4OHFA

Crystal structure of cytosolic nucleotidase ii (lpg0095) in complex with gmp from legionella pneumophila, northeast structural genomics consortium target lgr1
Total Genus 159
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
159
sequence length
461
structure length
455
Chain Sequence
KVFVNRIINMRKIKLIGLDMDHTLIRYNSKNFESLVYDLVKERLAESFHYPEEIKKFKFNFDDAIRGLVIDSKNGNILKLSRYGAIRLSYHGTKQISFSDQKKIYRSIYVDLGDPNYMAIDTSFSIAFCILYGQLVDLKDTNPDKMPSYQAIAQDVQYCVDKVHSDGTLKNIIIKNLKKYVIREKEVVEGLKHFIRYGKKIFILTNSEYSYSKLLLDYALSPFLDKGEHWQGLFEFVITLANKPRFFYDNLRFLSVNPENGTMTNVHGPIVPGVYQGGNAKKFTEDLGVGGDEILYIGDHIYGDILRLKKDCNWRTALVVEELGEEIASQIRALPIEKKIGEAMAIKKELEQKYVDLCTRSIDESYDQEIHDLQLQISTVDLQISRLLQEQNSFYNPKWERVFRAGAEESYFAYQVDRFACIYMEKLSDLLEHSPMTYFRANRRLLAHDIDILEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Allosteric regulation and substrate activation in cytosolic nucleotidase II from Legionella pneumophila.
pubmed doi rcsb
source organism Legionella pneumophila subsp. pneumophila
molecule tags Hydrolase
molecule keywords Cytosolic IMP-GMP specific 5'-nucleotidase
total genus 159
structure length 455
sequence length 461
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05761 5_nucleotid 5' nucleotidase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1160 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4ohfA03
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 4ohfA01
3QGMA 2IOHA 1Z5GA 2I6XA 4GXTA 2HO4A 2HHLA 4UMFA 4KYTA 3U26A 4YIKA 4F71A 1NRWA 3FGOA 3OCZA 2YY6A 4EELA 3W5BA 5ALNA 5AM2A 3FVVA 5AW1A 3QNMA 2OBBA 2I34A 4HGRA 3TLMA 3FZQA 1L6RA 3ESRA 2IYEA 2NO5A 2VKQA 3SKYA 3N5KA 5ALOA 3OCVA 3R4CA 1N9KA 4NV0A 3ZU6A 3ZVMA 3QUBA 1QQ5A 5FP0A 2MSNA 2QYHA 2CFSA 3D6JA 3OCWA 4BNDA 4FFDA 3SD7A 4BX3A 2IA5A 3FM9A 4NAVA 3MN1A 5IT0A 2W4MA 1RRCA 5ALYA 1U2TA 5AKEA 2HEGA 3GYGA 5AVRA 1RMTA 2AGVA 2EARA 5AI5A 2ZBDA 5AKYA 4XE5A 4CNQA 1Z88A 3NASA 3QX7A 2HOQA 2HCFA 4BNDB 4IFTA 1WVIA 3RF6A 4CF3A 3QYPA 2P27A 3WKEA 3ED5A 3ZWKA 2YMLA 4Y2UA 5AW8A 1VFPA 3I76A 5ALIA 2ZG6A 5AVXA 2GFHA 5JJBA 1Z4LA 3KD3A 1RMQA 3NUQA 2CFRA 3DV9A 2ZBEA 2OA0A 2IOFA 1S8OA 3MMZA 2WF5A 3ET4A 1AQ6A 1Z4JA 2WF9A 1EK1A 2WM8A 1ZRNA 2JARA 4DW8A 4HGOA 3KBBA 2ZBGA 3R9KA 2WHEA 3WKBA 1Y8AA 3NALA 3UMBA 4GIBA 1RQLA 5ALXA 2HF7A 3WGVA 2R8XA 1J8DA 3U7FB 5AKJA 3AR4A 2RB5A 4FE3A 3OTQA 3PDWA 2PKEA 3KC2A 4CF5A 3UM9A 1CR6A 1CQZA 3OCXA 1XVIA 5AI0A 3WK7A 3ZVNA 3L1VA 2FPRA 1Q91A 1KYTA 2GMWA 3ZX5A 4IG4A 2FUCA 4UARA 5AW5A 1RKUA 2FPXA 1IWOA 3QUQA 3SMVA 1F5SA 2ZOSA 1X42A 5AI9A 3K1ZA 3W5AA 4ZEXA 3BA6A 3M1YA 4UAVA 2YMQA 1VJ5A 5AI6A 1Z4KA 4JDPA 3U19A 1ZD5A 5A3QA 2RBKA 5AI4A 1O03A 1TJ5A 1YV9A 3WKAA 4B6JA 4ZEWA 2R8YA 5AW3A 3F9RA 3A1EA 3L1UA 4Y2SA 1EK2A 2G1AA 2OYCA 1L8OA 4YH1A 2ZBFA 1SWVA 4UATA 4CF4A 5ALVA 4MUMA 2O9JA 5AICA 4DCCA 1O08A 3ZVLA 2G06A 3PGLA 1TJ3A 4XQ0A 4C4TA 5AKZA 2AMYA 2GHTA 3B9BA 2AH5A 1YNSA 1ZD2P 4DWOA 3U7GA 2C88A 3EWIA 4HYTA 3WK8A 2B0CA 5AM4A 2WF8A 4KNVA 2FI1A 1FEZA 2GHQA 2Q4TA 4YCMA 3NRJA 4DFDA 1TA0A 3HLTA 3PCTA 3I28A 2YMPA 1TJ4A 5ALFA 4G63A 2EATA 2YFYA 3B8EA 4OHFA 5ALRA 1XPJA 4O8CA 3ZUPA 2O2XA 2ZXEA 4KN8A 5ALMA 3ZW7A 2P9JA 2BY4A 3IJ5A 3ZTWA 4BBJA 4Y2RA 2R8EA 3E81A 5AKKA 3CZ4A 4QQFA 1ZRMA 1RQNA 3EF0A 1T5SA 5AW0A 1NNLA 2HDOA 5ALQA 1RKQA 3KDPA 1T5TA 1TE2A 1Z4NA 1RKVA 1YDFA 2I33A 1U2SA 2JAUA 4Y2QA 4C4SA 4J2TA 1RLTA 1ZS9A 2G07A 2HI0A 3SLRA 2WF6A 3AR8A 3E8MA 3L0CA 5AM0A 3ONNA 2CN1A 3N8GA 5ALEA 2YJ5A 2FPUA 1S2OA 3WK5A 1SU4A 3FPBA 3U7HB 2I54A 5T41A 5AKLA 2AUTA 5A3SA 5AM3A 3VAYA 4RESA 2FUEA 2Q4RA 4I9GA 2B82A 2X4DA 5AM5A 1K1EA 5AVSA 2QLTA 4BKMA 3L8HA 1U7OA 4OCZA 1T9ZA 3OCUA 5AKXA 2D2VA 4UMDA 1L7NA 3A1DA 2BDUA 3A1CA 1PW5A 1WR8A 2YJ4A 1L7OA 1QYIA 2G09A 2G0AA 1Z4IA 4L57A 3RFUA 3OCYA 5ALGA 2JAOA 1SWWA 2FPWA 1JUDA 1WPGA 1ZD4A 3N28A 5AVVA 3M9LA 3QLEA 1LTQA 4CE6A 2YJ3A 3N1UA 4E88A 4KX5A 5AK6A 3KOOA 1Z5UA 2RAVA 5AW4A 1U02A 2YBDA 1YJ5A 3E58A 2P11A 4BEWA 4UMEA 1QH9A 4UMVA 3DDHA 4NWIA 4UW9A 1ZOLA 4Y2YA 1YS9A 2C8KA 3WGUA 5A3RA 2Q5EA 4QJBA 2C8LA 1NF2A 2HSZA 3W5DA 1Z4PX 3QU4A 2BDEA 3NAMA 3QU2A 5ALSA 3ZI4A 5AW2A 2B8JA 1L8LA 2PQ0A 3SF0A 5IS2A 4UU0A 5IT4A 3ZWDA 4FYPA 3J7TA 4AP9A 1RLOA 3DAOA 3L8FA 5AVUA 3WKDA 3AR7A 1RC8A 4MWOA 4HGNA 3S6JA 3MC1A 2YMMA 1VJRA 4AS2A 5ALZA 1RLMA 2CFTA 3P96A 3QU9A 3AR5A 5AKGA 3KZXA 2FPSA 3SKXA 2G80A 4BX0A 2MU1A 2IOFK 2B8EA 2ODAA 3ZX4A 2FEAA 2JGAA 2NO4A 5AK5A 2RARA 3A3YA 3I1YA 4NABA 2FDRA 3QU5A 4NFLA 4L6AA 5AI8A 3AR3A 4BX2A 5AW7A 2GO7A 2YN4A 3NIWA 5AVQA 5AKHA 1RMYA 3SHQA 5ALUA 3U7EB 2I7DA 4EX7A 4I9FA 1L7PA 4UASA 1Z4MA 1ZJJA 4Y2JA 1WZCA 3L8GA 5AVWA 4Y3UA 3EPRA 2HX1A 3IRUA 4XOUA 4AS3A 3AR2A 3N07A 2DQSA 2C9MA 5AVYA 4BYGA 3W5CA 4KX3A 1ZD3A 3ET5A 2NYVA 1Z4OA 5ALDA 1Q92A 5AESA 1MH9A 2B1RA 3DNPA 5ALWA 4UM5A 2B1QA 4EZEA 2I55A 4Y2TA 3EF1A 2OM6A 1U7PA 2W11A 2R8ZA 5ALHA 3UMCA 4HGQA 5ALLA 2B30A 2W43A 3ZTYA 3QUCA 3R09A 1N8NA 4EX6A 5AM1A 5ALJA 4L6CA 1L7MA 3CNHA 4UU1A 5ALPA 3E84A 1YMQA 1QQ7A 5AK3A 4YCNA 4YIHA 3I6BA 4H1WA 1Z4QA 3ESQA 1QQ6A 3QXGA 4HAIA 1XP5A 3L0YA 2JAWA 4UM7A 5AK4A 3MPOA 3L0BA 4EEKA 4BEVA 4UAUA 2EAUA 3OPXA 4G9BA 4Y2VA 3QUTA 3B9RA 5ALTA 2WF7A 1J97A 2P69A 4OD0A 5E0OA 3UMGA 3HYCA 3L7YA 3BWVA 5AHXA 4YCLA 3U13A 3WK6A 4PNHA 2WFAA 4Y2PA 4F72A 4JB3A 2YJ6A 5AIBA 1RPZA 4OFZA 3FPSA 3WK4A 1LVHA 4YGYA 1RDFA 3PGVA 5AW9A 4ZEVA 3AR6A 3QU7A 5AIAA 2G08A 3L8EA 5AKIA 3NANA 4RETA 3WKCA 4Y2XA 5AW6A 4J03A 5ALKA 5AVZA 2PR7A 5AVTA 4HGPA 4C4RA 2HF2A 2C4NA 3AR9A 3L5KA 3IB6A 4EENA 3WK9A 4KNWA 4XPZA
chains in the Genus database with same CATH superfamily
1H7CA 1AHNA 3TTWA 4K6KA 1G8PA 3EQ6A 3GGDA 3N0RA 4RTPA 1K98A 5BVHB 1XEXA 4OM7A 2X9LA 4R0NA 3RYIA 2BT4A 3QJ5A 4WL0A 1JI0A 4MQEB 5CX1B 2WJPA 1QORA 3G0OA 1MC4A 2CNWA 1Y64B 3FVVA 4NJMB 3URKA 2QRVB 3VR3A 3KYDB 4LRSB 4YSXA 3MUNA 4I50F 1LGYA 4YBZA 1AGXA 2DZDA 3DC2A 5LMZA 2ZKIA 2KT9A 2ZJ7A 3UGKA 4X1YE 3H13A 1J7KA 1ECCA 3OCVA 4GWKA 1E5XA 2UXBT 1HH4A 4MPJA 4UUBA 4N7RA 3QLUA 4MDHA 1FRQA 5CUQA 4PYNA 4L8FA 4KE6A 3SR4A 4PGHA 4S0XA 4LFAB 3EMBA 4Y7DA 2QYHA 4BAZA 4IV8A 3DL0A 4QHOA 1EJ0A 4OI1A 2LCQA 4EGJA 4R0MA 3OCWA 1XDPA 2YWFA 3A6EA 3EZNA 5EXSA 1VMEA 5KYYB 2IXFA 4ENQA 3RUEA 2XKJE 1Y3IA 3MACA 3CSDA 1G20B 4GRDA 4M7PA 1XDGA 4UHCA 4ZCLA 4EMSA 1E58A 1U2TA 4A97A 2A9OA 2HLNA 2CD9A 2CXNA 2MBGA 3GYGA 4ZO7A 3RM3A 2C9YA 1LDGA 2FLVA 1N7HA 5KDLA 2WJIA 1R0WA 3S0JA 4RVUA 3GRVA 1NXWA 4AJPA 3G5UA 3PFKA 1SXJA 2PSFA 1QS0B 3AHHA 3C7CB 2G5CA 4MEBA 1PT8A 4MLCA 4XD7D 4ENRA 2IZOA 3Q1KA 2E85A 3G7SA 4FGZA 2HNAA 4NU6A 1E2HA 1GG8A 1TU3A 2J46A 4DJDC 2HUNA 2PKQP 2RA1A 3COZA 2CLOB 4YTNA 2J9RA 4M3NA 4C88A 5JDQA 4ESVA 3O75A 4JUCA 3GLRA 2F2TA 2PLAA 4JUAA 4PX2A 1VKRA 5KTNA 1TAUA 4OXKA 3TLSA 4B2PA 5JTGA 2BZGA 3H9QA 3KETA 1XMQT 5BURA 1TQ2A 1ST2A 2EL9A 3DGEC 4QDTA 1X74A 1SN7A 3ER9A 3H8JA 5TT0A 4F3TA 2Z4TA 1I2CA 5EXPA 2A3RA 3OZWA 3V4ZA 3AFOA 3DT8A 4EITA 5FHRA 2QZPA 1NR5A 2J5BA 2RHGB 2X1VA 1UBTS 4YLYA 3EMDA 2JQHA 1NJ1A 4ITRC 3OLVA 2LSYA 4R68A 2WDRA 1PQYA 2OK8A 3SU8A 5A9SA 3KXDA 3LBAA 3NPAA 3Q3IA 4ENPA 3EPHA 1KI6B 3BD9A 4CZZB 1TYEB 5INTA 2PFVA 2ZM8A 5CITA 2FQQA 1ZUNB 3WAKA 3KBUA 3RKSA 1XZEA 2PCLA 4UOQA 4X8MA 5KCMA 5I7EA 1ISMA 4FFMA 1YZYA 4G1EB 1GARA 3ZE7A 1QYWA 2BEUB 2YWXA 3DVLA 3FRIA 2RJ3A 3QY0A 1AGPA 2C2XA 4PYLA 2DC1A 2UXBB 5F8PA 2QMUA 3WBFA 1HGXA 3OTQA 3VPAA 3A1NA 3O4VA 3T4PA 4OTZA 1KO7A 1TAHA 2QGNA 3W1EA 2Q5IA 5T6MA 2C1ZA 3PC8C 4HE8A 1JFTA 1NVDA 3ETCA 4CKBB 4QPPA 4YJGA 3NEJA 4HWSA 3EW9A 4DR5B 1OIVA 1T4BA 1JFFA 3F2EA 4EIWA 1BJRE 1Q91A 3VPCA 1DO2A 3ZJTA 2G9QA 3Q0IA 1JN0A 4DQUA 2G0TA 2CFIA 1KI4A 1J8MF 1N6LA 1ORTA 2AX3A 1QVRA 4KUHA 4OJNA 3DBRB 1MOSA 5JDNA 1UFKA 1XF9A 1H8EA 3H3MA 2UVPA 2UV8A 4DBZA 4BWYA 3ZW9A 4HEA1 2Q3JA 4RF2A 5AW5A 2PO5A 4NS1A 5JJCA 4ARIA 4LDPA 1S2NA 2AWOA 3SIPA 4DIBA 4BLQA 2ZXUA 1CY1A 1VSBA 3VZSA 3MINB 4II3A 4HWKA 2OVFA 3OIDA 5LMNT 1OFUX 4YRJA 3W3AA 5T5QA 1DUVG 4JR2A 2WIDA 2LE0A 4YYEA 3PT9A 3EGOA 4P5EA 4Q82A 1NI4B 3OFVA 3I61A 3AP2A 4FLEA 3FKJA 5EQTA 2YJGA 2J5RA 2QJRA 1W8IA 3AGPA 2H7YA 3G79A 4MMXB 1CZKA 3FXAA 1EA5A 3I72A 3ETNA 1Q7CA 1D4FA 1XMQB 1WAMA 3N2IA 3OOWA 1XZQA 4L6IA 4MDEA 2EQ5A 4FR5A 4B48A 3MGGA 5LMCA 5LQAA 2HMTA 1QV6A 2Y93A 4JKYA 1EDOA 1SUFA 1XQXA 2XGSA 4DY4A 5DJ5A 1JX6A 3Q72A 4YY3T 1NBMA 2OGWA 4F92B 2A4KA 4BWFB 3MGCA 4EEXA 3TCKA 5BSMA 3W5DA 3BS4A 3HI6A 2VF8A 4RVSA 2PS0A 4EECA 5DLYA 4EG3A 5I3CA 4U3CA 1FP4B 4CF4A 3K9WA 4ZYYA 4JITA 4GPEA 3NKVA 3S5JA 1KI3A 4CIXA 4ZAXA 4ENWA 3H18A 1V45E 1ZVJA 1J4AA 4KHZA 3UK6A 1NZDA 1N32B 2J9FA 3G8AA 1B3BA 1IZ0A 3HCDA 3RIUC 4F04A 2O5EA 1SCQA 1VL0A 1B14A 1I3MA 2GF9A 3AHJA 5BN5B 5A4FS 1U2EA 3OPYA 4WMLA 3LCJA 2XDQA 4RTQA 3IHTA 2G4CA 1NW9B 1V1MA 2OCXA 1NFQA 1T5HX 1X1CA 1F6WA 4HUJA 4XCQA 3B12A 2P9YA 5L3CB 2QLFA 4DR5T 1KAHA 2HF9A 1D0IA 2HU5A 2GHQA 1CG6A 2QVBA 3EARA 1I3LA 3RRXA 5HOEA 2XY8B 5ETWA 3NHBA 3I5AA 4R9RA 1OVMA 4D6YA 5L45A 4BZPA 1KL7A 2FUG6 3C98A 4RFSB 2PM8A 3VC1A 4O4LB 4BGIA 4DE5A 1EFKA 1ST3A 3AM5A 4RTRA 2ID7A 4C76A 1KY3A 1QRDA 1MA3A 4M4SA 2ZWAA 2X0EA 1ATZA 2F17A 2LV8A 2BMAA 1XMJA 2J7PD 2YY7A 4BLPA 4ZI3A 4XIYA 5BWBA 3H9BA 4QO7A 1VKNA 2HSJA 1T4DA 2FTKE 2OV4A 4P82A 1ANKA 3B82A 2EGGA 1GPNA 4N01A 3S7TA 3RUCA 4BNJA 5E9QA 3ZU3A 1MIVA 4A6XA 2FG5A 3FLAA 2MTBA 1DLIA 2IE8A 4QQFA 4MRMB 2JDIA 4LHSA 1XEAA 3LP8A 1U5BB 2GH1A 3PUGA 2IIBA 1AXEA 1N6KA 4QYXA 4RLHA 3V34A 1LZKA 2GSWA 3IHKA 2DWKA 2W2PA 1BXRB 1GGVA 2UUAB 4S05A 4MAAA 3W8RA 3DUFB 2B34A 3F4KA 4J6FA 2YJNA 3KDPA 4J0DA 4MZDA 3UQZA 5JSQA 2QAGC 2I0MA 4FS8A 5AQIB 3NI2A 3HCWA 4FE7A 4WK2B 5DLDA 1FDIA 3PXEA 1VJ1A 4OHBA 4N65A 3LY8A 3VSCA 1UK7A 4B3JA 3AA0B 2X1HA 1SY7A 1A8HA 1NQTA 1XAGA 1DCMA 2BCEA 2F00A 5KQSA 5KO2A 3IR7A 1Y82A 5HKLA 1QYXA 5ER6A 1I4LD 3E8MA 2ZVQX 4YXFA 2JJYA 1PO7A 2CL5A 2VCEA 1O94A 2X14A 4WKBA 3CEAA 1CRLA 3IR6A 2AJBA 3GBSA 4KU4A 1I6WA 1OXZA 2I71A 2ZSKA 5FDFA 2KSQA 4KP3C 5E0KB 1V3UA 4XLLA 4I50E 4HAWA 4D99A 1M7HA 2HBZA 3SC6A 4AZ3B 1V4VA 4DCPA 1HZZC 4S24A 4C07A 4X7MA 2QEQA 2C95A 2FZEA 3GFBA 3HBFA 3PNOA 3BDVA 3R3ZA 4IOMA 4TT8A 5A0TA 4G5RA 1XRJA 2OMEA 2P4SA 4MHCA 1D4ZA 3GGOA 3LVFO 4XYBA 5K2MA 4D45A 1SC3A 2Q4RA 4XIGS 2EX0A 2MMCA 3C3AA 5KYNA 2VTKA 4IFBA 2UYHA 2RIPA 3AONB 4WCFC 4J7AA 2WT4A 3OCUA 1US7B 2BDTA 3DLCA 1L8QA 2Z0MA 4NCBA 1KDYA 4Q34A 2AFHE 3VR4A 2WTXA 4CMGA 3GMTA 4IREA 3IULA 1YA8A 4DBLE 4Q4JA 2A1TS 4FHDA 2PZKA 3U6KA 2QQ5A 2H51A 3W9BA 2Q8PA 3BXFA 4AZVA 5KSPA 1IK4A 4MQ4A 1M34B 1VHQA 5A1JA 5DO9A 5ESWA 4TKVA 3B70A 1ODFA 4NR0A 1XTRA 1B42A 2V5VA 4EA8A 3KWLA 1XZGA 1REQA 3OJEA 4EABA 1ZN9A 3JZMA 3DOHA 1P1KA 2C07A 2E21A 2NNWB 2PWAA 4KO1S 4U7PB 2ISQA 1V43A 1KEWA 3IP5A 2BCGY 2Z95A 3PCRB 4P5PA 3N9QA 2HNKA 2VP6A 3F0TA 4GMDA 3W2GA 3IIJA 2BF4A 2WRZA 4QX7B 3NXKA 4JI1T 3WIUA 4TN5A 3S2GA 1YS4A 1JLLB 2R66A 4K5QA 4DCGA 4UDYX 1G2QA 1L5SA 4Q3KA 4Q18A 1UOOA 1X7XB 1XJQA 5IEBA 1FBTA 1YQEA 3NHKA 2KYRA 5KINB 3IT1A 1R6BX 1PR5A 3R84B 3DCJA 1W1UA 2QM7A 4L4RA 4AJ2A 1RXWA 3B53X 3VAAA 4FI3C 1SVOA 3ZDFA 4TV9F 1JNXX 3FJ1A 3IBYA 1V8BA 4WINA 3FOBA 4WW0A 1GCAA 3BCUA 3HXKA 1SKAA 1PR1A 3DHVA 3K09C 2CEKA 2PQ0A 5IS2A 2BONA 1OXXK 4DJAA 3U7JA 3ND5A 4OREX 3D3KA 1E2GA 1W0CA 4C7JA 2IXDA 1A9RA 1CS0A 1G8JA 3WGKA 2F3PA 2G9RA 4Q1EA 3WNQA 1YMUA 4RDCA 2GZHA 1FS5A 4EG8A 2CT8A 2D5BA 3ELYA 3P4QA 4P36A 1UXOA 3KQUA 1RBMA 2NOAA 5BWNA 2UXNB 5KHOC 2CHQA 3KXPA 1JE1A 1XQ1A 1GN9A 2FF7A 4QH4A 1TU4A 2JQKA 1NDHA 3P96A 4JXKA 5AKGA 2FPSA 1MEJA 1MGPA 3PFWO 2PJDA 4RA6B 3CH5A 1U99A 2QRMA 2QGZA 1WXFA 4FCWA 5EN4A 2LKGA 1CETA 1V8FA 3ONFA 4JN6B 4QNMA 4CTOA 1WE2A 5HKBA 5EZSA 5C31A 2OM2A 4DSTA 1EWQA 4H9GA 2VS1A 3G5MA 4UTZA 1XR3A 3EDMA 5AXAA 5A9RA 1FYDA 3HEAA 4TQGA 5FH9A 2M6BA 2VDVE 3B9QA 4X5OA 3DLBA 4MWEA 3KVOA 1LRJA 4IDFA 4AQFC 4B73A 3K9HA 4C5CA 3BRWA 5JAZA 2WJVA 3GJTA 4EYQA 4W5WA 5TRTA 3PDIA 4ME6A 4DV5B 3H0EA 3ZZTA 2EJTA 2J4FA 3AG5A 2QZZA 4QXMA 4YCDA 1UBCA 3HR7A 3DYVA 2G36A 3IALA 2WWRA 3H3JA 5DSXA 1L5WA 3C1OA 4F4CA 4DV3B 2ZI9A 2FSSA 2IDKA 2XUQA 4MWGA 1GLVA 5AFUL 4ES6A 5HILA 3TW8B 5B7PA 13PKA 1ZMRA 5CFPA 1Z4MA 3DDOA 1Y0BA 3C2QA 5TMPA 1CSEE 3ORSA 3ENVA 4QJIA 4LSWA 4Q9LA 1K3UB 3NKFA 3TZEA 1PNVA 2BJVA 4N49A 2IYQA 1R0RE 2R3SA 3OTOB 2F1KA 4NAUA 4PFKA 2CCKA 3OZRA 5D6NA 2ZT5A 3ASZA 2DYKA 5CH8A 2IXEA 1SBQA 3N7AA 5TSDA 3WL5A 2WUGA 3QTLA 2QL5A 3LHIA 4C6RA 1FZTA 1GRRA 2PMCA 4QRIA 3L09A 1M1XB 3PUIA 1JXQA 2A7XA 2HU8A 2V6IA 3DH0A 5JAOA 4Q1VA 3R3WA 3TSOA 5IWCA 1RJEA 2D0IA 2HK6A 2NW9A 1CZOA 4AKTA 4TUYB 4ARBA 1Y5MA 3QQ5A 4PXYA 1N2EA 4PO9A 1GJRA 4RDHA 3T7RA 4C4XA 4ILBA 1Z6QA 3QEJA 4BLRA 1W4CA 1Z4OA 2R00A 1XP8A 4KO3S 1XJWA 5CXQA 4Z53A 2HQBA 1JPNA 2WWIA 3RSCA 2QE7A 1Y3FE 4A8JA 4YAUA 1IQRA 1KYIA 2XVAA 3BWCA 3QJYA 4G4GA 5CDHA 2AE9A 5MFZA 4DPLA 1CUWA 2WNSA 4DUYB 2GLTA 1EVKA 4FI5A 2YS7A 1JG7A 3EUFA 3LGAA 4RPLA 3FPKA 1U3VA 5LSAA 3E1GA 1CJMA 1T35A 4Y98A 4EA7A 3O4XE 4BVAA 2CNBA 3GLHA 4PF1A 1L1RA 3SJAA 3THWB 1LVGA 3UHAA 4EHBA 5JR9B 1KGDA 1DAMA 1BMQA 4CF6A 4UVGA 5IDQA 3T1QA 1L7DA 8AT1A 1PJRA 1JA9A 1UKEA 3S99A 2EHDA 2IYPA 4GUAA 1WP9A 1CHNA 4IUCS 2PUDA 4LI3X 1N5IA 1YMQA 2H88A 3EXFB 5JC8A 5K0TA 1XNQT 2DUWA 3MS2A 1Y01A 1ACLA 1IOWA 1SBYA 2V7VA 5DYGA 4YRPA 3I6BA 5KQPA 4RD0A 1CU1A 2O7VA 5SV2A 1D0VA 2ZRFA 5AJHA 2MR5A 3PTRB 3OWHA 2P6MA 2WYWA 5G0TA 2VG8A 2IV7A 1QH1A 2VT6A 1I4WA 3A3OA 5FV4A 1HR0B 3AEQB 4J0IA 3DDSA 5CA0E 1GYQA 3LY7A 4QQ8A 4E03A 4HB3A 1XU9A 2HLHA 1I8TA 2BBWA 2VAMA 1AQJA 3PB3A 2WU5A 4H0NA 3D54D 4PWYA 3OTOT 1KJYA 1C0PA 3A4YA 4Z4GA 2ZRDA 3FZEA 2WJGA 3ZMSB 4GFDA 4HMOA 4R2HA 5DM1A 3L7YA 1YT5A 4KUGA 3UMGA 3TGPA 3SY8A 2WWFA 2PS9A 1M7GA 2ZJFA 4Y2PA 5NULA 1BU8A 1KAGA 2QVGA 4I8XA 4JB3A 4S3MA 3U7QB 4CTNA 4WH0A 3EG5A 4C01A 1DQSA 2PMFA 2DHRA 2CUNA 3A25A 4GEGA 4H59A 2VDLB 3CH7A 5DRTA 1P3JA 3B2NA 4QXQA 4ZI2C 1U3WA 3RPUA 3DE5X 4XGKA 3EGEA 1DT3A 5J5VA 3SG0A 5LCXA 3VU3A 4BFXA 2CEAA 1DL5A 1XAHA 2OCAA 1T0PA 1M0WA 2PA0A 1PU2A 1R66A 2YNMD 3DQPA 3GRKA 4GC9A 2XWJI 4M88A 3W7AA 3NANA 3ZOKA 2XAUA 1DS6A 4ENTA 4MFRA 2I6UA 5I4KA 1LW7A 2HXGA 4TZKA 3VR2D 4AG6A 3PDCA 3TLJA 2QTWB 2LSJA 3LKBA 3U80A 1KOJA 5I01A 1YAJA 2AQIA 1C80A 2VFAA 2NU9B 1WKVA 2RI1A 3L6BA 2NXCA 5HZMA 2TMDA 4CMJA 1T2UA 1VLVA 3J81k 4ZYTA 1ORIA 4IS2A 4EHAA 2HPLA 3HSYA 1IMJA 4ATNA 4NMMA 4DGQA 3W79A 4UMFA 4Q9DA 2AJCA 3QW2A 2CZGA 4CN9A 3B2QA 2R751 4YQYA 1IWBB 1H8HD 5CJPA 3I53A 5JXIA 1RWMA 2CLEB 3TDKA 2ZYUX 4DTIA 2XQIA 2YHBA 2AOWA 4HFCA 3AOGA 2O2DA 5IFKA 4GX1A 2E4AA 3S2EA 4ND6A 1XVUA 1L6RA 3GX1A 3U4QB 1YBMA 3CRQA 1FS4A 3AOEA 2GXUA 1Y4SA 3SN6A 1CF9A 3FCCA 3AHIA 3MA0A 3T3NA 2ACWA 1WXWA 4ERNA 3ZU6A 3KB1A 1CR4A 5JVDF 5DNAA 3JWIA 3GF4A 2YWJA 1KZ7B 2GASA 2OCLA 4HD8A 4KMOA 3UJNA 3EVCA 2WK1A 5HXCA 4W1PA 5HTKA 3VQTA 4C0BA 3FCEA 2MR6A 2NV6A 2FR8A 3WWEA 1QFXA 4Q66C 1Z75A 1M1NA 5AFSA 3W5VA 4QARA 1U0OC 3D6JA 3GA8A 4CEJA 2GAJA 2P5YA 1EP1B 3MLAA 3OWXA 3QKUA 3R3YA 1J70A 1SAYA 3SX0A 1RRCA 4IDEA 2HO5A 1E2UA 4TS4A 4GMKA 3V4VB 1TQ8A 2GVZC 4CMIA 1AB5A 1JEYA 2X3UA 4K9NA 3H87A 2BKEA 4QDOA 4R1UA 2H1HA 3IUMA 3JVUA 3P0EA 4R3NA 3WSVA 3LNCA 1UGOA 2V5UA 3VVBA 4M1EA 3RADC 4N82A 3UFGA 5L3EB 1IOLA 3KO8A 2WU3A 1KYWA 3PGMA 4XASA 1JVSA 3JQDA 1QH0A 4R1MA 3K7EA 4ZEMA 2E5LT 3EMVA 1KJ9A 1EHCA 3DG9A 3FLBA 3MG9A 5JE8A 4B3MB 2OO5C 2ZI4A 3VC7A 2C7QA 4Y1RA 2NO6A 2FMHA 1ZI8A 4GQAA 1OF1A 4OJQA 3DLPX 3D5EA 1EZ1A 4K8OA 1FUIA 2GFHA 2W2TA 4JBXA 4IJWA 1RM4A 2GLXA 2IYUA 1N2SA 1PFQA 4RM3A 4Z1MA 1JIQA 2YZ2A 3TIFA 1Y6FA 1IHXA 4UBLA 3RVRA 2JI9A 5G2OA 1QWOA 1Q17A 3KJQA 4IE6A 2WOOA 1E5DA 3S1LA 1A8PA 3RDPA 1AQ6A 3K20A 3TTVA 2HJVA 2PHZA 4M8KA 4RA9B 3CLHA 2RHHA 3LRPA 5JADA 3EH2A 1OB5A 4X20B 3BMQB 1EUDB 4GBJA 1HE5A 3KP1A 1O6CA 1NFFA 4UXNB 1NQAO 3G88A 1DG3A 3P94A 4G9GA 3UTDA 1EVLA 3SJUA 5JZMA 5LDHA 3ISVA 4BYMA 3HO6A 2PD3A 3WLLA 3I09A 5HEHA 1ZGZA 5AKJA 3QK7A 2OXIA 4EI2A 3AAAB 3G85A 4HTFB 5EJ6A 2OLTA 5JVDE 1C9KA 1N3BA 2LEHA 2G5PA 2OFWA 3IMKA 3FNQA 4ZI5A 1Z0SA 2C2WA 3G2MA 2Z8XA 2PKEA 3ZEAA 3B78A 2LKCA 1OZAA 1P77A 1KQNA 3T0GA 3UM9A 5J4KA 2VNJA 2A1UA 2X6QA 1XVIA 3KLNA 4N7MA 2C98A 1P75A 3ZVNA 3AE5A 4FHGA 3CH6A 4EY7A 4MYSA 1P0CA 4KB5A 5KTTA 2E4ZA 4X63A 1EVQA 3DKRA 4MUEA 3WI3A 1X3SA 2XWPA 4DMRA 4FNMA 1Q14A 1MFZA 3M9WA 3LBFA 3GFVA 5ABFA 5LQNA 4OMFG 3TFWA 3ECCA 3WMXA 3N6RA 4GK0E 4BRZA 1LSSA 1Z3IX 4LOHA 2DULA 2GZRA 1RQXA 4JR0A 3A58B 4HYEA 3SMVA 3GJRA 3QFHA 5EE1A 1YJ8A 3SHWA 3OHPA 4RNCA 1XZYA 2QGSA 2V3WA 5BNIA 2ODEA 3BA6A 5JTTA 4X8LA 3FIUA 1T91A 1EFPB 4U3JB 3W1VA 4ZCIA 1F9EA 2O3QA 3IOEA 4E21A 5DYWA 4L2IB 3BE8A 3CURA 3AEFA 5D5PA 3UU3A 1N33B 1MG0A 2I62A 3K0CC 2ID8A 4DXDA 1B7TA 3OFKA 4LDJA 2WFZA 1GNRA 3AUJB 2A86A 4HYYA 3WA6A 2OY0A 6REQA 1O03A 4MS1B 3JAFA 5T57A 3T7TA 2A5LA 1XE3A 1RWWA 5KYUA 5CLGA 1S7CA 3WGZA 3O9XA 6LDHA 1RQRA 4YLGA 2BUBA 3KUDA 3ESLA 2JFWA 4X1KA 4OL9A 3GROA 1KNZA 5CDUA 4CIDA 3IPYA 4PLTA 5IVDA 1U1IA 3KV6A 1SK9A 3F3YA 3L93A 4I4NA 4RX1A 4L3VA 3ZDEA 3FKSD 3D8BA 1GG5A 1T26A 3KJFA 4RK5A 5JJLA 4JXJA 1BD4A 1P5JA 1J21A 1X79A 2IELA 1FFBA 2D1SA 3PFFA 4NZ9A 3ANWB 4RKFA 4FQ7A 2L9QA 3RCBA 3VO2A 4JVMA 3VDMA 4FYKA 5CW1A 2LZ0A 3KYIB 2CDAA 4ZEYA 1MO2A 2GZMA 3A6FA 1J1IA 2N42A 4L8LA 1D2NA 1TD9A 4U6NA 3S44A 4A15A 4OXXA 1XD8A 1CWUA 2RHJA 3N6XA 5AMXA 3M6IA 1W52X 3MJEA 2WTMA 3O9ZA 4L4SA 1R16A 3E7PA 1B4DA 1GGJA 2WJHA 1HF8A 1PJQA 3E9ZA 3TZLA 1A9ZA 2XMQA 1PLKA 1HDXA 2QN6A 4XJXA 4K0UA 2P2CA 1FS6A 2C3UA 1W5FA 2OZLB 2V8BA 1DBRA 1T8YA 2WWVA 1ULZA 3BCRA 3LKVA 2JHCA 1ZN2A 3EOAI 4HAXA 5I9LA 2H7OA 1NGSA 4YACA 3ZW7A 1IRXA 3OQBA 1IZYA 2KPOA 1P2BA 4JI3B 4IO1A 1ZGGA 3QLTA 4B81A 3DKPA 1GOTA 3BFXA 3MWDA 4JP8A 4EHHA 3VA7A 1OHHA 2J1DG 2VVNA 1EIZA 1I3OA 2APJA 4MUAA 3P0HA 4U2FA 4WIAA 3CZ4A 4RPCA 4BAYB 3HE3A 3UAYA 2Y66A 1TCCA 3CPHA 3EF0A 3K9CA 4JC4A 5KX5F 1K8ZB 2HHAA 3B51X 5A7FA 1I36A 2J3JA 5FY7A 2PYIA 4QFBA 4FHEA 3D3NA 5AW0A 2UUBT 2AVNA 2I78A 1JP7A 3KOZA 4EFLA 3ZBUA 4JYAT 1P0QA 5ALQA 4HEQA 5TQ2B 1L4MA 1XLTC 1EFTA 5JEDA 4LTMA 1Z12A 1QP0A 1BR0A 3DT6A 3M1AA 5EIAA 3R6TA 3LG2A 2K5BB 2RJNA 4W4TA 3NH9A 4WFJA 1SELA 3WLRA 5JMWA 1ZNZA 3AI3A 4J2TA 4PBTA 5JYEA 1I4EB 4KWEA 4O2RA 5KQRA 2ZCUA 5L95A 1IMOA 3UGJA 2XCTB 3PQCA 4IIFA 2YHSA 1N1DA 2HFKA 3OAAD 4GOUA 2WZDA 4TMYA 1K7EB 1UPAA 5CXSA 3R2JA 2Q1UA 3Q5GA 1KNQA 3ZI0A 5IF3A 3T52A 3AUYA 3TJRA 3AU8A 4WESB 1VQ1A 3OBVE 4OMUA 4YDQA 5EIEA 1SE7A 2PFSA 1V4NA 3PVZA 3VDRA 4DLVA 2OCBA 3AJ9A 2I2XB 3BJIC 3OC6A 1N9ZA 1NLZA 2Z4RA 3FKSA 4UJ5A 1PYDA 2DG2A 3CUEF 5FR2A 4UZSA 1JECA 3H6KA 2IYYA 4M0KA 3COJA 1Q7RA 3MKDA 4NPCA 2FUKA 4FIDA 1QUEA 3RYHE 2OB1A 3M9XA 2P8SA 2CE2X 4HBGA 1O6BA 1V3TA 2VZ0A 4HAVA 3VKVA 3EZ6A 1Y4AE 3E5NA 3FBGA 4I9GA 1F8GA 2DLRA 4YRCA 1ICEA 3C8ZA 2Q5QA 4AJEA 3ZUGA 4XWOA 3F8SA 2E37A 1M2HA 1T9AA 3FDZA 5AQNB 4KR7A 5EE0A 5IG2A 5I4IA 4IQ4A 2AHRA 3JX9A 4AUMA 5HVNA 1FW6A 1R10A 3FI9A 4E2ZA 4XTRA 1BR2A 2OV1A 5IANA 3N0VA 4P0QB 4R1QA 3ND6A 2Q4BA 3ND7A 2Q6LA 2H31A 3U2QA 2A78A 4WFIA 5KCZA 4WBSA 2ZYDA 4XAQA 4X62T 2GNPA 3CW9A 2J41A 2QUHA 3BORA 3HUTA 3FBLA 4JI2T 2SKDA 4HRYA 4X7PA 5AVOA 3ZWAA 4LF6B 2C5BA 4I1SA 3E8XA 1JUDA 3DXZA 2CXFA 1WXDA 1X1BA 2ATEA 2I67A 3U61B 5LWHA 3K0KA 1L3CA 2ONCA 1RABA 2EU8A 2XW6A 4B7AA 4QDZA 3IBFA 4TMKA 1X0XA 3FUWA 4YJFB 4A0GA 3N2KE 4EF4A 3GUUA 3O1HB 5A2GA 2FDCA 1TRHA 1SVWA 5L7WA 2PQ6A 4CKCA 3KOOA 1GTMA 2B35A 4B43A 4GZMA 3BK9A 1ZN7A 2FA9A 3K31A 1QIDA 3IFSA 4IP0A 4QUEA 4TN1A 1T72A 4ZO6A 4Y30A 3NOQA 5EAIA 4E12A 5IXYA 1J2UA 2JFBA 2XM2A 2QSUA 3LPLA 4DSZA 1LI5A 2CK3D 4UMVA 3DZDA 3PEFA 2NACA 4UW9A 2IH4A 2H8GA 4QHTA 1JJBA 3ZKWB 4NG5A 4ZO4A 5EPEA 3R8XA 3D3WA 4OB6A 3IIEA 4C5BA 2B5OA 5LNKA 2D8AA 4FYVA 4N5NA 3RVNA 1Z5NA 2GCNA 3W90A 4BC1A 3AL0C 4C0SA 1I01A 4KWCA 1ZAKA 2R6CA 4D79A 2DUJA 1Z6GA 4JT2A 4OYYA 2DI4A 1L0BA 3HDQA 4RL6A 5LOVF 1RZRA 4P6VF 4CT0A 5K8UA 3RUIA 5EIXA 4RH0A 3OVUA 5EKTA 3CWZA 2KX7A 1VA4A 2D0PB 2FB9A 2PSHA 4N0DA 2ZYHA 1DRVA 3R0ZA 3TKLA 1QLHA 2H1CA 2LOPA 3FJOA 1TC2A 4YCAA 3D2BA 3NBKA 4HQFA 3BVPA 2RHLA 3T1HT 3RSSA 1CRPA 4Y7CA 3TI9A 4A6EA 2D1YA 1W73A 2VP0A 4J94A 3X1WA 4RAQA 3H2BA 3L3PA 2SHKA 1DP4A 4F6LA 2PQMA 3RU9A 1U80A 1TVKB 1W0BA 5C5EA 4PZYA 4BLUA 4KFCA 4WWHA 5ABFB 4EPVA 2YNMC 1J9GA 5KYVA 3GMDA 4C0LA 2TMGA 2QP9X 5BUSA 1KPGA 4QJ3A 1R0YA 5DI9A 5KSWB 2KMFA 3T0FA 5L51A 2IS4A 3P4YA 1EINA 4QPJC 1AQNA 2EL7A 4MLDA 2E0IA 1WY7A 2GN9A 4JI2B 5AW7A 3RYHA 2XHEB 4TMZA 2OR3A 2CYBA 3T7JA 4OX9B 2KBFA 3OKQA 5KNLA 1G2IA 4WLVA 4MUFA 4LDQA 3WLPA 5KSOA 2ZEJA 3GL9A 2ZCJA 4MUGA 2H9IA 1FLVA 1V7CA 2QQEA 2C83A 4IO0A 4BVLA 4P3OA 2Z43A 3HKCA 4FW8A 4EATA 5EEHA 4G07A 5SICE 2IY7A 1L7QA 1MIOA 4J4BA 3L46A 3D8HA 1FFHA 4AT1A 2A35A 2ZLYA 2ZPTX 3FPLA 4ESHA 1KEYA 1BS1A 1ZHHA 1ZHOA 1GGKA 1ZUNA 2EBWA 3COVA 4LSZA 1WW3A 3CEHA 4XYLA 2HX1A 2X23A 3Q6IA 5AQTB 1UBNA 2LDBA 2CXHA 1S3FA 2B4TO 4NLLA 5U9CA 1IEVA 1KH1A 1RKXA 3W4KA 3VH1A 4YAGA 2X0HA 4YNBA 3V4OA 4IGUA 5EFZA 3RFFA 5EYPA 4BQFA 5IVHA 1W19A 1TM3E 3G5LA 4D4KA 3T8OA 4B5KA 4CODB 4N8SA 4DZZA 3PI7A 3S2SA 3COWA 2UZAA 1Z8DA 2G0NA 2WPNA 4C6TA 2G9VA 3WAGA 1Q12A 2JDID 1SXQA 4XVCA 1ZM4A 1C41A 1QYRA 2XT0A 2ZU6A 3DAPA 2PN1A 1XMPA 3F5QA 3S8EA 1DTEA 2DFVA 3FNEA 3EF1A 1BG6A 3QX3A 2JHAA 2GS9A 4C0HA 1HXHA 2PT9A 1AKEA 3VU0A 1Y7TA 2QR2A 3G13A 4FKMA 1T36A 3E22B 4RTNA 4TRMA 3NNSA 2OESA 3KR2A 4CFSA 4UVHA 1FQKA 3LDAA 5GPBA 1DC4A 3NWOA 1NT4A 1NW7A 4L6CA 1OILA 1VIYA 4IIXA 5AQQB 2I3GA 2PV0A 4JJZA 5J2TF 4Y1EA 1VKJA 3TI7A 2EYQA 4JEUB 1SXJE 5F51A 5JRCB 3KTFA 3LUBA 2VUUA 1CZRA 1HE2A 1QHHA 2XMGA 4PRKA 3KVAA 1Z4QA 5DGHA 4R54A 3TQQA 1JDBB 2HGZA 4YRFA 1N36B 3HN2A 2E49A 1PNOA 2PYZA 3Q7EA 4O4HF 4UM7A 4E13A 1V16B 1JSZA 1JZSA 3P4UA 1R6VA 5C2TA 2QUAA 4RKYA 5E1MA 1H2RS 4C20A 3C48A 2R7NA 1DC7A 4ARZA 4GLFA 5JS1A 1E3QA 1TIBA 3NBFA 2QNIA 3VOSA 2GWRA 3WZ2A 1NUQA 3QUTA 4E5UA 1Y7PA 1GHTA 1V8OA 4MICA 1XLVA 1J97A 4XB2A 4YP6A 5FBQB 3AINA 3UJBA 4D9GA 2YXNA 4ZYWA 4UPDA 2XB8A 1VZ3A 4Y9SA 2E8IA 5JI2E 2KNDA 2IRWA 2XLCA 5CYFA 1L4NA 3W77A 2BKNA 1LCIA 2Y1FA 3H0CA 3C5WP 2AKEA 3ELBA 1TA4A 3SZGA 3KAPA 2HUPA 4F2WA 2XUPA 3OBBA 2C8JA 3O8QA 3FCUB 4ZVVA 5AUPB 4GOLD 1UK5A 1XJ5A 5D87A 3BD7A 2B3DA 4MQLA 4B6EA 3FNRA 2V1UA 3DTVB 4NECA 2YV2A 3QE9Y 2BLNA 3C15C 5ALKA 1Z29A 3INTA 3WDMA 3WGYA 4B17A 2RAUA 1YASA 1APBA 3ONJA 1Q84A 3QBEA 1WUIS 2OHVA 1OPXA 4TVSA 3T12A 3Q8MA 1N0VC 2VVTA 2EYUA 1PKXA 1VPVA 1NAHA 3MMNA 1M1YE 4M1SA 5G4LA 1UIMA 5K2OA 4LZNA 1SD2A 3KKQA 4LK2A 2ECPA 3VTFA 2G76A 4R2IA 2VT3A 4AIUA 3KU1A 2GRJA 3QEKA 1VLZA 1XQ6A 1JAYA 3KAQA 2JLAA 1RZVA 3NDRA 1GPUA 2C3PA 5CU7A 3TQIA 3LCRA 4TLMB 5BORA 3BB4A 4BXOB 3OQIA 1F0YA 3M3PA 3OF2A 4RIGA 5CMLA 4QXPA 1UBFA 3NKLA 1AGRA 3PD7A 1KQOA 5DW3A 1IIRA 4U9IS 2RGRA 1V39A 3WRYC 1VBMA 2DFPA 2K3WA 4MHSA 2J30A 2QRNA 3MAAC 2V7PA 4MQ5A 4YHHT 3AUTA 1T6ZA 4D2IA 1ZCJA 3RD5A 3RV4A 3KQMA 2D2EA 1P9OA 1HFWA 2J3KA 4M76B 4B3TT 5ENDA 3IKTA 1P5ZB 1MBZA 2JLVA 3CM0A 4WBNE 4ZT7A 4DQVA 5LZ4A 1D2RA 3VM6A 4E5KA 4WXHA 4V38A 3TSZA 4EPXA 2C2MA 6ADHA 2HHHT 4JLPA 1JDSA 4S1NA 5E4TA 3AP1A 2IKSA 3UOAB 4JUBA 5EP1A 1ZM2A 4MNTA 2IS1A 3FPEA 4B3RT 3GCWA 3MCAA 5ARBA 3DR5A 1UBOS 3HBAA 1OU0A 4IGEA 1V1RB 1EQUA 3MSXA 5ERGB 5HKAA 5LOVE 3O8BA 3ICPA 1U6KA 1KVQA 2FFAA 4KC0A 5BMVF 5HZKA 1N0IA 3ZYLA 2AQ8A 1LBTA 1YVDA 1T3SA 2R6GA 2ZANA 1QFMA 3DNFA 3ABZA 2HSGA 3PQ7A 4XR4A 5T4HA 4Z3DA 3A04A 3GLKA 5CVCA 1CUHA 2G1KA 1CB0A 1JF8A 3I0MA 5IKXA 3ZOZA 1P6UA 4TV9A 3R75A 4KPFC 4EPYA 4ZICA 2GVDC 1JBKA 1ODJA 2OGTA 4BP1A 2WBLA 3MOGA 4JGBA 1FSSA 5EIBD 3LPNA 2OA0A 4YSZA 4H7EA 3MRTA 2I6GA 2A9RA 1LDNA 1PX2A 3MMZA 3ONEA 2CUTA 4PG4A 1P45A 5HF8A 1JVNA 3WB1A 4B71A 4I1OA 2YV1A 2V1XA 3SYMA 1VSVA 3CLSD 3WLSA 4HGOA 4DMHA 4QU9A 3VVMA 2WP0A 2QD2A 3E08A 4Q7EA 4X85A 1WSAA 3VZRA 1R00A 1VGRA 4GL4A 4E7OA 3HN6A 3QVLA 1JDUA 1U0LA 1P29A 3L79A 4CFYA 2G1PA 2WQYA 2W6QA 3BH6A 4C43A 2IK8A 4IXTA 1NVGA 4MB0A 3TWOA 1C2YA 2CC2A 4URVR 3V4FA 3BIWA 3G0BA 2D3WA 3R7WB 4DQKA 2I9KA 3EFOB 3EW7A 2A3DA 1DO0A 3K9LA 3SC4A 4ABYA 4E2FA 3EFOA 1GUBA 4LFAT 1CR6A 4I4TA 3BQIA 5PGMA 1CQZA 2B1EA 1E2JA 2FMUA 1IUNA 1XMOB 1SEVA 2R62A 5B2ZA 4BRWA 4TMVA 2A0FA 1ZITA 3MD9A 4PZLA 5BVGB 4IHJE 3LK2B 3NBUA 4NEGA 2CWWA 2BM0A 3H0KA 4Y18A 1PVOA 1KE1A 3EAQA 3FNBA 3HYTA 1JKXA 2AWNA 1SQ0A 4NY1A 5IUNC 4P4SA 2BHRA 3VYUB 4LFCT 1XZKA 2PT5A 3TM4A 1WMAA 1I32A 4I36A 1EE2A 1E4OA 3BF7A 4N39A 5K01A 1JKJB 1R5BA 1W6RA 5JIBA 5JWOA 4RYLA 4PSVA 4HFEA 1O2DA 3I9LA 3O82A 5FLKA 1Y9JA 3ZJ2A 2ZJ6A 3FSGD 5IAJA 5FVKA 5A1LA 2W8BB 3KJXA 3SZLA 4DILA 1IRIA 2I7XA 3V80A 1T2AA 1W94A 1W9MA 3QSYA 1GP2A 2WFLA 1EI9A 1A9SA 2QU8A 3AUKA 3O2SB 2I2CA 4JL8A 2V6XA 2E7ZA 1LWNA 2WQZA 4QD3A 4BATA 2VPTA 5BNTA 1H2ZA 2C04A 3FG9A 4G5FA 5I7AA 4ML3A 4FLFA 1ILEA 4DWJA 5JFGA 1ZD5A 5KDOA 2BZBA 3PGXA 5FPHA 5AI4A 4XJSA 1FP1D 3DMGA 1ZSNA 1GTSA 3V8RA 3TZKA 4WZBA 2XOEA 2UDPA 3MRXA 4H63V 2VBGA 4KSCA 3KFLA 3NOXA 3JQ8A 1P2FA 1UDAA 1WRBA 1KYQA 1ZI9A 3C39A 3I2HA 3O21A 3WL6A 2G1AA 1SC1A 2V4UA 3OIVA 2XMPA 3THSA 1E4VA 3QMWA 5EMNA 2ZBFA 5B1SA 4GI1A 3MFQA 3CT4A 5TGDA 1KORA 4C7MA 1TD1A 4J1TC 4OQNA 5LBTA 3OLCX 3P4XA 1YB5A 4RZIA 1WVMA 3AZPA 4TWDA 2I22A 5KX5A 1CUFA 2ERCA 3GLFB 5AICA 3Q5DA 3T7SA 3JPWA 2JGMA 1KOGA 4C14A 2ZRLA 5B53A 2VSXA 4XW2A 5IN4A 5FPKA 3FUTA 1GSAA 2RC6A 3RHFA 2O5RA 3D6UA 3WYFA 1Y3DE 1JQDA 4G23A 1YS7A 2OLEA 5FV7A 5B4TA 2JZNA 5L4SA 2XUEA 4ILEA 1E98A 3L9XA 3OLQA 3PGJA 3RUHA 2KWIB 5EJ7A 4IIJB 2KJQA 3D5QA 3VV2A 4CCWA 1CZHA 2RI0A 4JI8B 1JFVA 2WF8A 5DLQC 1B23P 4QAQA 5K8CA 5EMHA 2OGUA 1HG5A 1QCYA 1IN7A 1W48A 2MYUA 2H63A 3CISA 3G49A 2EFJA 4BO1A 3K53A 3MUFA 1QG2A 2QVCA 1G7CA 4CIYA 4G25A 4FFLA 3TL3A 3EWAA 1J07A 2D4HA 1DWUA 2RCNA 1S01A 1XQ9A 4MJ7A 2PU5A 4KN8A 4O8CA 4LFCB 2WA1A 1TMYA 3IJ5A 2C84A 3E1SA 4ZXFA 221PA 2H57A 3RLFA 4NUUA 3K1AB 2UZIR 3ZTWA 2H5LA 5FOVA 4CI9A 4JX8A 1O6ZA 3K9QO 3V9AA 3VH2A 4M55A 1ZM9A 4HFIA 1EAYA 3B3JA 5EVJA 3WIEA 1MGOA 1MCZA 1VLLA 3KDAA 3AYXB 3DTYA 1LLDA 1O54A 1DAEA 1HOTA 1KFBB 2NUBA 2XMZA 4DIUA 5KU1A 2BSQA 2IHNA 3TKLB 1OUMA 1RPTA 3O8CA 2PRSA 4P0AA 3AIOA 3TX6A 3EZ7A 5G1PA 3L07A 2JAUA 3EQ2A 1G2PA 2INGX 1FMTA 3TIGA 4C4SA 5JMTA 3GLSA 1GA4A 1X80B 3OM1A 4O3MA 1S8AA 3E2MA 3W6NA 2X8JA 1XK6A 4DDUA 5BMVA 1KBOA 1FZQA 4JU8A 3RBZA 3PUYF 2BGWA 2O14A 4MV8A 2OOSA 4N4AA 5TS3A 2IC6A 5A4JA 2IV3A 5IK2A 1V6AA 2PX4A 2YJ5A 4BIIA 3OZGA 3RTGA 2JATA 2OCGA 5LP6B 1YZTA 1QHYA 1XTPA 2OD7A 5KVSA 6ABPA 1QU2A 1RR6A 3JAKA 1H66A 2F3SA 1U8XX 3HDGA 2C2ZA 3CNEA 2XECA 3JQAB 2Q0HA 4KXXA 1UMCB 4K6FA 4MV6A 3PQDA 4YT4A 4MVJG 1C1DA 4G1CA 3ZHTA 3VAYA 1U2GC 4Q4HA 3HU5A 4L7VA 3WA7A 2AI3A 5CA1B 3TZHA 4CRWB 5DK6A 5FL7D 2KLBA 4HNRA 4LVUA 4M9SA 1N8SA 5I5EA 2JAPA 2WHXA 4FNGA 1ZJYA 1EUCB 4RMNA 2BZ0A 4RCZA 3RVKA 3EEOA 3QXSA 2PSJA 4GS5A 4CR7A 1E1LA 5C8XA 1NOIA 1XTKA 2PK3A 4P32A 1MHTA 2J0SA 1CF2O 1BE8A 1ZXXA 4P7GA 4X90A 1H2EA 3PR2B 4RLSA 4B5LA 2R5NA 2QE7D 3DEAA 3LOPA 1D04A 1UDCA 2H59A 3LK42 1AVTA 1GTG1 2FN7A 3FDZB 1TU0A 2RONA 3OCCA 3Q7RA 2F7SA 3N8HA 3JARB 3OG9A 4LE0A 4X5TA 1N1EA 1JTFA 3TVYA 3K6KA 3M9LA 3AEXA 2RJOA 3OPYB 4BMPB 4R2XA 1KEEB 5E2AA 3CUWA 1QIIA 5AK6A 2UUAT 4TV9E 1E3MA 3LMKA 1SOVA 4KE8A 4UVAB 2A0YA 2B94A 1H0SA 2ERYA 3F49S 2AYZA 3ADCA 3SZOA 2XTNA 4BGUA 4MP3A 3IDOA 1C9JA 1DBPA 4P0BA 1OEDA 1L3BA 3AKCA 2AZMA 2CKMA 3AY6A 3DDHA 4EW3A 2HWKA 4IDNA 2YZMA 3I6MA 2X0RA 1II9A 2AXQA 3KQVA 1DAGA 5T4BA 1NF2A 2HSZA 1MRNA 5THXA 3JADA 4PZDA 2ORVA 3AUXA 1DG1G 1M5RA 3OM8A 1MOQA 1KI9A 2BDEA 2O3JA 2NO9A 2VH1A 3G5AA 4GVXA 4JJEA 1V4BA 3LLMA 4LJ7A 4LRQA 4MH0R 4MKIA 4TXNA 5LA6B 3H9GA 2JBAA 3ORHA 4IKEA 5K3BA 3ZJ5A 5K0SA 2HRQA 5IK2D 2IPNA 3OX4A 3QKRB 1P0PA 2XTZA 1RZ3A 1ENYA 3GCXA 4IJ6A 5DDIP 1N4DA 1Z0JA 1W09A 1FVFA 4OLAA 3NHLA 1B6RA 3GRUA 1FP2A 2EQAA 3OZUA 5FOXA 3KTDA 1HMPA 3MJDA 4WV3A 1JZTA 2WA2A 4LZLA 2I4NA 3S6JA 3MC1A 3VISA 3CVYA 3TPFA 3O1HA 3K3QC 4AS2A 2VRCD 5DABA 4F6RA 4JDUA 3MBOA 3AR5A 4INAA 3MWDB 5FA5A 3TEJA 4Z0HO 3QP9A 4MPDA 3FSRA 3SKXA 3UUWA 4TT3A 4AJ1A 3NM6B 1ODCA 3PC6A 1HNWB 3E9YA 2VURA 1SIBE 5BT8A 2ZRJA 2DWQA 2JLWA 1DOAA 2NW8A 2VNAA 1SVIA 1MKYA 1Q1AA 3TS1A 2IGBA 3BT7A 3H2KA 1K8YB 4S2UA 1TYBE 1U2RA 1VG8A 3AR3A 9LDBA 4BQEA 2F3QA 3UMVA 4D9BA 1K88A 3FYUC 3LIIA 2OCYC 2R1TB 3FMGA 5TPWB 4ZI7A 3H2ZA 4K26A 4ZZ1A 4GKKB 3TW4A 3UHFA 7ABPA 4LK3A 3DTTA 1XHFA 3THOA 3TFOA 3BXPA 3U7EB 2I7DA 1KEVA 2XV1A 3SQXA 4UASA 4TYYA 4HNVA 3LHKA 2J67A 1YQDA 1II8A 5HIMA 3PWTA 2CLMB 4O4JA 5LB4A 4GYJA 1KP3A 2BRUA 2ZSBA 5C7OO 2NTYA 1IBMT 1MAUA 2DFKB 3P97A 5FXMA 5AVWA 4Z4FA 2P0AA 4EI8A 4EEDA 1MJGM 1T4CB 4M99A 1OZHA 5AQUB 1HURA 3CLVA 3C70A 2HADA 4KBYA 4CMBA 1WPQA 3WRXA 4LZOA 1T8PA 4W5QA 1JKFA 3AL3A 4J3FA 2VT2A 1W9HA 3AR2A 3R3VA 3UCXA 3C7DB 3UJ6A 3UC5A 2IX3A 3IAM6 1YJQA 3DEKA 4QBGB 5H70A 3FCOA 3NOOA 5MGBA 3A1FA 4MW4A 4GR5A 1R8XA 1A04A 1GPKA 2PU7A 3BHNA 3C3XA 4YP1A 3SBDA 3L6DA 2SKEA 1FNMA 3DVSX 2NYVA 3ZC1A 3L6CA 4JFRA 2GPTA 4J0QA 3I9V6 5LQRA 3QKWA 4JVNA 2GN6A 1SKMA 3K8YA 1AZTA 2PDAA 1OTHA 3OT1B 3PWSA 4QQNA 5FHQA 4DLKA 5LBMA 1CD5A 3EXIB 2FXVA 4O3FA 2QM3A 5HFNA 2QTAA 4ALJA 3TLXA 2OCIA 1SHZA 1HLGA 2YZ7A 4UE6A 4DIFA 5F7OA 2IHR1 4GZLA 1ZH6A 3OIGA 1QMGA 4LPKA 3S3TA 1PG2A 1VPEA 1Z5VA 5DYIA 3WL3A 3RI3A 2OM6A 4QM6A 3O95A 2DPLA 3I45A 2XUAA 3I4CA 5AJZA 1CP2A 1VJTA 1LC3A 2XJ9A 3E9MA 3G8BA 1NUTA 1F8YA 3MINA 3O6VA 3QIVA 5AQFB 4R40A 1GILA 1MO6A 3TR6A 3ZLJA 2DJIA 4EOGA 4DG5A 3UPUA 1NNSA 2W43A 1OIWA 5C7YA 5CFRA 5F9FA 5FWNA 2V5DA 3M6UA 3OA0A 4HQNA 5E4YA 1QPBA 4PINA 1JAIA 3M1LA 4Z91A 1D7AA 1U0NA 1ZGBA 1YACA 2QV7A 1MDBA 3ES9A 1KFJB 4H1UA 3DHYA 4KXVA 5ALPA 3AG6A 4PFJA 2IYZA 3AEDA 1H6BA 1YCDA 2WIGA 3DFUA 1PZHA 1RW4A 2XSZA 4G01B 3P0JA 2E3JA 4HVLA 1T9KA 1P4AA 1Z35A 2C0SA 3LW7A 4ZTUB 3KEOA 1FNCA 3MJSA 1D6NA 2LSIA 3MPOA 5JAHA 1U9CA 1DTWA 1WL8A 1X7GA 4KAXA 4EEKA 3ZHRA 3K1SA 1T24A 3T1YB 1RRPA 2ONYA 3O74A 2CMHA 3K2QA 5EY5B 3B9RA 4OG2A 2RHDA 5ALTA 2IV2X 1GA1A 3ZWVA 3EIXA 4MVJA 1BE6A 3U13A 4D46A 4F8EA 3BICA 3U3IA 3PEYA 1WDMA 1MABB 5D3ZA 3RPEA 2UVDA 2YKSA 5FXWA 1U0HC 2K2QB 5D51S 1WUJS 3W15B 1MB0A 3OEED 4HB4A 3KIPA 2ZYIA 1UT5A 3S4YA 4KUMB 4PZCA 3QPUA 4R83A 2IHUA 2IY9A 4P3KA 5GIOE 1DFGA 3DVAA 5H68A 4NJEA 3V55A 4D26A 3A9CA 1G7RA 1NW3A 3CLUD 3H65A 3E9DA 3V3TA 4CN4A 4KYIB 3W7BA 3I0QA 5JH7E 1PQ4A 3CZ9A 2D7CA 4EGQA 4IQFA 4G85A 4M38A 5BXQC 4TQAA 1G19A 5KYTA 3AE9A 3A37A 1KEZA 2HPAA 4EYOA 5FEUA 3N59A 2A9QA 3X2FA 4XWTA 3UV3A 1F0NA 1LU9A 1RYNA 3I32A 1N9GA 5LZ5A 1W1WA 4CM9D 2O8BB 2SPCA 4HFNA 1V3VA 1ISJA 1YL7A 1ZMOA 1ZXBA 2BMJA 2C2YA 1J09A 3IEXA 1QV9A 2H5JA 4GX0A 4UUAA 5DNEA 1Q50A 3CO5A 5KTKA 2UZ1B 2V7XA 4YREA 3OQ1A 4ISSA 4I2NA 1RLUA 1AG9A 1RFGE 3IAS1 4GXTA 1OX5A 4IIDA 5AWFC 3FOZA 4GHWA 4P8RA 5LG3A 2R60A 4P7KA 4BQRA 1MG5A 1F2DA 3AJEA 2VSYA 3R5FA 3QLJA 4X1IB 1GPYA 2P2DA 3CEPB 1I1NA 3CW8X 4EELA 2FWRA 1ZGAA 1BSVA 3NWBA 5EA2A 1P9NA 3IEEA 1OAKA 1QO0A 2DAPA 4KO4S 4P9NA 4HR7A 3HKDB 4KJXA 4HGRA 1H0HA 1RZUA 2FV8A 4I4TB 1NOKA 2P9EA 2AR0A 2D2FA 1DBVO 1F12A 3D6AA 5JAQA 1NXQA 2OORC 3ILXA 4KW7A 1FNSA 4N12A 4Q9AA 2VUIB 4C2AA 2YTZA 3FMFA 3HO8A 3ZSSA 1Z7BA 5A9TA 3CV3A 3JAEA 5HS6A 5DVZA 3NTRA 5GM1A 4ALKA 3PXAA 4XWWA 5FD8A 4CF7A 1TZMA 3T1YT 1YRQA 1QZZA 2PLFA 2FZLA 2WU8A 3EYWA 3D7KA 5FQNA 4JJGA 1DZ3A 3DE0X 4KR2A 3PCXA 1H2BA 5AQPB 2JFXA 1MP0A 3PVCA 4N3AA 4UEWA 3ZCSA 1KP9A 1OVGA 2BR3A 1FYWA 3B6MA 4IDDA 1HDRA 4U5QA 4WN3A 1LRLA 4B75A 2V7KA 5LP6E 4QKQA 3ADDA 1PEAA 1DHRA 3DZ8A 3O8NA 2NP9A 2FEKA 3IHRA 5EJGA 4FEAA 3ZQ6A 2HEGA 4YRAA 2HIAA 5FFNA 1KI7A 2W6JA 3K6JA 4ZAYA 2WAOA 3EAFA 4AMYA 1SG6A 1P72A 3CKLA 4LTNA 1VG9B 4H18A 4MITA 5CR9A 1C3XA 1FW8A 1L4BA 1LA2A 1K63A 3WV5A 5F1YA 2REXB 3P9QA 1VCMA 5LBUA 3QKTA 1WKCA 2D1FA 5B36A 4M22A 5J5CA 2DWOA 4GXRA 4IMJB 2G9UA 1WVIA 3D5TA 3ESDA 4JCOA 1X8KA 4CHGA 4FFOA 5GV8A 3M5DA 1I80A 1S3IA 1T2VA 1H8ED 2ARKA 1YK1A 2C1XA 2PX2A 2R86A 4BTVA 2V3CC 1BWQA 2O23A 4ERXA 3DMRA 2EKLA 3GEBA 3P50A 5EXTA 2FNAA 1U65A 2F1OA 4UVIA 4U02A 3ZKAA 2JGRA 3FPJA 4F60A 3VHLA 5F33A 2BHSA 4CQNA 4ZCRA 4NCKA 3EXAA 2V7IA 2AV6A 3E7FA 4QOSA 5EP4A 2DBZA 1GQEA 3RBXA 7GPBA 3GK3A 1Y8ZA 2L0XA 4EUHA 5IBCA 5SYAA 4L1KA 3QJGA 4RHXA 3IUYA 3VSBA 2P4QA 4KIFA 1PR3A 5COBA 4OQQA 2BL4A 4FHZA 1A2BA 2H2HA 1KMIY 2R8XA 4L08A 1Q83A 3I30X 2H3RA 4YP0A 1Z18A 2QVXX 3EIOA 3ZE6A 1PGPA 1VCTA 3EISA 1GXSB 2DUMA 5LJLA 2YXBA 3EVEA 3LHSA 1YJBA 3IEIA 4PVDA 5KWJA 1EWVA 3JY6A 4FZ3A 4YXWA 3P2KA 4PGGA 1GRQA 1YFJA 2R8RA 4BLVA 4CNBA 2N9UA 1T6NA 3IJRA 4ITVA 5JDGA 3T3OA 3Q8LA 2B25A 1J2JA 1Z47A 1AKNA 3HVHA 3KZVA 1HEYA 4QBIA 3FMPB 4QULA 3H8VA 3S28A 4ZK6A 5JTUA 1MO3A 1K92A 3DTOA 3CKMA 4NZZA 2VK4A 3TX2A 1YK0A 3F1LA 5IC4A 3I64A 1K75A 1EH5A 3OETA 3HLYA 1HSOA 3SZRA 1GRNA 1R37A 1XQYA 3KOWA 5AJYA 5FULA 4PN3A 2RH5A 5EC8A 5TPZA 4KE7A 3GT4A 4TYMA 2ZWMA 2DWCA 1G59A 1AQIA 5A7HA 3RYFB 1J1UA 3KWFA 3RAGA 1LD3A 3NMUF 2OHXA 1SVUA 4FC7A 4K28A 4IUBS 5C5CA 2GKOA 3LVBA 3CUYA 3GH3A 2QR5A 3MRVA 2ZBRA 3J9X1 4I1RA 4N9WA 4K87A 5B4VA 5FP3A 2NYRA 4CL8A 1XRQA 4OX9Y 2Q9QC 4YJ2E 2B3TA 3TF5A 3K0FB 3WRWA 2QBYB 1Q0QA 3I2IA 1PX0A 1UC5B 1BYIA 3RSHA 3LO8A 4IKPA 1AK2A 3F46A 3UJ8A 4YP7A 2GKSA 3OU6A 3HU2A 3JQ7B 4GAEA 2DXIA 2QN9A 2O7QA 1D5WA 5HXEA 2X5JO 1UURA 3LLCA 1N2HA 1H3FA 2QSJA 3FH0A 3L1UA 1EK2A 2YUIA 3PQ5A 4OOFA 1BGWA 4RVOA 3EEQA 3PU6A 3P1JA 4MA5A 5IH7A 1PK7A 2WJZB 5FADA 4ZOBA 4ZZCA 1MF7A 2Q6VA 2CVFA 3ZEIA 5A3JA 5AQKB 5CEJA 3JXEA 2BH9A 2ETXA 3H5WA 4MIEA 1HNZT 1R3UA 1XGKA 4ZYVA 3MIZA 4B7ZA 4IIJE 2EKBA 2B83A 1BDBA 5J47A 3PD1A 3CVXA 3OZBA 4CEJB 5AKZA 2VUSA 5HCNA 3OH8A 1B41A 4G81A 1TZJA 2BGRA 3E3NA 1KSGA 2JVJA 2O7RA 3FOWA 3FROA 3HR8A 3MYYA 4DLAA 2FWJA 2WABA 4F3YA 5LP6A 2A1TR 2V4MA 1EBFA 1XZHA 1JMYA 3EWIA 4EFNA 3AF4A 4ZAVA 5KNCD 2QYTA 3D81A 3K9BA 3RVMA 4KNVA 3URMA 2OD9A 4YBRA 2I6QA 1SNYA 2XA2A 1FMFA 4YCMA 3KV5A 3H5AA 5EJ2A 1E1KA 1ZEJA 2IIQA 3HLTA 3OQIB 5HXAA 2AG8A 2YMPA 2QTTA 3N5CA 5K5EA 4NE9A 3WLEA 5BW5A 2HHJA 2ZS7A 3X1KA 1SUDA 2N47A 2BY4A 1UMKA 1JXMA 1ULHA 1IM8A 1NYTA 1C0KA 1OV6A 3HKCE 4MAMA 4P92A 4IIBA 1HLPA 4ZAZA 1Y1LA 4JLMA 1OXBB 2ZRNA 1T9GR 3UXYA 1MJNA 2IMLA 1RQNA 4JOSA 4QYIA 4OY3A 3PU3A 2D5UA 2WFMA 4IDGA 4DOMA 3JPYA 4LCJA 1D9ZA 4D41A 5BV7A 2F64A 5GGXA 4TLDA 4IMRA 3VX4A 3SWWA 4B1FA 2C99A 2LIPA 1I2DA 2V74B 4HWPA 1NEKA 3AXJB 1E4EB 3PNQA 1ECFA 2IE0A 3OJ0A 4IXNA 5TC4A 1WXGA 5KJ1A 3CH4B 4G0XA 5EWLA 1U5PA 5FF9A 3WIDA 2BKXA 3OJCA 3T7DA 3MT7A 4IE0A 1ZVKA 2XQYA 3B3FA 4OB8A 1K9VF 1Y8QA 2IWHA 3GPCA 2DT8A 4GO1A 2H2FA 3A9SA 1RS0A 2C7VA 3MOSA 1CQWA 3I1AA 2IKQA 2WF6A 3GHHA 3AR8A 4JELA 1L5OA 4JT4A 5M04A 3ONNA 3S2FA 4ONEA 4F84A 1BGVA 4QBTA 5CNJA 2O2EA 3AAIA 3MCWA 1S2OA 3H4VA 2X9HA 1TLLA 1UWVA 1PDWA 1E9AA 3CUTA 3ZYMA 3NWEA 3DEHA 2C4TA 4MW0A 2P6PA 2O6LA 3W05A 4QUDA 4N5MA 2FLWA 4RESA 5LP6C 5JFTA 3HVJA 4B6PA 1EFDN 1XZCA 2IXGA 1ZH0A 2POQX 2XE8A 2WU2A 4HLUC 3AVYA 2YX1A 1QHEA 4IZIA 1IDN1 4DSNA 5IYZB 3VSEA 2Q3DA 1WU8A 3ZT5A 1FUEA 3L8HA 4KQ1A 3V5UA 3LGXA 3O3OB 3TSYA 4LF5T 5KC8A 4PWZA 5IZCA 2JK0A 4JK3A 2ZR7A 3N2ZB 4U6QA 3SVTA 3FZKB 3GFQA 3JD0A 4WACA 4LZPA 4CG0A 3OFND 1CK4A 3W5HA 1WCWA 2HY7A 4Q24A 1M8JA 4Q4JB 2GJ4A 1Z4IA 1VMKA 3PE3A 4GVLA 3TQSA 4B32A 2QX7A 4TWRA 3B6EA 3DL7A 1OFIA 3RIEA 4NHEA 3IH5A 3U4IA 3VMMA 3VMFA 1JH8A 1ONNA 2CLSA 2V59A 2E9XD 1II0A 3DP9A 1NN5A 1PQWA 5FUBA 3UJ3X 1PDVA 1L4GA 3QX8A 4TKZA 5JR9A 3OZ7A 1M2GA 1QAMA 2G8NA 4UBJA 5CW2A 2QYSA 3THWA 5K0NA 3OD1A 3ER6A 5HWSA 3QMVA 3HGTA 3FWHA 3R0XA 3KR9A 1JMVA 1Z8HA 1Z39A 3WGMA 3GOHA 4M21A 5F12A 3OJOA 1U3UA 2F9LA 3ODGA 3TTXA 5KS2A 2CMKA 1XNJA 1Z5UA 5ANRB 3NGLA 3QUSA 3WVNA 3HL6A 3ADBA 1G38A 2IPOA 2YBDA 2O3TA 2RPAA 3R4VA 4HDAA 5LXTF 2OUKA 3FCYA 4ZYLA 5D3QA 2WDVA 2M6RA 1E92A 1BOFA 1NW6A 1RADA 4TOIA 5CM2Z 3EPLA 2QN2A 4X60A 3N5LA 3LFHA 4LZZA 3R6WA 4QATA 4RK1A 4X64B 1ORHA 3NYQA 1JYEA 2QZ4A 3KB6A 3IOMA 2CK3A 3CX3A 2P62A 1P81A 4A5SA 5HQJA 2GYYA 3H86A 1U1FA 1FOEB 1IM5A 2LGJA 5LHGB 3ZMVB 3GCZA 3ORYA 4M7OA 4NE2A 4OBXA 4YCJA 5KWIA 4ILKA 2XQ7A 1W25A 2V45A 3BL5A 4QE3A 4X44A 4JUIA 3QVKA 2QAJA 2WJ6A 1QRAA 1D03A 3GPIA 3C6ZA 3RFXA 3JQ9C 3SF0A 1H9CA 3ENWA 1Z25A 2HV8A 3ZT7A 2HEIA 2JFUA 3HJGA 1U11A 2P3OA 4LRUA 4AP9A 1RLOA 5JS7A 3V8MA 5HPYB 1XWFA 4ZI3D 4JYCA 4G8JA 1HZJA 2ZE8A 3GGGA 1RC8A 3PQFA 3VDQA 1SHKA 2OBXA 3CN9A 4H1TA 5E9AA 2EFEB 2XQJA 4A1OA 2RGXA 4BOYA 3A6PC 5FBKA 5E6UB 4Z9AA 1ZRHA 4ZREA 1DB3A 2JIWA 2NP6A 4A8PA 2PS1A 3O8DA 3BUSA 3MXZA 2FH5B 4BVFA 4DTCA 4AX4A 5JARA 3WGLA 3U5ZB 2HMWA 3VR5A 2I3AA 4E46A 4EJMA 5A5VA 3G06A 4JT9A 4DR6B 2H7VC 2OSVA 1FE8A 1WD7A 1ZUIA 1OI7A 5F4ZA 1RYDA 3ENZA 1E7QA 1BRTA 3LXUX 4GR4A 4MARA 2R47A 4LA4A 5EMJA 4RTLA 3UT5E 2QQFA 4FXPA 1D2AA 1P9RA 2YDXA 3ZH2A 4KXNA 4CQLA 1J7JA 1Z6XA 3NATA 1EUQA 1VB5A 2JEYA 1AT1A 2Q9CA 1H9BA 2VL0A 5ALUA 1WEHA 4XCVA 2FPGA 4A9AA 2ZJYA 5HP4A 3QEMA 3VR6D 1EGQA 2R1ZA 3FVTA 1ZJJA 2O8BA 5H3HA 1ZYUA 4CKXA 3B89A 4D98A 3DA8A 3UXEA 3ESYA 3L8GA 4Z4EA 4L9AA 4BKPA 2WYUA 5I8PA 5A3VA 4W1QA 2HF8A 4IGKA 1C8LA 2BFOA 4BUZA 3LSTA 3RIFA 2Y4OA 1NXOA 4QXRA 2ZTUA 3K9NA 3KVRA 1L5HA 1J25A 5TR9A 2KE5A 2OGZA 4U7JA 3BMCA 3TXYA 3ZHXA 1GTVA 2EV9A 1K0UA 4EW1A 5J43A 2W0GA 3U3MA 2Y67A 2C9MA 4LCBA 4B6QA 4E2YA 1M8FA 1G21E 1RCFA 5B12A 1BRMA 2P6UA 3SFTA 1K0FA 4BKQA 3K4HA 1CJUC 3U3RA 5ICGA 4WJKB 2YINA 1R0LA 3WOHA 2EC5A 1IBKB 3X1YA 5JCOA 2HA2A 3R3JA 3AI2A 1X8JA 4GOND 4U7FA 1G291 2QQGA 3TKAA 1E0JA 3NHWA 1ZM7A 2CFCA 2WR8A 4D9JA 1FVHA 1IN8A 1Z15A 2ACVA 2I55A 4MRMA 5DGXA 1HETA 1OY1A 2BVNA 1D1BA 4LJRA 3F8WA 1NUAA 4F4UA 3FYDA 1UEXC 1UJ4A 2QI9F 4V0QA 3DLTA 1EXWA 4LMAA 4CM7A 4DPMA 3IIMA 4DARA 4Q7LA 5HJ7A 2J3MA 1VTKA 2B30A 3F4LA 4G8BA 4PAQA 4DWVA 3GNSA 1PZXA 1VHJA 1H0RA 2GK6A 2V6JA 3O93A 4PBRA 3BJZA 4CEHB 2QN7A 3NGXA 1T5LA 3AUUA 3CNHA 4L8YA 3SIWA 3E84A 3U3XA 4WXPA 4ZVLA 4AN0A 1OWMA 5AK3A 4YCNA 2QVLA 2BVMA 2IEZA 3K8OE 3QYJA 3IPRA 1J49A 1F6BA 2CJWB 3D4BA 3O0DA 4QUBA 2H54A 4CTKA 1WXHA 4JQSA 5LJMA 1GKYA 2P2SA 1VZ2A 3TR0A 5ELXA 4HAIA 4UZFA 1QZTA 1T25A 4HPJB 4YHJA 4Y1GA 4RVHA 2TS1A 4FDLA 1RAIA 4X45A 1QH8B 4WXRA 1TQHA 4WZXA 1MOZA 2EFCB 3ZV7A 1D9XA 1ZGCA 4EUKA 1SO8A 3KQTA 4BV2A 4DPKA 2WF7A 3ICVA 2WTNA 2YS6A 3KQPA 5TMDA 4IDPA 2IEDA 1X15A 4OOEA 4OYKA 2ES4A 3ZNQA 1O7JA 3RG2A 3DFMA 4MKZA 5DLEA 1M62A 1TA9A 2WE8A 4D92A 2WWUA 3OIFA 4QWNB 4HB0A 2H1RA 3WDLA 3ABQB 3MEQA 4JJIA 3ZY2A 1FQJA 3KWJA 4J1SA 5J63A 1IZZA 1XCBA 2VHCA 2ESRA 1RDFA 3IHWA 4EG4A 2XJ7A 2GF0A 1NX6A 2J9GA 2W6ID 4KQIA 1HK7A 2BLLA 4KTVE 1J56A 1UOQA 1GUYA 2V8SV 1NMYA 1FSPA 5SZKB 2ZUSA 3RYTC 3EDYA 4FCTA 4L2IA 3ONVA 2C5HA 2FSPA 3QEMB 1EZ3A 1MTOA 1QZXA 4QDKA 4MEJA 2PR7A 4Q5IA 1NN3A 5FBLB 1CDOA 2ZM5A 4DV0T 4XA8A 4OQFA 4YP5A 3IXLA 1Z0PA 4HH4A 4ZZBA 4MWCA 5JPCA 4GOOD 4FMPA 4K9PA 5EKDA 5D2CA 4NFYA 3QGMA 4H2DA 1L5RA 3KT3A 5MFPA 4ZEOA 1Y8CA 2I6XA 4JLUA 3VNRA 2I91A 3PE4A 2B78A 2P75A 1TXGA 2OWEA 4WZAB 5FO0A 4A36A 1U1GA 1Q0ZA 4B4WA 4K6MA 4U31A 3QPDA 2LM9A 2W67A 4R1NA 4A7PA 4M53A 4FNOA 5ECDA 2OAEA 3JWPA 1GAXA 2D5LA 3O8OA 3UWPA 2XCIA 5EE9A 4EHKA 4HAOA 1EVZA 3QNMA 4YAOA 1LLFA 2OBBA 3TOXA 1AC5A 1NQUA 1T0IA 1EUCA 4R8VA 2DX7A 5KMGA 2IYEA 3BWDD 2G25A 2C4UA 2NO5A 4TXHA 2OT3B 1NLMA 1YD8G 3P2OA 3U62A 3I8OA 1E0KA 3RROA 7ADHA 2C2OA 1JPVA 1UX4A 1T0UA 2J3IA 3D3EA 4WZAA 4F21A 5KQLA 5CT9A 1G9XA 1KF0A 4DR3B 1QQ5A 1XCPA 2B7CA 1HE1C 4J7CA 4MW6A 2VOEA 4WOPA 1ZG3A 2CB9A 3L06A 1T1GA 1FRVA 2O20A 1QGAA 4HFRA 1XD9A 4FUQA 3V8BA 4NJMA 2J48A 2Z98A 3BFKA 2WM9B 1K8QA 1O8BA 3JAKB 5CDGA 3PX2A 1JHXA 1KFEB 2ATCA 3CLUC 2GUWA 5AKEA 4IWYA 3PPYA 5B6IA 4MLKA 1L6IA 2UYOA 4LHYA 1WXIA 1YBVA 4ASUA 2ZAIA 3LM8A 4MO9A 2XRYA 3VGJA 4B6RA 4E3WA 4EI7A 4QXOA 2DH5A 1WNFA 2G4LA 1QHXA 3NTOA 1QCZA 1D2MA 1KNXA 1X2BA 2XUGA 3HYNA 4BVGA 4WXEA 2JLSA 4IVQA 1DBWA 2EKZA 3FSJX 4PBSA 5LIPA 3OPVA 3L8RA 3ESXA 2Z1DA 1CZNA 1V9CA 1PYOA 2BFFA 2QPTA 1ZXLA 2LSKA 4UELA 2Y77A 3E9QA 2GM9A 4PC7A 4RD4A 3ZCPA 2DOKA 4C0XA 2YMLA 4FOSA 3OTIA 2DKNA 2ZG6A 4LV8B 3HKEE 1UBGA 3MCUA 3QWIA 4TPKA 3UJCA 3AI7A 5JXGA 2ODTX 4PW8A 1GPBA 3D0OA 1T3HA 3D6FA 3H5LA 3V7NA 4DUZT 3I52A 2NWBA 9ATCA 2J31A 3D9QX 1NPDA 4X94A 2HXSA 5JQGF 1OGYA 3TL2A 5KYXA 1BFUA 4G5QA 5JS2A 1ESNA 5EZ5A 2YRWA 4HVAA 1S2DA 1F8UA 1SPBS 4G0PA 3R9KA 5DHPA 3WKBA 1SXPA 1VLQA 1KRWA 2IJGX 4RD6A 4JB0A 3DO6A 3AU9A 1G5IA 3I42A 1PHPA 4QH5A 4ZOLE 1GTL1 1HMYA 2J8ZA 3HHPA 4N0PA 3C7AA 4IAOA 4RKEA 3N58A 5KOHB 1E3WA 4LWPA 3GEMA 3KTAB 2D59A 3A2LA 4F8YA 5DGDA 1DT5A 2H2GA 5IYZA 4PSDA 1C9DB 1XZFA 1T0JB 1Z68A 1XAIA 3PDWA 1A76A 3IEPA 3ZNNA 3GDWA 1UPUA 4LJ4A 3DE2X 3TB4A 4IVNA 1HX8A 3IDFA 1NE2A 2GI4A 2P9HA 2PH5A 3DQQA 3OCXA 4MMZB 3R7LA 2IUFA 1PJ2A 4PG7A 2XGMA 2DFLA 3KJHA 1JZQA 3WL7A 1OXVA 2GMWA 1NAFA 4QWMA 2XE7A 3TFQA 3MWYW 3T7EA 3SE7A 4ZJZA 4OLHA 4PTZA 3H11B 5TMEA 3X2SA 1WZ2A 4RHUA 3MD0A 1WULS 4YAEA 1AHIA 3WQRA 3ZV5A 1AMOA 3E7DA 3ONWA 1X1DA 2L17A 1P4HA 1CV2A 1RKUA 3W8DA 4D81A 5A62A 1GQQA 4PRLA 2V6YA 1TDJA 2A33A 3HFGA 1QX4A 3L1KA 3JQ8B 2BTQB 1C1XA 2J07A 2PGLA 5AH0A 4AYTA 1YRBA 1NHGA 1CDEA 4NMWA 5EWLB 3TLVA 2FSVC 1W49A 2FJUA 5DASA 5EFOA 3LGSA 4XQEA 1JIVA 4GI7A 1NM5A 1Y1PA 3CW2A 4GM1A 2A94A 2J6HA 2AFHB 1T29A 3RIYA 5F77A 2POCA 2ZI6A 1ACMA 1MT3A 1W4AA 2YHIA 1DC3A 1SULA 1YRHA 2JAHA 3RC7A 1QPGA 3WLKX 3U19A 3F78A 2RBKA 1O57A 1YQ9A 1RYZA 2DPGA 5K8VA 1E7RA 1N5OX 2XEDA 1YU6A 3DBLA 5DSZA 5I9NA 4ZWNA 4HDSA 4UQOA 3BMOB 5CVVA 3DF7A 1OYWA 1JA1A 1YSCA 1MVLA 3HR0A 2FQ1A 3PUVA 4NV3A 3CX6A 4O63O 4EFMA 5HJEA 1PK8A 1SHLA 1QVZA 1G3IA 2AOVA 1A9QA 2GBLA 1SWVA 2VRWA 3EBPA 4JY7A 5DHSA 1ISIA 5FBRB 4QOJA 3T5MA 1Y7HA 1YGYA 4YDSA 3CF6R 1QO7A 3F8TA 1VYTA 3O3CA 3OLWA 5H4HA 5FIUA 5LC1A 1Q7EA 4HWCA 1CZUA 4FKZA 4KWIA 4X3CA 1XQWA 3KVNA 4ZVPA 3ONXA 4DY6A 3EVNA 4B3IA 2MOZA 2YQZA 4WXMA 1L1EA 3N75A 2GK9A 1YNSA 2Q2QA 2W2KB 1BEUB 3D6VA 3D0TA 2FN4A 1VL1A 1E9SA 4LY3A 4QX6A 4RGQA 4D0LB 1Z45A 4TZ6A 2IYLD 4K0RA 4RLQA 3P4WA 4W9NA 4FZ5A 2Q62A 1HG0A 1XCMA 1NXTA 2YC2C 1JSCA 3KJEA 3I9YA 4O2BA 3PUSA 4TTQA 4C89A 5BR4A 1Q0RA 3I0OA 4Z1MD 1L9KA 5BQPA 4DV2T 5HDQA 1R0KA 4OHFA 2IHYA 4X6YA 5ALRA 1XPJA 4GI3A 1Z33A 1YOVB 2OXEA 5ALMA 1KY2A 3W2FA 3WIOA 5ISMA 2E18A 4L5JA 5HK9A 2E6KA 2WWHA 4EKEA 2B92A 4QA9A 1UOPA 2R2GA 4XFJA 3RFTA 2VAXA 1MZVA 4DDVA 3NT2A 4ZVKA 2WUWE 2H16A 2OAQ1 3VR3D 1HG1A 3FPHA 2WKPA 4OU4A 3ETGA 2K87A 1UFVA 5F73A 2VOJA 1TM7E 5IWAB 1MJGA 5JC1A 3AVOA 3CZCA 1UKYA 4L0CA 3JASA 4BNGA 3QUJA 4F3RA 5JDCA 4EYUA 1BHJA 2V7EA 3GLGB 4D8TA 5C7IO 1GKLA 3AXJA 1E4EA 3G9QA 3UKOA 3C5HA 3F31A 3GG2A 3JQBC 4TLAA 4XUDA 2CFOA 1RVDA 1P73A 2C78A 2VYVD 4B09A 1MXFA 2GAAA 5JEEA 2HN2A 3TTSA 1VL5A 4UTOA 3I92A 3R7AA 4S1OA 1D6MA 5DN9A 4ZT6A 3SLRA 3G2OA 4WK4B 2AR7A 1A5SB <