5FNV E;  4C90 A;  3HA4 A;  3ZYL A;  4MAL A;  2CLY C;  3NRY A;  4YT0 A;  3KV9 A;  3WAJ A;  4X1K E;  5L3D B;  2C5J A;  2UXN B;  4PNI A;  2XAS B;  1J5E T;  4O4J E;  2V8S V;  2CXL A;  4O2A E;  4X64 T;  2WDV A;  2LHN A;  5IWA T;  1D0Y A;  4P1N A;  1YKH B;  1UCU A;  3FXD B;  3HR0 A;  5JDM A;  3MKD A;  1S35 A;  2W00 A;  2FJB A;  1WCR A;  2I6H A;  2V5C A;  1I6Z A;  3Q9D A;  4AQY T;  3UU4 A;  1IAP A;  3MA9 A;  3EDU A;  4K0U A;  5FVL A;  3H3M A;  1BR2 A;  5AQR B;  4IDO A;  5A1L A;  3I0Q A;  3UT5 E;  1ZEE A;  4XAX B;  2MPK A;  2CA5 A;  1LVK A;  1AJ3 A;  4JI5 T;  3ONJ A;  2XQY A;  4DV3 T;  2EHO B;  3VR8 A;  2NW8 A;  4UEL A;  3ZC1 A;  3OVU A;  3P7I A;  1YD8 G;  5FP3 A;  2L9Q A;  5CJ5 A;  5AQS B;  1ZP0 A;  4HWF A;  3UFG A;  3ANW A;  3C4W A;  3ETV A;  3P4W A;  5FXZ A;  5E0O A;  2IIU A;  3ONL C;  5AQN B;  1UX4 A;  4JI6 T;  3UU6 A;  3E0Z A;  3LJC A;  1SUM B;  4JI2 T;  3FXE B;  3PUR A;  2V7K A;  5C3J A;  4A5X A;  4IRE A;  3AE2 A;  5L4E A;  1HCI A;  1WR0 A;  4U33 A;  2IML A;  4G2A A;  4OX9 T;  2D0U A;  1SHZ C;  1FEW A;  1O3X A;  2Q9Q B;  3IHR A;  3J9X 1;  1XMQ T;  3FZH B;  3AEG A;  4XBF B;  2H88 A;  3UUX B;  4P09 A;  2JPF A;  2NP9 A;  1FMV A;  3OPC A;  1NAF A;  4QX7 B;  3I1A A;  4O4I E;  1LKX A;  5IHY A;  3AE7 A;  3M3Z B;  1UGO A;  2FJA A;  1U4Q A;  4JEH B;  2BKO A;  2CHO A;  2LSI A;  3CIR A;  3IF8 B;  5HAX A;  4G63 A;  3OJA A;  3ZYM A;  3TLT A;  2BVM A;  4ILA A;  4X1Y E;  4K0K T;  2K5B B;  5CGM A;  4JI4 T;  2E9X C;  3TLW A;  1HF8 A;  3SOL A;  2XM1 A;  4DR6 T;  4QXB B;  4HTE A;  5AQP B;  4CN6 A;  4KMC A;  2YU1 A;  2MAW A;  3KV5 A;  3F31 A;  4L5G A;  4YXD A;  3F2E A;  2LRK A;  3K3Q C;  5ADX L;  5AQO B;  1T72 A;  5CA0 E;  1BR4 A;  4ZS2 A;  4QH4 A;  4ZOL E;  1MMD A;  2X9W A;  4AQF A;  3N5L A;  2NOX A;  4HFB A;  3GN5 B;  1M62 A;  2ACZ A;  4JYA T;  3QNU A;  1G8X A;  1UX5 A;  4FJO A;  3DTO A;  3LFM A;  4DR3 T;  2BVL A;  5HYA A;  5LYJ E;  4UV9 B;  4UIG A;  5LB7 B;  2PTF A;  3FZM B;  2UXB T;  3EAB A;  2VAS A;  3ZMZ B;  1NEK A;  3H37 A;  2LJL A;  4JUY A;  4F6R C;  3PU8 A;  4YJ3 E;  2XQ4 A;  4QWN B;  4YLH A;  3AE6 A;  2XAG B;  3CQC B;  3JC6 C;  2NTX A;  3ZN1 B;  2EHO A;  4Q25 A;  4IL4 A;  3L09 A;  4LFB T;  1ZHC A;  1IBL T;  3QK6 A;  4HN9 A;  5ABE A;  2PJQ A;  1W09 A;  2H7O A;  1WFD A;  3ZSS A;  5FXW A;  3N9M A;  3UQ7 A;  4DR1 T;  4IGU A;  2M67 A;  4A98 A;  3ZC0 A;  3AA0 B;  2V7L A;  4JV5 T;  4ZI2 D;  2JJ9 A;  3FZK B;  4TWH A;  5C2T A;  4HEA A;  2BBJ A;  4TUY E;  3PUY F;  4Z8X A;  2V5D A;  3AA7 B;  4UVC B;  5JRC B;  4ISS A;  2KSR A;  3ABV A;  4NUV A;  5J1G A;  2FUP A;  5L2L A;  1M7K A;  3ZN0 B;  3PTR B;  2BDE A;  2Q9Q A;  3Q2M A;  4ZS3 A;  1KNP A;  4ZI3 D;  2UU9 T;  4ZZB A;  2DNX A;  3ZT7 A;  4QH5 A;  2QGS A;  5L3C B;  3SRZ A;  3P4Q A;  4B3M T;  4IHJ E;  1HFA A;  4OFZ A;  4U31 A;  2W62 A;  2FBW A;  3CX8 B;  5FXV A;  5L3F B;  4LFC T;  3AXJ B;  3NKZ A;  5KX5 E;  3AEB A;  4GYS A;  2C5I T;  3TLV A;  3ETU A;  5GON E;  5C8Y E;  2WS3 A;  2CM0 A;  4U72 A;  3UUN A;  2KZ7 B;  2LE8 A;  3EAM A;  3EI0 A;  3P4S A;  4B3T T;  2ES0 A;  4IE4 A;  3KVA A;  1VOM A;  4IST A;  2E2A A;  4UVA B;  2WZI A;  2EHO C;  2LKG A;  3ZJ1 A;  3C51 A;  3S4U A;  3CWZ B;  1J5W A;  1UK5 A;  3B5M A;  3GN5 A;  3N9P A;  5L47 A;  3JC6 D;  1MMN A;  4A56 A;  1Z8U A;  2XQ3 A;  5FL0 A;  3C4X A;  3PU3 A;  4H63 V;  3B13 A;  2LEH A;  2X9X A;  5AQK B;  2V6Y A;  2WMO A;  3ZMU B;  4DR7 T;  2KWI B;  1LVF A;  3UTK A;  5KMG P;  2BS4 A;  3NWI A;  3ZT5 A;  4PK4 A;  2DWK A;  1YXR A;  3ANW B;  2M6I A;  4BJM A;  2ZM8 A;  2P9B A;  5AQG B;  3ZT6 A;  4XZC A;  5F5W A;  4CQI A;  2Y6X A;  2Q9Q C;  1IJ6 A;  2A2F X;  2X68 A;  4OK0 A;  2WAU A;  2VQF T;  4DUY T;  4LMK A;  3AE5 A;  1HNZ T;  5HWX A;  2X66 A;  4GKK T;  5DQW A;  3O1H A;  2UUA T;  3EVY A;  4QHO A;  3JCF A;  1MIY A;  3RX6 A;  5JVD E;  3AA6 B;  4DV7 T;  2D9D A;  3QB5 A;  1KNR A;  3OTO T;  2BG9 A;  2JQK A;  3RIF A;  4YTN A;  4IE6 A;  2D2S A;  2J4G A;  4TX5 A;  4YFS A;  3UFE A;  2F4V T;  4IDP A;  2H3R A;  4UV8 B;  5JRC A;  1US7 B;  2RA1 A;  3A8Y C;  5LHH B;  5LBQ B;  2OV9 A;  1T98 A;  4JI0 T;  3C50 A;  2CWY A;  1WYC A;  4L9I A;  3TLS A;  5LNK A;  2VKD A;  1BR0 A;  2WSS V;  4X5T A;  5HEG A;  2LM9 A;  3QOF A;  2CBJ A;  4JLE A;  4I0U A;  3AED A;  4GK5 E;  5J2U E;  2H7V C;  3RIA A;  4TWF A;  2BS3 A;  2XHE B;  3AXJ A; 
#chains in the Genus database with same CATH homology
 2WMN A;  1WYB A;  2D0U A;  4TV9 E;  1SHZ C;  3PUG A;  1FEW A;  1O3X A;  5CB4 E;  4N78 D;  2Q9Q B;  3H3A A;  3IHR A;  3QC9 A;  3J9X 1;  3VKH A;  2WBL A;  1E1H B;  3R84 B;  1S94 A;  1SA0 E;  3SS1 A;  4O8S A;  5LHG B;  3FB2 A;  4XBF B;  2YU2 A;  1OXZ A;  3UUX B;  3N2O A;  4WNK A;  1Y64 B;  4P09 A;  2JPF A;  2NP9 A;  1FMV A;  2LSG A;  5JH7 E;  3UUM A;  2XUE A;  1NAF A;  4QX7 B;  5JDG A;  2XAH B;  2JRK A;  2Y48 B;  3I1A A;  4EYY R;  4O4I E;  3OYZ A;  2DWG A;  5HWY A;  1KK7 A;  2V7J A;  1LKX A;  5H6R B;  4AKI A;  4HFV A;  5IHY A;  4H9R C;  2L3L A;  2HH7 A;  4X1I E;  4OYK A;  3OYX A;  3PUA A;  1U4Q A;  4EZ4 A;  3ZLI A;  2CMR A;  4JEH B;  4DMW A;  2LSK A;  3KBU A;  3LBX B;  2LSI A;  3IF8 B;  5HAX A;  2ACX A;  3Q5W A;  4G63 A;  3OJA A;  2MBG A;  3ZYM A;  4E7Z A;  2BVM A;  4X1Y E;  5CA1 E;  2K5B B;  3C4Z A;  3NBX X;  4IE0 A;  4H63 H;  1V9D A;  5FY1 A;  2IC6 A;  2E9X C;  4BA9 A;  2KXP B;  3AVS A;  3V5S A;  2ZM0 A;  1MIW A;  1HF8 A;  5JR9 B;  3SOL A;  4TN7 B;  2V26 A;  4ASK A;  5LJM A;  1BR1 A;  2LSY A;  4QXB B;  2KIN B;  4HTE A;  3KV6 A;  5DJQ C;  4PAG A;  4KMC A;  2YU1 A;  4WBO A;  2C0S A;  2K24 A;  3GA8 A;  5EZY E;  5LJN A;  1HX8 A;  3IEE A;  3F31 A;  3KV5 A;  4UVB B;  4AKG A;  3MXZ A;  4L5G A;  2B1E A;  3LG7 A;  3VHL A;  3BQL A;  4IE5 A;  3F2E A;  5IYZ E;  4TZ4 C;  3WAK A;  3K3Q C;  4UEM A;  5ADX L;  1LRZ A;  3C98 B;  3IBP A;  3RYH E;  4C91 A;  1BR4 A;  3BQK A;  4PK5 A;  4ZS2 A;  2PFV A;  5FY0 A;  4ZOL E;  2YEV C;  3ZMV B;  1MMD A;  3O1J A;  2X9W A;  2DLR A;  5LA6 E;  2IW5 B;  4AQF A;  4ANJ A;  3N5L A;  2NOX A;  3GN5 B;  5JRE A;  4KUM B;  5FXX A;  4ERR A;  4AKR B;  5FYM A;  3HL6 A;  5AFU L;  1WLX A;  2VL8 A;  3MJX A;  4BJN A;  1G8X A;  3NZP A;  5JDN A;  1UX5 A;  1Z0P A;  4EYU A;  3PDY A;  1CUN A;  4FJO A;  3RYC E;  2HPL A;  3DTO A;  3LK2 B;  5M4Y A;  3LFM A;  3QUJ A;  2XTL A;  3CPZ A;  3UUL A;  3HKB E;  3M65 A;  3OKQ A;  2BVL A;  4QXH B;  5HYA A;  5LYJ E;  4M1P A;  4WW0 A;  5JDL A;  4UF0 B;  2NTY A;  3OBV E;  3K8P C;  4L0R A;  4UV9 B;  4UIG A;  2ZLY A;  1IZN B;  4CI2 B;  5F3J A;  3Q5X A;  2HPJ A;  4IIJ E;  2K48 A;  3CVR A;  2VAS A;  3ZMZ B;  2X9H A;  3H37 A;  2KND A;  3VKG A;  3KVB A;  4GOU A;  2LJL A;  3LK4 2;  4JUY A;  4CXW A;  4F6R C;  5LGU B;  3PU8 A;  2EHO D;  3ZCJ A;  3AAA B;  4UXN B;  5EK2 A;  4IE7 A;  4PJL A;  4QWN B;  4YJ3 E;  4YLH A;  2D0T A;  3BQI A;  1D1C A;  2V7I A;  4CI1 B;  2X67 A;  3CQC B;  2XAG B;  3N2K E;  3PE0 A;  4ILU A;  3JC6 C;  5F8P A;  3N9N A;  2W61 A;  3CQG B;  3W15 B;  2NTX A;  3ZN1 B;  3V5U A;  2EHO A;  5LGN B;  4CZZ B;  4HGA A;  5FY7 A;  4AI6 A;  2LHR A;  3L09 A;  2E9X B;  3TKL B;  2OA5 A;  1D1A A;  3FHN A;  5HXC A;  2LOP A;  4B6X A;  4P0A A;  4I50 E;  5L3E B;  1ZHC A;  3HKD E;  1D0Z A;  3QK6 A;  3O9X A;  4H9N C;  3RC3 A;  4HN9 A;  4H9O C;  2NW7 A;  4CI3 B;  2PJQ A;  4TV8 E;  2E8I A;  1MMG A;  2G0U A;  2H7O A;  3RRW A;  4CXY A;  4HKA A;  5FXW A;  2MTQ A;  4NUU A;  3N9M A;  3RRC A;  2CEA A;  3KFW X;  3O1I A;  1EZ3 A;  2M67 A;  4IGU A;  4KBM B;  4O4H E;  3ZC0 A;  3PUQ A;  4ZI7 E;  4UF0 A;  2QA7 A;  3AA0 B;  2V7L A;  4ZI2 D;  4H9Q C;  2JJ9 A;  3AAI A;  2J1D G;  5LOV E;  2I59 A;  2ZM2 A;  4AKH A;  3E22 E;  3ZYK A;  4HEA A;  4TUY E;  5H6Q B;  4Z8X A;  3AA7 B;  3MZK B;  4UVC B;  5JDF A;  3FBL A;  3T8O A;  3NRX A;  4EIW A;  2XAJ B;  5ETW A;  5JRC B;  2PBI A;  4ISS A;  2Q9Q D;  4MHC A;  4V1A v;  4MFR A;  5HXH A;  4OHF A;  3J7Y q;  2W63 A;  2PG8 A;  4NUV A;  1H7C A;  5J1G A;  5L2L A;  4O4L E;  4I4T E;  3I9Y A;  1HG2 A;  1HS7 A;  3ZN0 B;  5JDQ A;  3PTR B;  1QUU A;  3PUS A;  2BDE A;  3ZMS B;  2Q9Q A;  1ZV4 X;  4DND A;  3Q2M A;  4X20 E;  4YHJ A;  4ZS3 A;  4ZI3 D;  3ZJ2 A;  2E9X A;  2DNX A;  4ADZ A;  2QGS A;  2CXF A;  5L3C B;  3CKD A;  4ZHQ E;  3NZQ A;  3ESL A;  3SRZ A;  4IHJ E;  1HFA A;  4OFZ A;  2DCF A;  2W62 A;  2NWB A;  5KDM C;  2KWH A;  2CE7 A;  3RYI E;  3CML A;  2VKH A;  4WBN E;  1D1B A;  2JMK A;  3U78 A;  3CX8 B;  2JQQ A;  2CWO A;  5JDH A;  5FXV A;  5L3F B;  2X51 A;  5KX5 E;  3RPU A;  1D0X A;  4GYS A;  5LG4 A;  4O2B E;  2CCQ A;  3RH3 A;  2C5I T;  3LBX A;  3ZCI A;  2X0L B;  3ETU A;  4PFP A;  5GON E;  4GK0 E;  5C8Y E;  3N2G E;  2CM0 A;  4U72 A;  4AKL A;  3ONX A;  4PJN A;  4FI5 A;  3UUN A;  5J2T E;  1FMW A;  3CQX C;  4HE8 A;  4MLK A;  3A5X A;  5LBM A;  2KMF A;  2KZ7 B;  2Y8D A;  2YIN A;  4EAH A;  2LE8 A;  5HXE A;  1MIV A;  5JR9 A;  5EK4 A;  5LGT B;  4E7S A;  2ES0 A;  3DJB A;  5EK3 A;  2N2N A;  3KIN B;  1MMA A;  3E08 A;  4J2C A;  4IE4 A;  4PW8 A;  4BAY B;  3AVR A;  1OWA A;  3B57 A;  2V7M A;  3ZEF B;  2CLY B;  3KVA A;  3GMI A;  2KT9 A;  1U5P A;  1VOM A;  1KNZ A;  3AB3 B;  4PFO A;  2RP4 A;  4H9S E;  1YKE B;  4IST A;  4UVA B;  1NWM X;  2DHR A;  2A3D A;  2EHO C;  3ZJ1 A;  1VRB A;  3DP7 A;  4OYJ A;  3I0O A;  2N9D A;  3RYF E;  2WWU A;  3N9Q A;  5FMN A;  2YK0 A;  3C64 A;  5L3G B;  3C51 A;  4I55 E;  3S4U A;  3CWZ B;  4DMV A;  3BK9 A;  3LK3 B;  1YW0 A;  1HTJ F;  3HKE E;  1FIO A;  5DAB A;  3GN5 A;  3N9P A;  5DQV A;  3JC6 D;  5CA0 E;  1MMN A;  2LT3 A;  4DBR A;  4A56 A;  5FNV E;  4EZH A;  3HKC E;  5LCY A;  4C90 A;  5LXT E;  2XAQ B;  3HA4 A;  2LOS A;  3I9W A;  3C4X A;  3ZYL A;  4MAL A;  2IAK A;  2CLY C;  2D5U A;  3NRY A;  2IC9 A;  2VKJ A;  3PU3 A;  3KV9 A;  2V1D B;  3D0T A;  4H63 V;  5TAO A;  3WAJ A;  4X1K E;  4MBQ A;  5L3D B;  3B13 A;  2LEH A;  2X9X A;  2C5J A;  2UXN B;  2L8K A;  4PNI A;  2DI4 A;  2XAS B;  4O4J E;  4DVD A;  3N9O A;  2CXL A;  2VWA A;  4O2A E;  4EXT A;  2C5K T;  2WMO A;  3ZMU B;  4DBQ A;  4GYR A;  5L3B B;  2KWI B;  2LHN A;  2KLQ A;  4PJM A;  1LVF A;  1D0Y A;  3EDV A;  3UTK A;  3KV4 A;  1YKH B;  4ZI2 C;  5BMV E;  5KMG P;  2W0G A;  2MOZ A;  3KBT A;  2SPC A;  1UCU A;  3FXD B;  4PK4 A;  2DWK A;  2ODU A;  3HR0 A;  5JDM A;  5LHI B;  3ANW B;  3HI2 A;  3MKD A;  3WI3 A;  2ZM8 A;  4BJM A;  2P9B A;  1S35 A;  3R6N A;  2W00 A;  3P8C D;  2ZMA A;  4QX8 B;  2K9A A;  3ZMT B;  4XZC A;  1X79 A;  2MYS A;  3N9L A;  4CQI A;  2Y6X A;  2E9X D;  3AA1 B;  2Q9Q C;  4YJ2 E;  1IJ6 A;  2A2F X;  2X68 A;  3KDS E;  4OK0 A;  2WAU A;  3Q9D A;  2XAF B;  4EOZ B;  5HXS A;  3ZPO A;  5JQG E;  2VKO A;  1IAP A;  3MA9 A;  4H9P C;  3EDU A;  3FBZ A;  4K0U A;  2VK9 A;  4DO0 A;  5HWX A;  4ZI3 C;  2X66 A;  1BR2 A;  3L3P A;  4AQF C;  3MAC A;  5DQW A;  3O1H A;  3O4X E;  2VB6 A;  5A1L A;  3SWH A;  1IJ5 A;  5LP6 E;  3EVY A;  4QHO A;  1WRD A;  3I0Q A;  3UT5 E;  1ZEE A;  4GIW A;  4XAX B;  4IDZ A;  4AXP A;  3MK7 C;  2UXX B;  2CA5 A;  1LVK A;  1G73 A;  1MIY A;  3RX6 A;  2NW9 A;  1AJ3 A;  4I43 B;  5JVD E;  3AA6 B;  3F57 A;  2X9Y A;  1HG5 A;  2A72 A;  2XQY A;  4U74 A;  2EHO B;  2NW8 A;  4QXC B;  4UEL A;  4P0B A;  3ZC1 A;  3P7I A;  1YD8 G;  5FP3 A;  2BZB A;  2L9Q A;  3U3I A;  2N1G A;  2ODV A;  3K3O A;  4IE6 A;  2D2S A;  5JR9 C;  2Z6E A;  3AAE B;  4TX5 A;  4YFS A;  3UFE A;  4JEU B;  3ANW A;  3CX6 B;  2H3R A;  4UV8 B;  1MND A;  4PK6 A;  5JRC A;  3CX7 B;  3C4W A;  1US7 B;  3ETV A;  1B7T A;  2RA1 A;  5FXZ A;  5E0O A;  3RKO A;  3VU7 H;  5LHH B;  5LBQ B;  1T98 A;  1UX4 A;  3C50 A;  2CWY A;  1WYC A;  4L9I A;  3GWH A;  4EB6 E;  5HXR A;  3E0Z A;  3EUH A;  5LNK A;  3LJC A;  4KP3 C;  4CXX A;  2VKD A;  1BR0 A;  3FXE B;  2CXD A;  3PUR A;  4QKN A;  2WSS V;  2JMH A;  2LM9 A;  2GK9 A;  1QSD A;  1ZKE A;  2V7K A;  4JLE A;  4AQG A;  3RC8 A;  1WR6 A;  4GK5 E;  1HCI A;  5J2U E;  2H7V C;  4PJJ A;  2WM9 A;  1MNE A;  2XHE B;  2LSJ A;  4G2A A;  3K3N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...