4OHFA

Crystal structure of cytosolic nucleotidase ii (lpg0095) in complex with gmp from legionella pneumophila, northeast structural genomics consortium target lgr1
Total Genus 159
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
159
sequence length
461
structure length
455
Chain Sequence
KVFVNRIINMRKIKLIGLDMDHTLIRYNSKNFESLVYDLVKERLAESFHYPEEIKKFKFNFDDAIRGLVIDSKNGNILKLSRYGAIRLSYHGTKQISFSDQKKIYRSIYVDLGDPNYMAIDTSFSIAFCILYGQLVDLKDTNPDKMPSYQAIAQDVQYCVDKVHSDGTLKNIIIKNLKKYVIREKEVVEGLKHFIRYGKKIFILTNSEYSYSKLLLDYALSPFLDKGEHWQGLFEFVITLANKPRFFYDNLRFLSVNPENGTMTNVHGPIVPGVYQGGNAKKFTEDLGVGGDEILYIGDHIYGDILRLKKDCNWRTALVVEELGEEIASQIRALPIEKKIGEAMAIKKELEQKYVDLCTRSIDESYDQEIHDLQLQISTVDLQISRLLQEQNSFYNPKWERVFRAGAEESYFAYQVDRFACIYMEKLSDLLEHSPMTYFRANRRLLAHDIDILEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Allosteric regulation and substrate activation in cytosolic nucleotidase II from Legionella pneumophila.
pubmed doi rcsb
source organism Legionella pneumophila subsp. pneumophila
molecule tags Hydrolase
molecule keywords Cytosolic IMP-GMP specific 5'-nucleotidase
total genus 159
structure length 455
sequence length 461
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05761 5_nucleotid 5' nucleotidase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1160 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4ohfA03
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 4ohfA01
3AR7A 3AR5A 3I6BA 1SWVA 1TJ5A 1YJ5A 1ZS9A 1RKVA 3OCXA 3N8GA 1L6RA 4C4RA 3ZX5A 1ZOLA 5AK6A 2P69A 2D2VA 4EX7A 5AI9A 5AKIA 5AI8A 3ZWKA 3FVVA 3KZXA 1RMQA 1CR6A 3KOOA 5AM3A 4BX3A 3SHQA 2P27A 3MC1A 2YMPA 4UMDA 5ALLA 4I9GA 3AR2A 3QUCA 4CE6A 4HYTA 3QU7A 4CF4A 5ALSA 2HO4A 1RLTA 1Z5UA 1VJRA 3WK9A 4RETA 4RESA 1WVIA 2G80A 4UARA 4BNDA 3N28A 1WR8A 2B1QA 1YV9A 2C4NA 5ALUA 3U13A 3K1ZA 1Z4PX 3L1UA 3ZWDA 5AW8A 5AHXA 2ZOSA 1AQ6A 3S6JA 3WKAA 3ESQA 2WF7A 3GYGA 2ZBFA 4PNHA 4UU0A 4YCLA 1TJ3A 1O03A 3SKXA 3FZQA 3UMCA 2FPXA 2HCFA 1RLMA 5ALYA 1QYIA 2EARA 3KDPA 4KNVA 1FEZA 3NASA 1YS9A 5AI0A 3ZVNA 4J2TA 5ALIA 5ALRA 1Z4MA 3NUQA 2FPSA 4XQ0A 3ZTYA 2R8ZA 3I28A 4UASA 4IG4A 1RQLA 2B8JA 3WK4A 2VKQA 3J7TA 2HHLA 2HF2A 3E58A 2YN4A 2G1AA 3ZUPA 1J97A 5AVUA 3OCVA 5AK5A 3L8GA 3QXGA 5AM0A 3F9RA 1Z4QA 1ZD4A 4AS3A 3BWVA 4AP9A 5AM5A 2OA0A 1U2TA 2G09A 3HLTA 4NWIA 4KYTA 3W5AA 2AGVA 2WF8A 2C8KA 3R4CA 5IT0A 5AK4A 5IS2A 2ZG6A 5AKLA 2CFTA 2HF7A 3VAYA 3W5CA 4Y2XA 1CQZA 1ZRMA 4NV0A 5ALKA 3ZX4A 1VFPA 3SD7A 1RQNA 3ET4A 3WK7A 3E84A 2G07A 2WHEA 4ZEWA 2DQSA 4L6CA 3I76A 4DCCA 2GO7A 3WKDA 3PCTA 1Q92A 5AI4A 4QJBA 4FFDA 1QQ5A 2FI1A 1U7OA 3OCUA 5AW6A 3FPSA 2B82A 3DNPA 4Y2VA 4BEWA 3L1VA 2I7DA 4EZEA 5AVVA 2R8YA 3QX7A 1RMYA 1RC8A 2FPWA 5IT4A 4UW9A 2HX1A 1U2SA 2ZBGA 3FPBA 5AKXA 2YMLA 1MH9A 5AVRA 4Y2QA 1L7MA 4EENA 1ZJJA 4O8CA 3NIWA 2GHTA 1YMQA 3WGVA 3N07A 5ALOA 4Y2TA 4CF5A 2W11A 4YCNA 4E88A 4BEVA 1T5SA 3CZ4A 4Y2YA 1RMTA 1QQ6A 4HGNA 4KNWA 3N5KA 3QNMA 3U26A 2HEGA 1EK2A 5ALGA 3L0CA 3A1EA 5A3RA 1SWWA 2P9JA 5AW2A 2O9JA 3FM9A 2GFHA 3I1YA 3MMZA 3ZTWA 5ALJA 1RKQA 2G08A 3QU4A 4OD0A 5A3SA 2HOQA 4UM5A 3W5DA 3L8FA 3AR3A 3BA6A 4YIKA 2Q4TA 2C9MA 4HGPA 2I34A 4EX6A 5T41A 2G06A 4OHFA 1Z4IA 5JJBA 2I6XA 5ALTA 3ZU6A 2JAOA 4XOUA 3B9RA 4YIHA 5A3QA 4UMEA 1O08A 1Z4KA 4Y2RA 3SKYA 4J03A 1EK1A 3OPXA 3ED5A 2PQ0A 4G63A 1QQ7A 3NALA 3MN1A 3QUQA 4Y2UA 4FYPA 1TE2A 2B1RA 5AKYA 3UMBA 5AKKA 2QLTA 3E8MA 1F5SA 4BYGA 1RRCA 1Z5GA 4MUMA 3SMVA 4Y2JA 3A1CA 4IFTA 4F71A 2FUEA 2IOFA 1N8NA 2ZBDA 3OCZA 4KX5A 5AICA 3E81A 4Y2PA 3FGOA 4OFZA 2I54A 2AUTA 3EF0A 5ALVA 2B30A 1Z4OA 3HYCA 2Q5EA 2R8XA 2ODAA 2YFYA 4OCZA 3UM9A 5AVSA 2IOFK 3L5KA 3AR6A 3OTQA 5ALQA 3IRUA 5FP0A 3WGUA 3EWIA 1WPGA 3NANA 4CF3A 1VJ5A 4HGOA 5AKHA 2GHQA 3CNHA 3U7GA 1L8LA 2IA5A 5AW5A 4UAVA 1Z4LA 5AKEA 3IJ5A 1JUDA 4G9BA 2BY4A 4XPZA 5AKJA 2CFSA 3SF0A 1YDFA 3DAOA 2P11A 1WZCA 1RKUA 3DV9A 3M1YA 3PDWA 3A1DA 2W43A 4HAIA 3R9KA 3OCYA 5ALFA 3KD3A 1NRWA 4XE5A 2YMQA 4BX2A 4DWOA 3RFUA 1TA0A 4GIBA 3QU2A 3L8HA 3WKCA 4MWOA 4DW8A 5ALMA 1NF2A 2CN1A 2FEAA 2MSNA 5ALNA 3QU5A 2RB5A 5AVWA 4UAUA 4BX0A 1ZD2P 5AI5A 1RDFA 1L8OA 3UMGA 3U19A 4C4SA 2I33A 4UU1A 1U02A 1ZD3A 1IWOA 5AW4A 2AMYA 2GMWA 2YJ4A 2NO4A 2JARA 2YY6A 3U7FB 3EPRA 2FUCA 3PGLA 5AW1A 3W5BA 2B8EA 2RAVA 3NAMA 1ZD5A 4QQFA 1S8OA 2YBDA 3ET5A 2NYVA 2YMMA 3B8EA 2WF6A 2BDEA 1Z4NA 5AIBA 5ALEA 2AH5A 1S2OA 5AVZA 1YNSA 2JAWA 3QU9A 4ZEVA 3ZW7A 1L7NA 5ALPA 3N1UA 4KX3A 5AIAA 1Q91A 1L7OA 2OM6A 4NAVA 3QUBA 4Y3UA 4H1WA 1RPZA 4AS2A 1K1EA 4L6AA 5AW9A 2YJ5A 5AW7A 3QUTA 4C4TA 5AKZA 3D6JA 4I9FA 2C88A 3WKBA 4EELA 2ZXEA 2FPUA 4KN8A 2BDUA 5AI6A 5ALZA 5AW0A 3SLRA 2W4MA 3TLMA 3ZVMA 3L7YA 5AVYA 3L0YA 3RF6A 1TJ4A 3AR9A 4BBJA 2Q4RA 2WFAA 2I55A 4HGQA 5AESA 4CNQA 1L7PA 5AM2A 3U7HB 1KYTA 1NNLA 3QGMA 4ZEXA 3NRJA 3U7EB 2WM8A 5AKGA 1XVIA 3DDHA 5AM1A 2YJ6A 1XP5A 4GXTA 4YGYA 1N9KA 2FDRA 4YH1A 5E0OA 2QYHA 3KC2A 2HSZA 1U7PA 3M9LA 3A3YA 2PR7A 1X42A 2FPRA 2OBBA 3L0BA 1Y8AA 1J8DA 5AVXA 4JDPA 3ZVLA 4NABA 1SU4A 1T9ZA 4JB3A 3WK5A 4UM7A 5AK3A 3B9BA 3PGVA 5ALWA 3ONNA 2JAUA 4UMFA 1T5TA 4NFLA 1Z4JA 5AVQA 1LTQA 3WKEA 3ESRA 2X4DA 2CFRA 2C8LA 3IB6A 1QH9A 3OCWA 1LVHA 3QLEA 2EATA 2G0AA 2IOHA 3P96A 4Y2SA 4DFDA 3KBBA 2B0CA 4YCMA 1Z88A 4BNDB 5AW3A 2IYEA 5AVTA 2JGAA 3EF1A 2MU1A 2O2XA 4FE3A 4UMVA 3WK6A 4B6JA 2PKEA 3QYPA 2HI0A 2R8EA 4L57A 2ZBEA 3ZI4A 4F72A 5AM4A 2EAUA 5ALHA 2RARA 2OYCA 5ALDA 5ALXA 1PW5A 2HDOA 3R09A 2WF9A 1ZRNA 4HGRA 1XPJA 4BKMA 2RBKA 3MPOA 2NO5A 2YJ3A 3AR8A 2WF5A 3AR4A 1RLOA 4EEKA 3L8EA 4UATA 3WK8A
chains in the Genus database with same CATH superfamily
3ZDQA 1T8RA 1XYGA 2BIFA 5AK0A 5JPDA 1TMOA 2GPWA 3E0XA 2WYVA 4XB2A 3LPDA 4A6PA 1SUEA 4QHTA 2QW8A 4S0XA 2H1RA 4N6NA 3CWCA 4BFUA 4TZTA 1IN1A 4PC3A 5LD2B 3FMPB 1A9XB 2P3SA 1USWA 5JCOC 1HE3A 2I6HA 3K9GA 5LN1A 5K3SA 3C98B 5C3UA 2CXTA 2G7ZA 3VPCA 3PJAJ 4ND2A 1PV4A 2ZYHA 5AI9A 2BBOA 2E5FA 4PG6A 4XUGB 4AIIA 4I9NA 3RYFB 5EPOA 5EXEA 4D7AA 3FVVA 3I8XA 4NZYA 3EDYA 1DAMA 4MLDA 3D6MA 2V7WA 1AIPA 1IBLT 5FWXA 4M7OA 2ES0A 3QNUA 1VCIA 2LJLA 2BMJA 2G9QA 2VWHA 4JNCA 4HWPA 1ZMBA 5LJLA 1BOFA 5LA6A 3CJTA 3D5QA 1DEAA 1Y82A 2XAGB 2Q3EA 2XZOA 1BWQA 1RP1A 1Z8DA 3WHLA 3HV0A 1MT0A 4GLLA 3TAXA 1XVAA 2N46A 3LX6A 3VGPA 1CC1S 1JQ5A 3X1DA 2FLVA 3P0RA 3QE4A 2IHKA 3SR3A 2EBUA 2CLSA 3VVLA 4CFSA 2I2DA 4JI8T 3OCJA 4GHWA 1BD4A 2COUA 1ZCAA 2PO7A 2O8EA 5H6QB 1JBKA 3UMMA 2V6YA 4ZMRA 1Q7CA 3JWIA 2WAYA 3ZXYA 4TKVB 3RARA 3AI3A 4QPCA 2CBZA 4ZVVA 5J4HA 5TR9A 2C4NA 3MJTA 4FFWA 1Y3CE 2DCUA 4OGGA 2CCGA 3LZCA 3FPKA 4HEJA 2H4YA 2BJHA 3MZKB 4DV1T 2R00C 4FBGA 3GRUA 4YSXA 4AAYA 1E2IA 2B34A 1EG7A 1DI0A 4G07A 9LDTA 4AW9A 4KRYA 4DV3T 1IUPA 4TX5A 1IHDA 2H5JA 3AFHA 3C85A 3DTNA 2E48A 3FGNA 2QPAA 3TCNA 2GCOB 4BQNA 3RRNA 2UUBB 3I1JA 3QEMA 3OAAA 4IUBS 2C95A 2REBA 5DXJA 3VO2A 3PEYA 1P1KA 3FMIA 4IS3A 2JRKA 1NVXQ 2C4TA 2HCFA 3O2JA 1GR0A 2BFAA 3R23A 4LXUA 3D7KA 3NWEA 5E6SB 4WLNA 3NIDB 3P5BA 3SBXA 3JAMA 1QVRA 5BQOA 4KC0A 3AEFA 5HGXA 5I5EA 5HTKA 3V9AA 4EF6A 1G16A 1SRRA 3P0JA 3NASA 4MPPA 4U3JA 3VM6A 2WA2A 4O4HB 3LL4A 4GUDA 4MQFB 2LKCA 1ARZA 3H18A 4PLFA 5I7UA 1UANA 3ZTYA 3THYA 1V4NA 1P9LA 4MGKR 1A1VA 4PFOA 3TTYA 1IEXA 3DAGA 3TLXA 2AZMA 1DRVA 2VKQA 5FA8A 3RLFA 3L18A 1RJ9B 4LW8A 5EHNA 5JLJA 2O54A 1YI1A 3CZQA 1Z8HA 3DLTA 1HY3A 1U1CA 3ONFA 1UQTA 1K98A 3Q87B 4PG8A 5L3SB 1N3LA 2TYSB 4QASA 2I80A 5IZCA 4KQEA 3FTCA 2DERA 1HE8B 1LRLA 1NN3A 1KP9A 1FMWA 5HCUA 1BEEA 1BR2A 1FLAA 1EI9A 1FP4A 1HYQA 3MKDA 2IIBA 2WFZA 4QOFA 4P5PA 4XB6B 2JGRA 3DOCA 2OVBA 1IHPA 3TG8A 3IHLA 1EM8B 1BHSA 4OATA 4RVSA 4DNDA 2FG5A 2FP3A 4YWHA 5KPDA 3Q8LA 1FP7A 1P33A 3D6TB 3TR6A 4BFCA 2DUWA 3BRWD 3OPYB 4WFJA 3S2SA 3D5TA 5AK4A 4U5QA 1VXOA 3OHPA 1B0UA 2JGMA 3E6AA 3G2HA 1IUOA 1CIVA 1AV7A 1L8QA 2AE1A 4FTWA 4NX2A 1M1NA 3OJCA 2HF7A 3V1KA 5JC1A 2JIOA 1F4LA 4F2WA 1BR4A 3M70A 3W5CA 2H4XA 4C90A 4XB1A 1FQJA 1KYYA 5IT5A 1U3GA 1USUA 4EY6A 3VR5H 3TZKA 4H7FA 2NTYC 2P6NA 2E4XA 3TEJA 3OF2A 3P2JA 3Q0IA 3WBBA 1JS1X 1CT9A 3CW8X 2AJBA 4B31A 2HMYB 3RIGA 4RKRA 2X6TA 3HKBE 5IAEA 2VQFT 2BW0A 2Q8QA 4HXFB 3VHQA 1K7SN 3NBXX 1QFYA 4OHXA 2HMSA 1ZHOA 1V8ZA 4I55B 3A37A 1N5DA 4M1OA 2ZAGA 4QTTB 3K9WA 4R98A 2ZYWX 4LF7B 3TLTA 1XE3A 1JPUA 1S89A 2XEXA 1G8XA 1C3JA 2GBIA 3U4CA 2QV7A 1DP4A 4JQCA 2VPPA 4AN1A 2I03A 3PPIA 1RM3A 1T36A 5BSMA 4HKTA 1QTIA 2NZYA 1XTZA 3CUSA 4RE5A 4H1VA 3RUAA 1RAIA 3DF7A 3U44B 1I7LA 3PRKE 5E9JA 1N2EA 1JKMA 1G20E 2IOYA 3BL8A 1NF8A 4G4JA 4GOOD 4ZIRB 4CXMA 1WBJB 4FMCB 3PX7A 1VDMA 1XZEA 2J5QA 3NJ8A 3ZGYA 3WGKA 1MABB 4F1WA 5JNSA 7ADHA 2Q1XA 3QVVA 5CG1A 3EPPA 3O4JA 4YCBA 4RX1A 1V8DA 4GH5A 4QOGA 3FPBA 4UUQA 5CEEA 3FFWA 4POOA 1S1CA 3ZWVA 3DTVA 4ENTA 4EAAA 1W0KA 4WVFA 1K92A 4G8BA 3NIGB 4KMRA 3X1MA 1MOPA 1Y9JA 3DQPA 1ZJJA 4AJNA 1QQAA 2FSSA 3P71T 4NNPA 4EZ4A 1QZ3A 2A4KA 3EGDA 4G5RA 5AQOB 4ZIRA 1M0TA 2NU8B 2C9BA 1AK1A 3MWJA 3ELDA 5KNDD 1OZFA 1WXFA 5ALGA 2BJWA 4NJMA 3A1EA 4BO2A 5KNDH 2XV1A 1TU3A 2NN3C 4FN5A 4GUAA 4UE6A 2BGRA 3UH1A 4HUTA 4V0LA 1RKQA 1U0JA 3AF1A 3ER8A 1F6BA 2IXEA 3R5FA 4MARA 4H9PC 4XX1A 4BO8A 4ZGGA 1IIBA 3QVGB 4NVRA 5GY7A 1VHJA 3AR3A 3PQ4A 4TL9A 1PLJA 1GLNA 4MIKA 4YIKA 3TSOA 3V7UA 2D6FA 4EX6A 1XTIA 3DEHA 2VN8A 1PT8A 3H1GA 4OYHA 2GM5A 2J3QA 4ZCTA 4MINA 1DKOA 2QRVA 3JARA 4RYLA 1WVGA 1BN6A 1OFIA 1DZIA 2ODPA 2VEOA 3IAUA 2HMVA 4IOLA 2GZ2A 1STOA 1I51A 5EXPA 5JMWA 2O2DA 3ZVKA 4X7MA 4MEAA 3A0UA 4RGBA 4HMOA 4QOEA 3HXOA 3NKLA 2Z5FA 3N7AA 2E21A 1WYCA 1G21E 1NJ8A 3H9UA 3KQPA 3T7CA 1A9XA 1JLSA 4DDMA 4HLDA 5BR8B 1HOTA 3KJFA 3CLSC 3GXOA 3PUVF 1A4RA 2PRJA 3L6EA 2DWGA 1K9VF 3CR8A 2GB4A 3HNPA 3ZKWB 1CYEA 2HSEA 3UJ7A 3W4JA 3LS2A 1F8XA 2D59A 5L45A 1TM2A 3KJGA 3QUQA 4DV4T 4MEJA 3ZXIA 2A3DA 5GONB 4GVLA 4Z5XA 2NUTB 3SF8A 4GYYA 3PUYA 4UC0A 2C2HA 3PVCA 3CISA 1FYFA 3NCTA 5FA6A 4CKWB 1AK2A 1FFXA 1OT5A 1ADFA 3IXLA 4G0YA 4O08A 3IDZA 4ARSA 4RA6A 4LIPD 1WP4A 3DFFA 2HA3A 3IKVA 1PEDA 4AQFA 2PR2A 3IOMA 3K4PA 2I2XB 4AURA 1W48A 2IEIA 4HYYA 2FCAA 2I6FA 3FXDB 4BQQA 3K8PC 4JCOA 5A3VA 5DIZA 1F8FA 3GC6A 2D00A 1IXKA 4GNKA 3HDGA 1N7GA 2HXSA 3I0QA 1ZSYA 4LFAT 5EMJA 3WGZA 4AM8A 4CLXA 3FYTA 2XJ7A 2X42A 4CI1B 1VYVA 2VDJA 3KQWA 3WAJA 3KZCA 4MV4A 1W29A 2HFJA 4XJTA 5SZKB 1XZPA 3M5PA 5DLEA 3TOVA 4ABTA 3EQ7A 4RPLA 3AVXA 4AQFC 4Y6SA 1L4FA 2BKOA 1XDGA 2AOTA 4H60A 5JVDA 5JS6A 2O23A 1TLFA 5ITWA 2IDJA 3PQ6A 1KZ9A 4DVDA 2O1SA 1VP9A 1JQKA 1FSGA 1JSLA 4YP6A 3AHGA 4IP0A 4Y8VA 1S7CA 4P0QB 3JVVA 4HDMA 2ZATA 5J47A 4M36A 3SF0A 3DAOA 3PDWA 1P6UA 3URMA 2JH3A 3NBUA 3KYCA 4FUQA 3E3NA 3HA5A 4JUAA 3ZY5A 1L4GA 4IQ4A 2EGHA 1UCUA 1VZ2A 3SM9A 1W4ZA 8MHTA 1Z6QA 3T1VA 1B1CA 4EPYA 5LNK1 2ZR7A 1X77A 2BSQA 1FUKA 1GUBA 2ETXA 1QIMA 2PM8A 2YJZA 3QBVA 4HWDA 5HDQA 3O8NA 2H1HA 3ZHXA 5T4EA 4YV1A 3ISJA 3CH4B 5IULC 4IWYA 5JNLA 1J24A 3HCAA 3KV9A 2XUEA 3M0EA 4H17A 4B7UA 3T0IA 1XPUA 3CONA 3X3HA 3DULA 1OIWA 4PLVA 5FBWB 1ODFA 4N8SA 1XQ1A 3QG5A 1ZD2P 3AKDA 1R00A 2FMHA 3PVZA 4AIUA 2X86A 5KOJB 4M8LA 1DFGA 2YY7A 1Q3TA 4L3WA 6LDHA 4RWEA 1XEXB 4ZC8A 3A3NA 4BVEA 2AZDA 4YXDA 2H0AA 2ZAIA 4GDMA 5I7SA 4HBGA 2WSLA 5DBFA 5TJHA 4IH9A 4LZOA 3TI7A 1IM8A 1R6VA 1DHTA 2WMNA 1H8HD 1OYYA 4PR0A 2OAP1 3O1JC 3C97A 4MLCA 3AEQA 4A5OA 4XD2A 2PLFA 4X65B 2P2GA 2BWJA 4QU9A 4M8KA 3LBXA 3DMDA 2C3PA 2Z43A 2XXAB 1JQDA 4Y1GA 1Z2AA 2UZAA 3FAKA 2CLDX 1ZGZA 3GLTA 3WQRA 3EA5A 121PA 1N6RA 4HN9A 2GZMA 5K8VA 3OZFA 1M6WA 4X63A 4D25A 3TEMA 3AVOA 5LYJB 3MTQA 2ZZNA 1C9NA 3R6WA 4B80A 1Z28A 1DKMA 1Y80A 5JALA 2CWWA 3PDIB 5F1OA 3C3XA 4JLOA 2NX2A 1QHHA 3CLTC 1QFMA 1X1DA 1QYCA 2Y6UA 3L4KA 5GADl 3WLHA 1E77A 2C5HA 3UMRA 1LVGA 1QYRA 3W2EA 4LOAA 1ST3A 5GV8A 3CYFA 1POWA 3Q7EA 1E99A 5ECGC 4B1FA 2WQZA 2WP9A 2CNLA 1I3LA 2V1XA 3BYZA 4IYJA 4PFQA 1P60A 4MQ4A 4W1QA 3Q6NA 1RP7A 2CNDA 1XQ6A 1JSRA 1R8JA 2PPVA 2XVMA 1QCCA 4KWHA 4DMWA 3S1SA 2MSDB 4J0FA 3NNDA 3F6CA 4A0SA 3NHZA 2ZB7A 3EDCA 1KETA 1QFJA 5HYAA 3F49S 4AUKA 4DHEA 2W22A 3K0FB 1N2CA 5JXWA 3M2TA 4YO7A 4TUYA 3D2AA 3LQ4A 4I4TE 2Q21A 2JQQA 1MAWA 3PR2B 5AI6A 5DK6A 2KMFA 2NWQA 1P7CA 3K6KA 1VHTA 2HK6A 3E35A 3LP5A 2OZLB 4M0DA 4TYQA 1LNZA 2QRGA 5FJJA 3OQ6A 4MI1A 2ECKA 3TLAA 2J9YB 1M2NA 5L4HA 5DGHA 2K7FA 2RK6A 3EW7A 3H83A 4CV2A 3VC1A 1X3SA 1GKUB 3EUHA 1UDRA 2TMKA 2WAXA 1QO7A 4US0R 8AT1A 2BKNA 2QGZA 2WSSA 2I55A 2D74A 1NVDA 2B5WA 3W3AH 4ZOLE 5KCMA 3WYAA 4CNQA 4G1FA 3FRJA 3E1KA 2AUMA 5MN5A 1MH1A 3JZIA 5ILGA 2RHHA 3FB4A 1DUSA 4NE7A 4M83A 3PEUA 4J4BA 4DYHA 1W52X 3GV0A 2Q9QD 3AETA 1CRQA 2VF7A 4QE3A 2Q2QA 1NJ6A 1YULA 1USGA 2X58A 4ZHQA 2JLVA 1XRSB 5CJ2A 1S2MA 1Y4AE 3CZCA 2H7YA 3M9LA 4BDTA 4PRYA 4BMOB 1SAYA 2C5FA 3CPSA 4DUGD 4ESHA 2VT2A 2XOXA 2FKAA 3BCHA 3BORA 2IHUA 1MNEA 3R3JA 4ZT5A 3WK5A 4QUKA 5AK3A 1PE0A 1FYWA 2GK4A 2XQ6A 3DQZA 1RQ2A 2EKQA 2Z8YM 1N2OA 1EBBA 5AJTA 2LM2A 3MLEA 4I1IA 1X14A 4A0FA 4C0AC 3B82A 3EWNA 1XU9A 4IREA 5JQGE 2AJDA 3GFFA 2UXXB 4U3CA 1JECA 2J30A 1RWBA 1X7WA 3AG5A 4JXKA 3O7MA 4OK6A 4R2MA 4XA8A 4B73A 2FSGA 4G2NA 4NE2A 3SX0A 3AB3A 1GUFA 1YOVA 1ZITA 5F33A 1N5JA 1A8QA 1Y1RA 3PDCA 2QIOA 1ECGA 3DKKA 4AJ2A 2PWBA 4BS9A 4Y2SA 3T3OA 1Q6YA 3KBBA 4P53A 1XWMA 3CX7A 1DIBA 1RTTA 3EXHB 5JVDB 4M88A 4TX1A 3JZFA 3ZIDA 4DWVA 3HWRA 5AVTA 5L7TA 1WJGA 3BH6A 4W99A 2MDTA 3EBLA 3GY0A 4ENWA 5M7EA 3R1IA 1NQTA 3K09A 4U7JA 5CNIA 1CRWG 2JLBA 5JBNA 5KTSA 3NRYA 3X1XA 2GJKA 4L5YA 4YRKA 3CH6A 3FIJA 2ZSAA 1TEXA 4WD3A 5KAPA 3C3AA 3WRXC 1BKYA 3TMAA 4LMKA 1UBLS 2XSBA 3K30A 5GJBA 3Q2OA 4JI2T 3LUCA 1TPZA 3S8MA 3QX9A 4TRNA 5IEJA 4LDRA 2QYSA 2OCXA 2ZI9A 3H87A 4D8YA 4JUYA 4N47A 3GIWA 1J0CA 1GU7A 2CL7X 1YR8A 3PU3A 3E48A 3JQ7B 4FIDA 4GVPA 4HGRA 4LF8T 4CKWA 2YBEA 2RI0A 3OF5A 4GLFA 2BD0A 3KKQA 2XNDD 4ZCRA 4M1QA 1E7PA 2P0YA 3HN6A 4K28A 1LSUA 5LHIB 1E1NA 1UT8A 3OH8A 3P4UA 2WAMA 3LK7A 4U2EA 2HCBA 2V8BA 3T9DA 1SKYE 3QVTA 4BLOA 3F47A 4F06A 1IXRC 4F60A 3ZK9A 1G5RA 3ER6A 5ERYA 2WIJA 1DIHA 3DSRA 4E7ZA 3RYHA 1F17A 2OK7A 1D2EA 3DCIA 4WASA 1WXDA 2QG6A 1THGA 3HVUA 4GR9A 3RE1A 3TZEA 1Q7TA 1AHPA 4Z8XA 5E7QA 1E8NA 4M0CA 3AF4A 4FONA 1YR9A 1XX6A 2LNDA 3HSKA 3NDPA 3DT6A 4YP5A 5F4ZA 3MINA 621PA 5KCZA 4KNYA 1R5OA 3H05A 4IHJB 2AXEA 3NZEA 2LSGA 3HXTA 3MQFA 4BVGA 1EVQA 3RVJA 1H5UA 1NVBA 6GPBA 5CUQA 3ZWKA 2MINA 1T7SA 3KZXA 4J0KA 1G8GA 4YLGA 4OK0A 2XWPA 1JIIA 2D5BA 4PIPA 1W581 4D9MA 4ZS2A 1B14A 3OOJA 3EZFA 3EX7C 4HKAA 3K53A 3EGVA 3RS4A 4AF8A 1GKLA 1LEHA 1Z7WA 2NPIA 3FKQA 5CVEA 4ZZIA 1OPXA 3B13A 1PX0A 3VU1A 3CWZA 3IUQA 1UBOS 3U4AA 2RA1A 5C0OE 1YVPA 3AR2A 2JLXA 1IBKB 3GXBA 1G9XA 4ZOBA 3UYLA 2DB3A 1BAPA 1K8XB 2TECE 1WV0A 2AQIA 4HEHA 2JFZA 1X94A 4WDRA 4DV2B 5M04A 1YZQA 4AQ7A 1P4AA 2ZUBA 4K6KA 5ICCA 2JGJA 4AKGA 1MT3A 1VE7A 1WDTA 1XLTA 2ZU0C 4JKOA 5DM1A 5G2OA 5TQJA 4B4VA 4YV7A 1DBPA 1KERA 1QTNA 5E4TA 4ALJA 4DNQA 1DAEA 1NYLA 3IQXA 1K06A 1VLQA 1R0LA 2ZWIA 1UXJA 1L7AA 2B1QA 4HD8A 4MPTA 4ZTZB 1BNCA 1Z38A 2WZBA 1XL0A 4LY6A 5BRJA 5DDIP 1CZOA 1W2GA 5BRAA 5FKJA 3WAKA 3L1UA 4EHFA 4YRMA 4ZEMA 1PZXA 5EUCA 3C6MA 3H8JA 2PUGA 2BG9A 1LQUA 2E9XD 1D2AA 5HAXA 2WKPA 2GILA 3VVCA 4A8HA 3N5CA 3ULKA 3ESQA 1Z7EA 2PT6A 3ZY6A 4BFXA 3F71A 1EFTA 1Z26A 3OZBA 1DQSA 5GGXA 5CA0A 3AL2A 3ETHA 4XPIB 2FWMX 3FCXA 4RY8A 2D5IA 2CHEA 3KOXA 5F35A 2XCUA 4CT5A 2RGBA 3A32A 3GRVA 5EQDA 4E6EA 3I12A 3U62A 3JCFA 2AVDA 4H9OC 3WO1A 1RHRA 1YVEI 3R40A 4Q6WA 3TSZA 4ZI3C 1MV8A 3FYUA 3IPCA 3QXSA 4ZCPA 2JIDA 4EMBA 3ZBUA 3WYEA 3L84A 1J00A 5L3EB 1GL6A 1R5JA 3WAGA 2DG2A 3VI3B 1PNQA 2YV5A 3U39A 3K4QA 4DMHA 1HGXA 2PU5A 5K3OA 1P0QA 1EH5A 4UASA 1YL6A 3GLRA 4MPDA 3CFYA 2X0HA 1M2EA 3EY9A 1KNRA 3QMPA 2JCSA 3IBSA 1IOVA 4ZI2C 1EGQA 5AJUA 1SEVA 3MFYA 1JFLA 2ZTUA 5EXXA 2WWWA 3RYFE 2EX0A 6ADHA 1G2IA 2EXXA 3AFGA 4JJKA 4V39A 3I8OA 2QTAA 3ZD8A 4AICA 1FRNA 1YBMA 1A4IA 2AQ8A 4G0XA 2XHZA 1PTJC 4Y6RA 1TXGA 2QU8A 4C7KA 1UK9A 1GTVA 1OT3A 2YC2C 5BSRA 1KO5A 1U0NA 4EATA 1Z9BA 2EQ5A 3ZWOA 4PJLA 1FMFA 1DBVO 3T0GA 3NYRA 4P31A 3OZXA 3SU8A 1XLVA 2QN3A 3CGGA 1UBNA 5AOAA 4R4JA 4N65A 4HRAA 2Q62A 4MV9A 2D1TA 2XTLA 2IVFA 4KYTA 3R2JA 3R7LA 4QVIA 2DR2A 4RIIA 2QUBA 4ARVA 4YY3T 2PX4A 5IN5A 4DG9A 1DDGA 4DB4A 4PC6A 3AGPA 4FOLA 5DRTA 2V45A 1GDHA 1WSAA 3TNDA 3DEJA 4BWYA 4WKGA 2IHNA 2H4HA 4R83A 1Z2PX 2OILA 1QNFA 1BVRA 1WCIA 4P0BA 3RHFA 3GW8A 3BGVA 2ASVA 1AF7A 5IKPA 4KN9S 4QDTA 3G79A 4B3HA 1AXEA 3SFZA 1KJYA 4QBFA 2IUUA 2C99A 2H18A 2ENUA 3DF9A 2KI5A 2RC5A 2ANCA 4B79A 1AM4D 3T5AA 5KTRA 1SQ5A 3E7FA 1N3YA 3NHFA 4MWBA 2AEMA 4DNOA 4L6CA 4EPWA 2XAQB 2VJBA 2Z2XA 4NZMA 4DCCA 1XTVA 1S94A 4OSPA 1PL0A 3FCOA 4LRYA 4MRMA 3WP1B 3EXHC 4LN1A 5BSGA 1E0AA 4GK5E 4WZXA 1TQHA 1AURA 5DGCA 2C4VA 5CH5A 4O4JE 4LYYA 5EJMA 5B37A 1CHNA 2LCFA 3ROPA 5HIIA 5UKDA 3OCUA 1C4KA 3Q3IA 5DASA 1KHTA 1RM0A 1C30B 1ZIPA 4M9RA 1MIHA 5E9QA 5CDFA 2ROQA 2K5UA 2Z09A 1J5PA 4LJ5A 1AX9A 2JAHA 2VHEA 1H85A 4UUBA 1JYSA 2AMJA 4ARAA 4ETMA 3R8FA 4R41A 2RGGA 1G3RA 1UZNA 1OI3A 3OMXA 5JUWA 1W30A 3FWKA 2C5AA 1NBWB 3CG4A 3COZA 1QIJA 4HAXA 3TE6A 3OQMA 1ZI6A 2JFQA 4J1NA 4ZN6A 4CN1A 2LEHA 4XWWA 1GGEA 3SXPA 5AD1A 5JFOA 4NOLA 1E5TA 3SOPA 1QVWA 3GEPA 2CWDA 2H5LA 1ZPDA 2C2ZA 4H3KB 2IYVA 4MRVA 4U0JA 5CD9A 5LL6P 3ORQA 2ZJ8A 3TSCA 3V5NA 3G2NA 1ULHA 2OCBA 1DARA 4ISSA 1EYZA 3HZRA 5FLXA 2B2CA 4M89A 4WJKB 3HJGA 3VU8A 1L7MA 4JB0A 2K4MA 1P1CA 2X0EA 1QDEA 2D2FA 3TPCA 4IJ5A 1Z6ZA 3RHSA 5HZGA 3CVVA 3TL2A 4ZARA 5LG4A 1Y4DE 2C98A 1LDMA 1D4AA 1EK6A 1UM9A 1IK6A 5NULA 2NT4A 4HZGA 5TE9A 3K6SA 2ONZA 4RIEA 4MW1A 4X64B 2E9XA 1OIXA 3KQNA 4ARZB 1XB2A 4WYVA 2XTNA 4M99A 4E7OA 5K8LA 2HEGA 1K6IA 5GOTA 1DPGA 5FY7A 4KR9A 2F62A 1CS4C 1USKA 3VSCA 1E2JA 4MMXB 4CIWA 3HY3A 1E20A 1D1CA 3B1FA 3BICA 3I1YA 3ZJ2A 3MMZA 2G08A 4E2FA 2F6RA 2NYAA 3C8ZA 4MAMA 3CR7A 2SKEA 4YRLA 1ZVKA 3C45A 1G59A 4ZJUA 2E9XC 3OEWA 4P84A 1EP9A 1P0PA 2JLQA 2A3NA 4K2AA 4OHVA 4HQ0A 2JK1A 1TEVA 2P2DA 4FKBA 3U6KA 1GIAA 3QVOA 1PHRA 5T41A 1XZMA 3KALA 3QFRA 4DLWA 1BCSA 4OHFA 4PQYA 1P2BA 1XSEA 3D4BA 3F6PA 5FXVA 2XAFB 3P7MA 4RGVA 1E7YA 4CMEA 1VE5A 3NHAA 2NU9A 3LQYA 2WJVA 3MT9A 3OZDA 4LNHA 2OBNA 1W59A 1XHFA 2BI4A 1T5DX 3N2IA 4GMXA 1Y64B 2Y3IA 2VYCA 4H16A 2KLBA 4P3XA 1ZVJA 3SM3A 5JO0A 3V8BA 3FUUA 5TJ9A 3PD7A 3RBZA 4IRUB 5JS2A 2O52A 3UK6A 2E89A 3ZE6A 4DQLA 1GILA 1NQWA 3N0RA 3LLCA 2LP4Y 1SA0E 4GKJT 1C4OA 1CU1A 2M9MA 3A4YA 1BTOA 3CRNA 3IURA 3QOXA 4JL8A 4L8FA 1DRWA 1H8EA 5AKYA 1TE2A 1GL3A 2D4HA 3DPSA 3AL0C 3PITA 2DQZA 1RRCA 1XD8A 1XNRT 4MUMA 4YK7A 1DTWB 2XUDA 2QAIA 4RORA 3U37A 2HRDA 5IUNC 3PI7A 5HF6A 2AFHB 3ZEIA 3GROA 1EFPA 4LMJA 3O9VA 3F1LA 2WYWA 1UZMA 3KEMA 3E81A 2H92A 8LDHA 5L2LA 4YUAA 2P4SA 2GN0A 3CNLA 4HO1X 4KX6A 5F3JA 4FGZA 3EA0A 4JA0A 3EC1A 3TLUA 2QYTA 4HPJB 4QPNA 1MABA 4GOUA 3DEIA 4F4JA 3NBZC 4DJDC 4ZYVA 1EEXB 2ODAA 4CI2B 3QHPA 4Y1EA 4Z2YA 2WWVD 5COBA 3J80A 1GTMA 4PJJA 1YOBA 1NZFA 1WL8A 5L53A 2QN8A 3BILA 1FDRA 3AR6A 3D6UA 2OMEA 3KOYA 1MMGA 3WLNA 4YMTA 1C14A 1E3TA 2G8LA 1SK8A 4YALA 1BQEA 3ANMA 1B6GA 4HQRA 3RS3A 4WBNB 1LSJA 1NXOA 2QWXA 3K2BA 1ND5A 4BQIA 4DCGA 3HB0A 3DP9A 4PX9A 3RIUA 3HNOA 2RCNA 3GX1A 5DHRA 4AQDA 5CB4E 3B60A 2I0MA 4Q3EA 3A6PC 3JC6C 4M1SA 4BVLA 1EHYA 1U4SA 4UAVA 1QGYA 3OKCA 3IJ5A 3AU9A 4MDHA 4G86A 1D2GA 1WZCA 5JCJA 1WZ2A 1M0EA 2WHQA 2DFDA 3CWZB 2AFIE 2W43A 3GJSA 3R9KA 3QVLA 1JH8A 1Y8RA 3A9CA 4WHMA 5JASA 4DABA 1USIA 5HJEA 5DYNA 5G3ZA 1I7DA 5CDSA 4BVJA 4EF5A 1VPVA 4U9UA 2PKQP 2FWNA 4MS3B 1I5EA 2BTOA 1RWXA 5I9BA 4EVQA 1YU9A 2SICE 2WYIA 5FY0A 2VQ3A 2LRKA 3TW8B 3SVLA 3B1ZA 3A25A 1MQ9A 3A7MA 1UWCA 1XDZA 4IDNA 2X2EA 4IIEA 4PG5A 3D0TA 1KMHA 1GFZA 1R4MA 1ZM9A 4LDPA 2IF2A 1RYMA 2EJBA 1VRVA 4UAUA 3WICA 1E7SA 3V33A 1GNSA 2WAOA 4CTNA 1L8OA 1V8PA 1UFRA 2FUG6 4PZ0A 3OX1A 5G1OA 3RJZA 3ZS9A 1NA5A 3CCCA 4LOLA 5EY5B 4E1VA 2GCNA 2G40A 2CDNA 4PAQA 4FVTA 4UUNA 4RD0A 2GN1A 2ERYA 1ULBA 1K6MA 2K48A 2PGLA 4H9NC 5TGZA 3R7WA 5FYQA 3U4DA 1J9GA 2JFWA 2ZM5A 3WGQA 1E6UA 3QLVA 5BO5A 3LHIA 2JFNA 2J9FB 3NAMA 4LJAA 3DTTA 5L3CB 1S3GA 4KVGA 2PH5A 1E0SA 5JCJD 3EMKA 4AF6A 3DVSX 1MO5A 3QTTA 5EE9A 3T99A 5EIBC 3AUYA 4U7IA 1SKQA 1WKVA 3D3JA 3QLJA 1B7TA 1IHOA 1PT9A 3FNFA 2WIDA 2IIPA 5HF8A 3WQSB 3PEWA 1CUSA 1D0XA 3U31A 4E30A 3UAYA 3ZNPA 4RTLA 1OWOA 2KXPB 4BQRA 1SUDA 4JB2A 3EQ6A 4NMXB 5LMUB 2OY0A 2ZM0A 3GQVA 4HFNA 3TM5A 4BWFB 5FVLA 2JAWA 2IU6A 4L5IA 1XTRA 3VRBA 3GT4A 4B44A 5HPYB 3DOEA 2GPNA 3NM5A 3WDMA 4QFDA 3DW3X 3Q7TA 2J1DG 1CLEA 2AJ8A 1FSPA 2OM6A 2G9VA 4NAVA 5AJVB 2G4LA 2JH9A 3QEKA 2R6JA 3QZUA 4HDSA 4JX8A 4MW7A 4UUPA 3WDKA 1PKEA 4OKIA 4FEAA 4HFIA 4CF3A 5C52B 1PKXA 2M6RA 4D81A 4CQNA 5H80A 3SSAA 1M2VA 3CNQS 3QUTA 1JQEA 4ZKEA 1CQJB 2NU6B 3UUFA 4HNVA 5L8VA 2EDAA 2PCJA 3PIRA 3BMQB 2HPHA 3PL5A 5CFPA 4LVCA 5DM0A 4LJKA 5KJ6A 3UAVA 5J2TB 4OHWA 3CRW1 3DEFA 1KFCB 2ZXEA 4FHCA 4DLLA 3AOEA 1EX6A 2G67A 2P35A 4UDOA 5AVKA 1H8ED 3AKYA 5EE3A 1KZHA 4EVRA 4RKFA 3TW8A 3K92A 5EWMA 1IQPA 4N5HX 2G0TA 3L49A 2CBJA 5D1HA 1Q6ZA 3O4XE 3JZAA 4OQLA 2OEPA 4RD1A 2I9KA 2MMCA 1IEVA 3QELA 2C5KT 2QTFA 4RYDA 4LMLA 1RXUA 1YJCA 4OB7A 5F5NA 4LZJA 3TTUA 2HEIA 3M5DA 3QW2A 5ERXA 3ZIAA 5BP7A 2WS3A 5LHHB 2C20A 1T98A 1GZDA 1PRYA 3CWQA 3H2KA 4PLCA 4V0QA 2LBPA 4ARUA 4DXDA 1IATA 5FIUA 1YDMA 2LZ0A 1KJ8A 3U7HB 2P3LA 3PUGA 2D54A 5DGTA 1SKMA 5KQLA 1QF9A 3OECA 3HU1A 4RVGA 1QK5A 1Z25A 1OGYA 1M75A 2LTAA 2QRZA 5HWYA 5AKGA 1ZIOA 3MTEA 3UV6A 4FJ1A 3NUZA 3YASA 5FV4A 3I53A 6NULA 5HKOA 4NMLA 5D1NA 1SCIA 2VJLA 1H3EA 4TZ6A 1S2GA 4YJFB 1VSTA 3D4LA 4OQXA 3RTCA 2JA1A 2V8OA 2NO7A 5HEHA 4BQSA 1QE0A 4EJFA 1Z82A 4O33A 5FCDA 1ISHA 3UKOA 2B7LA 1UH5A 4I50B 4ND8B 2HIAA 4AQYB 5EG5A 3NYQA 1DO8A 3G7UA 4KQ1A 5EE0A 3DKVA 1EFDN 4GOKA 4PM4A 2IUSA 1L7DA 1SCNE 2B4YA 3FXAA 1L5QA 3IA2A 3ANTA 1SHZA 3B9BA 4G5OA 4WK0B 1NTOA 5H4GA 5H6RB 4O2LA 1TA9A 2OV3A 3INYA 3VZDA 1NYRA 4ESOA 3AI1A 4QUBA 2IKQA 4PICA 3F5DA 4NFLA 1GADO 3RANA 3W9BA 1JNZA 1CUVA 4D92A 4DKXA 3LO8A 2E87A 3GMTA 4E11A 4EJ6A 4LRSB 4LYJA 4JLUA 5LA6F 2GEJA 3LP8A 5LU8A 1KI8A 2R60A 1MAUA 1J42A 1VG8A 4HQFA 4KRGA 4Q1FA 2WSYB 1TK2A 2YR0A 5FWYB 4DFDA 4OJNA 4TQAA 5AQLB 3C2QA 1Q21A 3ACBA 2ECOA 2CJPA 1N7JA 3NU1A 4EQ6A 2VTDA 1R7RA 4UMVA 3FBZA 3NI2A 2Z5VA 3ZUGA 4LF9T 1FS4A 1T5HX 3S4YA 3JATA 3WK6A 1XN4A 2W37A 5AO9A 1LB1B 4XR9A 3O8RA 3WRYC 5DWQA 3EGOA 3ZJYA 3PDIA 2QTVB 2HI0A 5DNUA 2H1WA 4N40A 4DNPA 3UXYA 1L2TA 2XX3A 5AM4A 4ILAA 4RLQA 3WIDA 3LV8A 4HQNA 3X2FA 4CFZA 2FPOA 1YFJA 4QJ5A 3ELBA 3HB7A 2IEGA 3TNLA 4B09A 4K0KT 3I1IA 3RSSA 1G3IA 4YJFA 4A6EA 3TGPA 5CFLA 1ID8A 3R09A 4PW8A 4N5NA 3I5MA 2XGSA 3F97A 2NO5A 3ND6A 4BMPB 4DAEA 1X9BA 3FN4A 1F8UA 4IT4A 1JWBB 2DWOA 3OBBA 4MS4B 5CDGA 1CX9B 1CUUA 2G7MC 1I7PA 1DOHA 3N8NA 4KO4S 3T38A 5A2QA 3C3EA 3T1YB 4QFCA 3OKFA 2PSEA 2WMYA 3DGFC 4IDAA 1FFGA 1KYIA 1ZD9A 3UQ4A 3K20A 3UUXB 1SWVA 1YJ5A 2W5UA 2WUEA 1VHQA 3HDQA 2PGDA 1ZY2A 3LT5A 3QY9A 1EE1A 2ZJFA 3N6RA 1V1RB 2LSKA 3QXXA 5B1IA 4WI1A 2DPLA 2ORYA 2PSHA 5LYYA 4J91A 4OJTA 2XQ4A 5JLAA 4PYIA 1K5HA 2HQBA 3TI9A 1CUGA 5HCMA 3L43A 3N6XA 3NFRA 5IABA 1EG2A 2WP0A 5AKIA 4UBNA 3KSRA 1JT9A 5AI8A 3RQUA 1CF2O 3AQ4A 3HKEA 4JBYA 4PTZA 3Q40A 3EDMA 3ZGNA 1JV2B 1RMQA 4GI1A 3GUZA 1U2EA 4KVZA 4L4RA 4BX3A 3UMSA 4N7MA 2RGRA 4J16A 4EFKA 4IIFA 1HDEA 3IEIA 4G1BA 3UICA 2ZM6T 1IQRA 4ASKA 4DEXA 4I66A 2NVUA 1W5FA 2VDUE 2GPBA 4M9SA 4CE6A 4IIDA 4BRWA 2CT8A 3FUTA 1SQGA 2VAPA 3R3VA 3ZOZA 4ROSA 4IMPA 2FJBA 3KVVA 1SBHA 1A8HA 2B4RO 4RL4A 2HIHA 2EFJA 3M6UA 5JTTA 4X66B 3ZWXA 1E9VA 1WLSA 3OQIB 1YS4A 5FR2A 3ZBTA 4NCHA 1DINA 3KV3O 4PTYA 4XIGS 1OYWA 3JQDA 4QRHA 2YH2A 4LJSA 1ZJ6A 4DY4A 2FP4A 2IUBA 2OUIA 2VDMB 3E7DA 4QARA 1HLPA 2Y1DA 2RHTA 1ZYUA 4KMCA 1E5XA 2O2CA 4IS2A 4JASB 2BH2A 4UBKA 1QYVA 3LKZA 3W6UA 1U1IA 4HI0E 2FN9A 4HZUB 3SF8B 3SIPA 3AG6A 2GD1O 2QPTA 3DZBA 4UXNB 3H17A 3GJ3A 3VYWA 3ABVA 2PHZA 4H7JA 4L2IA 3V2IA 1ZOSA 1XMOB 2NZVG 1P74A 2J33A 3A10A 3A6EA 1RLMA 2WJZB 4WOBA 2NZXA 4RFVA 1IG0A 1SOWA 3ZC1A 1ECFA 1J0BA 3HPRA 1ABFA 1WDMA 3UTKA 1CY2A 1ZK3A 3QH4A 4B6XA 4LC0A 4ERXA 1JDUA 2OGTA 4EUKA 2NOAA 3AO0B 5ALIA 5ECDA 1J7KA 2R8PA 3IAM1 3NUQA 4IE7A 4KIJA 1JHMA 3IIMA 2IRWA 1JZQA 3UA3A 4HTFB 1EJ2A 2ZFUA 3GZNA 3WGOA 3E22A 3C70A 3M7IA 4JLPA 1GAJA 1CUIA 3Q9UA 4G5SA 2HHLA 3IOBA 3NBMA 3RHTA 1LNSA 5ES3A 2I65A 3ZV3A 1JF8A 1ZBQA 2FR8A 1FLDA 4JX9A 3FDJA 3PICA 1U7XA 1X0VA 2OXEA 1DQZA 3ZCUA 4KHZA 3TBKA 1P2VA 5AK5A 2ZWMA 4Z86A 3NYIA 2Z8YA 3N39C 4II7A 2O5EA 3EJWA 1JG6A 3RC3A 2WABA 3INGA 1NKSA 3LT2A 4P1NA 4XLTA 2AYXA 1PSZA 1QWOA 2I4LA 2PGNA 3AJRA 5GZ6A 4KXNA 2Z8ZA 2C29D 2OSVA 1L5LA 2FJPA 2HHCA 4WBNE 3BERA 3MMPA 5CCBA 3ITKA 3O9ZA 3SEZA 1ZN7A 4GPBA 1GAWA 5KQSA 4PWZA 1VRWA 3RABA 4MPRA 5GZ1A 2I1LA 1PGPA 3BXGA 1CE8B 1K8RA 2VP3A 2VPQA 2WB4A 5IUKC 5J2UB 3FOEC 4MTLA 4DSZA 2WTAA 2WJ4A 5T57A 4HPWA 1EVIA 4NV0A 1W1UA 5BN5B 4D9BA 4BGDA 3B6JA 3OOWA 4YI3A 1NM5A 4MI6A 4MO2A 4D8UA 4K3VA 1XDOA 2Q3HA 1SIOA 3DCNA 1LU9A 3EFOB 1XTTA 4UZEA 2IV7A 1KOGA 3G17A 2PXCA 1AN9A 2XIJA 1TFUA 3KWMA 5BWLA 2REQB 1HE5A 1ZC3A 2VWAA 3ZQKA 4QM7A 2GUGA 4F9EA 4JT8A 2CUNA 4J0CA 4IGKA 3B2QA 4LX8A 1BXGB 4LJ6A 2XCIA 4W5RA 1KVQA 2YK0A 2NGRA 2QXYA 3R6TA 4Q9DA 3V1TC 2ARKA 1TYZA 2C4UA 2VSNA 3P2EA 5FI0B 3CUWA 2F8TA 3Q5XA 5LMZA 5ARCA 1G21A 3HFRA 4BO0A 4UXIA 3NKZA 3P0HA 2J3EA 1ZKMA 3NV7A 4BYMA 4DA6A 3AUFA 4ES6A 3L1VA 4IO0A 3RAPR 4ER6A 2DPXA 4F3YA 2ZUFA 5F1YA 1LI4A 3QX7A 2DX7A 4ZEOA 5JIBA 3PUWF 3I5YA 3BWDD 3EIHA 4KXWA 3Q7SA 3U81A 1EDBA 3PIDA 4ZQCB 3AEEA 3SWWA 3HL6A 3B6MA 2E4YA 1DJNA 1DAPA 3HNRA 5SY4A 4B2PA 1XLTC 3NNSA 1E6EA 2C2MA 2P8SA 4ZYXA 1E6CA 1X8JA 3O7WA 4I55A 3N2ZB 1CJUC 1UC5B 5BWMA 5KJCA 1I33A 2V7VA 5I7FA 2XYHA 1KR2A 2BGGA 4YJ3E 1HE4A 1MQSA 1MH9A 3A9VA 1ZD1A 3N8HA 1C41A 2VNKA 2X3YA 1RKXA 4LX0A 4M1EA 4KI0A 2BRUA 1DNPA 4ZV4A 4Y2TA 2CLLB 2FVYA 1BS2A 1A4XA 2Q9QC 4HWCA 2H57A 4HEQA 1QQ6A 3GOQA 4EDHA 4HGNA 5JVDE 3ESDA 4DDTA 3MEQA 2Q3LA 1N5OX 3ZHOA 2QL6A 3ZN1B 2Z98A 2CF6A 2NNLD 4DCNA 4H0FA 1U3WA 3EZGA 3EGEA 1UBSB 4JKYA 3DL2A 4GQIA 2X0NA 3LJCA 2H5IA 4OD0A 3T41A 4IDDA 2YDQA 1R88A 1E4VA 2FHPA 2DLNA 1O4VA 3ILSA 1IXYA 3EISA 2HNAA 4XVRA 5CYPA 2AEEA 1HYEA 2X4IA 2IW1A 4GRAA 5L3SA 1B93A 1Q1NA 5JC8A 3ZNOA 1SB9A 5CG2A 4YFVA 1HNXT 1YC5A 4AXPA 3FR7A 4ITUA 1NSYA 4WE3A 1WCWA 2V0NA 1Y5NA 4ZPJA 5JPCA 3IR5A 1C0KA 1YZKA 3OLQA 3N9MA 1U63A 3L8DA 4P3NA 4R8LA 3D7LA 3SP1A 4ETIA 3OQIA 5LXTA 4RY9A 2I87A 4HN2A 4X3PA 2EGUA 1VCOA 2O5RA 4L1KA 3WHKA 1LSOA 1H0SA 1RXSA 3K5IA 1BYIA 1NC3A 4RK1A 4MHCA 1PSDA 1VXRA 4RABA 1H4QA 1MNDA 3FFXA 3NRBA 2NO0A 2FSHA 1REQB 4OUKX 5C8YA 1Z17A 1ZC4A 4C0JA 3FOWA 2H65A 2V7MA 5D3KA 2WZCA 2OFFA 1PNRA 1HTTA 3K3OA 3GEGA 3QUSA 4LBVA 3QEMB 3PJRA 4DR1T 3IIKA 3V32A 2GD2A 2Z08A 4KO1S 2JLSA 1QOZA 1L4MA 5IUXA 1QVZA 2P9QA 2VHTA 3K35A 4JA2A 4MFRA 3TQTA 1LC0A 1BDHA 1WABA 1VOMA 1IY2A 2PKRA 3GD7A 1ODTC 3V3TA 7AT1A 5JG7A 2IYZA 2JI9A 1XJCA 5T3YA 3SQWA 2YFYA 4OCZA 1BCRB 4IXDA 4ZQIA 5JS7A 3ADKA 3ZDXB 4C0SA 4TQ9A 4ZOQI 1SD2A 1K8QA 1UEJA 2VJYA 2FSPA 5HA5A 1ZCJA 2BELA 2FGKA 2JGDB 3A4NA 3BDAA 4GKKB 2MJLA 2ODTX 5PNTA 3QUJA 1I01A 3K8QA 4JI5T 3CB4A 4MYCA 2VAMA 4OL9A 1P7PA 3NAQA 5KYTA 5BWOA 4LE2A 1HRDA 1CULC 4JVOA 1IOZA 4W6ZA 3T1NA 2IA5A 3CF0A 2IDZA 1Z4LA 3UFGA 3IUPA 4QBGB 3WP0A 1L5OA 1I32A 4FEYA 1IUNA 4HNTA 3A5XA 5JAIA 1T8WA 2P11A 3M1YA 3TZ6A 1ZQ1A 1BRMA 4KLCA 1GZ7A 4K26A 1HR0B 3PXBA 1Y4UA 1G9TA 3CPHA 3Q7PA 4NS4A 1GRCA 1LWOA 2GBCA 1X7XB 2YUTA 4PHHA 3MUEA 3PKIA 5TV2A 3A6JA 1T8BA 3LC1O 4G5FA 1HSOA 1ZWLA 4QTZA 5G1NA 4GR4A 3CVOA 4ZI7A 2X0DA 5BVGB 1QIEA 2BZ1A 2C2BA 4Q02A 4KQFA 1BX0A 2VWPA 1PJ2A 2VZ0A 3P9SA 4NP6A 4EYYR 2CLKB 3FWYA 5F5XA 4U8GA 3BFJA 2O1WA 4YRPA 3ROXA 2GSDA 4E5NA 4C7BA 1I3NA 3OSZA 1XP8A 1ZNXA 2K3WA 1AO0A 1IBMB 2QY9A 2ABWA 1SVLA 3OFVA 2MSNA 4CI3B 1ENPA 2RB5A 1CEEA 1PG5A 1T1JA 2DF8A 2YXEA 2XF2A 3HN7A 2I6UA 1L1QA 4YRBA 1W19A 2LRHA 2CEAA 3CZ9A 4FS3A 4N18A 4UEQA 4R3WA 1GCAA 2I33A 2V3CC 2PLWA 1Y3DE 3O3CA 2OXIA 2AMYA 3RS2A 1V9CA 4BV9A 3TOZA 1O8CA 1YZFA 2G5CA 4J29A 4UU7A 2Z6VA 3TQHA 3L92A 4IIJA 3U7FB 2EGGA 5EZSA 3GWZA 4I1UA 1T5BA 3BIXA 1DKLA 3G1TA 2RAVA 4MI9A 4MDEA 4EARA 3L7KA 5DTRA 8GPBA 5COAA 5IJZA 1YTUA 3F5MA 2LKGA 2P2CA 4LE0A 1FSZA 4D3FA 5LMNT 2VDNB 2YBDA 3B1YA 4BC0A 2WJJA 4PNEA 3ZD6A 3IR6A 3AF2A 1WHSB 5DNAA 1KK3A 5C7OO 5LWQA 1ZGGA 5JSZA 3N9QA 1XA0A 3GF4A 2WIAA 4L4SA 4GAEA 4LCBA 3UG6A 3DUFA 1VPEA 2O5CA 4RTRA 2QMUA 4G85A 4N82A 4YSYA 3N05A 1B8VA 2XRMA 3Q7RA 4QHYA 1Y9EA 8ADHA 2PQ2A 1E1HB 1MHPA 1KEVA 3BJZA 4DA0A 3QU9A 1X1EA 2L82A 1UBCA 4QULA 1ACJA 3C7CB 4HJXA 1T1IA 2A5GA 4RHCA 4JVLA 2IZOA 3N2GE 3CEPB 3JAKB 1DT3A 1Q91A 2AFIA 3O8OB 2G3YA 3E9CA 3DR3A 4PZPA 5I4CA 1BRTA 2PNJA 3QUBA 2H2HA 1P1IA 1JW9B 4CQLB 3K70D 4KUGA 1K1EA 2AMVA 4EFMA 4P8RA 1GT6A 2PPLA 4HNUA 4ZJYA 5CB4A 1B43A 1TJPB 5J2UE 4Z0NA 1EB9A 1L6IA 4ZVOA 1QOQB 1A97A 1JILA 5HBGA 2B8TA 3NKVA 1WBDA 4NMMA 3U16A 3DOJA 4RSMA 5HZHA 2O59A 1ECJA 4EB3A 4S1VA 4I55E 1D1BA 3SFDA 1HF3A 1XD2A 1E1YA 2I7TA 2JBAB 4WY8A 3GL9A 2R7AA 5TDHA 1DBQA 1HEIA 2WDPA 1SY7A 3ZHQA 3CX8B 3O1HB 1AKEA 1WG8A 1X15A 3OIUA 4HLNA 4N7RA 3AXTA 2O3JA 1IZNB 2W58A 4QEZA 1ITZA 2VQDA 3PBKA 4ZAFA 3CX6B 2ZM2A 4O1MA 4EB6B 4O2AF 3AY6A 2O6HA 2E5VA 4FSDA 3ER9A 2A5DA 1PU2A 3G7NA 2XA9A 2ZIAA 3DQQA 1RHJA 5HWXA 4RHXA 4BMVA 4XUDA 2DUJA 1U94A 1CQJA 2NU6A 3AEKB 3MRSA 3RF6A 2H0QA 5DMHA 1AKMA 2G9NA 2R1TA 4BBJA 4BCDA 3AE8A 1XZLA 5A5VA 3GLKA 5KWVA 2D5UA 2AD1A 1FDUA 2QI9F 3B6ZA 4Y0VA 1II0A 4JP8A 3BF8A 4B2YA 3GDHA 1SKUA 1UKBA 4QYTA 3LNCA 5KNBD 4F45A 4PLWA 2WILA 1ULTA 1IY1A 1RRPA 1A5BB 4PX2A 3U3ZA 5AM1A 1SCAA 1FTGA 3KVYA 3O83A 1E1QA 4WWHA 3K73O 1Z0UA 4CKEB 3ZU3A 1SXHA 3R4VA 4F38A 2QM3A 3PF8A 4S1PA 1YW0A 3OD1A 1HC7A 2QYHA 2C2GA 2QRUA 3KC2A 3KTAA 4MO9A 3RYTC 2PR7A 1OAAA 3PX2A 3QPDA 1RLIA 1PHPA 4JEUB 3ECSA 4IX9A 2Y27A 1K88A 4MVCA 1KFBB 2OA5A 4NABA 1JMVA 2OCDA 4NYJQ 2W70A 3PC6A 3VHLB 3S8YA 4CL0A 2BHSA 2H1OA 5FT9A 2ZQ5A 1SPBS 3T7KA 5KNDA 5EIWA 5CBPA 5BNIA 4JZKA 4J7XA 2Q1WA 5FULA 1LH0A 1KEKA 2PN1A 3V4VB 1KYQA 2PZ8A 2ZYRA 1UWLA 4ADSG 1V43A 2XRFA 2PLAA 5AVQA 1Z0SA 5KDOA 1C7EA 3WKEA 3ESRA 1ZJ5A 1Z83A 4QX8B 2H3EA 2X4DA 4P3OA 5FBQB 2X67A 3D3KA 8OHMA 1DJQA 1W5AA 3FD8A 4D0LB 2VJNA 5J1SB 3HEMA 1C8KA 1KDVA 3L09A 1QVAA 4J07A 4M87A 3LWDA 1MO2A 3REOA 4C5BA 3BMOA 5JTGA 5AW3A 2WIGA 1Y5RA 1H6BA 2ATXA 3FMFA 3WLRA 8ABPA 2WWTA 4HV4A 3E22B 2IE0A 3OIWA 2A4MA 3PG5A 2W2KB 3OKAA 4JJ4A 4MUIA 1ADJA 3O4FA 5J3JA 3PJGA 2ZVDA 3V48A 2X22A 3RC8A 2PKEA 4RY0A 2DR3A 4UE3S 4TN5A 4A8JA 1YXMA 4JBXA 4X44A 2JIWA 5HSGA 3K70C 1XXHB 4GLOA 4BNKA 1W96A 1X13A 3CC8A 1OPRA 1E3MA 1UJ5A 1LBTA 1PGJA 2AOUB 3CKKA 3MTIA 4RANA 5FBLB 1W73A 1SHLA 2A5YB 4FHFA 2I67A 3WMGA 2WPDA 1AV6A 3FNQA 2IXFA 2B6HA 1CK4A 1ZM2A 4PYNA 1SJ9A 4I4IA 4OHMA 3WGTA 3NS7A 3NOQA 3ESXA 4ZI7F 2WF5A 2FZCA 3AM3A 4KBYA 1JHXA 3OZTA 4D57A 2Q9UA 2QGFA 4IHJE 2I6SA 2XTMA 5JYEA 2WAUA 1KFKB 4HZUA 5KYWB 3BXFA 4PSCA 3GVPA 2QD5A 3WK8A 4RJIA 3AR7A 4DV7B 1ZLYA 3FKSA 4YRFA 3UENA 3UK1A 4BOYA 4NOKA 4UNRA 4JJ8A 3A2MA 3H6HA 3DG9A 4IDPA 1EWKA 5EZYF 5G0WA 4B6OA 4MRNA 1Z22A 2IW3A 4HFEA 4BJ1A 1DELA 4C20A 5L4SA 2FFHA 2FR0A 2R66A 4AUEA 3TUZC 2EHOD 4KE6A 1CJKC 1A8PA 2X14A 3B5EA 5DEIA 3UUBA 1SXJA 1JDBC 5FNZA 4JJGA 3WL3A 3FG9A 2PGIA 3HP1A 2K2QB 2F67A 5EEGA 3TINA 4RMHA 1K7FB 1J8YF 1OZAA 3EXFB 2WD7A 5AK6A 1J2YA 5BR8T 1I4OA 2X0KA 1JJAA 2JCGA 2VF8A 3K9HA 2P0EA 1L4LA 1I1NA 3MSXA 2O3TA 5FP3A 3FCAA 3LKVA 3A1SA 1GLGA 4K86A 4MOWA 3TTSA 4GX1A 3O9XA 1DC6A 4HAVA 1VDZA 1XZBA 2OGSA 5A9SB 5LOVB 3N0TA 4XJXA 2O7SA 1IN7A 4H08A 1V25A 4CEIB 4KPYA 2DBYA 2A2FX 2CCKA 3LG7A 3DYVA 5GZ3A 4CG2A 3HO6A 4X84A 5T6BA 3RTAA 1TB4A 1SG6A 3AUUA 1N2JA 4NMHA 3ZE9A 1XC7A 3NQ41 5JMOA 4PS0A 4H15A 2MPKA 1N33T 4RAOA 1T36B 3PDJA 2NTEA 3RSOA 4DPKA 5JMTA 3DFMA 3L4SO 2O3QA 5KI6A 2VT7A 5IDYA 4AN0A 2PZEA 4TLEA 5JEDA 1WW3A 1GHTA 4GX0A 3OX3A 4J1TA 2VLIA 4Z9YA 3DAPA 3FOCA 3TVTA 3L7CA 1Z3IX 3C5EA 3C7TA 4GC5A 3CQ9A 3UXMA 1T6BY 4CL2A 4R0MA 2IPAB 5ALUA 1ADCA 1XMJA 3P9XA 1EE9A 2BFCB 2GYYA 1ZH8A 5BQ5A 4G26A 1M34E 3QB5K 4GBMA 4KE9A 4Q82A 2C03A 1LF5A 4DTIA 4YP9A 3I1AA 4M6WA 1OBOA 3QYAA 3R24A 3HCCA 2ZRPA 1MC1A 3HGMA 2AN1A 4BFTA 1FYXA 1E4YA 2AG1A 2DI4A 4BCCA 3JYPA 3K9QO 4UU0A 4BN4A 5H4HA 2C82A 4MK4A 4CEJB 4F9FA 3BPSA 4ZK6A 1CRLA 2VASA 3E3OA 4RQBA 3ZW8A 1M73E 1RIIA 2ODVA 2AI3A 3OUTA 4OQZA 4TL6A 3KSDO 1NW5A 3A27A 3KDPA 2HPLA 4TV8E 3ELUA 5JDIA 4ZAXA 3ZK8A 5JSZB 4JSTA 4TT3D 2VEDA 1YS9A 2QTVA 3ORFA 3IBGA 3BQNB 4J2TA 4ENVA 1J90A 1Q0LA 1ZDMA 2FF5A 3D59A 5JDNA 3JQGB 4MWGA 2HMUA 3HJTA 5HEOA 4Q4CA 2ODUA 2I62A 1JGTA 3AVSA 2JQ9A 1EM8A 1PL7A 1UK8A 2GBFA 4FDAA 4LI0A 4QNRA 1QE5A 3PZBA 4IO1A 4Q4JB 1C8BA 3VYUB 3I9OA 3ZY2A 1JHUA 3FSJX 5CFZA 5L4NA 4Z4QA 1D0SA 3X1KA 4ZICA 4G8JA 2J9ZB 1XNQT 2NNWB 3H9CA 4KI0F 3IX7A 3OHSX 2H4WA 1GNPA 1WCRA 1G0OA 3M65A 5LA6E 1PR1A 2VP0A 2W83A 4CM9D 2XVZA 1TO1E 3CEJA 4K6MA 4FR0A 3MJHA 2CB0A 1BHQ1 2YOGA 4AX8A 3KCQA 2BGJA 4ZOLF 3WV4A 4N5DA 4QO7A 1R9MA 3CN9A 2EHOC 4BNUA 3G2JA 4RVOA 3AVUA 2C4MA 2XQVA 1E5QA 3PI6A 3GO4A 3QW4B 4OGLA 3W5AA 1YE5A 2RONA 1GKYA 1TEZA 2Q41A 3VO1A 4KXMA 4NV3A 2ZR0A 3T7DA 4UVCB 3HE3A 2JFHA 1RADA 2RHOA 1PS9A 2XUGA 3PUWA 5F77A 2QF7A 2PSFA 3HJUA 1B15A 3IALA 3LCCA 4S1OA 4Q9IA 2FX2A 4BLSA 4MXDA 2VAXA 3VTZA 2AR0A 2JIQA 2Q3JA 3HWSA 4GWGA 3V4SA 4CKZA 2R85A 3MF4A 2LLYA 1SD5A 3STUA 2ISSD 1ZK2A 2DKOA 1TA4A 2ADFA 4HFJA 4QNNA 3FKSD 4J6FA 1KK2A 5HKBA 3L8MA 3B3JA 1J07A 1GUYA 3G88A 3IBTA 1CNFA 1PJZA 1JDZA 5A7HA 2ZRFA 3HS3A 4DV1B 2PUFA 3O94A 2R5NA 5DX0A 4FB4A 2DFNA 1I4TD 1DAFA 4ZANA 1Z15A 1NGSA 2YOHA 3O2NA 1F51E 4RXTA 1T9BA 2ZAOA 2HJHA 2Y2UA 4AXBA 2PFVA 3C50A 3TF5A 3I9JA 3FYCA 2GO1A 4CQIA 4ZTBA 2EP5A 4OQYA 1G18A 2HTEA 1XDSA 3ZJ4A 3AVYA 1KF6A 1KH1A 1Y6QA 3R0ZA 1RW4A 1QZXA 3AOEC 1A4UA 1TLLA 1FDSA 2HLNA 2ZRQA 2GK9A 1SCJA 4DNXA 5LUAA 2BI7A 3KJEA 4H27A 5K3DA 1RM5A 3MHTA 2I4OA 1QHXA 1E69A 4G4IA 4IWNA 3S7ZA 4G0PA 1PK7A 3PFWO 4IILA 1X70A 4Q93A 3L7BA 4EMTA 4G1UC 5T7BA 1PR5A 2DR0A 2OPBA 2RHJA 2DWPA 4O3FA 1E64A 4U6SA 5AM2A 2YOFA 1ILEA 1EGMB 3C8MA 2I4MA 3VRHA 2W6NA 3A8TA 3KQLA 1SUFA 2XWJI 3UFXA 5JBQA 4Y2HA 2XMSA 2UXBT 4FS8A 4KH0A 2GZSA 3VR6H 3ABSB 4DCJA 5BWNA 4JI0T 2LCIA 5TNXA 3OA2A 4FXPA 2XYVA 4WNKA 4YWJA 4U39A 4R8KA 1IZ0A 1HTBA 3PIIA 2HZ7A 1PK9A 2YMLA 4F7WA 5ABFA 3G0CA 4Y0NA 1KP2A 4MLZA 1Z37A 1PYDA 2WG1A 5CH3A 3QC9A 2QS9A 2VVTA 3EGCA 1TYAE 1RC0A 3NM4A 3QVGA 4IEFB 1KDOA 4KQWA 3UJ6A 4DQKA 2FJUA 3GLSA 3KOZA 4BEVA 1T5SA 4DRXB 3O3MB 5KYGA 1ADYA 1VBKA 3N2KA 2D0TA 2ODWA 3EVTA 3FMOB 3VHLA 4X66T 3NTQA 4X64T 4OMUA 5DMXA 3AFMA 3CF6R 3PYLA 3U9LA 3WADA 3I2JA 2L17A 2QB5A 4OTZA 2KWIA 1N2GA 1RXCA 2O9JA 4IGFA 1CVLA 4JLJA 3KTAB 5GINE 3T1TA 1RXEA 3N3BC 5A3SA 3R9XB 3T4UA 4CM6A 4R9UC 1A9QA 1HDGO 4G9EA 1U0HC 4Y6LA 3DLCA 3LY9A 1GAXA 2R2AA 1WR0A 2XITA 1EJ6A 4U72A 3ZGXA 3UQ7A 1PW7A 5L47A 2P7IA 3ZWNA 3NW9A 4YBZA 2X0IA 1QC5B 1U1GA 2PT7A 3I4LA 3OIFA 3OU7A 5E7MA 5ESXA 3I4FA 4JGBA 3C3YA 3H2IA 1SHUX 5JJBA 1GY8A 1VBFA 2VI5A 3SC3A 4A8PA 2NTYA 4BVHA 1T4DA 2J4GA 5BW6B 3S2FA 3WFIA 2W6MA 3CX3A 2R4UA 4EHJA 4E5KA 3U5TA 5KKNB 4M0UA 2AN4A 2R96A 2X1HA 3FWHA 4DIKA 3R0QA 1YQ9A 2MSLA 4ENSA 4J9UE 1C4XA 4EM6A 3EVNA 4JYZA 1JDTA 4P33A 2RJNA 3GPIA 1CERA 1ZNYA 2ISCA 1XMPA 3ODGA 1FF9A 2B1RA 3M82A 3AEUB 3LKBA 1S4QA 1I7NA 1YS1X 2RFLA 4DLPA 1ZMOA 5IBCA 2B36A 3A1CA 2OB2A 5M4YA 3ONXA 2RI6A 1A2OA 3AHEA 3CNBA 4JI6T 4Q3OA 3T5MA 1E61A 1H23A 4BNHA 1OMOA 2JBAA 1COWD 2ZBDA 1TOAA 2AG8A 5J5VA 2VZLA 2GJ8A 4UM9B 1JEYB 1FCJA 4H9SE 4BRUA 2C4WA 2WJIA 4RZQA 1W49A 3HRHA 5TAOA 4IXNA 4QUIA 5G4LA 4CPDA 2PA0A 5ALVA 1PWXA 3OP4A 3U78A 4YHBA 1HUQA 2NTNA 2G63A 1B7GO 1QLHA 3G9QA 3P50A 3H2ZA 4E5YA 1NP6A 2R8XA 4F4HA 1G21B 1GFSA 3T1OA 1Y3FE 4Q00A 4AVYA 3O90A 1ZI9A 3USES 3EULA 5DN6A 2WMOB 2BKAA 3MRVA 5AHOA 1DC8A 3AEAA 2GEUA 4GPAA 5CYFA 4JBGA 2BGUA 2VPZA 5AYVA 2JZOA 2FMXA 3DLBA 3AAEB 1BXGA 1YT5A 3ABIA 2WNHA 2VDKB 3WNZA 1Q17A 2D5CA 5KKCA 1QC5A 2KZ7B 2VJAA 3IYLW 4RLSA 3RVNA 1AMNA 5IT9A 1R66A 1MAAA 2GHQA 1E3JA 2WYHA 3PC8C 4UE2A 1L8LA 1ZKDA 1ZNWA 3HCOA 3QTLA 3ZE0B 4DSTA 3ONVA 4E33A 1T5OA 1P73A 2JJ1D 3W90A 2ZPUA 2FU5C 4TL8A 3MB5A 3EODA 2W66A 1CF9A 4A98A 1RKUA 3QEJA 4HDRA 4HDKB 4OYLA 1YKHB 2XJ4A 1J25A 5DABA 1H93A 2ZBUA 3KS9A 1BW9B 3LD9A 2AXQA 4FHZA 4GMGA 2C7GA 4F5EA 4Q34A 4QQNA 4HLQB 5CMLA 1XZ8A 2AKYA 4JYAT 4MROA 3HXQA 2RGXA 2CV0A 3KSBC 2C0PA 5G02A 1W85A 1WOYA 4C4PA 4FD3A 2HQ1A 1S1MA 1C3VA 1HFJA 5K01A 1WUJS 2GEBA 4MV0A 1HQDA 4PHGA 2XQGA 4A16A 3EIEA 2R44A 4KQ9A 1FYDA 5IANA 5DWVA 1RKBA 2Y8DA 4GDFA 4JC0A 4RZUA 5IM4F 1KI4A 4RMIA 1DB3A 5D7NA 3D31A 1YBVA 3QU5A 2LOPA 1DQPA 2WZIA 1P6QA 2AKAB 2B8NA 1I3OA 1A5SB 2R7NA 3BCSA 1E0KA 3HUFA 1E3WB 4RK0A 4ZU1X 2OO3A 3MIIA 2VKHA 4NFSA 2OENG 4LVUA 4YROA 3SQDA 1IDOA 4W5JA 2ATEA 4LVOA 3C1OA 3C1UA 1GGFA 2FH5B 3CKYA 2LGJA 3NVAA 4CGYA 4EW6A 1W4LA 3MCZA 1QGZA 3PDUA 1J56A 1NFFA 4I9UA 4OP2A 2RG7A 5EVJA 4AJHA 4A26A 4RF4A 5IP5A 3IKMB 3INNA 3KM0A 3ZWMA 1NNEA 1SXIA 2GZ1A 1IM5A 5DK4A 1IU9A 3KZVA 3M83A 5I7EA 3D3NA 2Q6OA 4G84A 3ABRB 4N3AA 5CXSA 4V0SA 1JIJA 3GDFA 3L0SA 3GUVA 3EQ9A 1Z0DA 3WWYA 1O5TA 2QZ9A 1OVGA 3W2HA 5HE9A 1FFDA 2WHRA 4CM4A 4G0UA 1KI1A 1YNSA 4Z9BA 4XCVA 1ZGJA 3QNWA 2FOXA 1HFEL 3AETB 1ZXXA 3BJRA 1XAGA 4DS3A 4E3ZA 1IN6A 1I13A 2OD7A 3DO6A 3TKYA 3ZW7A 1KY3A 4CCAA 1EHIA 2JCYA 5I4IA 3DMGA 1NPDA 2KHZA 3A4LA 2JD1A 3K5PA 4CLRB 4UHFA 2N3ZA 4CEHA 3N2EA 1GPWB 1AXGA 4K3UA 4ZO8A 2B61A 2W90A 4Y9RA 1OXSC 1JU9A 2BHNA 1XCLA 1XTSA 1E2NA 1ZIYA 3LJKA 4KO3S 3LA6A 1N78A 3A2LA 2UZ1A 2KWHA 4NQRA 2IPOA 1JG4A 1KXJA 1QHIA 2RDMA 5AHWA 1YB5A 3VSEA 1QOPB 3FTNA 3QKTA 1KVTA 2V5VA 2WVGA 3KZNA 4I9FA 2BS3A 2LWIA 4PSDA 4CR8A 4MEBA 2EBFX 3WB1A 2EW2A 2WMDA 2X0JA 2PWAA 3SEFA 3VU3A 1NW6A 3OIGA 4TRRA 3FUXA 4ZDWA 3L06A 4NESA 1WTCA 4KWEA 3BM5A 2C61A 2R1VA 4BL5A 4DCUA 3SLRA 1VJTA 3CPZA 1MB2A 2EWVA 2OHIA 3DJFA 4LHEA 3TLMA 4XH9B 1WXGA 4KACA 3NEJA 4DR2T 4NCJA 4OY3A 3L7YA 1N34B 1GYQA 3L04A 3TOXA 4GXNA 5LQCA 3Q6MA 2J46A 1O87A 1ES9A 1V4VA 4GPZA 4A3SA 5CYGA 3RIFA 5C8DA 3TKLB 4A1OA 1C50A 2CWOA 2FPIB 2H4JA 4RKWA 2VA9A 3IEUA 1L3BA 2Z9DA 4FEEA 4Q1DA 1XOIA 4ZEXA 4TWJA 3PRJA 1FDOA 4LAFA 5KJEA 4RJLA 1MB0A 1JQAA 3DDHA 2PIDA 4NCAA 1U0GA 2QN9A 3RK4A 2Z6EA 1N9KA 4LXHA 5D3MA 2AS0A 1XZJA 3BSWA 3Q2IA 3P9YA 4REOA 3ZW9A 1MIYA 2TRSB 3E27A 3ONDA 3HHPA 4Q3LA 5FL3A 1JMYA 3JAWA 3EIWA 1IQ0A 4MIYA 4RACA 3WDLA 4F9GA 3NJ4A 5BN3A 1U2GC 5BW5A 4WUTA 3VAZA 3PR1A 3C7AA 4IY1A 1T3HA 3KNZA 4N5MA 4GP6A 3N9PA 1IN8A 2ENWA 4K6FA 5A9TA 1JEQB 1L9KA 3WWDA 5ALWA 1BQ3A 5EIAA 1F7VA 13PKA 3EABA 3UT5E 5HCIA 3KKEA 4G09A 1YQ3A 3WGIA 3IV7A 2WTNA 5F2KA 1Z4JA 4FFOA 1WHTA 2G9UA 1XHEA 3G9XA 3AXJA 2C8LA 3EIFA 3VR5D 1XEXA 1P4HA 4J0GA 3NC0C 4UHKA 4WJZA 5D87A 1F7UA 3DBRB 4ZT3A 5LP6F 1E2DA 3FLBA 1KARA 3ZHTA 3FCEA 3DJYA 3PNLA 1M9NA 4YP7A 5DLYA 2WLSA 3HCWA 1QONA 3D1VA 2UUCT 1SC9A 3LYLA 5D5HA 2JLUA 5REQA 1CDOA 1NZJA 2GN4A 1QKKA 4WA7A 1TJYA 3I4CA 4XKJA 2QL7A 2YVAA 1CQXA 4FD2A 4V0NA 3RF7A 5I7OA 4D26A 1WIWA 2CFOA 2MSEB 1Z0AA 4DR5T 4J1QA 3N70A 4MAAA 4OPMA 1RXYA 2R8EA 4QDXA 4RZ2A 5IM5A 4ER5A 4AG5A 1Q2XA 1T4BA 2G0UA 5SZIA 1E2KA 2GETA 2WBLC 4KZKA 4BZZA 1IY0A 3T0FA 3EFHA 1HR0T 5J58A 1KHHA 2HDOA 3BTVA 3PQCA 2X9GA 1X87A 1X1RA 4WOJA 3T4XA 1YQEA 2LDBA 1N5IA 1XPJA 3MM4A 3G89A 4Z90A 3TNJA 4ZVMA 3L4EA 1ADBA 3W7AA 2DULA 3D3EA 1RLOA 2VSOA 4EECA 3M4NA 1SHZC 4PEVA 3RUDA 2W6ID 2XD4A 4YV2A 1CUFA 1VIDA 4C01A 3IAHA 5HTOA 1HO3A 1J8MF 1DTSA 1KDTA 3H4MA 5IH3A 4BVKA 1WULS 3OC6A 4W9MC 1BU8A 4D3SA 1T1SA 3E18A 1A0OA 2RP4A 1U65A 3T3MB 4YYEA 4FOTA 2VPYA 3K0AA 5LP6B 2IYLD 1CR4A 2YIJA 3IXMA 4OGFA 1C7FA 2Q1UA 4EPVA 3DBIA 4INOA 1F38A 1YRBA 2V6MA 4MV8A 5HIMA 3IF8B 1AHIA 2QW0X 4P3KA 5AJYA 2JFUA 1K6XA 2XVXA 4XJSA 3DTYA 3P52A 4DVGA 4X45A 1L5RA 2J07A 2XMGA 5C9ZA 2N1BA 4OXIA 3QFHA 4AG6A 3KQTA 1QGOA 1P0CA 2PSSA 3G9ZA 4JT4A 4NJEA 4PSKA 2FVXA 3LDHA 5AR1A 4NZNA 1YH3A 1I4EB 1W0KD 1XRNA 4TSKA 3EEYA 3LY5A 3UJHA 1B42A 3IQIX 4Q4AB 4D42A 5CVTA 4WCFB 5LQJA 5FORA 3ZJ1A 1B2RA 1D6SA 2NQ2C 1NR5A 3A6GA 3KZ1E 5GVSA 1O0BA 3WNVA 1YBAA 2H3HA 3RS9A 1FZQA 3NTXA 2TMGA 3MT0A 4HYTA 5DBOA 4F2DA 1CFZA 4JYPA 4NU0A 4CF4A 4BKOA 1L7BA 1MAVA 3FSEA 3I9YA 3L40A 1ZU5A 1NLZA 3IDSA 1MJNA 3OQVA 2ZM8A 4RETA 2OAQ1 3QWBA 4RESA 1JVBA 4O2AE 1WCYA 4WZAE 4AJJA 4F3CA 2PQ6A 3WA7A 3SGLA 1T8PA 3T9EA 3TDMA 1MEOA 3NEPX 4D8XA 1LS1A 4QOSA 4YDHB 3MHPA 3U1BA 3SBEA 1OJ7A 1YKFA 4TWZA 5FPYA 2VYVA 8ATCA 1TCVA 2NPOA 1DV2A 3NHBA 1G55A 4GKVA 1H9BA 4P54A 1DCTA 4HTAA 4KWTA 2PKXA 5I9MA 1ZM7A 2EP7A 4Q4AA 4JHLA 2YQZA 3RYHE 3IQEA 4PCUA 1VPTA 4JXJA 5JAMA 4IZIA 1TUGA 2BM0A 1KEEA 4YHHB 3ESZA 1WDKA 2FPGA 2XPKA 4G97A 4OH1A 2ZRKA 4L9IA 1EUCB 3PR3A 1BH2A 3QA3E 2GZHA 2UKDA 1FLVA 5F73A 3LXRA 2YIMA 3BDIA 4LHWA 4X5OA 2L9QA 1Z0IA 4N8EA 3UMCA 3UAOA 4YUWA 1II8B 2FZ4A 1RQ7A 1K86A 5HXCA 2FNAA 1WDWB 3ZCXA 4LMBA 3RVBA 1C8LA 3JC6D 2R6GA 5H9VA 3IT1A 1PUJA 1ATIA 2OZVA 1L8AA 2EW8A 3ME5A 4UD2A 3UU5A 1JSZA 4UBJA 2Q1YA 3SJBA 2B0JA 2R68A 1Y37A 1EUQA 4N78D 3LGAA 1Z62A 1KK7A 2XA2A 2ZE6A 1YE8A 4RSGA 2R8ZA 3AV3A 4Q37A 3T5GA 3U1TA 3GWHA 2CLYC 1F1BA 1MOSA 3SSNA 3FPEA 4JEMA 2QZJA 3OLXA 5F12A 4BAZA 3RSHA 5K6TA 4HGAA 2OYSA 4FCCA 1M34B 1W5BA 4J90A 2APJA 1Y81A 3O8DA 4IWXA 1L8XA 2J5RA 1PNVA 3ZUPA 4V1CI 4MVJI 5GMOA 4WZBA 3L8GA 2H2DA 4ECEA 1A9RA 3CZMA 5F8PA 3E0QA 4E14A 3PA8A 1NL3A 1JR3A 3UFBA 3QX3A 4DR6T 2BGIA 2Y71A 1YRLA 3ACDA 4OG2A 2FSIA 4P7JA 2BR3A 3N3AC 4R2HA 5AM5A 4AP9A 4BNGA 3TZHA 1F8GA 1T3LA 4NWIA 5F78A 3DMYA 1UQRA 3F4LA 3JQ6A 4GP9A 2AGVA 1V7CA 3ND7A 3HU5A 1GTRA 4F8JA 4DCMA 2W4QA 1VHWA 3BHNA 5BR1A 5C1BA 4XEUA 1P1HA 4X90A 5GJWC 5KIAA 4DR2B 2H07A 4RFLA 4EG8A 2XNCA 5FEUA 4MW4A 5B58T 1NXSA 4GGOA 5HNKA 1XLWA 3OP1A 2V4ZA 2ZIEA 2G5GX 2N75A 4L95C 3U4MA 3GPCA 5K4HA 4H7PA 1V1RA 2FPLA 3EFEA 4HAUA 1W93A 1EX7A 5IJ0B 3TM4A 5DNVA 1XCGB 3ET4A 1BGWA 3W06A 1JDJA 3RTEA 1JHDA 1HT0A 1R0CA 1NLFA 3CG0A 3AW8A 4XGQA 3WGHA 3MYRA 4E2WA 1T2DA 2PUJA 3MS4A 4FCTA 4ISTA 1Z45A 4O4JA 1WPRA 3PE4A 3N2KE 1J23A 4NFHA 3WKDA 4MS4A 1JNRA 4MJ3A 4JP1A 3V5SA 1JR3D 1BXZA 3LOQA 5JV5A 4AY6A 4X6UA 4TMFA 4JI1T 2HRZA 2IQIA 5FPQA 2I3BA 1MFPA 1QV6A 4N0MA 3S5UA 4ILKA 3W8FA 4NKRA 4M38A 4NXMT 2Q29A 3CEHA 4OUDA 3RASA 4BEWA 2ZSIA 3Q9DA 3Q5WA 4QH4A 3BMCB 3G2PA 3GCGA 1D5CA 1UOOA 4QWNB 4X1KA 2W67A 1VPWA 2HQOA 4YBRA 3KAJA 1O57A 1N2CB 1O0CA 4BGEA 3RLIA 3R75A 2OV9A 1GPH1 3ENNA 1MXHA 4EW2A 3O4HA 2E4VA 2WHPB 1KL7A 1QHSA 1EFPB 2K24A 1I2BA 3K0HA 2VYQA 2AFHA 3HWX1 3RVPA 1RFGE 2ODNA 3PEFA 4P82A 2C1EA 4U7WA 3EAFA 1L5HB 1PZEA 3WHIA 1CRPA 1BVUA 5J4YA 4UR9A 5AKXA 1WS6A 4J1SA 5JH7A 3KL2A 4Z3KA 5JROA 5KSOA <