4OHFA

Crystal structure of cytosolic nucleotidase ii (lpg0095) in complex with gmp from legionella pneumophila, northeast structural genomics consortium target lgr1
Total Genus 159
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
159
sequence length
461
structure length
455
Chain Sequence
b'KVFVNRIINMRKIKLIGLDMDHTLIRYNSKNFESLVYDLVKERLAESFHYPEEIKKFKFNFDDAIRGLVIDSKNGNILKLSRYGAIRLSYHGTKQISFSDQKKIYRSIYVDLGDPNYMAIDTSFSIAFCILYGQLVDLKDTNPDKMPSYQAIAQDVQYCVDKVHSDGTLKNIIIKNLKKYVIREKEVVEGLKHFIRYGKKIFILTNSEYSYSKLLLDYALSPFLDKGEHWQGLFEFVITLANKPRFFYDNLRFLSVNPENGTMTNVHGPIVPGVYQGGNAKKFTEDLGVGGDEILYIGDHIYGDILRLKKDCNWRTALVVEELGEEIASQIRALPIEKKIGEAMAIKKELEQKYVDLCTRSIDESYDQEIHDLQLQISTVDLQISRLLQEQNSFYNPKWERVFRAGAEESYFAYQVDRFACIYMEKLSDLLEHSPMTYFRANRRLLAHDIDILEH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytosolic IMP-GMP specific 5'-nucleotidase
publication title Allosteric regulation and substrate activation in cytosolic nucleotidase II from Legionella pneumophila.
pubmed doi rcsb
source organism Legionella pneumophila subsp. pneumophila
molecule tags Hydrolase
total genus 159
structure length 455
sequence length 461
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05761 5_nucleotid 5' nucleotidase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1160 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4ohfA03
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 4ohfA01
3A1CA 1WR8A 3L7YA 4MWOA 3L5KA 2RAVA 5AI4A 2I7DA 2YJ3A 1U7OA 3KD3A 5IT0A 3FZQA 1Z4LA 2R8EA 2W11A 2C88A 3TLMA 4F71A 5ALYA 1RDFA 3QUBA 4O8CA 3WGUA 3AR7A 5AW8A 4YIKA 3U7GA 3PGVA 3FVVA 2AMYA 3ED5A 3SKXA 4Y2VA 4BNDB 3EF0A 3RF6A 3NIWA 1O08A 4YIHA 4NFLA 5E0OA 2AGVA 4EELA 4MUMA 2HCFA 4HGRA 3DAOA 5AW5A 5AI6A 2ZBDA 4ZEWA 2QLTA 2OYCA 1PW5A 4DFDA 4BNDA 1ZD2P 2YY6A 5AVRA 2C8LA 4Y2YA 1L7PA 3R4CA 2G0AA 5ALZA 3I28A 1RQLA 1ZS9A 3OCYA 4Y3UA 5AM5A 5AI8A 5AW2A 3AR4A 3NANA 5AM1A 3MC1A 3SD7A 3WK4A 4UARA 3NRJA 1ZD4A 2FDRA 1RPZA 1Z4JA 3QX7A 5AKIA 3L1VA 3KOOA 2ZG6A 1Y8AA 3F9RA 5ALDA 3K1ZA 5AIAA 1RLTA 3PDWA 4EZEA 2EATA 2WF5A 5AM0A 1MH9A 1U2TA 3HLTA 3U7EB 1FEZA 3WK7A 3ZUPA 3MPOA 4NWIA 1TJ3A 2G1AA 1XP5A 2G08A 5AKJA 3SMVA 1LTQA 3MMZA 3OCZA 3PGLA 3U19A 2OA0A 2G80A 2ZBFA 2YJ5A 3ZWKA 3SKYA 1T9ZA 4L6AA 1YNSA 4IG4A 2YJ6A 3KC2A 5AI9A 5ALLA 2JGAA 5AM2A 3SHQA 1JUDA 2HF2A 4C4SA 1SWVA 2C8KA 3WK8A 1QQ6A 2P69A 3CNHA 3AR9A 2W43A 3QUCA 4UMDA 3CZ4A 2B1QA 5AM4A 5ALHA 4C4TA 3W5CA 5AVYA 2B8JA 4G9BA 4HGQA 1CR6A 5AI5A 1QQ7A 1N9KA 1QYIA 2PKEA 1J97A 2I54A 2NO5A 1WPGA 1RKVA 2HOQA 5IT4A 1O03A 4NABA 3KZXA 3W5AA 1EK1A 2IOHA 3L1UA 1TE2A 4YCMA 5ALIA 4IFTA 2ODAA 3N5KA 2NYVA 2PR7A 1ZD3A 3PCTA 5AW3A 2FI1A 5JJBA 2RB5A 1Z4OA 4XE5A 2FPXA 2FUCA 3N8GA 5AK4A 4XOUA 3S6JA 3L0YA 3ZTYA 4L57A 3WK6A 5ALPA 3ZWDA 4AP9A 4ZEVA 3ZW7A 3ET4A 5ALGA 3E58A 5AW4A 2YMLA 4OD0A 5ALOA 2B0CA 2FEAA 1Q92A 3QU2A 2BDUA 3ZVLA 2P9JA 1CQZA 2X4DA 5AVQA 2B30A 4RETA 3E84A 3DV9A 1KYTA 4UAVA 1L7NA 3D6JA 3QU5A 4I9FA 4UMVA 2CFRA 5ALEA 5AI0A 5ALTA 1YS9A 2IOFA 3B8EA 2WHEA 4C4RA 5ALFA 3AR6A 5AW6A 3L8EA 3ZVNA 2RARA 3NASA 2FPUA 2G07A 2FUEA 2IYEA 3L0BA 2YN4A 3AR5A 4BX3A 4UU0A 1Q91A 3N28A 2C9MA 3A1EA 1QH9A 5AKEA 1RQNA 1N8NA 3WK5A 3QYPA 5ALXA 3L0CA 1SWWA 2HDOA 4YCNA 2HHLA 2WF6A 1L6RA 4AS3A 4DW8A 4HGPA 4BX0A 1Z4IA 2RBKA 2FPRA 5AICA 4EEKA 3U7FB 4HGOA 3UMCA 4EX7A 3QNMA 1Z5GA 3N1UA 5T41A 3WKBA 3ZU6A 3B9BA 3M9LA 2GHQA 1RKUA 4UW9A 4Y2PA 2GO7A 2I55A 2WM8A 4UU1A 4ZEXA 2Q4TA 3R9KA 3NAMA 5AW1A 2IOFK 5ALVA 4BBJA 1VJ5A 3W5BA 2NO4A 5AK3A 2AH5A 3KDPA 3FPSA 4KX3A 1ZRNA 5FP0A 4Y2XA 2OM6A 4Y2SA 1T5TA 3WKAA 2B82A 1X42A 1Z4PX 1S2OA 4DCCA 3HYCA 3IJ5A 5AK6A 3I1YA 1TJ4A 5AKGA 1RLOA 3VAYA 4Y2UA 2FPSA 1T5SA 4BKMA 3U26A 3AR2A 3ESQA 2O9JA 1Z4NA 2HX1A 3BA6A 3DNPA 3OTQA 5AK5A 3MN1A 4UMFA 2GHTA 2GMWA 3ESRA 5ALMA 5ALWA 1RMTA 2PQ0A 4KNVA 4KNWA 3RFUA 5A3SA 4CF4A 4H1WA 2Q4RA 1Z88A 5IS2A 4UASA 5ALUA 2WF7A 3A3YA 5AVTA 1NRWA 4UMEA 1F5SA 2DQSA 5AKYA 2G06A 1VJRA 4JDPA 2Q5EA 2JAOA 2GFHA 2OBBA 1NNLA 3J7TA 2C4NA 3QLEA 1S8OA 5AESA 4F72A 1YJ5A 3WK9A 4J2TA 3QUTA 2YMQA 4QQFA 1NF2A 3N07A 2JAWA 5A3QA 4FYPA 4KYTA 4G63A 3R09A 2YMPA 3IB6A 3ONNA 3M1YA 2BY4A 3WKEA 2WF9A 5AVUA 2WF8A 4Y2RA 4AS2A 2VKQA 1Z4KA 1YMQA 2ZBGA 1L7OA 2QYHA 4CF5A 4B6JA 2P27A 3IRUA 4BYGA 3WGVA 3I6BA 3EWIA 3OPXA 3OCUA 3W5DA 3SLRA 4PNHA 2I33A 2WFAA 3FGOA 4Y2QA 3NALA 3EF1A 5AVWA 1VFPA 5AKXA 2MU1A 3U13A 3SF0A 2B1RA 4BEWA 4YGYA 3OCVA 1U2SA 2YFYA 3UMGA 3KBBA 3ET5A 1RKQA 2HEGA 1TJ5A 4GXTA 5AM3A 4JB3A 1LVHA 2HF7A 4HAIA 4E88A 2ZBEA 5AVZA 4NAVA 1Z4QA 3WKDA 3AR3A 4GIBA 5AKHA 4J03A 5ALJA 3GYGA 5AW9A 2P11A 3FM9A 4UAUA 3OCXA 4KX5A 2YMMA 1ZRMA 1ZD5A 3OCWA 1RMQA 1Z4MA 3UMBA 4CE6A 4DWOA 4OFZA 1K1EA 3QUQA 4CNQA 3B9RA 4BEVA 2FPWA 2YJ4A 3L8HA 5ALKA 5AVVA 5AW0A 3U7HB 3E81A 1XVIA 2YBDA 1ZJJA 3DDHA 2MSNA 5AIBA 3A1DA 3ZI4A 2ZOSA 5AHXA 4EX6A 4BX2A 3QGMA 5AKZA 3ZX4A 3AR8A 1TA0A 3NUQA 3BWVA 3UM9A 1YDFA 2ZXEA 5A3RA 2I34A 2R8XA 3QU9A 3E8MA 1AQ6A 1RLMA 5AW7A 4EENA 2AUTA 5ALSA 3L8GA 1WZCA 2G09A 4UATA 5AVSA 4UM7A 4RESA 4Y2TA 1RRCA 2CFSA 4CF3A 2BDEA 3QXGA 5AVXA 1L7MA 1U02A 2CN1A 1U7PA 2D2VA 3I76A 4KN8A 4NV0A 3ZTWA 4YH1A 5AKKA 2HSZA 4OCZA 1Z5UA 1ZOLA 2CFTA 2EARA 4FFDA 1L8OA 4OHFA 1IWOA 1WVIA 4UM5A 3FPBA 1RMYA 2JAUA 2B8EA 1XPJA 4FE3A 1L8LA 1RC8A 1J8DA 2JARA 3EPRA 3P96A 3L8FA 4XPZA 2EAUA 4Y2JA 4XQ0A 3ZVMA 4I9GA 5ALQA 1QQ5A 2R8YA 1YV9A 3QU7A 2IA5A 2W4MA 4L6CA 2I6XA 5ALNA 3QU4A 2R8ZA 4QJBA 4HYTA 3WKCA 4YCLA 2HO4A 5AKLA 5ALRA 2O2XA 1EK2A 1SU4A 4HGNA 2HI0A 3ZX5A
chains in the Genus database with same CATH superfamily
5HZGA 1VGVA 2HTFA 4Q1EA 5ABFB 5DMHA 1GL6A 1JI0A 2R8EA 4BNKA 1BVRA 1H8HA 4V0KA 1BN7A 1QFYA 4LQCA 2V9ZA 1CB7A 2D2EA 3TF5A 1E9RA 2QLTA 4J9VA 1YQUA 1DFIA 1FNSA 3I28A 4RXUA 1YE8A 1U0RA 1IDN1 3AEXA 5CT5A 5IW8A 3ROFA 1VJTA 1QXSA 2JLUA 2FDRA 1WA5A 3U16A 4FDAA 5L3SB 4QM6A 5CA0E 4Q4HB 1AQUA 1FFDA 3TL6A 4OQMA 3MIIA 4CI1B 3F6BX 1A71A 5MGBA 2YXBA 3EGEA 3NWOA 3HCOA 1XMJA 2RP4A 2AW5A 2DFPA 5KYTA 4C7OB 4C4TA 4EW2A 4FPXA 3RC1A 3ZVRA 4HF7A 1KZGB 3VU3A 3U3DA 3KHSA 4J91A 4TZ6A 2EHDA 4KR2A 1NBHA 2WSSA 1I4LD 2MPKA 3GLIB 4R0VA 1H6BA 3BWMA 2HUPA 2D5AA 2UUPA 2OPHA 3QKRA 5FO1A 1NT2A 1P0IA 2PT6A 4IQ8A 2W6JA 2PZLA 1WZNA 4I9FA 3CX8B 1GZ4A 2XUQA 2I2FA 1QANA 4FGJA 2CLHB 3WWEA 2UZIR 4V0LA 1BDIA 4OQFA 3H04A 4MYUA 1Z39A 1TCUA 3K9LA 1LSOA 3DTNA 3U7FB 4DVDA 2E21A 3LA6A 1V95A 1HNWT 2H11A 5DXAA 1SZJG 2ZRLA 10MHA 4YECA 2RI1A 4XX0A 3VYTB 3RYIB 3MJEA 4OYYA 5HIMA 1XRPA 2ZUTA 1QU3A 3FPSA 3NBMA 4P38A 3NT2A 2NPOA 1L7RA 2WU0A 4A82A 4BO8A 2OEPA 4ON9A 1W88B 2QVXX 2NUAA 2IEIA 2GEBA 5KUTA 1L0BA 3HM2A 4D42A 1I2DA 4HD8A 3LUAA 3PYXA 2C5IT 2H5LA 3R7BA 2PXHA 5LP6F 2VAVA 4I4TE 3UQZA 2OGSA 4JYAB 2J67A 1P1FA 5D5HA 1MORA 5BSGA 2MAWA 1U7HA 1K8YB 4KH1A 1OBHA 3JRWA 4NTZA 1KMQA 4D81A 4GXNA 2E1PA 2PH7A 4OMFG 2C2KA 2WWHA 3E7XA 1TZMA 1M66A 3AKCA 4C6RA 1UFQA 4M0PA 4OF4A 1R0SA 4HNSA 4HWKA 2AC2A 2QM0A 3U7RA 1CYDA 3QY0A 4U39A 2GTIA 1KH1A 3SPXA 5BRAA 2Z57A 1POXA 1UGOA 3HDQA 5FWXB 3KAKA 3NNNA 2QRJA 4JK3A 2EQAA 3DZFA 3AR3A 3MQFA 1PJTA 2F9FA 4E94A 2YKSA 4J94A 4DSNA 4S24A 3SP1A 1CULC 1Z12A 3JASA 1UPAA 5J59A 1USUA 1SA0B 2XD9A 3JPWA 1O9GA 4DMMA 4Q4JA 5ALSA 3OTOB 3FGNA 2OORA 3IUEA 3TRKA 4WUVA 2AN5A 3HCCA 1WTAA 4ZVOA 2ZYUX 4BVEA 4EHBA 4DR1B 3GJYA 1L8OA 2WP8J 1WF6A 1XTZA 2JJQA 1LCIA 1RC8A 2JARA 3UJ8A 3CX3A 3IAM1 2HRRA 4CLRB 2IQIA 1SBIA 1WCXA 5FI5A 3KU4A 1NC3A 3JALA 2KS6A 3MAJA 3FFWA 2JK0A 1WDKA 4G0WA 1D6NA 2MYTA 1P2UA 4DPLA 1BS2A 2WB4A 3QVLA 3PUGA 3ILYA 4JXZA 1YQDA 3SBXA 1AXGA 1C0LA 3UOWA 4KV9A 3WGUA 4BLVA 1M1YE 4OBEA 1UADA 3HJTA 3PLAE 3U7GA 4I4CA 4H7HA 4GZ6A 3D7MA 1LLCA 4M2LA 2IU3A 1U90A 2BKPA 1E3LA 2R8OA 3TNFA 3KLOA 3V2UA 2FEOA 2Y1DA 4G5FA 1R27A 2JLZA 1S02A 4DFDA 4KODA 5KAMA 1R4NB 2D1FA 1W2HA 1DBSA 4FFMA 5GQSA 3ZNNA 4BKRA 2VKHA 4TSRA 3O75A 5BNTA 4HVLA 1WUHS 1DCMA 4CN1A 1V11B 4OY3A 3CBQA 2X77A 2IEBA 2VT2A 2DCFA 1NI3A 2EATA 5K0TA 1GTZA 3G88A 2WWTA 3DZCA 1RQGA 2PD6A 2F7SA 4BMDA 3EVBA 4YT5A 4H7DA 1QLHA 4AZSA 5DGDA 3N7UA 2HF2A 2E82A 1G64A 4FFOA 2UXDT 2FZEA 3WK8A 5CEJA 1E98A 2A1TR 1MVLA 2EBFX 4UMDA 4QT0A 5EERA 1XYYA 3PEEA 1BGWA 1YHYA 4BJ6A 3I04A 3OPYA 2QQGA 4Y9SA 3IHTA 2C7PA 2QBYA 1NY5A 1OH8A 1GCAA 1GGMA 3ZDDA 1KO4A 1E18A 4EF4A 2OR3A 1FQKA 2IUFA 2P1ZA 1WBDA 1VL1A 1ZEJA 1K68A 1G4HA 3L05A 4O4IF 3LCVB 4DOMA 3K1JA 4KXWA 2DQYA 3JY6A 1ZRSA 4HOYA 5CB4B 2D0DA 4GBGA 3PSAA 1O6FA 1XLWA 4BNMA 2BFOA 2B25A 2GFQA 4ZZCA 1JS1X 4R0NA 1V6AA 5ALXA 5LD2B 4UDYX 2C1ZA 2X14A 4FOPA 2CKDA 5CXXA 1QHYA 1ZNXA 2ZE8A 3WNQA 2ZUBA 1BIFA 5M5BA 1QGUB 1A9TA 3H5AA 2J0VA 1T9CA 1ADYA 1P1BA 2OY0A 2JF0A 3ZBTA 2PWPA 1P7PA 1JQ5A 1G63A 2MINB 2GZMA 4ZYZA 4DVJA 4RA6A 4DE5A 1EESA 2REBA 2QJRA 3OA0A 4JP2A 3UFBA 1PJCA 5IS2A 4GSYA 2AI3A 1IYZA 4I55E 1SIBE 1I2BA 1XU9A 3HCFA 1G7RA 2I78A 1YL6A 5IMBA 2FFAA 3E5MA 1CRLA 1UBFA 5C3JA 1HRKA 1WD7A 2CPTA 3WBKA 2QRGA 1R9GA 2UYYA 5AOAA 5HIKA 3DAFA 3PR1A 2DBRA 4CZ2A 1YMQA 3D7LA 4KIJA 4ZOBA 1MO4A 3MIZA 3FMGA 4PPNA 2OILA 1PR9A 4ZVVA 3RC9A 2HSGA 1IIBA 1T0UA 1T29A 2VHUA 3A3KA 1R8SA 3PUVA 3BOSA 1KE2A 4KDEA 3JU3A 4J1QA 5EVCA 4LV5B 1KF0A 3QMWA 3QMMA 1XK7A 1UX5A 1M73E 4NPHA 5CNJA 1D1QA 2BGTA 2EJWA 1BGXT 4LIPD 4PNZA 5DHFA 2H63A 1ZIXA 1RWMA 1XD2A 4UNSA 5AKZA 4RTNA 1B2LA 3THYB 2IE0A 1YFZA 1NENA 1DXQA 1GGKA 3JARB 2V4ZA 1SVOA 2FFBA 1RLMA 3UJBA 5JXIA 4R6WA 3PLNA 2EERA 5IDQA 2PVSA 2VSQA 5EESA 1IJFA 4LHWA 3WLJA 1C0PA 1UEXC 3F4LA 1IBMT 4EMBA 4ESOA 3STUA 4DWWA 2D06A 3NVAA 3HYSA 3BF8A 4YK7A 3PF8A 4AP5A 4LRSB 5D3MA 3CG4A 4ZAXA 2WFMA 1G21E 4FQ5A 4F92B 2XTZA 2HXGA 1E7RA 1KEPA 1JECA 2AEEA 2ZRMA 3MAAC 1ABFA 2ZIEA 1KZ4A 3H11B 5AKLA 1PS8A 2HI0A 3G8DA 3V1LA 4JY7A 3AA6B 3QI2A 4A8JA 1YE5A 3AUTA 2BUBA 4IHJA 3D6HA 4XIGS 2C88A 5BV8A 2AJBA 3IUPA 3K2QA 4CGYA 4IUCS 1E9BA 1RLIA 3EPPA 4WNAB 4LBWA 4DB4A 3TW4A 3CZAA 3ZV5A 1V71A 4BNDA 2I1LA 1NAIA 1X13A 1I6WA 3W6PA 5AM5A 2DFDA 1GNTA 4MJXA 4P83A 5IKXA 3BREA 1O6ZA 2G9ZA 1X6VA 1AKWA 2LE0A 2WF5A 2GJAA 3GIDA 3U7EB 4Q7LA 3VR8A 1ZITA 5LOVB 4KGDA 1MB2A 1ZSVA 2VLBA 4M7OA 1I3CA 2H48A 4PC7A 2XQVA 1ZOPA 1Q1GA 1P33A 1MIOA 2ZUVA 2WU3A 4CTKA 1FTQA 4HS4A 1ZSNA 1AF4A 1RJFA 1G7TA 3W1WA 1H2WA 3EOAI 1N8KA 3H2KA 5IBRA 3ROGA 4UV9B 3NHFA 4TN5A 2NVBA 2OB2A 3RYHA 4BAGA 4KRFA 1VL5A 2Y4OA 2GYUA 3K70C 2RGDA 4DA6A 4B3GA 2O0MA 2QPOA 3BRWD 1LK0A 2WKSA 3AXTA 3DH0A 2OHXA 3DFUA 2VCYA 4FJOA 7MDHA 3GBSA 1N5OX 3P4YA 1E1YA 1XT6A 1DFHA 4B6OA 2H8KA 4H9NC 4Z9BA 1RKXA 1Y5RA 2WFZA 1M7GA 2E3JA 2JFZA 1W48A 2IYEA 5IT9A 3CPZA 4HFNA 3QVTA 3TUJC 1D0ZA 4AO8A 4R2HA 1BJKA 1FMJA 2FDCA 2C7GA 1Z4IA 2LHRA 2VH2A 1SZDA 1WXFA 4EI8A 1M34A 2FG6C 2P7HA 4U5QA 3RVOA 1Z06A 1KVRA 4DV4T 4R2WA 4BBAA 5HRUA 5BR8B 4Q12A 2ILTA 1JN0A 2TSYB 1OKKA 5D87A 1N25A 1U0EA 3DNPA 3MN1A 1XVLA 2I6FA 1M2HA 3OEHD 3ISVA 3M1LA 3DT6A 5AP9A 1BMFD 1BE8A 2HL6A 2CVQA 3UMVA 3I6IA 3PENA 3ZKWB 1UMCB 4UBJA 4ZZBA 1LPMA 4D4JA 4EAAA 2P4UA 1QDUA 2X0RA 3CYFA 3M7IA 2V7XA 4CCWA 1NVXQ 3IUJA 2F17A 1J6UA 3IR6A 1NF3A 1KEWA 2H2HA 3FSRA 1I13A 3NQ41 1NI5A 1HLPA 4DBQA 3SEFA 1I5OA 3NVKI 4A03A 2DT5A 2JH3A 3H3JA 4W99A 2WAOA 4YPOA 4XYBA 4EKEA 5I48A 4OJYA 4DDMA 3D02A 4IIHA 5HUJA 5I4IA 1GFSA 5EJ2A 4JCCA 1OR8A 3AJEA 2WUEA 3DWGA 3Q8MA 1MIWA 1BS9A 3AEUA 1OIXA 4UTVA 4AWXA 3VH3A 1XDOA 1GD1O 3EC2A 3S8MA 2QTRA 4ZDIA 3N2NA 4E2WA 4A0FA 1G8KA 3NP7A 4CR7A 2YWRA 5G02A 1GAQA 4QUBA 3EUWA 4OXRA 1EGQA 3MERA 4LOJA 1RHUA 4RKYA 3C3CA 3TDMA 2DWKA 2Z3VA 5DTEA 3PPYA 3WGKA 4OBWA 3EDCA 4B47A 4UM5A 5UKDA 2GXUA 1J8DA 1PQYA 4XFKA 3R3VA 1Y6FA 1MC4A 3HLKA 1FL9A 2Q5QA 4D4GA 5FB3A 4QGBA 1SVSA 5C8YA 4LWPA 2H1LA 2LWIA 2V74B 5CT4A 4W9MC 3WYEA 1UWLA 3CVWA 4KXVA 1DQYA 2H1OA 3NKFA 4I2VA 4PNEA 2Z4SA 5H3HA 5B4UA 1WBJB 3K8ZA 1NXVA 5HKBA 2VTDA 1T7SA 5CW2A 3VO2A 2Q1YA 2BZSA 3H6KA 1ODIA 2AXPA 3S4YA 1TMOA 2PX8A 2VKDA 1L7PA 5FPHA 1ZS9A 2E4AA 3Q9UA 4NHEA 4RKEA 2PUFA 4Y1GA 1PTJA 3E0ZA 1TIKA 3C3JA 2WZDA 3PV0F 3G5AA 1J0DA 1LZKA 2AJ8A 2XADA 4ZQCB 4K2AA 4P31A 4D79A 5AI9A 3EWNA 4MVJD 3THWB 2XMQA 4P8RA 4EIWA 1ZN9A 3HRKA 4M9ZA 3DV0B 2W43A 2W4XA 4X94A 4B4KA 1K8ZB 2R6R1 4AWAA 5T3YA 4C01A 1JH8A 4NJEB 3LQ1A 4CM1A 4CQMD 1KZ9A 4XVCA 3FHOA 1JHAA 3ZHQA 3DT8A 2J3HA 2AKAB 3W2FA 3ZGXA 2R6GA 4YJ3B 4BVLA 4ENUA 2OGUA 1EAMA 1ECGA 4Y2GA 3E2IA 1QUEA 3KCQA 4CQLA 2K5UA 3W8FA 2V6YB 1M6HA 5HBGA 1CV2A 2G7MC 4YGXB 3R0XA 5CA1F 4MIKA 2UVDA 4TLAA 4YRIA 5EP2A 2ZWMA 2XX3A 4R1UA 2JDID 1GZUA 1JFTA 4B17A 2YXNA 4IMPA 3N0RA 2Z5FA 2ZT5A 3TXXA 2R1UA 2AFHA 2WM9A 2BH9A 1M5TA 4HQNA 2WZBA 4G8CA 2DLRA 3UPTA 4P81A 3TAHA 5AICA 1D2AA 1R8XA 4X8LA 1LW6E 3HU3A 2ZSUA 3MBOA 2XQ7A 2ZKIA 4LXIA 2M6IA 3ZV4A 2Z3ZA 4KRXA 5TJHA 4ZVLA 1FUIA 5HG0A 3CSSA 3P2JA 2FEWB 2GILA 5KYGA 2PL9A 3GLHA 1X1EA 2X76A 4LZLA 1TU0A 3V8NA 2Y1LA 3JV7A 1Q6YA 3TNYA 3DQQA 2ZJ1A 4I0WB 4F3CA 4MP8A 4EKGA 1IOZA 3CRMA 2FWBA 3UJ6A 1Q22A 1LLFA 3TRHA 2HK8A 1NSTA 4LF9T 3L49A 4HKTA 1V48A 4X90A 2ZI5A 3GXOA 4R9SA 3AQIA 1K6MA 4MUGA 5IBQA 2PHZA 1QZ3A 1L5KA 1MXHA 3U7IA 5JFOA 2MIIA 3DZIA 4QD3A 1KY2A 3MRXA 2VT6A 5FUQA 3U56A 4DDUA 4G85A 4K0RA 1V3UA 3ZHUA 4OSPA 4RXTA 1CYEA 4HQOA 3QOYA 3O4JA 4GP7A 4K86A 3RSSA 3TVYA 2AFVA 5EWJB 3K53A 1PZHA 3C1TA 2YWJA 1H42A 3NM6B 4C4ZA 4EW3A 3B3AA 3DB2A 3DT9A 1NQAO 2VDQB 2DQZA 3OJAA 2P1RA 3LF1A 4JQZA 1T15A 1IAQA 1HT1E 4RHXA 4PLYA 3JZFA 5FBWB 1S3FA 3ZWQA 1KHHA 1XZMA 2QA5A 4BKPA 2CYBA 2ZBUA 4JEHB 4ND7A 4JJAA 1W94A 1BU8A 2EYQA 4BAYB 2AQ8A 1OU4A 2R1TA 1WEKA 4DQXA 2KMFA 2C20A 5GVRA 3QRWA 5EKDA 5BURA 4K3UA 3AV0B 1EFPB 1X7ZB 1YCDA 5EZYA 4CMEC 2FEKA 4G89A 2CLDX 4UHHA 5LSAA 5B3JA 2I9PA 2BBJA 4DIOA 3LPAA 4D3SA 2HF8A 3DCYA 5L3VA 2ZTVA 2HBRA 3WLOA 2HSJA 1LX7A 3EAFA 3RKOA 3WRVA 1YKEB 1XKXA 3BK7A 3JWPA 3BH0A 2F43B 4EYQA 4HYTA 4LJ5A 4I4TF 2W6NA 3PB3A 4XQGA 2RI0A 4B1FA 1IZNB 4O1IA 3EE6A 5DYIA 5TXGA 5IT0A 1Z38A 4HFVA 1ORVA 2B7CA 5FFNA 1FSFA 3D8NA 1VBKA 3Q7EA 3TRFA 1E5LA 4WWHA 4YJDA 4U6QA 3I39X 3OLCX 4ZGBA 3B6IA 1GGNA 4IJMA 1LLUA 1NULA 1P31A 1A8QA 1BFDA 2H3RA 2OFFA 2OVBA 3VJRA 5HPYB 3AYZB 1M10A 2NSLA 5H02A 4PCVA 5J2UA 1U8CB 3VHXB 1KYQA 5KVSA 4YCCA 2TS1A 3RRMA 4CQNA 1YFLA 1ZLXA 2QVLA 2VZEA 1HR0B 1JNRA 2QZPA 3HKCB 1K8QA 2V5UA 4D46A 4ZTBA 2PRZA 1EHCA 2X7HA 3GBPA 5JNWA 2C9OA 3NIDB 2A9VA 1J0XO 3CF4G 3KYBA 4S2UA 2G1KA 2ZQ5A 2PGXA 2GVZC 2NW6A 1OV4A 2DFVA 3JAWA 2WJ4A 2FI1A 4Q02A 4M38A 1R12A 2V8OA 1UPFA 1PUIA 4QU0A 1T4MA 1MHTA 2VDWB 2KX7A 4DB2A 2MMGA 4ZGWA 2FJ0A 1JQ3A 1XZHA 1AO0A 4F2GA 2O4CA 3ZVLA 2P9JA 4I19A 1CQZA 3CR3C 2XT9A 3TZLA 3DLHA 3EI0A 3N6RA 2XMSA 1FBNA 2ZVPX 4NL4H 5L51A 3ZYMA 4MJ3A 1NMSA 3WO1A 3B2QA 1BOOA 2RB4A 4ARVA 4MWGA 4B76A 3PDCA 4OHUA 3ILSA 1F6WA 1TKRA 1VHQA 2ZJ5A 4O29A 3UMCA 1VE9A 3M82A 5JATA 2Q1UA 3ORHA 3GZJA 1QIEA 3AESA 4EGCB 2BIFA 5JNVA 1APBA 4II3A 3ANNA 2FNAA 2JASA 4P33A 4FGKA 1UH5A 3A9UA 4RK4A 4MAMA 3WKAA 1EWQA 1RRVA 1WHTA 3A9RA 3D6NB 1EVEA 1Y5MA 4UNQA 3AETB 4XWTA 4M8LA 1QBGA 1IK6A 2YX1A 3LXXA 4GOUA 5CJJA 4UEQA 4OFWA 1P2GA 4NCXA 4PS0A 2AIRA 3ER9A 1QCZA 3GJRA 3O21A 1Z5PA 2WSMA 2AS0A 5JY6A 5AKYA 2V4MA 2G06A 1ZXBA 2ZIAA 4DRXB 4OB6A 2N0SA 1K2WA 4EKYA 1GPBA 3UUFA 3LGXA 3KT6A 3H9GA 3WK9A 1C8BA 4JH0A 3ZVKA 3SOLA 5LZ5A 4CIYA 3W6ZA 4QHTA 4H4EA 2GCPA 2PWBA 4Z91A 1TDJA 3ZH9B 5ER6A 2PUJA 3ZY6A 3Q88A 1H5UA 3RRNA 3AZPA 4H2DA 5JRZA 5AVOA 2BJVA 1U6IA 1RWWA 3UKDA 1B1AA 3H5RA 4CL0A 3D3JA 3HY3A 2XNKA 2XQ3A 4I50B 2MU1A 3PD1A 3EXG1 4WKNA 2VH5R 3ECSA 1G5IA 2D1RA 2KPOA 4OQXA 1FRQA 1GYRA 2WFLA 5DULA 2L17A 3QTLA 1RMQA 4B3MB 4KE7A 4PCLA 5C81A 4O4HF 3DDHA 5KWJA 1G4AE 4EA9A 4H7FA 4HNTA 2ETXA 2D54A 4KUGA 2VA8A 2IHZA 1EK5A 4ZMRA 2R2GA 5FPKA 1CUEA 1YGPA 2GF2A 2NUPA 3GDFA 1AKTA 2GJKA 2P5UA 2C4UA 1B23P 4HLDA 4C4OA 3RUDA 4H0CA 4FWTA 2XXAB 1W581 3JQGA 4CMAA 4LX0A 1F4PA 2JAUA 4YB8A 5CFOA 1VOMA 3VHQA 2AN9A 3DFFA 3INNA 3TL3A 2H2FA 3F71A 2RKBA 1E9DA 3WYDA 4NATA 2ECKA 4UE2A 1YB5A 4I55F 2R4TA 4L78A 2YS7A 2HTEA 3RLFA 2VJBA 4M0MA 2Q4OA 3HZZA 4K6HA 1YAJA 4QPDA 4ZZIA 5BP7A 3I5YA 2CLOB 4D80A 2BN4A 3AFNA 3PEVA 3IEXA 3EDYA 3ZQJA 4AUNA 3WL5A 1OVMA 1L9XA 2R48A 3KD2A 4KK3A 5FBRB 3C1OA 3AE6A 3P26A 4KWIA 5EE1A 3A04A 3FJOA 3KVYA 5JS1A 3HR0A 3KKQA 4MMZB 3LSVA 2NUTA 1MZPA 1NP6A 3E22A 4MV1A 3HLTA 2CB0A 2A5FA 3TQQA 3LK3B 4E2YA 3OCZA 1F2TA 4LHVA 4CI2B 3NORA 4V0QA 4IDQA 3CJTA 3O8DA 2E1RA 4TRMA 4O3MA 3O1JA 4G4SP 2CJPA 5DCUA 3VI3B 2VJQA 2B8JA 3DMGA 1RI5A 5JXJA 5IABA 5A6SA 3HJFA 1PT6A 4NABA 1PEKE 3OBVE 3T1YT 4HTEA 3PXXA 1L5WA 3G13A 2O8FB 3QPDA 4I66A 4IH4A 2R1ZA 4JGIA 4HFEA 4U5XA 3QKSB 5J2TB 4W8GA 5GTDA 2ZR7A 4PO1A 1MOQA 1CJMA 1KP9A 3T52A 1JJBA 5HJEA 4Q01A 3B13B 8ATCA 4WJLA 4P5PA 3U62A 3LZCA 2H3EA 5IJ9B 2X2FA 1SCDA 3RBVA 2OZPA 4KQ2A 3FX2A 4L8YA 1R6UA 3DZBA 4QOSA 4YT8A 2I91A 3WFJA 2OZLA 4DV2T 2Y0PA 3RS8A 5T4BA 4E7ZA 5B2ZA 3B51X 1PJ2A 3LD9A 2VHJA 4HLQB 5KHAA 3LBFA 3KSBC 4RD4A 2H3HA 3OKFA 1T35A 2C5BA 1E66A 4WDQA 4GKVA 4GXRA 2FLVA 1XWMA 4QFBA 3RGGA 3NCHA 4XASA 1Y6GA 2DWQA 3KR1A 1UK5A 1SCUB 4NXMB 1WCWA 1Z74A 1ZV4X 2I6GA 3A1NA 1O94D 2QBYB 5L4LA 5CM9C 5ALUA 1DWOA 4EFNA 2PFKA 2ASEA 5FUXA 4ND4A 2OV6A 4X65B 1UFKA 2GWRA 5HXCA 2AZTA 2EW2A 1A9RA 3S81A 3PVZA 1OXTA 2PCLA 2GPSA 2A57A 3RC3A 3VNVA 2UYCA 4L9RA 1XQ6A 3ZCJA 1P7VA 4RKQA 1KZ6A 4WKBA 1Q1EA 3TKAA 4J1TC 4M55A 2OO5C 3EEFA 4DNDA 3H9CA 3GFRA 4V02A 1A9SA 3NONA 1SKMA 5K8JB 2XMCA 1SD1A 3ABZA 2Z2JA 1HURA 1AS0A 5DM60 3PC8C 1PNVA 2HDHA 3RR2A 4B6RA 3K0EA 2DLCX 1Y4DE 1MAWA 3R0QA 3BRWA 1GUBA 1WVMA 1YCFA 4XSVA 4CL8A 2V96A 2LUOA 5LYJF 4URHA 4L02A 5KOJB 4FDLA 3PPIA 5F35A 2ZJFA 4V1CA 3H0EA 4TTPA 4CDRA 3OY7A 1UXJA 1OXXK 3JQEA 3NDBB 1U7PA 1T72A 1ENYA 3EIFA 2JGIA 1P8JA 4D9IA 3W7VA 3KL2A 4E5KA 2ZIFA 1WSAA 1XLUA 3ND8A 3IP7A 4R98A 2F1RA 2DRIA 2EZ4A 2O3JA 4L8GA 2A7QA 2GT1A 1H2XA 1NLUA 3A1FA 3N2KE 2VDOB 3DAYA 4JVLA 2ONYA 3ZIDA 2BS4A 1NVUQ 5BWLA 3AF3A 1UK8A 3KBTA 3ZMTB 3LKBA 3ZD7A 1A9YA 5A4IS 2HHAA 4AJHA 1IH8A 2YN6A 4HAXA 2XZDA 2W8BA 3R3HA 4I8DA 2V5DA 3B36A 2Y9PB 5FAXA 4DARA 2CLEB 5LKAA 2PBLA 4QFMA 3REQB 2A9OA 3WGQA 2AK2A 1BMFA 2SKDA 3PYLA 4FZVA 2Y0CA 1QORA 1DUIA 3SSNA 1QYWA 4O4JE 4OBBA 4E4TA 4B8ZA 2WSBA 2JRKA 2WHQA 2V0NA 3I2HA 1QV9A 2Q4BA 1X39A 3AHCA 1XD2B 2LOSA 5A62A 1QKKA 2NACA 4CCYA 1YT5A 4QU9A 3RRZA 1NSFA 1SXJE 1E64A 3LYUA 1HE8B 1EI9A 2OCDA 2JVJA 3V5NA 1AX9A 3MJ4A 1YS6A 3CIRA 3HB4X 1XMPA 4GGMX 3BQKA 1LTHR 1XF1A 1SD2A 3UFXA 4IHQA 2YJGA 1U6KA 4FS3A 3OEED 3TW6A 2BL4A 3EXIA 2FPIA 4PRZA 2R3SA 4DMKA 1NVMB 3OZGA 2JVIA 2O1EA 4EJ2A 2J87A 1G5FA 3TTUA 4RHTA 2NO0A 3AVRA 1NDUA 2EFCB 5CDFE 1M54A 1PI3A 3EOBI 4YEDA 1PNQA 2OBYA 2NPIA 2QD4A 2XWBF 2DPXA 1EFVA 1D1TA 1B43A 1L3IA 3BKWA 1BQ3A 2J3QA 1TVMA 3PUXA 1KJZA 2Y8DA 3MCZA 4DHWA 3B3FA 1TU4A 3Q5WA 5CIQA 2H52A 3EAQA 4OJQA 4UHEA 1TYAE 2E6KA 1WXQA 1GARA 3B6KA 3MWEB 3LRTA 1ISFA 4LF7T 1N3IA 3KUKA 1HKHA 4F4HA 3IR5A 4D4MA 2VP3A 5CURA 3HVKA 1GGJA 3KYDB 3ZC1A 1SKBA 3ZHBA 1SCQA 4JODA 1Y4UA 4UXJA 4GUAA 5KSZA 1IK4A 3WRXC 2A72A 1OAOA 1YZNA 4ZDJA 4J07A 4TMKA 1T9HA 3H87A 1XZQA 1CR4A 1XRQA 3TSAA 2ABWA 4ZXPA 2VQFB 1PFUA 1H23A 3A3PA 3I9JA 4NC9A 3WMGA 4PCUA 4RHYA 2Q6TA 2X8JA 1V5WA 1NVKA 1VGQA 5IAAA 2O2HA 2ZU0C 3G85A 1MNQA 4IGAA 4QYWA 4BP9A 5IU6A 3I9YA 2WHYA 4NNPA 3AHJA 5C52B 1C1YA 4RNDB 4ARCA 4CDMA 3HDGA 3KR9A 4NCJA 1TM4E 2DOKA 1E3QA 3MTDA 1WXHA 1NPDA 2OK8A 1EDEA 1CSEE 4MUHA 2C5AA 3O1HB 5LBQB 1EM8B 3CJRA 4OPMA 2LKGA 4QPPA 1WDWB 2HPZA 4EYOA 3KKOA 1W2WB 3I32A 4QQKA 3VNSA 1MGPA 5A3QA 2BR5A 2ZJ3A 4IIFA 3WGNA 1J9EA 4NE2A 2ZYDA 3DOEA 2Z2IA 3U4QA 4KOAA 3PS9A 3D43A 3MCAA 4MVJA 4XB6B 2QN8A 1B6TA 1I0IA 2KYRA 1CLUA 3JQAD 3TMKA 1VIMA 4ZHQA 3B7PA 3PD7A 5HR5A 4QDOA 2ZRCA 4F5WA 3U81A 2R7AA 1XFDA 2DH5A 3GP3A 3OEWA 2UUBB 4CQMA 3KKZA 5DNUA 2GEFA 3TSWA 1XVUA 4LRXA 3FOEC 4X91A 3EXHB 3FXEB 4JX8A 3K2BA 3Q7QA 1JDSA 3EQ8A 4EQZA 3Q2OA 5B3KA 3PUSA 3DTTA 2BZGA 1ES9A 1J90A 4WEQA 4NPPA 1QCDA 5IN5A 2G9QA 1SQSA 3RU7A 5HXHA 1FNDA 2BP7B 4HGYA 1NR1A 2W2QA 4DREA 1J2YA 3D4PA 5BUCA 1FUKA 4PBSA 1ZJZA 4EB6E 3T7DA 3ZYKA 4FM9A 2JDIA 1EUYA 1XJWA 2OQRA 4I1YA 3D1JA 3JVIA 1J2JA 4NBUA 2GNPA 3IHRA 4P2BA 2EBWA 5FORA 2B1JA 2YVAA 2ZSJA 1USKA 3G9UA 3H6HA 4WLOA 5IKEA 5E4FA 3G8AA 2Y1WA 3OOSA 1Q7TA 4JB2A 4XPIB 3BVPA 5EPEA 2OXRA 4PGMA 1A5SB 2EL7A 4LZPA 2DJIA 2GFIA 3OQ1A 4CU2A 4AL4A 5BWCA 2MR6A 1EK2A 2OL4A 2GA9A 4AY3A 4PN3A 1E7QA 1PJZA 3UUGA 4Y8VA 3DOCA 5ITWA 1NRXA 4DEYA 2WNIA 2RGAA 3HJRA 2HLNA 3WB0A 5AJWA 2E9XD 2C1EA 1D1SA 1CUCA 1JVBA 5CG1A 3I83A 4X20E 4HB2A 1WLXA 1KJ8A 1MABB 1FSPA 2CNDA 4BASA 1C30A 4DM4A 3UJAA 5E1DA 4QUAA 5EMNA 1JLSA 3R3ZA 1NV9A 4YTNA 1ISSA 1U8AA 1T4DA 2ISSD 1ZMRA 1HYHA 1X8KA 3HJGA 5A5GA 1JILA 4PW0A 3TSOA 1FEZA 1RR6A 1TMGE 3KB6A 1KIAA 1OY1A 1D7OA 4AZ3B 4KH0A 3K6JA 2WIJA 5P21A 2DUMA 2VWQA 1FZTA 3I0MA 5F3RA 2K24A 2BFDA 3OC0A 4G8BA 1CR0A 2P69A 2VHXA 3UGQA 1Z83A 3HA4A 5CYPA 4DLWA 3OICA 5FOUA 4KKXB 1E4EB 5EWLA 3TX6A 2WEKA 3MNFA 2IIVA 5C8YB 2IBTA 3LZ6A 4JI0T 1XC7A 4I99A 1GTSA 3O7MA 3BGWA 1VCHA 1XAIA 2NWQA 1P8AA 4ZEVA 1N77A 2A5JA 3GGGA 4L9IA 5CBPA 2LDBA 2I71A 3NRYA 3E84A 1KNPA 1F12A 4Z9AA 1BA3A 2V5VA 3L79A 1YJ8A 1SXJC 1B41A 2RG7A 2D0TA 1ISMA 1W44A 1DTEA 5DK4A 5LMCA 1QH8A 4OREX 4PAMA 1XP8A 4AS3A 4CMJA 3MA0A 1B74A 4RNCA 4L75A 1DBIA 5FPPA 5BV7A 3HPRA 3JZIA 3X2FA 2ASVA 3AG6A 4MSUA 4BBJA 3LC2O 2LSYA 4X1IE 1JEYA 4JT4A 5IHYA 1NMZA 4C0JA 1S2OA 2FN9A 1QIGA 4PG8A 4V03A 4K9QA 1VJCA 1E4OA 4Z4CA 2DQ4A 4QTXA 4JLNA 3D8HA 5KWEA 5IZ4A 2NSDA 5C3MA 2X9NA 1IXZA 4PYLA 5K03A 2IVZA 2WJAA 4RPIA 2A35A 3OTWA 4NBTA 2HWYA 4H59A 4QXMA 3OEYA 2FG7C 3ROKA 4D74A 1CUWA 3CFYA 2XODA 2GJSA 2ZAGA 4FMBB 4MWTA 2AMFA 5E7QA 2FZ4A 4YLYA 3UJ9A 3K1YA 3D8TA 3U61B 2WDVA 3GROA 2VKQA 1J1ZA 2GNAA 4P7GA 2A58A 1WO8A 4MUKA 5HVNA 3D64A 1J5EB 1MB3A 1RADA 3QEKA 3FOFC 1HFJA 2O2DA 1NUHA 3NALA 3OKAA 3I8XA 3PXCX 4WA8A 2ENWA 2QS9A 2CM0A 2HU2A 1IY1A 3P0HA 3C6YA 2PUAA 4BOYA 4ZAGA 4ZZ2A 3DL2A 4D3DA 2CF6A 2C96A 4P3YA 1YR1A 2FMXA 1W36C 4CETA 3HKDA 3RT9A 1UXIA 4FEEA 4IUDS 4V2UA 3B1YA 3G0DA 4RY2A 3PUIA 2IWHA 4H77A 3RJMA 1AS3A 3KSUA 4FW8A 5LJLA 1AQIA 3M65A 1I0LA 2PUEA 4EG6A 3HB5X 4B46A 4PTYA 4PR0A 3L1JA 4L4YA 1PNRA 1ZH0A 1UCFA 1KVSA 2G1PA 1E2BA 2AFIE 3CKYA 4D6XA 4RVOA 2GK4A 3G0BA 3HRIA 1UBEA 4FE3A 2JG3A 1IJEA 4DDVA 5EJFA 4BAZA 4LPSA 2RKWA 5KOHB 4UVAB 1YJAA 4TWDA 5ALQA 2EWMA 2NUBA 4KQIA 5DLQC 3ZY5A 4JWKA 5E1OA 1BNCA 1JG4A 2HO4A 2KJQA 4PAOA 1JMYA 5I9SA 3SVZA 3PJFA 5AI4A 3WL7A 5DRYA 3A9VA 3RK4A 2P65A 2I2XB 1G60A 1KDOA 4P3PA 1IQPA 5FA5A 2QZ4A 2P8JA 3HVIA 3FOAA 2PMKA 3ZZTA 4MYCA 2ZQZA 4NZMA 2KXPB 3FZHB 5ELXA 4O4HE 5DWQA 3D7RA 4I5EA 4D45A 4MPTA 4Z1MD 3NANA 4KPYA 3FPJA 3EEOA 3SD7A 4J0EA 1MMDA 3JTMA 4EQ6A 3A26A 4IREA 3C4XA 4EGSA 2EDAA 2Y0DA 5JI3E 2N42A 2OOKA 3PQ3A 1SHJA 3SQNA 4YX9A 4NESA 1KVUA 5B6PA 4OK3A 1MAAA 1FX0B 1X9GA 1MIVA 4P22A 3PGA1 4M54A 5AVYA 2XMGA 3OIUA 2C8VA 1W93A 5DN6D 2I2BA 4NBSA 2Z9BA 1Y33E 1PNTA 5F1OA 2CHEA 3ZC3A 3O2NA 1GGFA 4Y6RA 3IILA 4QUHA 5HIAA 2F3PA 2DERA 2PANA 2P2YA 3QHQA 2Q0SA 4TYNA 2H89A 3C16C 4TSKA 3PL1A 1AF7A 3TOCA 1V1MB 4ZEMA 2Q1XA 1GU0A 4TUYE 2YIVX 3VI4B 3M5WA 4RLHA 4TTQA 3WGLA 4CBVA 4B3IA 3KWLA 1DJPA 4UOEA 3KHKA 2WA2A 3AL2A 3D6JA 4JGGA 1IHXA 1N5RA 3B8EA 5CH5A 5KS2A 4TM8A 3DZ8A 2VJNA 2I0FA 1OZ0A 2GOYA 3CWQA 2I99A 2AW3A 1BH2A 1FVOA 2AI1A 1FJXA 4PRKA 4M9UA 3LBNA 1QAMA 3RIFA 4URVR 2PKQO 1IDOA 1DUVG 2GHQA 1W4AA 1A1SA 3KIPA 2YZGA 4DR2B 3EA4A 4DNPA 1P1JA 2AH5A 2FR8C 3GQBA 2OCKA 4U6SA 2AE9A 5C0OE 3EXG2 4JL8A 3LQ2A 3Q3JB 4RTKA 1Y1QA 4C04A 3TDNA 1KAMA 1T8WA 5SY6A 4LMKA 4MW9A 5LP6A 4LQ4A 5ALWA 2Q6LA 3PT9A 1V37A 4FT4A 3JAWB 4B2IA 2Q7OE 1VFNA 3DUFA 1MBZA 3QE9Y 1C9KA 1BFKA 3S2ZA 3BBPA 2HA7A 4RGVA 1YJBA 4DR4B 5AESA 5BMVB 2WYWA 3T6KA 2B8TA 4FR0A 4EA7A 1FXWF 2W6QA 3MGBA 3WKEA 4G0ZA 3H4TA 4DLNA 3A5XA 1XQ9A 1UC9A 2RHCA 3BMQB 5E4JA 3I58A 3ENZA 4R1TA 3O0DA 1LS6A 5EWMA 1VMEA 1SUAA 3L7IA 2IP1A 3U13A 3P2KA 1QQTA 2DCUA 4M1EA 4J8PA 1PS0A 3E9YA 4YMHA 4GWGA 2NXWA 5TB5A 2BF7A 3SJ7A 3AP3A 3EGXB 3ZU2A 4A9AA 3EFEA 4EGWA 5E2IA 3DYBA 3AH8A 1UJ6A 1IZYA 1WHTB 4KXUA 3FI0A 3HXPA 3Q2KA 3BXGA 2R6CA 3B6JA 2CMRA 4B5LA 1DIHA 4TPKA 5EA2A 3O2SB 3DE2X 2PKXA 3UKOA 2I2DA 1WUYA 4JYCA 3K1AA 4KE6A 4UATA 3OQHA 3P1JA 3P32A 4JQSA 3P2OA 4B44A 1Y3IA 2IGBA 2QUAA 2E7ZA 3RQIA 4M6WB 1V2HE 1QP0A 4BVHA 1T9KA 1RMYA 3P4WA 2R79A 4TX1A 4ID9A 4GLJA 5ELLA 2PPLA 4MWZA 1L7XA 2O6LA 3ZHRA 2UXBB 1I6LA 4H4CA 3ADOA 3L0DA 5JAHA 1F6BA 3GCXA 4FI3C 3GUHA 4CMHA 3SMQA 1OAKA 4N5MA 4N48A 1JE0A 2R8BA 1EXNA 4CGZA 2Q5HA 1QAQA 1O94A 3L7BA 2QAGC 4DQUA 2W7TA 4Y2VA 4M36A 1VJGA 4XJTA 4DGQA 2FEPA 1HF8A 4Y0AA 3TFQA 5LYJE 1T0BA 1KARA 5EKUA 1Z0DA 4LDNA 4C6SA 2INGX 1IM5A 3LMKA 4TLDA 1A4XA 1MHPA 4KB5A 1MA0A 5ECGC 3TLCA 1R4ZA 4QDUA 2CD7A 1SUBA 1PS9A 1QH1B 4IMRA 1XNRT 1TYZA 4RHUA 4IG4A 3R3JA 1L5HB 2ZSFA 1LSSA 2V6BA 4GDFA 1BCRB 3I37X 4DV7T 2GDJA 2QDXA 4C08A 4HRAA 1XWFA 2QD5A 1G3RA 2PGLA 2Y1EA 1DKPA 4D4IA 3TIFA 2FSGA 3MZ0A 2O0HA 2XF8A 4JELA 4YLEA 1OH5A 2C3UA 2RH5A 2QN6A 4RK6A 5FOSA 1KQOA 5CT9A 3VPAA 2HMWA 4E5YA 4O4IA 3ZDAA 3RH3A 1IHUA 2FEAA 3ENWA 4JUAA 2H59A 3LYHA 2PJUA 2VUIB 2O59A 4B71A 2NU6A 3DBVO 3JRXA 2WWRA 3PGKA 1AQNA 3WQHA 1IHOA 1CJCA 2NUTB 1U2RA 4FFLA 5IK2D 3KZCA 2Q9QB 3BRSA 1HE5A 1EZ3A 4HGOA 4O4JF 3W9YA 5LMZA 1G55A 1RI2A 5L3GB 3BGVA 2ONJA 1TZKA 3DMPA 1NXOA 1U0HC 5E6RA 2OM6A 3OOJA 1NRIA 1C7QA 5U9CA 3PNVA 2R5WA 1Q50A 4ZFNA 3RIXA 1NWMX 5CXUA 2IXTA 2PXAA 1SPXA 1RMTA 5ITSA 1SZPA 1D8AA 3FVRA 1N6LA 1E3TA 2BAGA 4JU8A 3FKSD 4ANFA 4A10A 1Q1NA 1WMDA 4NZYA 5LKRA 5H6QB 3CZRA 1DOAA 5CNIA 3GRRA 5L3EB 3RBAA 3SIPA 1GXSB 5HRAA 3OEEA 2VDJA 4NE9A 4FGUA 4DV6T 1B8VA 4Q1CA 4J90A 1RTTA 2RHBA 1C7IA 4P3KA 1IJBA 1BA2A 1GIAA 5J3JA 2C7QA 5BY2A 2HPLA 3PEWA 5BSFA 2ZS8A 3DKKA 4MVJI 4EYEA 2YJNA 1V2GA 1FDOA 3GLGE 1VRBA 1VMDA 3KU1A 4AJEA 3TSYA 1F7UA 4XRGA 4PLWA 4EY6A 5LQSA 4C7KA 3NRBA 2FZGA 2GASA 1THTA 3DEFA 4MPPA 4NHOA 5F64A 2NAFA 5JMWA 1I3OA 3AY0A 1WKBA 2O20A 1PSZA 1IEVA 2CYCA 2G09A 1C9EA 1E61A 1WY5A 2JLWA 3AU9A 4Z9XA 3V97A 5L53A 3UKJA 4E08A 3RAGA 1P73A 1XDBA 4FFDA 2G70A 3RJ5A 3B6MA 1M8JA 2GA8A 2EG9A 3ZCTA 3HRHA 1WOYA 1NSYA 1P72A 1BXRB 4JBWF 4U8GA 3RVKA 2UUCB 1AZTA 4O6VA 2XIQA 2JW5A 2X8LA 4W1QA 4MWOA 2FPKA 1XD9A 4A8HA 3H5NA 5JPDA 3G2HA 4R3UC 2PMFA 3EFHA 1OH7A 3RS0A 2NP7A 2ZUWA 5TQVA 5AHRA 1W35A 3E35A 3QM1A 2EZ8A 1WWKA 3C1UA 4WERA 5E9AA 4Y2YA 4GD3Q 4FYVA 2RIRA 1HE4A 4LNUB 4MS4B 5HEGA 3EG5A 5CVTA 4H7JA 2MR5A 4MH0R 3IBFA 2PLNA 4URWR 3M3PA 1B0UA 4EJFA 2BTEA 1PZNA 3TG2A 2YW2A 4A2PA 4FW9A 1KFBB 5IAJA 5FNZA 2JQQA 2V1DB 3KFVA 1YAHA 5BR7A 2DKOA 5T4EA 4ENQA 5BOVA 4IINA 1QG6A 4G9EA 5FA8A 4BNFA 1EK1A 3L1UA 1K5GA 4CIDA 1KK2A 4FBMA 2KHZA 1TT5B 1DAOA 5ALIA 1JKXA 4CKWB 3AEAA 4UELA 3EA5A 1D1CA 3NTXA 1XHFA 2J3KA 4CM5A 3IMKA 2IUBA 4AP9A 3ZE6A 4CFYA 1KQGA 4N0EA 3ZW7A 2AYYA 4MVJP 5HBRA 1ACMA 1RYBA 1X8XA 3AM3A 4JYZA 3E15A 1OX4A 4UAVA 4X1KA 3E1SA 1T8RA 2EFJA 1DFGA 4QTUB 2IDKA 4K6CA 3QFSA 4NJMB 2XQAA 1VKJA 3D5TA 1M6VB 1T8BA 1QMGA 4QLOA 3B85A 3ZHOA 3I6MA 2RGNA 3IULA 3C4WA 4AKLA 1FF9A 3QNUA 1RHJA 4DW8A 5KPJA 4YTEA 4DV5T 1RYNA 4LKOA 4YJHB 4J0CA 3RS9A 1KMNA 1UR5A 3G0IA 1L7DA 2O05A 2C4VA 4ZI3D 1K08A 3N6VA 1F1BA 1JJFA 1WL8A 4AKSA 4JI4T 2E9XA 1G8XA 4YJGA 2OECA 1V0JA 1OBOA 5JD3A 1D5CA 2EQ5A 1FIOA 4NUVA 5U4QA 4Z3DA 2OP1A 1N1MA 3FZYA 3RS3A 4ZWNA 2LM2A 2DFLA 2WKRA 5DX8A 5DIZA 2CDBA 3IUNA 4AIUA 4Q34A 2H2AA 3BIFA 4Y9TA 2B8WA 5KJEA 1K7XB 4DCSA 3QEAZ 4CR8A 3GT0A 5EJEA 3TRDA 4G4JA 3B1XA 1GRQA 1XZEA 2WZCA 4F60A 4UZFA 4RAQA 1FFEA 3NJ4A 3HKBB 2PZJA 4OSEA 1LVUA 1FNNA 2IYUA 1WP9A 4LSWA 1ARZA 1I0ZA 3A9CA 3MWGA 3DDNA 5TMDA 1V8DA 1COZA 4ZOAA 1JFLA 3T0IA 2FW8A 3A6ZA 3R0JA 3RBXA 4HDMB 4YMSA 1IAPA 5LQKA 3FTNA 1E2PA 2CMKA 4B7CA 2N75A 1PLJA 2XNDD 5TY0A 3FAKA 4MHCA 5CHYA 3D4OA 2Z8YA 1EAYA 3JATB 3PXBA 5D6NA 4ABTA 4TQ9A 3RAEC 1BWSA 5LHIB 4XUCA 1H2YA 4CNQA 3NHMA 5JYCA 2XKJE 3LXMA 5BNFA 4CTMA 2QNIA 4PIPA 5JR3A 1KOFA 4YMTA 3K6KA 5IARA 3BQ9A 1GJRA 3LLUA 4HBGA 2FZVA 5IVDA 4RMGA 1OXBB 1WZCA 3QXGA 1QMPA 5B37A 3IDFA 4KN9S 4A97A 1OV6A 1IPHA 2FZWA 3F96A 4EJSC 3AFIA 3CVXA 3REFA 3ZJ4A 4DUYT 5HJ2A 4FB5A 1MRZA 1H0SA 3FNRA 2ERYA 2CHUA 1KO5A 2QR3A 1UF9A 1V1RA 3TECE 1O58A 5K99A 1VP3A 2A9RA 4DAEA 4XDYA 3NKLA 4RH1A 1U2DC 5CAEA 1XLVA 4EUKA 2BKEA 1XTSA 2HJRA 5K0CA 3OPYI 2HH7A 3UHFA 2JL1A 1TAQA 4EA8A 2NW7A 4YR9A 1ZZEA 4PLTA 5DB4A 1WULS 3PQ7A 5GOZA 4PZDA 4C1BA 2IYYA 5A7FA 3SR4A 1LBIA 2CFCA 5IF3A 4A5XA 4PQYA 1QZXA 2UUOA 4IRUB 4XUGB 2ZBDA 2VQ3A 1U0BB 1RKBA 3TEMA 3NOQA 3UTKA 4YQYA 4FI3F 1M2VA 4KWCA 3OX2A 1AQJA 4LFCT 3N8NA 4KQ6A 4OSOA 2O5CA 3PV0A 4LJ7A 2JJMA 2FQQA 4EHNA 4RKWA 1U6JA 2FSFA 3GLFE 2WJ3A 1HTJF 4Q48A 5JC1A 3W1EA 4BQFA 1ZCAA 4YAKA 3PXUA 4F6CA 1NOKA 4BCCA 1PL0A 4P53A 4U74A 3HBNA 4D0RA 3FVQA 5EUBA 3PNSA 1T6XA 5LGNB 4OMDA 2PH5A 3GPBA 1PEYA 5CFBA 2FJDA 4X7BA 1Q1ZA 4R8VA 4EHIA 4JP3A 1G19A 4D1YA 3QKRB 4L22A 2IS6A 4QQRA 3MRSA 1JFSA 1H05A 4PF1A 3C3BA 5CA1A 2VSNA 5SY9A 4EL5A 3HBFA 5G0UA 4QSMA 3SSAA 2EHOC 2O8DA 1JBEA 5A4FS 3QE4A 3DO5A 1TO2E 2PMDA 1C30B 1JXOA 4EG8A 4H4DA 1CQPA 3GLUA 2XQGA 1DV1A 3GJXC 1J33A 2R85A 5ENDA 4JLPA 1JYFA 4R40A 4RV5A 4YJKA 3PDHA 3IQGX 3VVCA 1NXWA 1FNCA 2FMUA 4NENA 4MINA 2F48A 3JRNA 3IMCA 4B3TB 3PWTA 1WKVA 3ON5A 4XX0B 1FXSA 4MVWA 1GTVA 3G2JA 2JA2A 5A5DA 2B35A 5AW1A 2EF1A 3WBJA 2VYQA 2VUUA 2A0KA 2JZNA 3C85A 1UJ4A 3E1GA 4L3VA 2NUAB 1UOQA 1WNFA 5JMOA 4FZ3A 5CA0A 4HUJA 3HO1A 1QGDA 3ST7A 4EA6A 3RIUC 1UDAA 1B14A 2AD5A 1C7RA 4Z1MA 4UVIA 4DDTA 3U31A 2ATVA 4MFRA 1ZVMA 2Q3JA 3CF6R 1PYGA 1UZMA 1OF1A 2OHIA 1RW4A 1HM5A 3J7TA 3P2YA 4E03A 2UUAB 3AGQA 1BQ4A 1KI9A 4XWYA 2PWYA 1UWVA 5FUYA 2H4XA 4L16A 4TZKA 3TNDA 1SCNE 3P7IA 4KPUA 3O4RA 5KQLA 3IUYA 2FHSA 1SVIA 4FXOA 3TJZA 1PFGA 4WV3A 1Z9BA 2XW6A 1GNRA 5DN6A 4S05A 4TUYF 4DUGD 3D7KA 2P9HA 4CWAA 5EGSA 1KEVA 5IANA 2VUSA 5B1SA 4XQCA 4NOKA 5F77A 2WVHA 4O1HA 2VRCD 1CEXA 1ZKMA 3FVTA 5E6SA 3UMBA 2H9YA 3JASB 5H83A 1J2UA 2FPWA 5AVVA 2Z1DA 3V1UA 4PM4A 3INYA 3EY4A 1Y7IA 4A73A 4H7IA 1QKIA 3AERA 2ZYTX 4Q4JB 3CUUA 2I8AA 1UL1X 2HCRA 2E49A 2JHFA 4YBRA 3FROA 4UZSA 4CXYA 2ORWA 2Q2NA 5J4VA 4O0LA 3WHLA 1RU3A 2EF0A 3TFOA 5HZMA 2CJFA 3MK31 1J56A 3UYKA 4HADA 3ZIAD 2QTVA 5EXPA 3U3ZA 4ND1A 1JLLA 2D8MA 1PT7A 2HK6A 3JALB 1HV8A 3VPFA 4HFBA 1ESEA 2EAUA 4AUKA 3LNCA 2BMFA 3SFVA 4FN5A 1KO7A 5AMXA 1EU1A 4I4TA 5DZSA 4TL6A 4C06A 3LDHA 1XQWA 5JXHA 5JDQA 1Y82A 2B5WA 2BMJA 1GOTA 2ZTLA 3T41A 1QM5A 2YJ3A 3O6VA 2XAQB 4NXNT 3PNQA 5M04A 4QHOA 1RXYA 1FY2A 4Q25A 1YH3A 1TW2A 1DIBA 4IRXA 2CDCA 3VNAA 1ULSA 4YP6A 3IMEA 4BJ1A 4DMWA 3UG6A 1GZDA 5ALZA 4LDZA 2JPDA 2AT1A 2VURA 1I01A 4IL4A 4UARA 4CMCA 3B70A 1XTBA 1T3ZA 3TRJA 1U8YA 5J63A 3ZCRA 3AU8A 2VF2A 3T1NA 1TJ3A 3LO5A 1L6IA 1PIWA 1UFVA 4ARUA 3FHTA 2G8NA 3ZZ0A 4X8MA 4IG9A 4M9RA 1J4AA 1T6YA 2PEYA 1Z5WA 3CX4A 3H9EO 3E9ZA 3QUSA 1MT3A 1RT9A 3U2QA 2ZRKA 3OPYB 4E4YA 1P81A 2O19A 1WXIA 5HTKA 5LC1A 3ER6A 2ZRDA 1HCIA 5HXSA 1TEHA 1SXQA 2BHTA 2JJYA 4Q15A 1R5NA 4F3RA 4XE5A 3VR0A 4GOKA 3HGTA 3GN5A 3PNPA 4Q4DA 4IZOA 4X71A 1LPPA 1DWQA 1XNHA 1D7AA 3E3LA 4W5TA 4PZAA 2AZMA 4DXAA 1BE0A 3N9MA 4IIJE 1P75A 2ET6A 5AI0A 3F6PA 2IT1A 5NLLA 3BDAA 3AR6A 3HDYA 1M1YA 5EJ9A 3RNLA 3OZSA 3PUYF 3H1GA 5LP1A 1V5FA 1E6LA 3FWPA 4WXRA 1E2GA 5ES3A 4DR5B 2FPRA 4DBVO 3IAS1 1ZK4A 2LNDA 4N03A 3CQGB 3ZCXA 3DCNA 5I3ZA 1UQTA 2I65A 4RA6B 3AUXA 1QTRA 1NZDA 2XAHB 3IJ5A 1PJBA 3GRVA 4ZYTA 4ONEA 1ZJ6A 2QTWB 2CWDA 3KTDA 1VLLA 3AYXB 5KOYA 2KBFA 3NGMA 4QBGB 2VHQA 3IA2A 4LDJA 3TN7A 5HKAA 2V7KA 2Q3LA 2VJPA 2YEVC 3W5JA 1OI4A 3MOGA 1CUUA 4R8SA 5EMMA 3TW8A 4H1UA 2Z6VA 5IXJA 5IBPA 3BFJA 1NUUA 3IB6A 2AQIA 4F84A 4BLSA 4D7AA 3AP2A 1YR3A 1R5JA 4OJTA 1EUZA 2XWQA 4HNVA 2J41A 3K0BA 3OEHA 1J0BA 1TAGA 1ZUNA 2XCOA 1KZYC 2CXLA 1U11A 1ZI6A 3VJLA 2DG2A 4P7KA 1KGDA 4QJ3A 3F1KA 3DE4X 1ZX1A 5L8VA 1LVHA 3V8QA 4DLRA 1SKQA 2GLXA 2HZBA 2X23A 4DR3B 1QUUA 5EYPA 2WG0A 4O2AE 4RPHA 3RVQA 4LF5B 3KAQA 4FCWA 5ISMA 1WMEA 4ZCMA 1F8GA 5JD4A 1DJNA 3KVVA 1TQ8A 1GM5A 4AJOA 2VWHA 3PQCA 3PL5A 3LIIA 2ZRJA 1NA5A 5IK2A 4RJTA 1RI1A 3PGMA 1IM2A 1D2HA 4C2UA 2ANBA 5D3MB 4OXQA 1E96A 1JEDA 4NU6A 3D59A 4A1OA 3G0GA 4LMRA 4KKVA 2WPNA 1F20A 3DFKA 4P08A 1NN1A 3NMUF 1L8XA 2IOQA 3CMMA 2QYOA 2BSXA 4I55A 4JVMA 1QFZA 3ROPA 5I7HA 5EJ5A 4MRNA 4MUIA 1QHFA 4ZANA 4YAWA 2CBJA 4A8JB 4IHJB 3JWGA 4YCLA 4FDUA 2WZQA 1RHMA 1HFWA 1V96A 4E3WA 4R9RA 1KP3A 1J09A 4P32A 5LVAA 1UPBA 4F71A 4YXFA 5AQNB 1CTQA 4AYXA 3L6CA 4BNDB 3FKSA 4B3SB 1UJMA 5CVVA 5ECYA 5FLYA 1X14A 2YFHA 1OEDE 2VJLA 5D00A 1B76A 3PQ2A 4HX9A 4KRYA 4MI1A 4IIBA 1Y6QA 2DUJA 2P3QA 3VV2A 1NLMA 1XXHE 1TQHA 1MH9A 1D04A 3HG7A 4AAYA 1ZMBA 1LTQA 2BRUC 1JU3A 4QUIA 1MIOB 4MUFA 2BCJQ 1YK1A 3TPFA 4N5IX 3HYTA 1YS4A 3CUSA 3CUEF 3FPEA 5CG2A 1ZVJA 2A5LA 3PEUA 1A4IA 3OJLA 1KR5A 5AI5A 5BWOA 4KBFA 3UAZA 1J97A 3OE4A 3RYHB 2VN8A 1U3CA 1OFGA 2JCBA 3DZGA 4WZZA 4E6EA 3QVWA 4HAYA 2E5WA 3T1OA 3RKGA 1Z7BA 4D99A 1US8A 4M9CA 1G21A 2K7ZA 1I80A 4DPKA 4WXYB 1M1XB 2PQMA 3RI5A 3P0FA 5LQJA 5IDXA 3ESXA 1I7NA 1EWTA 2WTUA 1EUDA 1XDGA 4JASB 5LBTA 1QF6A 1ONOA 1XYVA 4PXAA 3TLVA 3PP8A 4D0GA 2JA1A 1ZBQA 1M34B 1AG9A 2DX7A 5A6VA 2LSJA 1JQEA 4GBED 3H6GA 5LG3A 4JR0A 3L02A 4P36A 5ITVA 4Q1AA 1NUTA 2NQ2C 1SG6A 3CKDA 3T5CA 2ZZKA 1TTPB 5BSTA 1BX0A 3LOPA 3AMVA 3CRVA 4R1SA 3KQMA 2BFCA 1Y8RA 4D3ZA 4N47A 3RIGA 4YRJA 6REQA 1NC1A 2VF7A 2VSXA 4L74A 3IUQA 1VJRA 4OGFA 1JR4A 1OWMA 5SV2A 4MB0A 3UIEA 4BLUA 3PX3A 4J2HA 2E55A 4LOKA 3QPBA 4NOLA 4Q16A 2WF9A 4AS2A 4C6HA 4KR0A 4MA4A 1EVYA 4X3CA 2XUHA 4TTTS 2D62A 4DJAA 1NKVA 1Z16A 1G8HA 4B74A 4LZNA 1XXLA 3OLYA 2VBCA 4MO9A 4WH0A 4DUPA 2QD2A 3R77A 2V03A 3OFVA 2H57A 2I4LA 2BYTA 3HR8A 1LDEA 2NZ8A 3AEUB 1QHNA 4UFPA 1D0XA 3GDHA 1CNEA 4G0NA 1AB5A 5D3QA 1VJ0A 4OFZA 4WINA 4U31A 1MDFA 4CKXA 1HL3A 2JZOA 3ZN2A 3MMSA 2WDPA 4NBKA 3F78A 1NDQA 5JRJA 9MHTA 3M6XA 3EZGA 3CQCB 3GF4A 4BV8A 3MZKB 4RMIA 2X6RA 4NP6A 4HWOA 3BQLA 3NHRA 3ENKA 1L0VA 1P17A 3EBLA 5KSPA 5BW4A 4S1VA 2JQKA 2ZUDA 2YYSA 5EPUA 3KVRA 2PVCA 4F8JA 3HFGA 4AJLA 3W8EA 4ZI3A 5DOVA 4UTOA 1ZIOA 1QYVA 3LCUA 3DMFA 3P9IA 4DADA 3GNLA 4WBSA 3U3RA 4KJXA 5FWAA 4CMEA 4I2NA 1Y0BA 4FUTA 3I9V6 4YCSA 4JR1A 1GQ2A 4XUEA 1SAYA 1U7OA 3WLRA 2VK4A 3UJ3X 2C2BA 1IWBB 3TLJA 2A94A 2LPMA 1SXJD 3GJTA 1MFPA 4EB3A 3E2PA 1V8FA 3PGVA 1W7AA 2FMIA 2YV1A 1FNMA 3GUCA 4UEJA 4JD5A 5JAQA 2A78A 3CN7A 2XOKD 1LJUA 2Q9UA 4RJLA 1DAMA 3QIVA 1P6QA 2RBGA 3TLGA 1ZD4A 4MDYA 4B7AA 3ORYA 2P2CA 3V4RA 5CUQA 5BSRA 4BMCA 3KUDA 2XF2A 3EVFA 3I53A 5L7WA 2I7TA 4PX5A 4YYEA 2JGAA 2NTVA 4JEIA 3ED1A 4B3BA 2XNDA 2MSWA 4RANA 1TKCA 2YV4A 2VPPA 4F96A 4ARZA 2ONKA 4XZCA 4B80A 1U3GA 3VRBA 4RZQA 1RXEA 4WD3A 2J47A 5BSUA 2QL7A 4HX2A 4CQLB 3BRQA 4UQLA 2BFMA 2ZSIA 2W22A 4LCJA 1Z0IA 3P4UA 4QUEA 3UMJA 5AW4A 1G9TA 3G6KA 1OEDC 5T57A 1OLXA 2WT9A 6ADHA 4Q47A 3P50A 2GN4A 2AFHB 4GDMA 2WM9B 3ZJ2A 4LJKA 3X1XA 1A27A 4JYAT 2XBMA 4OP2A 1JG2A 4MARA 2B4RO 4ILCA 4PIMA 3TSZA 4MIEA 3CWZA 2R5FA 1W36D 4E22A 1Q17A 4MPDA 4BX0A 5EKXA 1XDZA 3BH7A 5DBGA 1N2HA 2J59A 2I3ZA 1B8OA 2XD4A 3GLHB 3AJRA 2UDPA 3ZHXA 3PA6A 2O5VA 3I5UA 2VAPA 2BLLA 2XVYA 3QC9A 1JKIA 5E3HA 4NICA 3ECAA 5CB8A 1JIIA 3AI3A 2FETA 4BQEA 4JNCA 5K3DA 1NJ1A 5CCEA 4LY9A 3FOCA 1OIWA 3W5AA 3OZFA 3RRCA 2PN1A 3I45A 4IGEA 3KL4A 5EQTA 5BT9A 2V98A 4JDPA 3PFGA 4TXMA 5AQHB 4IP0A 3AJAA 1JJIA 1FTSA 4YREA 4BNZA 5CMLA 4NZPA 1OX4B 5U1PA 1FPQA 4MYDA 3NOOA 1NQVA 4QDKA 4BNGA 1K5PA 5JSUA 4P0QB 3OTOT 4IOLA 1GTL1 3KDAA 4TWAA 3OKQA 2HA6A 4DR1T 1A4UA 4X64B 2P6NA 2D0UA 4MR8A 3FNHA 1X70A 4RL4A 1T4BA 4D97A 5AM3A 3CIFA 3G0HA 3O47A 4C0SA 4NLLA 1EIWA 3QKIA 3G9TA 4HNUA 1NNI1 4AN1A 2J1DG 3WWOA 1WPQA 1ZI9A 2VXBA 2R1TB 1WPRA 2XUEA 2E9XB 1P3JA 5BSKA 5MFZA 3ME5A 3QVSA 3T3PB 4YJGB 1CZUA 4HSEA 1CUXA 2CBXA 3C5CA 3FKQA 4G5YA 5FUVA 1T8SA 3CMLA 5EZYB 1QFXA 2JAXA 3JQ6A 3AM5A 1JVNA 4MW0A 2OAQ1 2X0IA 3IP9A 1OZHA 3TB6A 4KYUA 2AOTA 2HHHT 3CW9A 4ZARA 2CF5A 2B8EA 3EHDA 5CVDA 1L8LA 2GUGA 5AJUA 1C1XA 3HABA 1KKUA 3OJOA 2I1WA 2Q21A 2RK6A 1N0HA 1F8XA 4EEZA 3UAVA 1GZ6A 1ORDA 5HEOA 1CDEA 1U0FA 1V43A 4WKCA 4F93B 2D5BA 1XCLA 4G0YA 3TPZA 5DI9A 4FUQA 3K73O 1Q0QA 2V1XA 4M83A 2IIQA 3ZC0A 2C7RA 3KWFA 4GM4A 2BGGA 4NVRA 1GP2A 5AW5A 2Q5LA 5TRTA 1PKXA 1KK0A 3VDXA 421PA 5JWOA 3LNTA 3FYCA 2X9QA 3PIDA 1R3UA 3OCCA 3EXFA 3CR8A 2N2NA 2VAXA 1CBUA 5J2UB 1YA6A 2W71A 3VX4A 2GD0A 3GRAA 5LZ7A 1EMDA 4MDEA 3PX2A 5IC5A 1E2KA 2BHSA 4LHZA 3JQRA 4JUIA 4LQDA 4KIUA 2B2XA 5TGZA 2CNNA 3S1LA 1USIA 2XGGA 3VKFA 4DUGA 2P9YA 1F8FA 2DGDA 1JUDA 1LK7A 1LRZA 4J4TA 2ZJBA 5C2JB 2WU4A 4ER3A 2ZRAA 4JJ7A 1UP7A 2IC9A 2JGLA 2FLKA 1JA9A 2VRCA 5JSKA 3KZOA 1ULUA 1WEHA 4JLBA 3NWJA 4G6ZA 5IT4A 4AM8A 1YWGO 1AHPA 2P5YA 3CEPB 1K88A 4H16A 3KR2A 2FDXA 4DCUA 1GT91 3KELA 1QO7A 2Z2XA 5IXSA 5G0SA 2XPCA 1DXYA 3C5EA 3TWOA 1D9XA 1YB1A 4L4SA 1W5SA 2YBEA 4KMRA 5H7XA 1D0YA 5BV0A 4YRDA 1JQAA 1ZRHA 1VKRA 3HJCA 2QXUA 1ZUD1 5CEEA 2P7IA 1XUOA 2CBIA 1XSEA 4OO3A 1GRNA 2QRPA 4JI1B 2XT0A 5JDCA 1BDHA 1ZGHA 3CUVA 3LC1O 4K9LA 3ZIAA 3E3OA 2FN3A 1HLDA 1C81A 5HCUA 5ALFA 2RARA 2C78A 4G67A 4PYJA 1OYWA 4HDKA 1TTQB 3UU3A 4JT9A 5JAMA 2YDSA 1SIOA 1QK5A 2HGSA 4TYWA 2H1CA 3IMGA 3O91A 5JSYA 5JSFA 5B2EA 3AESB 3T5TA 4HE8A 1TM1E 3HY6A 3IUMA 4E7SA 3QA3E 5CITA 5AQ1A 3BIXA 3UB3A 3ORFA 1IWPB 4IBOA 3TOXA 1DINA 3EEIA 2A0WA 4HGZA 5DI3A 3EHEA 1AU9A 5KEIA 5K2MA 2FWNA 2CW5A 5BW8A 4L4RA 4AG6A 3DDWA 2LCIA 4JI7B 3SQXA 1NURA 1V25A 1HG5A 1W29A 1Z0AA 4IL9A 4DJEC 3EC1A 3LO8A 2EX0A 4V1CI 3NHPA 3W15B 9ABPA 1U3FA 1T36A 1Q83A 3HGMA 4BN0A 3DA8A 3K70D 4J4HA 4QPZA 1G5RA 5AQSB 2JFWA 1W8IA 4HXEB 1NW4A 1FUYB 2DU8A 1E7WA 1I2AA 1WS6A 3TIGA 3QXSA 3NU1A 1R0LA 3ER8A 5A1LA 2RJOA 2J7KA 3LYLA 5CHEA 3IVAA 3CXRA 3ESLA 2VWAA 4LTMA 1CKEA 2QA7A 4KYIB 3ZJYA 3IHWA 3NBXX 2M1XA 4O2LA 3N3BC 5G53C 2WFLB 1RBQA 2RHDA 2RGCA 5F1PA 4C20A 1VCSA 4IIJF 3SYMA 5K6AC 4ARIA 3IDAA 2NLOA 1DKQA 3GY0A 1L4GA 2C2XA 4J1TA 3LI2A 2XTJA 4MVJM 3ZDBA 2OO5A 3H5OA 3HBMA 1QO9A 1ILWA 3OVUA 5J4YA 5FH9A 2XAGB 2GBFA 2NUPB 1NN0A 4FWIB 3LAWA 4TL7A 5FYDA 2IYWA 2JFOA 3WNVA 4ZQGA 3R84B 1OXUA 3ZCIA 4FYMA 2YWGA 4I4NA 4JBLA 3JQGB 2ZITA 3R3SA 3GGDA 5FBZA 2PMWB 2LEHA 1IWOA 2ZRNA 4KW7A 1Z2DA 3EPRA 1W0KD 2JFHA 4FTWA 2NXNA 3KXDA 2R8YA 5DQVA 4YV1A 2EWWA 3ZE2B 4ETWA 3KXKA 4JT8A 1H0KA 2YQ4A 3ESZA 3MLEA 2VK2A 4UEWA 3A1CA 3N8KA 2LP4Y 1KJNA 1WW3A 3WRYA 1S2LA 1VPWA 3OWHA 4AU1A 4LX8A 4H9PC 2GK9A 1ECBA 3H16A 2AN4A 3ICCA 4L3WA 2CWWA 1SB9A 3LFTA 2I7CA 1FDRA 4KIFA 1TF7A 3EMKA 4HH3C 3CK6A 4G09A 1RYHA 1XZNA 4OHMA 1YBFA 3MTBA 5DNEA 3E22B 1AKYA 1O6CA 4XWAA 4L9WA 4EYGA 1F2TB 4NIMA 1J06A 2QW8A 4F0JA 3DL7A 4IJWA 3OSZA 1JSCA 1TM7E 3LTNC 4IIYA 4PQEA 4EY8A 2P2ZA 3L04A 1GQEA 3QF4A 2C03A 3KJIA 4O2AF 1NQTA 4ID3A 1FLVA 3VU9A 3DXXA 5A6SB 3WI7A 2H07A 2Z8ZA 4PONA 5FKJA 1O8BA 2NO9A 2WIBA 4HGQA 3SSMA 4F38A 1ZK1A 2NVOA 4NG4A 2OV4A 5FF9A 5H16A 1SIUA 4GE3A 4HQLA 1I6MA 3H2HA 2X67A 3DWIA 1BVYF 1G8MA 1RXSA 3AUKA 5IPFA 3Q5DA 4MI9A 5BR8T 1PP4A 3PFFA 3K9WA 3NYRA 1KR2A 3FZNA 2ZLBA 1Y63A 4LRWA 2BEKA 1NU8A 3VR9A 1XVTA 4I1PA 5A4AA 5K3SA 3AKZA 1WR6A 1RC1A 3KXLA 1MLDA 4K9MA 3U37A 2G07A 3D6FA 2OZLB 3GPCA 4RVSA 4BRSA 1RIFA 1QVRA 4K3VA 4BO2A 1W9MA 3H5TA 3EVDA 3QMVA 1FFGA 3FXAA 1OVGA 4R4JA 2FUG6 4W82A 4BBPA 3QKTA 5AK3A 3WBBA 3LZDA 1WU7A 4EHKA 2Q7XA 2IODA 4DCOA 1G6OA 3C8HA 4C6TA 2W2XA 5JC8A 2EKZA 2O8NA 1G5TA 1PJLA 3HB7A 3UOAB 1RWKA 3ZZUA 2YWXA 2VR1A 3R0ZA 4K7JA 3OQPA 2Z43A 4KUMB 2HD4A 2QX6A 1FFBA 4PTZA 1OWLA 4NYIQ 4E14A 2HU5A 3MT0A 5AWFC 3OHPA 3GN5B 5I6DA 4Y9RA 2CNBA 4V3CA 1SM4A 3PJRA 4OOEA 4BHTA 4RTSA 1FXWA 2ZI6A 3AJ8A 3S3TA 4F85A 1OFIA 3OY2A 3ETJA 4I9HA 2RAFA 3OQNA 3DTYA 4OQNA 2JGFA 3AI2A 3LUJA 2PUBA 5GOTA 3BULA 1XG5A 3NHJA 4OU4A 1YNOA 3T3NA 3M8KA 4RY8A 2Y99A 3I1IA 4RYDA 1O2DA 3ET5A 2QMQA 3BHIA 1KFYA 1XZPA 4Z3KA 3WWZA 1F4LA 3CUTA 1N32B 4HDNA 2IY7A 4ETNA 3ZYLA 2LV8A 1ZD5A 1PBTA 4KMSA 3R3WA 3HN2A 5C8VA 1D2EA 5HMLA 3RIEA 4V1CB 3GH1A 2V7BA 3JQAA 3OZDA 1GUFA 3RWOA 3F74A 3T4EA 1NNEA 1P9NA 5AVSA 1XALA 4UEKA 2ODEA 3WDLA 4PC6A 2Q9BA 2Z83A 4XD2A 3N2OA 4AUMA 4P1NA 3Q12A 2C5FA 3ZZNA 5LJMA 4OATA 2CFTA 3HNPA 1IOVA 1N1DA 5FBHA 3UWKA 3TW8B 2QG9A 4DLLA 1B73A 2G4LA 3VDMA 2PTGA 3PGXA 4UAJA 1QQ5A 4GH5A 5G0WA 4PICA 1LPNA 4NNOA 2JFGA 5G1PA 2W8BB 1WXWA 1KOLA 5E4YA 3VUEA 4ZMSA 3P9SA 2JQ9A 4RVNA 3O1LA 1WXDA 4WAUA 4HSGA 1G8SA 1N5KA 5KDDA 1E1HB 1WAMA 4RVGA 2FV8A 4FWBA 3O92A 2VRBA 1Q3HA 1KFKB 3I04M 5HS4A 3MJVA 3L40A 2CXHA 5C4IA 1P0CA 1OGYA 3EG9A 2IGTA 4GKKB 4YC7A 3EQZA 4CCYB 3NHBA 5AW2A 3X0DA 4TMWA 5D1HA 3PHLA 1P1CA 4HEHA 1K7YA 2P35A 3HY4A 3MGCA 1E1QD 2X8WA 4MGHA 3I52A 4U7WA 3UFXB 1CY0A 1NBWB 3J80A 1DKUA 3EXIB 1J23A 4E21A 2FPIB 3X2EA 2A88A 3L7DA 1YMVA 2QF7A 4ZEYA 3DLCA 5DNWA 4JC8A 1P7YA 4K03A 4Z90A 2Q46A 5DBFA 2ACVA 1QGYA 3TUZC 3FETA 5TAOA 5CLQA 1I32A 1DHRA 3TLXA 1PQWA 1EFVB 2DETA 2JI8A 1DCTA 4G5XA 3TLZA 4IH1A 4U7GA 3M6LA 3LHFA 3W5SA 3ICEA 3D0QA 5TR9A 4CKCA 4EG7A 2BFWA 3SBDA 3JQCA 3N2KA 1B3RA 2JGEA 3QUAA 4G65A 4UFNA 5ICFA 1QJ4A 3FCSB 3C6BA 2R97A 5AVQA 1XPOA 4RETA 1Y3DE 1E8DA 4BZZA 4NY1A 4BFZA 2DPYA 4QICA 1Z82A 3VSAA 5KB3A 1PX0A 3IP6A 4RCVA 2HREA 5GJVC 3VR4D 1E63A 4EG1A 5C51B 4JUBA 5T64A 1VL6A 4GPD1 3PG5A 3PGJA 4BDSA 4O4JA 4YCNA 2WF6A 1XIVA 2X8JB 4YRSA 3UA3A 3TOZA 4RLFA 3ZK8A 1E8MA 2GCEA 1TF2A 3A2KA 5T41A 3PUQA 2ZIVB 1A8UA 1EDBA 1BHO1 2J9ZB 4GLFA 4CL3A 4XVRA 2X0LB 1SXJA 4RF2A 2FF7A 1L7BA 2OHOA 2X9GA 3KJXA 3J81k 3WMRA 1FU4A 3KPJA 1GN9A 4RH3A 3BXXA 1NPTO 1WSBA 4JOQA 4KR7A 2XOKA 4CEIA 2CLMB 4ENVA 2YWCA 4KQEA 5IG2A 4CMBA 3H1BA 2V8BA 2H2WA 4QFDA 3E5RA 3S2SA 1OZGA 3E2MA 1DAKA 1YKSA 1P5FA 4EVSA 2PUGA 3TQOA 1DAFA 3U1VA 5CDFA 3I6YA 2GM5A 3IX7A 3U4QB 3TLYA 1ECJA 5KWIA 2YMQA 4ZHQB 2UYHA 4B5KA 3CNBA 3ONNA 4RQUA 1P9WA 2B1IA 4FQ7A 3UN1A 1VI6A 4CQMB 3G2IA 1DAEA 1NASA 3KQPA 2I33A 1DQNA 4XJXA 1Q57A 3Q87B 3G89A 4DCGA 2VPZA 2H1VA 3UMGA 4Q24A 4TMZA 5TJ9A 1F8UA 1O5OA 1ZR2A 2SCUA 2BVMA 3QXXA 1OOEA 3H8JA 3UTDA 3UMRA 4E30A 4RZXA 3E1KA 3T1VA 5A4KA 1IVYA 1H0HA 3EQ9A 3SKVA 1SBHA 2H06A 1AKQA 1T1RA 3ZT6A 3OPQA 1AMOA 3ZX4A 2EL9A 2R68A 1TM5E 4GPEA 2NYRA 4F04A 3L1HA 5KCZA 1P4AA 3KUXA 2IX3A 3HE3A 5IYZE 1YVPA 1KJ9A 3RPEA 2XGMA 4BWVA 4GC9A 2XXBA 3RUHA 4DC0A 2EP7A 2AKEA 5AHKA 4AURA 5DKFA 2JFYA 4LI3X 1PG5A 4A3SA 1S9DA 3ETDA 4LKRA 1AN9A 1O9HA 3U40A 3R5TA 4R81A 2YDXA 4JA0A 2C5EA 3WADA 3JZMA 2EHOD 5E9WA 4IL5A 1HR0T 2X1VA 2MHCA 4D4LA 2IBMA 3J7Yq 3IPXA 1DZIA 4DSOA 5IHPA 2AG1A 5JHHB 3WHPA 1T2DA 4YAFA 3ZGYA 2BONA 4IDHA 1SC1A 3BN3A 1M76A 1F0KA 2PX0A 1BDMA 4LK3A 4NR0A 2J6HA 2GEVA 3PNYA