4OHFA

Crystal structure of cytosolic nucleotidase ii (lpg0095) in complex with gmp from legionella pneumophila, northeast structural genomics consortium target lgr1
Total Genus 159
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
159
sequence length
461
structure length
455
Chain Sequence
KVFVNRIINMRKIKLIGLDMDHTLIRYNSKNFESLVYDLVKERLAESFHYPEEIKKFKFNFDDAIRGLVIDSKNGNILKLSRYGAIRLSYHGTKQISFSDQKKIYRSIYVDLGDPNYMAIDTSFSIAFCILYGQLVDLKDTNPDKMPSYQAIAQDVQYCVDKVHSDGTLKNIIIKNLKKYVIREKEVVEGLKHFIRYGKKIFILTNSEYSYSKLLLDYALSPFLDKGEHWQGLFEFVITLANKPRFFYDNLRFLSVNPENGTMTNVHGPIVPGVYQGGNAKKFTEDLGVGGDEILYIGDHIYGDILRLKKDCNWRTALVVEELGEEIASQIRALPIEKKIGEAMAIKKELEQKYVDLCTRSIDESYDQEIHDLQLQISTVDLQISRLLQEQNSFYNPKWERVFRAGAEESYFAYQVDRFACIYMEKLSDLLEHSPMTYFRANRRLLAHDIDILEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytosolic IMP-GMP specific 5'-nucleotidase
publication title Allosteric regulation and substrate activation in cytosolic nucleotidase II from Legionella pneumophila.
pubmed doi rcsb
source organism Legionella pneumophila subsp. pneumophila
molecule tags Hydrolase
total genus 159
structure length 455
sequence length 461
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05761 5_nucleotid 5' nucleotidase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1160 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4ohfA03
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 4ohfA01
3AR6A 1LTQA 5JJBA 2ODAA 3ET4A 3QU5A 2X4DA 1PW5A 5AI8A 5AKKA 3AR5A 3U13A 1Z4KA 4XPZA 3L8GA 1WVIA 3WKAA 2VKQA 2AGVA 4IFTA 1ZD5A 4Y2TA 1U7OA 2EAUA 4QQFA 2IYEA 3ONNA 2ZBDA 1Z5GA 4Y2PA 3IRUA 4AS3A 5AM5A 1Z4MA 5ALSA 3WK6A 1VJRA 2EARA 4Y3UA 5IS2A 3L8FA 3N28A 5AKGA 3SKYA 2ZG6A 1ZD4A 4OCZA 1YV9A 4NAVA 4L57A 3WKBA 3ZU6A 2BDEA 5ALUA 4BX2A 2W43A 3ZTYA 2C4NA 4UATA 2B1RA 5FP0A 4O8CA 5ALRA 3QUQA 3MN1A 3SD7A 5AVSA 3U7FB 2QYHA 3L1VA 1X42A 3U7EB 3BWVA 3U26A 2GHTA 5ALZA 1L7MA 3E84A 5T41A 3AR9A 3QUTA 1RLOA 3QNMA 5AI5A 3L5KA 2P69A 4L6CA 5AIAA 5AKEA 3ZI4A 5IT4A 2YMQA 1TJ5A 3W5BA 2ZBFA 5AICA 1RDFA 3K1ZA 2HO4A 4AS2A 2B8EA 3A3YA 2MU1A 5AI6A 5ALKA 3OPXA 4NABA 3CZ4A 5ALPA 4ZEWA 1WZCA 2G0AA 4I9FA 4OHFA 4UMDA 2CN1A 2B82A 4CF3A 4Y2YA 2FPSA 1J97A 3QGMA 3WKCA 5AVYA 2FPXA 2BY4A 3QU9A 3E58A 4FE3A 4G9BA 3MMZA 3RFUA 1MH9A 1RC8A 1U2SA 5ALDA 3WGUA 4EX6A 3OCWA 1VJ5A 3QU4A 4BBJA 3NASA 3QYPA 3A1DA 2FI1A 2HOQA 4ZEVA 1QH9A 4NWIA 4NV0A 1ZRNA 2B1QA 5ALGA 4BNDA 3QX7A 4UARA 3EF0A 3SMVA 5AW5A 3CNHA 2CFTA 2Q4TA 1YJ5A 2EATA 4C4SA 1Y8AA 3ZW7A 2R8YA 3L7YA 2YJ3A 4FYPA 4FFDA 4YCNA 2YFYA 3WK9A 1J8DA 1Q92A 4RETA 2YN4A 2WF5A 1RQLA 2IOHA 3U19A 3R4CA 4UMFA 2I55A 1T5TA 3W5CA 3J7TA 4MWOA 1TE2A 3PGVA 3L0YA 1L6RA 3I76A 4C4TA 2HI0A 1L8OA 3I1YA 2NYVA 5ALWA 2WF7A 4KNWA 1LVHA 5AM2A 5AK6A 3FVVA 4KX5A 2D2VA 1K1EA 4UMEA 4YH1A 3QU2A 3E8MA 2DQSA 5AK3A 4UM5A 3DV9A 3FM9A 4BEWA 4UAUA 3KDPA 5AM1A 3QU7A 1RMTA 2WFAA 1N9KA 3B8EA 2YMLA 4EEKA 3IB6A 1CQZA 3OTQA 4Y2SA 2ZBGA 3UM9A 1NF2A 3AR8A 4ZEXA 2JAOA 3SF0A 1U7PA 3L8HA 5AM4A 2ZBEA 1QQ7A 2G08A 5A3SA 5AW6A 2FUEA 3ZVMA 1AQ6A 2YY6A 3EWIA 5ALMA 1EK1A 2WF9A 1L8LA 4HGPA 2ZXEA 5AKIA 3WK7A 1U02A 1U2TA 2I54A 3AR2A 3QXGA 1RKQA 1Z4QA 3NRJA 2FUCA 1VFPA 2AH5A 3HLTA 1ZJJA 4YCMA 4DFDA 3F9RA 5ALJA 3A1CA 5AVTA 4H1WA 3I28A 4CF5A 1QYIA 3KBBA 4YIKA 5AI0A 3DDHA 5AW2A 5AVWA 2G07A 3P96A 2O2XA 4KN8A 3ZVNA 2Q5EA 3ET5A 3OCUA 4BNDB 3U7GA 2R8EA 3W5DA 3ZWDA 2R8ZA 4BX0A 3FPBA 1EK2A 4DWOA 2IOFA 2YJ4A 5AKJA 2CFSA 4Y2UA 3L0CA 2RAVA 3EPRA 1O08A 1L7PA 2FEAA 3ESQA 1Z88A 3OCVA 2G09A 4Y2JA 1RLMA 2WM8A 3WK5A 4HGRA 2NO4A 2GHQA 2G1AA 5A3RA 4G63A 1SWWA 1ZD3A 5AKYA 3N8GA 5AK5A 2YMPA 3RF6A 2WF8A 2OA0A 3IJ5A 3KC2A 1RKUA 5ALHA 4XQ0A 4XOUA 2B8JA 1L7OA 2PR7A 3UMBA 4MUMA 1ZOLA 4XE5A 3N5KA 3MPOA 1N8NA 3NUQA 1RQNA 3GYGA 1Z4IA 2B30A 2AUTA 2RARA 1XP5A 1S8OA 1JUDA 5AKZA 4C4RA 4EZEA 2PKEA 3WGVA 1RMQA 1WPGA 5AESA 4UU1A 2C8KA 1QQ5A 4BYGA 1TJ4A 3QUCA 4UU0A 3L8EA 5ALXA 3B9RA 3ESRA 1YNSA 1XPJA 2FDRA 3WKEA 1YS9A 3EF1A 5ALLA 4KYTA 2Q4RA 2C88A 2JAWA 4UAVA 3NIWA 3KOOA 2BDUA 3ZTWA 4CNQA 2GFHA 3L0BA 2W11A 2FPWA 4J03A 4GIBA 4CE6A 4EX7A 5AW1A 4YGYA 5AVUA 5AVVA 2G80A 3OCYA 4EENA 3NANA 2I34A 1RPZA 3N07A 1TJ3A 1ZRMA 2GMWA 5ALIA 3MC1A 5AI4A 1T9ZA 2GO7A 3DNPA 4Y2QA 1IWOA 2HEGA 2YBDA 4DCCA 2HF2A 2YJ6A 4L6AA 5AVQA 4RESA 3FPSA 4HGOA 5AI9A 5AIBA 5AW4A 1Z5UA 1Z4JA 1CR6A 4BEVA 5AW7A 4QJBA 4BX3A 5IT0A 2FPRA 1S2OA 5ALQA 4J2TA 3VAYA 4KNVA 4IG4A 4NFLA 2R8XA 2ZOSA 3WKDA 2OM6A 3OCXA 1YMQA 1F5SA 2P27A 3R9KA 5ALYA 3W5AA 5ALVA 2WF6A 3PDWA 4JDPA 3M9LA 1XVIA 2JARA 4OFZA 2QLTA 5ALOA 5AM0A 3ZX5A 5AKHA 3NAMA 2I33A 5A3QA 2G06A 5AK4A 5AW8A 3KD3A 2C8LA 1Q91A 2HF7A 1T5SA 3N1UA 1NNLA 5AM3A 1SU4A 5AW3A 3L1UA 1O03A 3DAOA 4UM7A 1L7NA 2HSZA 3SKXA 1QQ6A 5AW0A 4Y2XA 1Z4LA 4PNHA 2CFRA 4F71A 5AW9A 2FPUA 2B0CA 1NRWA 3D6JA 3SLRA 3UMCA 4AP9A 3TLMA 2IOFK 2WHEA 3HYCA 2P9JA 4HGNA 2IA5A 3OCZA 4HGQA 3ZUPA 3FZQA 2I6XA 4BKMA 4Y2RA 2YMMA 2O9JA 5E0OA 2RB5A 3KZXA 4UW9A 1ZD2P 3WK4A 2YJ5A 2C9MA 1RMYA 5ALFA 1TA0A 1Z4PX 4E88A 3B9BA 5ALEA 4KX3A 1YDFA 2I7DA 3S6JA 3R09A 1Z4OA 3NALA 5ALTA 2AMYA 4OD0A 2RBKA 1ZS9A 3A1EA 3AR4A 3ED5A 2HHLA 3AR3A 4HAIA 2HDOA 2MSNA 1WR8A 5ALNA 2OYCA 2JGAA 1SWVA 4GXTA 3ZX4A 5AKLA 3M1YA 5AVRA 3U7HB 5AHXA 3ZVLA 1FEZA 2PQ0A 3QUBA 4B6JA 2P11A 2HX1A 1Z4NA 3SHQA 1RLTA 3WK8A 5AVZA 3FGOA 4UASA 2JAUA 4JB3A 2HCFA 4HYTA 4YIHA 3UMGA 3PCTA 3QLEA 2OBBA 4EELA 3AR7A 1RKVA 3PGLA 4CF4A 4UMVA 5AKXA 4F72A 4YCLA 3E81A 5AVXA 4Y2VA 1KYTA 2NO5A 1RRCA 3ZWKA 3I6BA 4DW8A 2W4MA 3BA6A 4I9GA
chains in the Genus database with same CATH superfamily
2QGNA 1QE0A 2P2SA 1SQ6A 5K05A 1HFKA 2QMHA 4MDFA 4Y1FA 1BDJA 4CM7A 3EABA 4JJAA 2ALJA 2XPCA 1CG6A 4NOMA 4EJFA 1SXGA 2E5LT 3AM5A 3AH8A 1VLMA 4HSGA 4WJLA 3KINB 4TMYA 4MV4A 2OSBA 4Y6SA 5HJEA 5HWYA 3U4IA 1BNCA 3YASA 5F3JA 4EA9A 1DCFA 2HSEA 2WA2A 3TLVA 4D7AA 1L4BA 1QGUA 4BUZA 4M9SA 3FGPA 5E9WA 3ESDA 2UYHA 2NR4A 3KKEA 3O8CA 5LNK6 4XIFA 4XGKA 2Z58A 3OIUA 5BUQA 4RH0A 1SVOA 1XMQT 4UDXX 5ICMA 2NPOA 3MINA 3AB8A 4N76A 2V7IA 4LWQA 3ZMVB 1YQWA 1VLQA 2EQ5A 1E0KA 4UEJA 3FKSD 1SPBS 3SFTA 3L1IA 1GNTA 2ZJOA 3PX3A 2JJ2A 5ABFB 4MO2A 2VH2A 3IP1A 5AQVB 3LDUA 2EHOC 4HAUA 2H57A 2YWXA 2HN9A 3FCOA 5AM2A 4YH1A 3NC4A 4NOJA 3RJ9A 4WBNE 2OBYA 5FJJA 1X9GA 4CQMB 3QVTA 1MJFA 2B4AA 1YIAA 2I7XA 4RACA 4HEHA 1U7PA 1C1DA 5H68A 4O4LA 1YDEA 4ERXA 1CLEA 1L8LA 3ME5A 2MMGA 1R9JA 1PFVA 4JKYA 3WV5A 4U9UA 4LW8A 4EHNA 2RGEA 5JCZA 1ECCA 1G6KA 2O2XA 4ZYZA 1X1SA 1X2EA 1PD1A 4BNDB 5H0IA 1E3IA 3AM4A 2WD7A 2PLNA 4JIGA 1ZCAA 8ADHA 2FRXA 5ABGA 3Q72A 2XUZA 1HYQA 1W35A 1FJGT 1JN0A 1GYQA 2X1LA 4B6FA 1FSZA 3T34A 2CVPA 3MELA 3TD2A 2ZIAA 2HZBA 4JQSA 1HE5A 5LP6E 1R7RA 1OWMA 4P3OA 3ZE8A 4M54A 3O92A 1H0HA 2AF3C 1DZ3A 1XTKA 5D01A 4JL6A 3K72B 4AKSA 3FBTA 1JDBB 3BTVA 5KYXB 3ESLA 3S68A 2Q9UA 3AKZA 1UBFA 4RHUA 3KHSA 4DZZA 5D1HA 1WBJB 1HT2E 3DZCA 2FSHA 3L7AA 1NOJA 3KS9A 1Y4DE 5BNTA 4CMAA 2FMIA 4QGHA 2WB5A 4N3GA 1QF9A 2W70A 2RHRA 1CUJA 2GEVA 4X1OA 3AESA 2FUG1 3IA2A 2HL6A 3SOPA 3A6DA 1ISRA 1LVUA 2XBMA 1M1XB 5THQA 3ZCRA 1NULA 3ADOA 4Q9JA 1BJKA 4F3KA 1KNXA 2VRBA 3G5UA 4YUXA 3H5RA 3DL2A 3AHFA 3RTDA 4BO1A 2GPTA 2WF6A 3L07A 5KNBH 2CBIA 3R23A 4XH9B 3ELYA 1NURA 1WAMA 3ICOA 2WIJA 3OBBA 3FYUB 4DAEA 2I4LA 2IU3A 4HNSA 3SN6A 2VF2A 3WIOA 3OJAA 1XEXA 3IAHA 1RYMA 4TUYB 3V4FA 3AZQA 3GY0A 1DQPA 2P78A 3L3BA 3NPMA 2JBHA 1J33A 3KAJA 5BR1A 2H89A 1H2HA 3FTDA 3BF8A 1Z4OA 3BWCA 3K0BA 4LYFA 3DBLB 3C97A 1A72A 2HDOA 1KGSA 4YHJA 4Y9UA 5BNIA 4L0RA 2WD8A 1C4OA 1PKXA 4JR0A 4IY1A 3GBVA 4RCZA 4ND3A 1QMGA 1O96B 3GLUA 2WJGA 1HDYA 2XX3A 2P3QA 3I5YA 2R6CA 2OB1A 3CEHA 3VR4A 2IQ5A 2VCHA 1FJ2A 5JO9A 3TK1A 4S04A 5IYZA 4ZCTA 3LQFA 1ONNA 5E95A 3P9ZA 4LYEA 2EARA 2WW8A 2NP9A 3F6RA 1QVWA 1ZJYA 3TE7A 1YV9A 3IEIA 4P98A 4DMWA 1NP3A 3SJUA 4JUDX 4I6JA 1UBCA 3WWOA 3RYCE 4MV7A 1WS6A 4HPWA 1HE3A 2J41A 2VYNA 3HNRA 4A2WA 5EJFA 3RS4A 2COEA 3K71B 2X1MA 2X3UA 5ALKA 1P44A 4DVGA 4W5NA 5K3DA 1WZCA 4F8HA 5K8VA 1FDRA 2GJ4A 2EERA 4OHKA 2H7VA 1MC4A 2D0UA 4L02A 3RYHB 1NVVQ 2IYRA 4HNGA 2TMDA 5FFMA 4B5KA 5CBKA 3HKCE 4TYWA 1FFDA 4I1SA 4RD4A 4H17A 3CWZB 3DBVO 3RVSA 1CEYA 3TI9A 4IHJA 5CUQA 1I7SB 4ISTA 5D1NA 1SHTX 3OD1A 2A84A 4NR0A 1LKXA 1JAYA 5BWCA 3NYQA 4IJMA 1BE1A 4G6ZA 4AY5A 2ZSFA 1J5WA 1J99A 4WN9B 3U5ZB 3QBTA 1NUTA 4TN1A 3GPLA 2PD3A 2MYPA 3CX7B 3NTXA 1E3TA 1I5OA 3VH3A 1BQ4A 5KU1A 2A94A 1X87A 1UIMA 2KWIA 2QSYA 4MW1A 2R2AA 2BL4A 4LISA 1RKXA 1T8YA 2JLQA 3FHCB 3CF4A 5IW8A 4L9SA 1FS4A 3CG0A 4D3ZA 3L4BA 2IIQA 2Q9QD 4HDRA 2PCLA 1BC5A 1SOAA 2BFWA 1R3UA 3AEGA 3CMMA 3F73A 4BWYA 2BBWA 5C2JB 4UDOA 1XQYA 5CD1A 4L8WB 1GTG1 1IZZA 3KL2A 2JCGA 1NXVA 2TECE 3O03A 1U0TA 1ISPA 2WHXA 2G09A 3AF0A 2WM8A 5BWLA 3DO5A 3OOEA 1PVOA 2FRDC 1U1EA 1E7RA 2WF8A 3BAZA 5T67A 2I0MA 5D85A 2EIXA 3ZDQA 4QA9A 2LW7A 2M6BA 2O0MA 3K9BA 5A62A 4INAA 2I2FA 1Z82A 3TO5A 1X19A 1W46A 3WGVA 4DDUA 5HM8A 3QUCA 4W6QA 4KI0F 1NL3A 1A9PA 4IUDS 4TTIA 2Q4RA 5H82A 2YYAA 4XUDA 1IVYA 2GZ2A 3S4UA 2AHRA 3QVJA 1BKYA 4WOKA 5KJCA 1XQXA 1AKYA 1UCFA 2OILA 2I34A 1V47A 2QL6A 1ACMA 4U7HA 4XXHA 1KEPA 3GJ0A 2GLXA 1X7ZA 2QM7A 1G4HA 1FMJA 3NBKA 4NC9A 2XUOA 4URFA 3TVYA 3KSDO 2FMUA 1JQBA 3RFXA 1F2UA 1NRJB 3V2IA 1CRZA 1E1QD 1D0IA 4YNBA 4Y7DA 1BD4A 3PFWO 7GPBA 4PIPA 3U31A 1QE3A 3HDHA 1ZWLA 3WRXA 5HFAA 2AD5A 3F9IA 1DEHA 4NHOA 2FPPB 4EW3A 4KK3A 5KVAA 2I2XB 1NWHA 4LQLA 2LSGA 4J4TA 1OAOC 2VDOB 1JH8A 2FYTA 4ZOBA 2D1QA 3MZ0A 3RQIA 2ATIA 4JASB 2AC7A 3ITNA 4RVFA 1TA0A 5KNCD 1NONA 1MRZA 4CN9A 1AN0A 3PNKA 1MB0A 3CGGA 2EZUA 4HQRA 1I6MA 5DHRA 2GK3A 4QTZA 4YV7A 8LDHA 2JGAA 2XUQA 1KI6A 4JI0B 3PVZA 2RHBA 3MMSA 3AUKA 1Z4NA 3JASB 1TCVA 5HP4A 4ZQHA 2ZYUX 2AEFA 3K8ZA 2KXPB 4D9FA 8ATCA 2L0XA 4OA8A 3IQEA 2ZRMA 4BA9A 4YMHA 3VZBA 4RNCA 4L76A 1GYPA 2X4DA 1ORDA 3O1IA 5CGZA 2WM9A 1JR3A 5GONE 1KBOA 1Z07A 4ATNA 5FH9A 3SSAA 2X0RA 1SXJA 5KSWB 1XQWA 1OVGA 1U11A 3OQIB 5DHPA 1T4GA 5H1YA 3ORSA 4N0MA 1Y3AA 3EBOA 1JFRA 2NUPA 4IX1A 3ZKRA 5BR7A 1BH6A 3NOXA 3DEYX 4E5KA 3IKTA 1MV8A 1H9AA 5C34B 3N7AA 1KMIY 1F17A 2H54A 3MWEB 1J56A 2MSKA 3AFNA 1T26A 3HKDE 4TYNA 5ALPA 4G5YA 4QVKA 1DIBA 1J1IA 1R5JA 1G3QA 4DPKA 3G5AA 1COZA 2BY4A 2XZOA 3V55A 4NULA 1RM4A 1XZBA 3STTA 4CDRA 2FDXA 3ZQKA 5AQIB 2WT8A 2WHRA 2YJ3A 1XF1A 1XTIA 4NBLA 4LVOA 3Q7TA 2DHEA 5F12A 4ACAA 5FY7A 1MMGA 4GOUA 3ZDYB 4S0XA 3SE0A 3K9LA 1AA6A 2XGSA 2DFNA 1LVHA 2YHUA 1JNRA 2ZSHA 2HHCA 2GPNA 4TT8A 2L3LA 1NUHA 3DV9A 3EMKA 1VKRA 4EFLA 4ETNA 5JNSA 1FZQA 1W2GA 1EBFA 2B9EA 4ZS3A 1ZV4X 2OHIA 1NF2A 2ZM8A 2C9CA 4F21A 1XLUA 3I9YA 2OLKA 1F1JA 1WOYA 2PUAA 3EJWA 2QTWB 5E7MA 1PQUA 1AKTA 4DFDA 1NUQA 1LKZA 1U0FA 4WKNA 2J0QA 3FYDA 1NJ2A 3V6MA 1U9IA 1ATIA 1OWPA 3VKGA 1D0ZA 3OO0A 1J5EB 3X1JA 1ULBA 1LU9A 3PEUA 4ER5A 5I9IA 1MG0A 2Y27A 1B23P 1SWWA 3QKRA 1JG7A 4FFBB 3C8MA 5CW2A 2O8NA 2B5OA 3KC2A 3V1MA 2W4IA 1E3LA 1CJVC 4BU0A 2VT3A 3B70A 2NTNA 4NCIA 2VUIB 421PA 4BHTA 3NV9A 4MYUA 4D6YA 4ZMBA 4M1EA 2M98A 1OC2A 3GFGA 3I0OA 2IPLA 1D03A 4MKHA 3D3EA 5J2TB 2PJUA 3FSGA 3WLLA 1ISMA 4MUIA 2VSNA 4EVRA 2D5BA 1IY0A 4IXDA 5CLLA 1GNLA 1SCNE 1JTEA 4G67A 4B33A 4WCVA 4Z51A 3WIEA 1L7AA 1SVLA 3EXEB 4EGQA 3REGA 2C92A 3G2PA 4FEGA 2N1MA 1UT5A 4JEIA 4ZAFA 2DCFA 5JY1A 3T5AA 4OFZA 1UURA 2OCDA 5FNVA 3CXUA 1V1MB 1M6VB 1VCSA 3C3YA 1KZ6A 3CF2A 3KV9A 2Q5FA 3OLXA 4UJ3A 2OG2A 1UODA 2ZAYA 5HNKA 2F1HA 1RI1A 2BCEA 3ZYLA 2F4VB 2BR5A 3B9BA 3TW0A 4KX3A 1K4KA 2PR2A 4YRKA 4DS3A 2W2OA 5DV9A 3AR4A 2PQMA 3FA2A 4QXCB 1EZ3A 4AX8A 4EAAA 1XV5A 2REXB 4OHPA 5CFPA 4IBOA 1N33B 4X7BA 5CTAA 2VF8A 4C7MA 3HDQA 1RM0A 5JSZA 3ZE0B 3NC1C 2ZB4A 1JBEA 5GOZA 3VDQA 3E22E 4WUVA 2J6HA 2ZUFA 1P0CA 1M34B 3QU5A 2J3HA 1G5RA 1OOEA 3KBUA 1V16A 3OJLA 3EPJA 2JPDA 2G1PA 3ZE2B 4PAMA 3TYXA 1K06A 4NMXB 1QP4A 3LTNC 1OASA 2C4TA 3FWNA 1R3DA 3EK2A 2ZK7A 3WFZA 2R79A 5IF9A 4WOJA 1YXMA 1S2MA 3RYFE 4KPGA 2VC2B 1D9ZA 1NF9A 5U4XA 2I4TA 4AY2A 1YKSA 4QHTA 1M0WA 2BG9A 4AUEA 5IVPA 2I87A 4ITRC 3HI6A 3AY3A 5J2UE 4YRIA 1L7QA 1GTRA 1Y98A 3W8RA 3DGFC 4EPXA 4P4LA 4DLRA 1I0LA 2PUGA 4E1AA 3N58A 3R2JA 4Q1FA 3K8PC 2HQ1A 2WZQA 2LSIA 1WLXA 4BNJA 2C5GA 1I6ZA 2J33A 3WL3A 3CQCB 1MNDA 3PQEA 5BXQC 3EVBA 3ZNPA 3M2PA 2IDOB 5T3UA 4UEKA 2WU8A 3AA0B 1K1EA 1B15A 3FMOB 3QU2A 4GR5A 3V2HA 1C0PA 3OTIA 2Z57A 1JE0A 1RCFA 4DUZB 3PUIA 3MG9A 1YA8A 5C8XA 3ZLBA 3TQCA 5JJ5A 2LSKA 4CKWA 2HQBA 4DNQA 1VL0A 3NBAA 1EK1A 4LNHA 2C4MA 4YUYA 2O0LA 5T6BA 3D4BA 4GL2A 4QD3A 3IEEA 1P7WA 4L75A 4AZ3A 3VPFA 4PQEA 4PM4A 2OBXA 1G3MA 3DMTA 4JJ6A 2GJKA 2ZSUA 1A98A 1A69A 1Y9EA 4K05A 3UIEA 3KL4A 3THXA 2RGRA 2GF9A 1XFAA 5IH7A 3RC2A 3T5MA 1F0PA 4TS1A 2AT1A 5J40A 1FQKA 3MJHA 1JVBA 3QJ5A 4KQCA 4DEXA 3W15B 2VVSA 1D2NA 4ZU3A 3R7LA 1JUDA 4GO1A 1FP7A 4FKBA 3Q9NA 1CY0A 1Q7EA 2H4HA 1XYVA 5FR1A 5BQPA 4GI3A 5TY0A 3PEFA 3I6QA 3PPXA 4QHYA 4ZI2A 2PWAA 2X40A 1J22A 3E3MA 3BJIC 1H6DA 3ETLA 1IB0A 1D7AA 5IX8A 1KDTA 2OQIA 4RD1A 2JLAA 2IGTA 4EI9A 3N2IA 1NIJA 1NI5A 3HU2A 4JXZA 4RH1A 1CE8B 3BD9A 2HHAA 1A7JA 1WV1A 4IGFA 1JX6A 2ORVA 3BE8A 1KPGA 2J62A 3AA7B 1Q1BA 1FTSA 1QH8B 3PLNA 3PU6A 3DHVA 3WLFA 2O8CA 1KBZA 1A8SA 1X38A 4I08A 3G8DA 2VZ0A 2XPKA 2BHSA 2RG1A 1KI7A 1U90A 1X7WB 1BCSB 1IXKA 3T7DA 1AKVA 2VEDA 2O9JA 4UW9A 2WYOA 2MWMA 4QTUB 2IHNA 2G0NA 5CM2Z 3IODA 3NALA 4GI5A 2FSPA 5E3JA 4QARA 1P9OA 3FZFB 3F57A 3ZJ5A 2ZZNA 4U1RA 3NVOA 1QIIA 4QPJC 2C78A 4ZO4A 3GFVA 1F8UA 4BMPB 2DFPA 5CJPA 1O57A 2R1UA 3GCGA 2WJ4A 3QKSB 4TVKA 4Z4CA 2RSLA 1L9KA 4I66A 1T36B 4NBKA 3CR8A 3O4FA 4ZN6A 1UP7A 1WULS 5DCLA 4ML3A 1DHTA 4CKBB 1V3UA 3N3AC 1RLIA 1OWLA 5CHYA 4WMLA 5F35A 3VU8A 3IRUA 4MMZB 2YJGA 2C31A 2GPAA 2H7CA 4ZI7E 1YT5A 1Y5NA 4FSDA 4R83A 1TYZA 3OTHA 4EMTA 4ADZA 3JAFA 5IT9A 2YZ2A 3R3UA 3TNJA 1ZIDA 4TM8A 5ALZA 1I4WA 1O94A 3E9RA 3HO6A 2PUDA 2FWAA 1NJ8A 2ZSKA 3ZU2A 2O2HA 1GPNA 1FZTA 3A3YA 2J9FA 4JELA 2LHRA 3JQCA 5EINA 5BRJA 2NP6A 1NMEA 2ORIA 4PSKA 1V45E 1A71A 3H2IA 1J97A 3I3SR 3M9XA 4IIUA 3FMPB 2NTJA 1WNTA 1DBRA 4GMXA 3NATA 1J49A 1D7OA 3W4KA 3AG5A 3NKLA 4MPDA 3CX6A 5FWYB 1LPPA 4LOAA 4I8DA 3MA0A 4CG3A 2C2MA 3DBHB 1SUCA 3RRCA 3IUQA 2VBGA 2A9KA 3MOGA 1CR1A 1AE1A 3KB8A 1VSTA 2C5BA 4MVJM 4MS1A 1OLUB 3DA8A 4RKQA 2CXLA 1LC0A 1SVNA 4KE8A 1N9KA 2P3OA 5CBPB 3KWJA 3VR3D 1SZJG 2GAIA 2VRCA 2ZBEA 4P82A 2JLWA 4GZ3A 4LRQA 2Y1EA 2X8LA 2F17A 4Z4GA 4JOCA 4DB4A 4A6XA 1L4UA 4O25A 3WGKA 2B76A 1EH5A 2BMEA 4JXXA 2AEJA 1FQOA 4CF5A 2ZM5A 2KPOA 3B57A 3HPRA 2OGZA 3MT8A 3SC3A 3ESYA 3WYDA 4YT5A 5AQMB 2DJ5A 2Q9BA 4JEHA 3CSSA 4ZHQB 1OZHA 2BJWA 3G2JA 3KZCA 4Z3KA 3AY7A 3ND8A 4LVNA 4EO9A 2IUFA 5F1YA 3KXLA 1EDEA 4DQ0A 3RGWS 3TX2A 3MUEA 1ZOPA 4PPYA 3CZ5A 3ETHA 5CPBA 1LRLA 2Q4DA 1AIPA 1JHQA 4O2AB 3NWIA 1G19A 1H3FA 3VR4H 3ROTA 3QRWA 3HKBA 3LP8A 4DJEC 3ANWA 5DASA 5EWJA 2CDNA 5HA5A 1K8YB 2FZ5A 2P2LA 2WMYA 4HFRA 4LV8B 3GT7A 4L9WA 4KGXA 2PL3A 4JBWF 4JHLA 2B2NA 3GK3A 1OQAA 2P5TB 3OUZA 4MRSA 3HDVA 4YTEA 3WGIA 5BRNA 4R68A 4O4IA 1IUNA 1Y1QA 2FLKA 3IPCA 2PBZA 3M83A 4ZTZB 1RYEA 3HA3A 1M1YE 1REQA 4HFDA 3UB2A 1DWQA 1MJ5A 1Y1RA 4X45A 4FS3A 4RSMA 3GC6A 4EEBA 4JZYA 3WYBA 3WRYA 4EHBA 2AG6A 1KDVA 2LLYA 1BHJA 1OUMA 3QJGA 1VM6A 4D8TA 1W0BA 3MCAA 3R0ZA 4RZSA 5DHQA 2ZPUA 3Q4GA 4EDHA 2OHFA 1YQGA 2XTAA 1EG2A 1UMBB 1PT5A 4MRPA 2UV8A 1TA9A 2JQKA 4PLCA 4Z1MD 4DMMA 2IS1A 3EGDA 2X5OA 2I7TA 2X9YA 4ILEA 3PR1A 4D41A 3CPZA 1G8MA 4ZRDA 3SFDA 1XKXA 3DYVA 4Z2YA 4EVIA 1XN1A 2F43B 1XNHA 4RF2A 3T5BA 1U6JA 2PO7A 5ESRA 2BSXA 4U2YA 4OJMX 4AL4A 5AJXA 2HMWA 1SVUA 4IX9A 2JLRA 1FUYB 2L18A 5CITA 3OQ6A 2KNDA 2C5LA 2YWBA 4EG8A 2WHQA 2PEZA 2P1ZA 2YDSA 3OJWA 2BMJA 3PUZF 4HUQA 5DXAA 2CVZA 4F91B 1OBVA 1M9NA 5JLJA 5FVLA 5ABPA 5AQPB 3CK6A 1K0FA 2IUYA 2TYSB 1ORTA 1P4RA 1QF6A 3GJZA 4S05A 1SBYA 1QYVA 2OCIA 3KPYA 2YVQA 4INOA 5TPWB 3H9GA 1C9EA 2WBLC 2VNHA 2OV9A 4AO7A 1D07A 1GPAA 3UAZA 3S8YA 4JJEA 3OTOT 2FLWA 3MTAA 1SIUA 4IVNA 1E9VA 2AXDS 1KMQA 4G9BA 4BBPA 2HBYA 3VKWA 1LJ8A 4TV8A 4G2TA 4PK4A 1QS0B 4GSYA 3T1VA 1OA0A 1IVSA 2JMKA 2GLUA 1PEYA 1LDBA 2P91A 2I78A 8GPBA 4F2WA 4DY6A 4ES6A 4H9RC 3ST7A 1Q1NA 1XTRA 5HXEA 3CLHA 2YVKA 1WF3A 4GT1A 4PG4A 5CA1F 1N36T 3FSJX 4KQ2A 2A3DA 5LA6F 4DV1B 2A9UA 3RK1A 1BDHA 4CCAA 1KZ4A 3WMXA 3KYDA 4MWZA 2DYKA 4IL4A 1QC5B 1DXQA 4XPIA 3FPGA 2EDAA 4BTLA 2YY6A 1C50A 2I4IA 1YHYA 3RYIE 1L5ZA 1IHXA 2DULA 1MMNA 4KGZA 5K6RA 2IS6A 4JI6B 2X0FA 4LDPA 4I4TA 4AJ1A 2D7JA 2C5FA 4NU8X 4HNHA 4H6VA 4WLFA 2ZR9A 3OU7A 1GZHB 3M1IA 4DBLE 3S70A 4TLCA 1XP8A 3IB3A 3OZDA 2OK7A 4ZO8A 1VYHA 3E48A 3EX7C 4GEGA 1W9HA 3NXSA 1VRBA 3KE8A 1CRLA 1OV6A 3MQ2A 1CSEE 4BX9A 2J8ZA 4WNCA 2R65A 4XQ0A 3NORA 4G5FA 5E4JA 3K8YA 1UDCA 1IZ8A 1R4MA 2BEWB 2PKEA 3KNZA 4RGYA 1FMFA 2NAPA 5I9BA 1VJ1A 1HPLA 1FYXA 2WHPA 5KC9A 1JE1A 3T3HA 3I6YA 1QGZA 3AM1A 3N9LA 3DVAA 2O05A 1E98A 3UQ4A 1Y9ZA 1KMMA 4X65T 4LJAA 5KJFA 3HO8A 5A6SB 3NKVA 3EYWA 3K6KA 2OAGA 5IXYA 3T3IA 3D6MA 3UWPA 3RUIA 3GRPA 4EH1A 3KWMA 3H97A 3TLYA 4FD3A 4QLBA 1I94B 2WIBA 3REFA 4R2KA 3FD8A 2GVDC 3I04A 3ACCA 4BY9E 3FNFA 3A1UA 2FSVA 3VQTA 1PQWA 3QLVC 4OKNA 1ZH4A 3LWDA 2GSDA 1A97A 1SC1A 3SBOA 2CD9A 4Q34A 3DOEA 3UBMA 4A0FA 1OLSA 2JASA 2I1VB 3WWYA 1NY5A 5DWQA 4IH9A 1P1CA 4RDHA 3NHSA 2X68A 4S35A 2GOYA 1EK5A 1T3GA 3HUDA 1KIFA 1JZQA 5BV1A 2FPUA 3M6WA 1VJTA 1ZNZA 3UMCA 2CBGA 2RB5A 3BZBA 3T35A 3MWLA 4LOJA 2GCOB 5LLDA 3N0XA 1UM9B 2P65A 5I01A 5HF9A 4PZAA 2JGDA 1P6QA 1XU4A 1JKJB 4Y9DA 2I3BA 2IEZA 1DKLA 2HRRA 2JIZA 2X4IA 3CEJA 5HZHA 4YXDA 1GZ7A 3T7JA 3QHPA 4LF7B 4QYIB 3CG4A 1VKJA 1OXZA 2HCFA 3R0QA 1BGVA 5L45A 4NH4A 1TK3A 1YD7A 1U5AA 1QHHB 4RKYA 1BXGA 1UBNA 1RLUA 3BOSA 3EZ6A 3NHUA 4DR1B 3G68A 3AR6A 5H4GA 5I4BA 3PNBA 2EHOB 2WZHA 4J7AA 3HCOA 4IDAA 1PE0A 4MQLA 1KP3A 5EZQA 4ZYTA 1N1GA 3MKDA 1FU4A 4I7EA 1XHFA 1BS2A 2MR5A 4CL8A 2ZIWB 2PS1A 4BKOA 4OXYA 2NZVG 3R5JA 4MHOA 1MQ8B 3Q7RA 4V3BA 3TLGA 4L6CA 3L2OB 3MIIA 2ZBFA 4UVHA 4P4GA 3ENQA 5HW0A 2QUZA 1U7UA 3TUIC 1KC1A 2V9PA 3SEZA 1ZOIA 4DR4T 4MDHA 4LY3A 3CA8A 1O2DA 2HRQA 2YS6A 4L4UA 1TCAA 2QOEA 4ANJA 2J7PA 4PSVA 1BD3A 1KZGB 2ZDQA 5FULA 2K5BB 2OMEA 4PJLA 3CUWA 1VJ5A 3ERCA 3A1DA 4IGEA 1JQDA 5LQAA 4CT5A 5F51A 4I50B 4LF8T 2NXJA 1M8FA 3I6IA 5G4KA 2EJTA 1NZFA 4IKOA 4UVIA 2IYLD 1VGQA 4XJXA 1SBQA 2E2AA 2IYTA 3WXBA 1D2CA 1V8ZA 2ZP1A 3SMQA 2WF7A 3PFBA 5D5HA 3TLAA 1PV4A 1JSXA 4OJYA 2AFHA 3BDAA 2OVBA 5L3ZA 4AY4A 3W1WA 4EYGA 3ENNA 5JW6A 2VSYA 1DQRA 5JR9A 1QE5A 3M3DA 4FQ7A 5EE0A 3WI7A 5ITWA 3PXUA 4WKPA 3SF0A 1Y8QA 4MJXA 1M7GA 3FLEA 2V6YA 3AF5A 5H02A 3K31A 2G63A 5LJMA 1KRXA 3WLTA 2YZKA 1DTEA 3I0MA 2Z8XA 4ZYXA 2VPWA 3IIJA 3JD1A 2WG1A 3P4SA 1IEWA 4U00A 3PC7A 1F4PA 4KLCA 1X3SA 5HK8A 2BEVA 3FPBA 3DB1A 3TOVA 2UDPA 4WXYB 4HADA 2GN6A 1DJOA 3ESQA 4QOSA 4WA7A 2R6GA 1EGVB 2I7VA 2AV6A 3QP9A 1NT4A 2HMSA 3AWIA 4I9NA 3UA4A 2FWRA 3VH1A 3C6BA 2PR7A 2NQ2C 3D0RA 3QVGA 2P62A 1AY0A 4LTDA 3FR8A 3O93A 1OWNA 4UBLA 4HWPA 1R6AA 3TQQA 4Q7MB 2N42A 1MBZA 1LQUA 1WF6A 3U3IA 1ZCBA 3WBBA 3CBGA 5ALXA 2O3SA 4LRSB 5ES4B 5GZ3A 3IR6A 3EYAA 2QZ4A 1HDCA 4Q3AA 4R69A 1HORA 4FYMA 1I4EB 4D9GA 4X1YE 2HD4A 3JX9A 2C7PA 1B3BA 2VJKA 1J09A 3BORA 1T4CA 5FPTA 5ALIA 3TCNA 3GAFA 4DL9A 2QAGA 1N8SA 2JHGA 3RE1A 4L6AA 5B2FA 1K2WA 1A3CA 3LUFA 4NHEA 1WD5A 1KEZA 1YVRA 4OAOA 2EHDA 5AP9A 1X1EA 1X3LA 5DB4A 3IHKA 5F1KA 2NV6A 1HTWA 1NN5A 2FXVA 2PMEA 3MLEA 5C2TA 4F06A 5FPHA 4IFBA 4XAXB 4V1CB 4M55A 1RXWA 4AROA 1JKIA 1PJSA 3VPSA 3HKEE 4CKEA 3UT5B 4WFJA 3UFGA 3PC8C 3WFIA 4DKJA 1SUDA 4TLAA 1KO7A 1KQ3A 5HFJA 5IC6A 1GPLA 4MPTA 2AFIE 2A58A 2XVAA 2K6GA 2EBWA 4LXIA 3ASVA 4DWJA 3ZCUA 3H3AA 2QUJA 4LYJA 5GGYA 1QTIA 4F4UA 3I52A 5IJ9A 4MS3A 1XROA 2I2WA 3HVRA 2RH5A 2VF7A 1Z3CA 2V55B 2MTBA 2OP0A 3L7JA 4E7OA 4EELA 1BXRB 5BSWA 1HGXA 4ZMRA 2PGAA 1SG0A 3BA6A 5MN6A 3C3WA 4FUTA 4KWCA 3DLHA 5CMLA 4DSNA 3UA3A 3ZHCA 1JDUA 3NKZA 2R00A 3LWNA 1XD9A 2FR8C 2XLBA 1RRGA 5C8YF 1PEKE 3IDFA 3W7AA 3MGCA 2GAAA 1A8UA 5LOVB 4B8YA 3KOXA 4QOEA 2LEHA 4R9RA 3IHRA 3VC2A 3HJFA 2H4JA 4BS9A 1HEIA 2QGSA 3G2QA 1P7YA 3L5KA 4NF2A 5COBA 4AO8A 5CK4A 3F46A 4YACA 4BB9A 2XOKD 4W7SA 2RDMA 4MPRA 5TF0A 2B8EA 3VKUA 1L7XA 3ZMTB 1KO1A 1KKMA 2VAVA 2ID9A 4OQXA 4E5UA 1NI4A 2DCMA 3IEXA 1GNVA 4ZVVA 5KI6A 2LOSA 4EZIA 4W5TA 1CF4A 4IFIA 4IQ8A 5E0KB 3IPLA 2VEOA 1GQQA 3GR6A 5E2IA 4MQFB 2G4VA 4GMHA 1G1AA 2WAOA 2M2IA 3FNRA 1NY6A 1UFQA 1XZ8A 3V1KA 1ZFNA 2PX2A 1C0IA 2GBFA 4DIUA 2V59A 4ENTA 3GLHE 3AHDA 5BN5B 3W8DA 2QUAA 3W79A 2CJWB 1NBIA 6AT1A 4XQ9A 5BN3B 1Z0FA 3NBUA 3KVNA 4Z4HA 1FW6A 4D46A 2OO7A 4YPVA 4MH0R 2EX1A 5CA0E 3FPFA 2H88A 3PZBA 4W63A 3LSVA 5TMDA 1FRVA 4BJ1A 1YIOA 3H99A 1U1GA 2UUBB 2FPLA 5CIQA 2FMFA 2WF9A 1TAQA 3UICA 1G3UA 1N5LA 4ZQEA 1L5GB 3DE3X 4D0RA 1TYEB 4EHFA 1QUUA 1E96A 2AW3A 2FETA 1U8XX 4RK1A 2RGBA 3TG2A 2R8EA 3OUTA 4J16A 4JI8T 4E2FA 5HOQA 3JVVA 4QPNA 5ULLA 1WB6A 1YKFA 2DP4E 4LJYA 1PJ8A 1T6NA 2IF2A 2Z2YA 2ZU0C 1AUXA 2IQIA 1Z2CA 4TRJA 4UXIA 2C9YA 2WAXA 4AC9A 2NU7A 3GJRA 4RORA 3ZCSA 1E2PA 5TV2A 3K96A 4R6WA 2I2CA 3OQHA 3DF9A 1WPGA 5FWAA 5B57C 1GU0A 4OUKX 5EFZA 1I13A 3HR7A 4QJ5A 5ARCA 2P9QA 5ABEA 1E3DA 3V1YA 4ZRNA 2ZT6A 3R5KA 4IF4A 2DPGA 4B45A 1A8QA 3VBCA 5DBFA 4XLTA 5ES3A 1E69A 3UMMA 2CA5A 4R2WA 4K6CA 3EUFA 1XRNA 2ORED 1U28A 2VKTA 4QGGA 4X8MA 1HG2A 4FX5A 2CXXA 3WL5A 1UMCB 2QP9X 4U33A 3VPXA 4UQPA 1VHTA 4PNEA 2R7AA 3IP3A 2IVFA 1EQ2A 1RHUA 4EG7A 1AQYA 3H84A 1G17A 2WFLA 1FLVA 1R8JA 3D3QA 5JMTA 5ABHA 1NBAA 4YHBA 4KR7A 1GAJA 3O91A 4P5EA 3ZV6A 3Q5GA 2HF9A 2CCGA 2CXTA 2RI6A 3DZ8A 3OM9A 3ZE6A 1EFVB 3M6FA 2I6XA 3WGYA 3HVUA 1QXSA 3KZXA 1NXPA 2G7ZA 3LX5A 1ECJA 3UCXA 2I3AA 1BE6A 5FTKA 4JHXA 4AJ2A 4JAVC 1GYRA 4FEYA 2WOOA 2X2PA 4BMSA 5U9CA 5LIRA 3BGVA 3STUA 3OOWA 3IOMA 1FVHA 1IATA 3SHQA 1PFGA 2O3TA 4FWBA 3AR7A 3DFIA 5C18A 3O90A 4ZU6X 3K9FC 1BCRA 3TUJC 2VFAA 1RHMA 1RRCA 1BHSA 2HT1A 2H7YA 2IW1A 3U62A 3FDJA 3FKJA 3KV1A 1LLCA 1RLJA 1QU3A 4WXMA 4WEOA 1DBIA 4YA6A 1FDIA 3KTAA 4I81A 1J70A 5EPEA 1YZUA 1YBHA 2IYFA 3M9WA 4Q02A 4Y0VA 1L1QA 4NAVA 4UD6A 2P9FA 1HNXT 3KP1A 1Y1SA 3H9UA 3AE3A 2E9XC 2FAXA 3K2QA 1RLOA 3DOJA 4YJ2E 3RUFA 3V32A 4WH0A 1C4KA 1H22A 4F5ZA 5BURA 2V7VA 2Y0EA 5D5QA 5CJ2A 4R8MA 1IONA 4X93A 4M98A 4PGAA 4MYCA 1RE1A 2ISSD 3H9QA 6NULA 2BUCA 5GQSA 1NG1A 1NKSA 2M1XA 3TDMA 2W83A 4PK6A 3A1SA 3RH3A 3NQ41 1XD2B 3JPYA 4MUBA 1A8IA 4C5BA 3PB3A 4QNMA 4CLOA 3DC2A 5JIBA 4LXGA 3JWPA 1SBCA 2FMTA 2QBYA 3GN5B 3PGVA 1EDBA 5I9TA 4O1IA 1ZP0A 4MR8B 4QEDA 3AG6A 3UJPA 4EUHA 3PUWA 4L8FA 1CX9B 3UU6A 2OGUA 4DV6B 4IEIA 2Y6UA 1NMYA 2EEZA 4AI6A 1OHHD 2X42A 4FFLA 5LBTA 2PAAA 4AB1A 1VKHA 2P3SA 1RBMA 3EFHA 3KAQA 5EJAA 1Z7WA 2QF7A 4E11A 1I33A 1IPHA 1OAKA 3K9CA 5F23A 4H3SA 3SYTA 1CHDA 3DFUA 3EG9A 4F2PA 4OOEA 3GGSA 4FJ1A 4CI2B 1OVMA 1V7PC 1XTPA 4Q00A 2WVJA 4PZDA 5IVDA 3M7IA 3EXFB 3O0DA 3C43A 2BBOA 3GBSA 4PLZA 2WY2A 2QD3A 4OATA 3HLYA 4AYTA 1KMHA 2WJVA 2ZXFA 4Y6LA 4GDMA 4KFTA 3W6NA 5IHXA 1G21A 1VXOA 2YRXA 2FJEA 5K8JB 1AB6A 5HMMA 1GUFA 3UHAA 2V98A 3ZN0B 3O95A 2YMPA 1L5LA 4XVQA 5JQGF 2DECA 4A7PA 3BBLA 1YOVB 1YZFA 1IK4A 3FNQA 3OZCA 4NSNA 1AS0A 3NWOA 3AE6A 3M1AA 1FLDA 1X9BA 1KFJB 3RJ5A 1HNWB 4J6EA 4EG0A 5FX2A 3AIKA 1OEDE 4CM6A 4DCUA 4HV4A 5LMUB 3RWOA 4QUHA 3N2GB 5C37A 2VQFT 2GK7A 3EF1A 3BSYA 1TO6A 1KETA 4U0KA 2ZRIA 3KOOA 3DMPA 4HB2A 2QY9A 1RQXA 4EHIA 4ZOLE 4JFAA 5EHNA 4YJ3A 3WLMA 3NANA 1XNQT 1TJ3A 4C0HA 4KXMA 3PHCA 4WESA 3COYA 1W73A 4EHKA 1PAUA 4B3BA 3I2FA 5CGMA 3WBFA 3QBJA 2ZYDA 1VL2A 1LBIA 1UOEA 2DY0A 1RYFA 1R8YA 3HBLA 4MJ7A 3IOBA 4GPD1 3E0QA 4BVBA 1NJ1A 3PVCA 3U40A 3EY9A 1QCZA 2HSWA 2QZJA 4PBRA 1IBRA 1NDQA 1BEEA 4U6NA 1IIRA 4HX2A 1JP7A 4MA4A 5ECDA 4YCDA 3VNVA 3DAOA 2VJYA 4X85A 2D4HA 3GEDA 1VL6A 2HWWA 5LQDA 5KX5F 2C7RA 2A2FX 5JD4A 2YUIA 2C1XA 3DLTA 2BGMA 5ALFA 4EDFA 2QIOA 1IOLA 4R7GA 5CLQA 4N5HX 5EIAA 1QVVA 2Q0HA 2GX6A 2OCBA 1BWSA 4Z9XA 2BP7B 3R84B 1DQYA 4QXRA 2J6CA 3MILA 2JLSA 3MWYW 4MI1A 4AY6A 3ZVLA 5T4HA 1TUGA 1KI8A 3CRVA 3D4NA 3EEIA 1KHHA 3GFOA 3R1IA 1OTHA 3GIWA 3QTBA 4IEFB 2Q6LA 4MULA 2FOLA 3ZW8A 3TINA 1P5JA 2HT6A 4H7HA 3O8DA 3UG7A 4IIGA 1RYNA 5TS3A 1OD6A 4KODA 3K09C 4IXWA 1FDVA 2AGVA 4PAOA 5IBCA 1ESCA 3A26A 4MK4A 5B4TA 3M6AA 1SBTA 1T9KA 1MO6A 1WOMA 1A27A 1UGOA 5JCOA 3AMVA 4NECA 3TB6A 2XUKA 2W43A 1TU0A 2QJTA 4PR0A 3ANXA 4RDXA 2D0IA 3FDZB 1V5WA 3LT1A 1UKAA 2OUIA 4Y9SA 2EQBA 1X9IA 2PZBA 2QKYA 2D00A 4J9VA 4LZZA 3DTTA 1P45A 1EFPA 1P5HA 5IDXA 1M2NA 1XG5A 1V96A 1VIAA 2M9MA 3BIOA 2P90A 2BIFA 4H0NA 4TWZA 1X1CA 2B1JA 1KF6A 2J67A 1R9NA 1XR3A 1IQRA 4LBWA 4URXR 5AJZA 3CB4A 3ONFA 3C64A 3DUFB 3V7WA 1SCKA 4F1WA 3KSZO 5IJAA 2AOXA 4UVAB 4R7TA 5DTQA 1BFKA 4GI1A 3SZLA 4K0KT 3J7TA 5M4YA 3FLAA 5B30A 1O5TA 4FIZA 1NVBA 2HJWA 3MM4A 2BELA 5MN5A 3N86A 4G5XA 4PGMA 1H5QA 4X41A 1W4AA 1T25A 4BYMA 4J1TA 4LXHA 4GOND 1RMTA 1JHOA 4U7GA 3H8JA 1TADA 4KG7A 4WCFC 1XU7A 3PYXA 4AP6A 1T5BA 4N40A 1IOVA 4KWEA 5AM4A 4CZZB 1TLLA 3CXRA 3D3KA 3OF5A 3V1UA 3LX4A 1W7AA 3ZK8A 4LNAA 4C2UA 1HOXA 2FY8A 5JREA 3UNXA 1BWPA 2WVGA 3U3MA 4H1WA 1OX5A 1UOOA 3O38A 2I6QA 4RD0A 4GD3Q 2PMCA 3W0LB 5BSKA 4Q1BA 1B41A 5IP5A 1N4DA 2ZM6B 1F0KA 5CB4A 1E18A 4NDNE 5EKXA 4BNIA 3BN3A 4EEXA 2RHOA 4H9PC 2KS6A 2MMCA 1YS2X 2R8PA 5FTWA 2W6ID 4ZP1A 1U9YA 3B53X 4BAGA 3DBRB 4EG3A 3OWOA 4NYIQ 2HN1A 4G0WA 2RARA 4FT4A 1EUZA 3AETA 4C4RA 4ENPA 2BFAA 1VCMA 2JFVA 2XRMA 4UU1A 3Q3IA 4PLYA 2ZJZA 4PCAA 5EE5B 3GAMA 3JQFC 1DC7A 1N34B 2X9NA 1IQUA 4UBIA 4OIFA 3PHGA 5EA2A 4J0QA 3SVZA 3RARA 3FSRA 3NTQA 1FFWA 1AJEA 4OFBA 1IJBA 3ZKWB 3ISTA 4CLEA 3KYIB 5L3BB 2IZ1A 3P9KA 2GBIA 2IHVA 3DKIA 1BX0A 3Q0IA 5LYJA 1W75A 4KR9A 2MSDB 1EUQA 1M2VA 2PQ2A 4RSHA 3LF2A 3OCXA 2UZ0A 3T3OA 1HLDA 4UPDA 4X20E 3HH8A 1ZOSA 3TXYA 2P6OA 4NNPA 4X91A 1DU4A 3H17A 4IREA 3T5TA 3VR9A 4CM3A 4MIOA 3GJ8A 3WZMA 5L7YA 3BE4A 2C96A 1VL5A 3UZUA 1EYZA 3IQFA 1R88A 4TKVB 2WTAA 5ILQA 5E6RA 4I5FA 2JIMA 3U17A 3UK7A 3HV0A 2B6HA 4NONA 1MRSA 4F8YA 1ITZA 5CXUA 1AGRA 3O7MA 1YDGA 4Q1EA 5CM9C 4E88A 3E2IA 2I9PA 2GF2A 4R9NA 2JFNA 1KXJA 5DGCA 3TOZA 3O73A 4CGZA 2VOJA 1UAAA 2YXEA 1H85A 2E87A 5A05A 4L85A 4EG1A 5HEOA 1RQPA 2O7VA 2UYGA 3SPXA 1KYTA 2AJDA 5K0LA 4Y18A 1IHYA 3MIZA 4V0MA 4DW8A 3BG5A 4G26A 4J0KA 1NUPA 5JJBA 1F6WA 1B76A 4MWGA 1G2PA 1Q0QA 4B7XA 4MRVA 4MRNA 1KDYA 4BMCA 3VR2A 1GPH1 4DV4T 2PL9A 1MVNA 4ZAVA 3CX8B 5ERXA 3FHJA 2BDEA 3C39A 5BN4B 2V7MA 3A4TA 4BX2A 4XYBA 5CYFA 2QU7A 4YHHB 2K2QB 5C5CA 2ODNA 1RYYA 3L1VA 2JHPA 5EWLA 5G0SA 3PDYA 2GKGA 3AB3B 4I55E 5LDHA 2WJIA 1RZ3A 3SYRA 1TIPA 1ZLXA 5DABA 1RXUA 4E7PA 3A06A 2H5IA 2GJSA 1S2NA 3EB9A 1T13A 4W9MC 5JSYA 2B37A 3FLBA 3AJ8A 1O95D 2A5FA 4D56A 3OLWA 4QFCA 4X97A 1KEUA 3P9SA 2CN1A 1I80A 1NSFA 5AVYA 1VLJA 3CNOA 2E89A 5JD6A 4ZD6A 1ZAKA 1Y01A 4UDYX 4QYXA 3DGEC 2R8BA 2QTHA 1CUFA 3C3AA 2BM0A 2XH8A 2C3MA 1XPRA 3C7CB 3L7OA 4IHAA 2B1QA 2PAFA 3QMMA 2RGXA 1I14A 4B3TB 3WNDA 4Y7CA 3L3PA 1N0UA 4U2CA 1Q92A 2A5GA 2XUGA 2BRUC 2XDQB 3K4PA 3NPAA 4PZZA 5LP6A 5DJQC 2NO1A 1GUAA 5D87A 3FB4A 4X92A 1ZICA 3E8MA 1JG4A 6Q21A 2B36A 3ICVA 2PXCA 4CT0A 3WQQA 3ZS8A 5IWAT 4Q0MA 4NPAA 5FY1A 4LYYA 2WNSA 2IHR1 6ABPA 1KI1A 3VPCA 2BD0A 3TLCA 3MJVA 4EA6A 1GL7A 3C70A 2G08A 1EWRA 4GMGA 2QLNA 4HWRA 3EA5A 4ADSG 1MHTA 3FPJA 5BWNA 3IVGA 1UIRA 2VDQB 1QO9A 2CHUA 1EZZA 4ZZBA 4R1NA 1JQJC 3K3QC 4A27A 2GTPA 5COQA 1ZUNA 4PZYA 3C3CA 2RK3A 2DWQA 2PL1A 4HFEA 1ZINA 3W9SA 4Y0NA 2EX4A 4B4OA 2V7EA 1R12A 1Q1QA 4Q9IA 3K0CC 1Z88A 4OJTA 2G1AA 3K92A 2GFQA 4YRFA 3ZHYA 4OUDB 5KOJA 2EJUA 5JLAA 7MHTA 2HWYA 4B7CA 2O5CA 4RL6A 3UMBA 2ZKIA 2UVDA 2KBFA 2KMLA 4D9KA 1I6KA 1UP6A 3AXTA 4HCJA 1V9DA 4YREA 3TL3A 3DMFA 5JAQA 4BV9A 1PX2A 3HJNA 3SVTA 1BDBA 1FP2A 4HRYA 1U2GA 1L3IA 4I3GA 4B3MT 2EWVA 1NNUA 2W90A 1D6SA 3PC3A 3T1TA 3FGNA 4P4SB 2W2TA 1CFZA 5AVJA 2QEQA 5FUWA 3UHPA 1YQXA 4AKRB 2H3HA 2RHLA 5IDWA 4HAOA 4NU6A 3BMOB 3F6BX 4XJSA 1XTSA 3IBGA 3OZ7A 1J2TA 3ED1A 4ZI5A 3NHJA 3QTLA 4NYJQ 1L1FA 1KK2A 1X1BA 1T8WA 1R74A 4UTXA 4YQEA 1D04A 5JYBA 4AKLA 3DMNA 4D8YA 2JGRA 2ACKA 4R54A 3Q9UA 2H17A 2J0UA 3EDOA 1SZPA 2DLNA 1XCJA 3FKSA 3HYNA 2ZAGA 3CUYA 4CI3B 5GTDA 4O4LF 3A2KA 2PGLA 1XXHE 3OYZA 4DR3T 2Q0QA 3PUJA 1FNDA 4JBGA 1SK9A 2NMVA 1J1ZA 1RWOA 1P1KA 3WWDA 5HR5A 2ASVA 2CNLA 4KR2A 3FVQA 1ZESA 4G89A 3BZUA 4CTMA 2XQGA 4D8XA 1JILA 1RHJA 3RVLA 2O06A 4L2IB 3O8LA 2VJNA 3ABZA 3GHYA 3I5UA 3LT2A 3COSA 5JBNA 4L22A 3HKCA 5KHLB 3H1EA 4Q12A 4E5DA 5CX1A 2O5VA 4Q21A 4WWHA 1OCEA 3L8GA 4JP8A 3K70D 4MW6A 3T4EA 1JLLA 4FYXA 3I2HA 4KVAA 2RK4A 3QUAA 2OBMA 1EGAA 4BNYA 3PP8A 4C22A 4ZJZA 1VE5A 3ZCTA 4PS1A 5CFNA 4MUEA 2P6NA 4O8CA 3IR7A 1HFEL 1PGOA 2G17A 1PTJC 2K9AA 3LF1A 3JVEA 5DYGA 3EDRA 1ZUHA 3LO8A 4EATA 2E5LB 1UR5A 2QR3A 4H7JA 1DIRA 3IP6A 3R3XA 4XJTA 5GAJA 2YIVX 2ZIEA 2CLOB 2PRJA 4AZVA 4GFDA 1E5TA 1YBFA 2VWPA 3P5SA 2I1LA 2B82A 1B14A 3QB5A 5E7IA 4TXJA 5FI5A 1LNZA 2ZVDA 2NO6A 4WXEA 1ZP6A 1RU3A 3C1AA 2HW8A 4LGVA 3RTEA 5BORA 2JHAA 1N2BA 3VM6A 3GPCA 1T34A 4TL8A 2IS2A 4WZBB 5TLSA 3H11A 4E5YA 3LKBA 3X1DA 3JALB 1F9EA 4N01A 2QQEA 6YASA 4PK5A 1KK0A 2WF5A 1GQEA 3AVPA 5CVUA 2I99A 4DR2T 4URWR 5A03A 3DXXA 5HAXA 3RVRA 1LS1A 3VJMA 3VTKA 4YO7A 1PN3A 1NVXQ 2VNSA 3NT5A 1AMOA 1OILA 3ZDRA 2GERA 2ZBGA 1TVKB 3IUNA 3NOQA 4Q3CA 4BQFA 4BMZA 1MZVA 4Z8YA 2YWCA 2PSHA 2R751 1OR8A 5C8VA 3ZK7A 5EQTA 1GVNB 1QGYA 5H3CA 3SXJA 3SQNA 1VMKA 4M6WA 5CFZA 3SHWA 3B5EA 4MR9B 2X15A 1B2LA 1ZK1A 1DX4A 3IOEA 1JAXA 4WK0B 3ROFA 3MRSA 5DW0A 2YDYA 5HIMA 1KU0A 2C54A 5KPJA 5HF8A 3PRHA 4DA4A 3DEZA 4IYJA 3E3OA 1Q7TA 2YFKA 3OZGA 2NADA 1BYUA 3T7IA 1HTJF 1DO0A 3ADKA 1GPDG 2X6QA 3SWHA 1T4MA 5CURA 2DH5A 3U3DA 4OGLA 4R05A 2AFRA 1WW3A 4QUKA 4IJVA 5JJIA 3BXPA 2FR0A 2Z2IA 4D0NA 4WJKB 1KTVA 5H9VA 1FRNA 4FB4A 2GCNA 2GVZC 1LPNA 4UF0B 3WIBA 1UL1X 1YA4A 1WLSA 2E5FA 1PT6A 4ILBA 4LWPA 3TBKA 3N6VA 3DHNA 2GRAA 3QVMA 1ISJA 5FPPA 3Q15C 5KYYB 4IHJF 2A7QA 4FOSA 1QJ4A 4MVJI 2VL0A 1FNNA 3KQMA 3E7DA 4OYHA 2XXAA 1E6LA 2FPRA 2WMNA 4HNVA 2XUEA 3GRUA 3PD0A 1B4DA 4Q3OA 3WKDA 2BH2A 1Z7GA 1BW9A 1UINA 4LOKA 2W63A 2JLBA 3TR5A 3FVTA 4UIGA 4R1UA 1I2DA 4MV0A 5CP8A 3IDQA 4Q25A 2VJPA 3PEYA 7ADHA 2WZBA 3L5OA 1MX5A 2D7CA 3Q5DA 1CJBA 1GOTA 3TSAA 3IXQA 4RV9A 4ZZCA 4NNOA 1IY9A 2YKGA 1U94A 3JSAA 1VE6A 4NKRA 5JZOA 2G9RA 1U3DA 1HEUA 4RJ2A 2O2YA 3BWEA 3CLUD 2NTVA 4M9RA 4N6GA 2G04A 4OQFA 3ANLA 1ICEA 2GAOA 1UPXA 2ERCA 4YAUA 3BDIA 2NU9A 1U5BA 1Z35A 5C7IO 4ZT5A 2FHPA 3ESBA 3KHKA 2EP8A 2CHOA 1GKIA 1UBLS 2R1TB 2PIAA 3RUEA 2Q5JA 4XWOA 4PG5A 5G2OA 2Q9QA 2GN1A 1I5RA 1ZLYA 3H1GA 3LZCA 1FNBA 2VSOA 2LGJA 3P7IA 4YMSA 2UUAT 4P7KA 1Z74A 4U9HS 2NM0A 2IWHA 1V6CA 3IEKA 4HDMA 1H9CA 4MV8A 3NFRA 1CD5A 2PLAA 2D1RA 4B9AA 5FV7A 5CFOA 1O9BA 2AR0A 5IC4A 4L08A 1NNI1 5D51S 1WSDA 1HE2A 3V9PA 2EZ4A 2JFZA 1NQVA 2Z09A 1G66A 2VF5X 5AJTA 3MJRA 2J1LA 5C46F 5E4YA 3I9KA 5AQNB 4D9EA 5BOVA 3PHJA 4RV4A 1HKHA 1A4RA 3PR3A 3FTQA 4IR7A 3PHBE 1PF7E 3UW3A 1QRTA 3HLKA 2P6RA 3K30A 3NBXX 5JRCB 4KDRA 4FGZA 4BNNA 3TVDA 4KN9S 4K6HA 1VHQA 4G8BA 2EFYA 2AK2A 4IICA 5BQ5A 2G0TA 1AKQA 2ZUWA 2DPMA 1GEEA 3Q7PA 3AEBA 4U9IS 3QV1A 4NMHA 3R20A 2LDXA 3V8NA 2X5XA 3TTXA 2YWDA 4YCNA 4QBTA 1PJTA 2WT4A 4G5SA 3BJEA 3I9JA 5SZIA 4BO2A 4BO6A 1FP1D 4JCOA 1CXZA 1E1QA 1PS9A 1YNOA 2QYSA 3TXAA 5LNK1 1QYCA 4S24A 1SR8A 2IXFA 3Q2IA 3T3DA 3TIIA 3UMVA 3MS4A 4NRDA 3RAFC 4MWEA 1XU9A 4IVRA 1HA3A 3NOOA 4KZKA 3U4CA 3EGXB 3PUYF 5DZSA 5LR6A 4ZVNA 4Q4AB 4PO3X 4YUZA 4XM2A 5K20A 4QBIA 2AWNA 3DPUA 4KO3S 5KNCA 3COVA 4CQNA 4C08A 3WGQA 3Q0EA 1FIOA 3C7TA 4EB6E 1T7SA 2A0WA 1DAIA 1HL7A 1KJ8A 5EUCA 3AY0A 1X80A 3VVLA 1LPOA 2PUVA 2HSGA 4NCXA 3I1JA 2GXAA 1I5EA 2Z83A 1EE1A 3T12A 2RAVA 3GUHA 2XTMA 4OQZA 1EGHA 5D2CA 4PN3A 4MGKR 1PYOA 3GZ4A 4C7KA 1XCMA 1DRJA 4K28A 4HWSA 2OBFA 1ZEMA 3G7UA 3MQFA 2JH9A 4G1UC 4B2YA 2P40A 1A5ZA 3RVMA 4R1SA 3RTBA 2DRIA 2ZUCA 2AN5A 4OU5A 1U2DC 4AT1A 1RHRA 1YUBA 3IJPA 1US8B 5DJ5A 3RADC 3MTJA 3S2UA 2VDMB 4FPXA 3GARA 2QRVB 3DEHA 3C1UA 2CYAA 2IX3A 1FSSA 4D42A 3E35A 3PPIA 3AGPA 3OCYA 3ZDEA 2MYTA 2OC4A 1RPZA 3GLRA 1KZ9A 2MINA 1UKEA 4ZI3C 4G0OA 4H77A 4HGOA 3TD6A 1MOQA 5HKLA 2J9RA 2HA2A 1MAUA 4INPA 4RE5A 2IODA 4WV3A 1EVYA 1F5SA 2NVWA 1NJ5A 4CR8A 1WLYA 1BMDA 1B8PA 3O31A 5REQB 3KD3A 3P4QA 3VU0A 1OH6A 3LP6A 1C2YA 1UWLA 4JB2A 3UYLA 4A56A 5FYDA 1L5WA 4NK4A 1ABFA 3KKPA 4NEHB 1EUCB 1M75A 1LLQA 3H5NA 2FKNA 5KYUA 4GE0A 1E1LA 2DT8A 4KQJA 5F7JA 3HJRA 3PXDA 3EQ2A 2P9HA 4Y0AA 5E7JA 2OCAA 2WSLA 3G0BA 1U3CA 4XTCS 1NBEA 4X6UA 3UMSA 4UEMA 2UZIR 3K2IA 4KUHA 4OMFG 2QMQA 4F60A 1HMYA 1PJBA 4H1UA 3MK31 4ZOCA 1W96A 2RHWA 4J76A 1GPYA 3ONLC 1UZUA 3OQVA 4H1VA 4LFAB 3NCTA 3F8TA 1ABEA 3C5WP 3FOAA 1W5TA 3BHMA 4S1TA 4Z5XA 4LJRA 3JCFA 4URZR 5JNUA 2NU6B 1NPDA 3MTBA 3TVTA 2VDWB 4MUFA 4UOQA 1TMGE 5LCYA 3O4VA 3M4ZA 1Y7TA 3TIVA 4TTVA 1RWPA 1XRPA 3T5CA 4N41A 4G3XA 2QROA 3QUTA 4E2YA 1OBHA 1LDYA 2O6HA 3CVOA 4OGFA 4IIJE 3KZOA 1E64A 4RTSA 3TAUA 2EYUA 3PS9A 4WTOA 4R1MA 4KHPB 3CLKA 3E58A 2C59A 3A9CA 3E82A 3SFZA 3QY9A 4NPPA 3QYPA 4GGMX 4RVSA 3G5LA 4NJMA 4QKQA 2QDXA 3N2KE 3ROZA 3KLNA 3H9BA 4FKZA 1PZXA 2GBPA 3GX1A 4KXXA 4UHFA 2HLPA 2IV7A 1KJZA 2JRLA 2QB5A 4OYLA 4JNCA 4ZARA 1M2KA 2VVTA 5C80A 1VXRA 1MVLA 3WR5A 3RIUC 4F2HA 3D5EA 4L3OA 3UHOA 1V11A 4BKQA 2A1TR 1N9GB 3Q7EA 2XQ8A 5BXYA 4V0RA 5LXTA 4I2NA 5CFMA 4XRGA 5K0EA 2B9VA 1AA9A 3ZGZA 1E2LA 4HTEA 4GKJB 4PLTA 2CLMB 3LGSA 3B6EA 1RVV1 1X7XA 1QDUA 1E5XA 4DREA 1CUSA 2XYPA 4O2BE 5J1SB 2IRWA 2PU5A 2CEKA 2Q2OA 3GEMA 2VP4A 3RUPA 2WKWA 1VHLA 3UUGA 2WIGA 1ML3A 4O4JE 3IBFA 5BUSA 5LHGB 3P97A 4NTZA 4U5XA 4MHSA 5ANRB 3KOMA 3QIAA 2I2BA 4QUAA 4CUJA 2XCIA 3X0DA 2J3QA 3QKTA 1W1WA 3H0KA 1NDHA 3D1LA 3WTCA 2F3RA 2QTRA 3OBIA 2HCBA 4L51A 5AKYA 3VC7A 5AXDA 4PNPA 3ECSA 2L17A 4N7JA 2CLFB 1QO0D 3CZQA 2BGGA 4ISBA 4YLYA 4RZ2A 1YU6A 2YV3A 2JKVA 4DIFA 1KP9A 3E61A 3LY8A 1QDLB 3JQAB 4EOZB 4KXFB 4JOQA 4YR7A 3OJFA 3AOEC 3NAQA 3VZRA 2FFQA 2H2FA 4QASA 3PXAA 5E6SA 2J59A 4MPJA 3H3JA 4LWOA 2BONA 3P0JA 4WINA 4DE5A 3Q3VA 4QGFA 1XX6A 2V0NA 1PJCA 4P81A 1B7GO 3RIYA 2IELA 2G80A 1HT0A 1EM8A 3VHXB 3GLKA 3K0KA 4REMA 1LSSA 2GO7A 4FINA 2B34A 2BC9A 3SSOA 3RSLA 1FMVA 3LPCA 1ANKA 5IEJA 4TKUB 5LN1A 1C2TA 2GN4A 1Y4AE 5FJIA 5LMCA 4KXVA 3AKYA 5M5BA 4TROA 2HF7A 4LNUB 3CVWA 4LAFA 4OVKA 1MMDA 1PNOA 5KXJA 5TQ0A 1P9NA 4DV5T 4L50A 2E9XB 3HDYA 4Q5IA 5A06A 4RL4A 4LSGA 1E6UA 5HRAA 1JBKA 3Q40A 1MMAA 5A9TA 1W29A 4IGUA 1E62A 2CVHA 3IIIA 2I91A 4O6VA 1MW8X 1YDFA 2V7XA 1I7PA 3EMBA 3ZD6A 1UJ2A 1ES9A 2F3SA 1XL0A 3IP8A 1QFMA 1IQPA 2DEUA 3F7TA 1SKUA 3R3SA 4LCBA 2CNOA 2QRPA 5A5GA 1EVIA 3LFUA 4GYRA 4Z9BA 4UASA 2JAUA 4CR7A 1I24A 1VI6A 3KSAC 1H2WA 2XOEA 2O4UX 1U99A 2AYXA 3THYB 1W34A 5EN4A 3VR6D 3ADCA 1WZNA 1PW5A 3CV3A 1M8JA 4IE4A 4W5QA 2GZDA 4XVCA 1KAHA 3SOZA 4CUKA 2X23A 4YONB 2DHDA 4BFXA 1AG9A 2PL5A 4TWHA 2JLUA 3UY4A 1GG8A 1H7CA 1G7SA 1ZVQA 1DMSA 4HX9A 1EFAA 4O5OA 1HDZA 1YKGA 2ILTA 3CLTD 5JSQA 1X42A 1SOVA 1UBUS 3ZLJA 3C3EA 1L5FA 1CJTC 5TF4A 2NZWA 1JKXA 2B2XA 4DG9A 1E5LA 1SU7A 3PNOA 4JLNA 4CMIB 1LZKA 3TNDA 4KU4A 1HG5A 4LGCA 1QNLA 3R9XA 3U6BA 3ORFA 5EJGA 3JQRA 2NW8A 4QXBB 3EEOA 7YASA 4LS3A 5ENZA 3PDHA 1G9TA 3TAHA 1ZI8A 2FJUA 4LJ4A 3PBKA 1Q3TA 3LDAA 1DOZA 2JJ9A 4WLNA 4ZAZA 4MA0A 2RGDA 3KXIA 1HE1C 3OC0A 3QEAZ 3KDSE 3OESA 2CCQA 2LSYA 3GOHA 4Q66C 1RPJA 2VHZA 1PHPA 2PEYA 1RQLA 3L8CA 4DBZA 4XWGA 1Q20A 2QD5A 2VJMB 2GYYA 3AX6A 4B6PA 3C98A 2QJFA 4EJ2A 4Y6QA 1B8OA 2XY8B 3LP5A 2JQQA 1OZGA 3BGSA 3PZRA 2PSJA 2WZCA 3F9CA 3CWQA 2IV3A 4OFWA 3GB9A 9LDBA 1QQ7A 4QL3A 2VDJA 2VDLB 1G8PA 3B85A 2F3PA 4RBNA 3PV0F 4XKJA 4ED9A 2E4AA 3AE1A 4L8VA 3U7GA 3CMCO 3BUSA 2C7BA 2MIIA 1IG3A 4M1YA 5KOIA 1IRXA 1PJAA 3RASA 1F9AA 4HDSB 1RWMA 3HUEA 4MCJA 1M1YA 4KYIB 3OEYA 2AZMA 4IV5A 2YNMC 1GKKA 3NUQA 1P4AA 2NTXA 3OE7D 4LY0A 1N6IA 5JZVA 2GXQA 1QLJA 3UJAA 4BYGA 1KEEA 1JTFA 4FHCA 3HBJA 1XDWA 1IE3A 2GZSA 4UAVA 1ZGZA 3SY8A 1TXGA 5EUMA 5A3VA 4GOXA 4BNWA 2A0YA 2QP3A 2GF0A 3O9XA 2R68A 3V8BA 4FZVA 3CUUA 1T9AA 4J0CA 2QN9A 3WBJA 4B74A 1GTZA 4P4NA 3LKDA 2YBDA 2LKHA 3WMFA 4ZO6A 3JQ9C 4P9NA 1HG1A 4K0UA 1GNRA 2W2PA 1QP0A 2PMWB 1U4QA 5JPDA 5SY9A 4L3VA 1ID1A 1TQHA 1YFZA 3FCEA 2IBSA 2JAHA 1D5CA 5DX0A 2IZOA 3S7TA 3IDOA 4CGYA 3UJHA 2QVCA 3O9VA 4B0PA 1Y0BA 3HB5X 2P9BA 2H9AA 1P2DA 4FR0A 2PKYX 3T95A 2RP4A 3G9ZA 1CU1A 3WK4A 1MGPA 3V8QA 4WZAA 4WLUA 1V9LA 2AI1A 2I7DA 4FP9A 1NBHA 4DV0B 3VR3A 2VZLA 3N2OA 1L7EA 5SYAA 1TU3A 4P31A 2WILA 2HMTA 1LY1A 5B1EA 4K46A 3BMNB 3OOJA 3VRAA 2X0EA 2FP4B 3DTVB 3ETCA 3JU3A 2PWYA 3EHEA 3E6AA 1DUIA 4HDQB 4ZXLA 3QPBA 1V7QA 4MKRA 2NP7A 4R5HA 4TT3D 2NPFA 1L0BA 1Z4KA 5ECGC 3BSSA 4ZZIA 2CLLB 4A5OA 2V7JA 2OGTA 2P6MA 2ZBDA 1DTSA 1UJMA 3I92A 3ZDCA 3QWBA 1LBQA 4P92A 4PCLA 1K63A 1FDUA 4UVCB 3VR1A 2Z5VA 4L78A 4WCFB 1TMOA 2DG2A 1WE2A 1TI7A 1LI4A 2X8JA 1RWKA 3CIOA 4K9SA 3C4JA 2FE1A 2HA0A 1EE9A 3C7DB 1OKKD 4NEGA 3G3EA 2OUKA 1E9BA 4CEJA 5CA1B 1VB5A 4Q1AA 2FPIB 3Q12A 1TB4A 3UENA 4XEUA 4O4IF 4QLOA 1EMDA 4EQ6A 5LA6B 4JJ4A 4DQUA 2QYOA 2AXNA 3IJRA 5FI1B 4F5DA 1S3FA 1F7UA 3PRKE 1V9SA 5IZCC 3F31A 1MH9A 4HWTA 5JH7E 4YRQA 1BHO1 1N5OX 1Z2AA 4MQUA 2X9QA 3FMVA 2OLTA 2AQIA 1YMUA 1YZGA 2IDZA 5DHAA 3ZU4A 2HPZA 3FW1A 1W4ZA 2E7ZA 3AW9A 3X1KA 5F5XA 1P3DA 3CKDA 5DF1A 3V4VB 1TE2A 4KSCA 1OPXA 4U7FA 2H06A 3QVLA 4L5CA 4MR7A 2FPKA 3C2QA 4ROTA 3AJ9A 2ADFA 2FZCA 4DZTA 3QU7A 2KLQA 3UBTA 4BVHA 2H63A 3OZVA 4FK8A 3WHPA 2W0MA 3HZRA 4AUNA 2XHEA 3QE9Y 3EWIA 5EKUA 1GADO 2HREA 2RJ3A 4N9WA 1XQ9A 2F48A 1UWVA 3G88A 1Z16A 4Z1MA 3PFFA 1NE2A 3PTRB 1SKYE 1Y4ZA 1DT5A 2JGFA 4C3UA 1YUMA 1E2DA 5DWDA 3DAYA 5IUXA 1GDTA 2DCUA 2DX7A 1NJGA 3FOWA 2ORWA 3N5CA 3FRJA 4BE9A 4FJOA 3KKOA 2ID4A 5K8UA 2OK8A 3EODA 2QAJA 1KAEA 3GDWA 4RY2A 3ZC0A 3MPOA 1JFFA 1MIWA 4O4HE 2ZYSA 1JLHA 2XCSB 1ODIA 1C9KA 4PHGA 5HQ3A 3JAKA 3OQBA 4RTKA 4ZDIA 2ZT7A 2KI5A 2WKSA 4KYTA 5BY2A 3MNFA 1RJDA 2GRJA 2VPIA 1XD8A 1RJEA 3J7Yq 5C53B 1F8GA 1G5PA 4RIFA 3NDIA 2RAUA 4J43A 1V43A 2HYIC 2BTEA 5CXQA 4A16A 4JP5A 2BE9A 2H7VC 2WDZA 3KXDA 4BVJA 1TM4E 4A5SA 2PJQA 3B13A 1D4FA 3L7DA 4CM8A 4R8KA 4XDZA 4R41A 3GEHA 5F8PA 1WPQA 2WSBA 2GJ8A 3DVQX 4FFMA 4W9NC 2EFGA 4C6SA 3PLRA 4FE4A 2ZT8A 4INJA 4F3RA 5A3QA 1Z18A 1ZCFA 4N6OA 4E13A 3I3OA 5P21A 2F62A 5JAZA 1T9HA 3C3PA 4J1QA 1C1XA 3WLPA 2KJQA 4C30A 2JW5A 2ZROA 3SHFA 5BSUA 3H6GA 3FXDB 3TRFA 1FTYA 1KO5A 2AW5A 2XVXA 1Z4PX 4D02A 1KO4A 1I2MA 2YW9A 1GARA 2PVPA 2PX8A 3L4BC 2J9ZB 4AF6A 4PX9A 4PG7A 4X8HA 1TRHA 4URVR 5CCEA 2CCJA 1E6CA 5CB8A 3K3NA 2XNJA 3EEYA 5FCDA 3GN2A 5AJHA 4S1OA 2HX1A 3Q3CA 2ZJAA 4BN5A 5IRCD 1MIOB 4W4TA 4DMCA 1VLZA 3NBQA 4E14A 2JBWA 2ZREA 2WV9A 2HLHA 5DEIA 5A9RA 5AI8A 4B2LA 2Y05A 5BVHB 3L6UA 5KNCH 5FEMA 1SC4A 4BPRA 1JDZA 1A7AA 4Y2PA 4AS3A 3BB1A 5ITZB 4XX0B 5FI3A 3HHPA 4YRAA 5TVKA 3OFJA 3D2BA 5MGBA 4IG9A 1JWBB 1FC0A 3AOGA 1RNLA 3QNWA 1XLTC 2WWGA 1IVNA 2FEKA 2IEYA 2CHVA 3BXHA 5EFOA 3K9QO 1WCIA 2ZRQA 4N3BA 1FVOA 2YN0A 3RNOA 3HA2A 4YRLA 1CETA 4KOAA 2FN9A 2W2LD 3LI2A 1H6AA 2DWKA 5EZYE 1K6MA 4DO0A 4BCCA 5KYGA 2Q9CA 1J9EA 1C9YA 3CY6A 4DSZA 1GZ6A 1CVRA 3KQLA 2YWRA 2AMFA 3E5MA 1J9GA 2PNFA 2FPXA 1LLDA 1M6HA 3G89A 5FIUA 1GGEA 1KDPA 2H65A 3AEQB 4RY0A 3LK7A 1EVLA 3RSQA 1GFWA 2BR3A 3OTOB 4B84A 1G5HA 1NQXA 3MQ4A 4BE4A 3A36A 2Z6VA 4I6EA 1OLXA 3JQ7B 2H92A 4BVAA 1DI0A 2W2XA 3PNMA 1DKNA 3TFOA 5C7LO 4FB5A 3GLIE 3F8WA 3CVYA 1WU7A 2IW5B 3DTOA 3IMFA 2VJLA 1F2TB 4TTQA 1RQGA 4MS4B 4IDPA 1LBTA 2VSXA 2XV1A 5JVDF 4RK4A 4ZEYA 2V6FA 2LDBA 4GK0E 2D5LA 4J49A 1N2GA 4B81A 4JI1T 4LG1A 3P2EA 2M6RA 4HDKA 4HGPA 3JWEA 3T7AA 3DM5A 3QXGA 5J1TB 1XL1A 4ZODA 3ZG6A 1VE3A 5TGDA 2B94A 3HJCA 1V7ZA 1N78A 5DNDA 1QZUA 5DCWA 3JYLA 2WEKA 5LB2A 1FEWA 2G3YA 2Q5EA 4K2HA 4UM9D 5MFZA 2V9ZA 1NG9A 4IL9A 2HSDA 2GO1A 4HN9A 4EHLA 5DCUA 2WQ6A 4J91A 4QFDA 2ICAA 3LLCA 3KT3A 4OQEA 1JJBA 3ZQJA 2NUAB 4I43B 4RELA 1SXJC 4C01A 5DISB 1U8CB 4MAFA 1XK6A 1JJAA 4X95A 5BV0A 1VZ3A 1PDOA 1MOZA 4R1QA 5IJ0B 2FW6A 4Z7QB 1SU6A 1QG2A 2HRZA 1B0UA 4QXOA 4CKCB 1B43A 3EEBA 3PICA 3R7NA 4A4DA 2WQ7A 5FXWA 4XD7D 1YS9A 4JLSA 2FZKA 1Y9AA 1ULHA 3MJXA 1PWXA 2WU4A 5GMOA 1M7HA 4LRUA 1SA0B 1J2UA 1JNZA 3V5UA 4RM3A 1Z37A 1AQUA 1NNEA 1AV6A 3TEJA 2Q50A 1XEWY 3GJ4A 1YR3A 3I01M 4LE1A 2I8CA 1IULA 4ETWA 2I1WA 1GGHA 3NM5A 2W2NA 4CETA 4HRAA 2Z1NA 1EXDA 3NEAA 4JENA 3EVGA 5JDCC 2Q1XA 3KEOA 1J4AA 2EFJA 4NMMA 4WBNA 2HA3A 2H18A 5AM0A 4DQDA 3AEDA 2V5VA 3I12A 4AMGA 4UNSA 1YR8A 4KPYA 1TAGA 2C8LA 4BV3A 4X66B 5J58A 4EARA 4UM7A 2C0PA 2PMKA 3ZZNA 1LPSA 4FONA 5ESWA 3KQOA 4ZPXA 2ZVQX 2ZEJA 4XGQA 5C8YB 2B3DA 1UXIA 4RM2A 4QBFA 5F7OA 3TWOA 4XYLA 2VSFA 1ZN9A 5DRTA 5FWDA 1ZA1A 1TQDA 4DM4A 1S2LA 3ND9A 3I4CA 3OOHA 2OXIA 3R0JA 1D1SA 1TLFA 4Q93A 5K09A 2R6GF 3FE2A 4ZC8A 3ZQ4A 5JXHA 521PA 4K9QA 4KNYA 4F04A 3B89A 2KMFA 1DO2A 1SG6A 3I9WA 4R1TA 1E7QA 1QX3A 4PGHA 2IIPA 1U9IC 4QT4A 2NO5A 2QZPA 3LCMA 4TL9A 3AGQA 3BTUA 1WZIA 3PEWA 1K27A 4GWGA 2IVZA 2HIAA 1HT3A 2PV0A 1N5RA 4QWMA 3ILSA 2BOVA 3GLHA 2WJ6A 2DBYA 4HMQA 4QREA 1M6YA 2ATCA 1UDBA 4Y3UA 4RCYA 2RH9B 1XTBA 4MMYB 3MAJA 2R7MA 1N6LA 1IM8A 5JDIA 1FNCA 4PEVA 5GZ1A 5JNRA 3UT6A 1TGYA 3IQZA 3EJ6A 4RXMA 4JBYA 5AI5A 2PZJA 1A9XB 1TAUA 1Q44A 4M0CA 5KNDD 4HZIA 5THKA 3ASUA 2M6LA 5A0TA 2PJDA 2QPOA 5AI6A 3CNLA 2O2DA 2FR1A 3R5TA 3D0QA 4WQMA 4ZV7A 2VHWA 2JKZA 3AIMA 5CAEA 2KYRA 3QGMA 4H0FA 4NMWA 3L6OO 4ND2A 4EHHA 4OLAA 3WYAA 3ONEA 1N0VC 4NAHA 4BLWA 3TLTA 2PUEA 4C7JA 4LBVA 2VPYA 3KUKA 4UVGA 3UJ8A 4C03A 5KOHB 2PFSA 1HBJA 2W5UA 1HLFA 3U60B 4GS5A 3TKAA 4C7VA 2HWKA 3T52A 4UPEA 1JU4A 3OJ0A 2XQVA 4LF8B 4RIIA 3LQYA 4QDXA 2Y0BA 2P2NA 2D2VA 4TYPA 1NVDA 5C0OE 4B4UA 3E9ZA 4UAJA 3OPYA 1V1RB 3CNEA 1PJRA 2N1BA 3S2SA 4WLOA 2XYGA 4FT2A 4UFNA 4V0OA 2UZ4A 5T4BA 1TZ2A 3N8DA 2PO5A 3KU4A 1TF7A 3SQDA 2Q28A 3L7LA 2CYBA 1G20B 3ODGA 4LRWA 2QM3A 4TS9A 3VKHA 4AMZA 3IYLW 2JIOA 1TZKA 3RS2A 2JKYA 3BK7A 4AZWA 1IB6A 1K92A 4JC0A 1GG9A 3C3JA 4TLLB 3MT7A 1SQ5A 3DDHA 5AVWA 5LQUA 3ZVNA 4IGIA 1PRYA 1QGDA 1LFAA 4C3OB 3WL7A 2ZKLA 3QWAA 1GZ3A 1SCBA 2NSYA 2UU9T 4OU4A 3CH6A 3PE6A 3RYCA 3CSUA 4KEAA 4IRXA 4H6XA 5BMVE 1WSBA 3C6XA 1EFLA 3CZPA 1XE3A 1YCFA 2Q0XA 2ZRBA 2QU8A 2KQUA 4BLUA 5JDLA 1P0QA 3K53A 2OFFA 1KXZA 4HQNA 3KQVA 3WB2A 4ZCLA 2HB6A 3JQPA 3B7GA 2AJCA 1XT6A 4H35A 1FXSA 5UKDA 1R6TA 1QDEA 2VP0A 2BG9C 4R31A 4QH1A 1VL1A 2XOKA 3QMWA 4ARAA 1GCOA 3UCFA 1II9A 3DZKA 1KAQA 1VQ1A 3EE6A 1Y3FE 1VI2A 3MAGA 3AP1A 1MB9A 3UTKA 4FHFA 4OK0A 5ILGA 2QG9A 2NVBA 3HA5A 2CDCA 4LMRA 4MVWA 4QTYA 2J46A 3PUAA 2GWHA 2GZMA 3PJFA 5LUBA 1Z5NA 1U8EA 2XNKA 2Q41A 1EZ4A 1ZMTA 2MHCA 3OQPA 4DANA 1Q21A 1U5CA 2PBRA 1P0PA 3BWXA 2ZS7A 3AEEA 4BASA 1T91A 4CXXA 1W8IA 3DJFA 3C16C 4S1PA 2OO5A 2PUFA