4OHFA

Crystal structure of cytosolic nucleotidase ii (lpg0095) in complex with gmp from legionella pneumophila, northeast structural genomics consortium target lgr1
Total Genus 159
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
159
sequence length
461
structure length
455
Chain Sequence
KVFVNRIINMRKIKLIGLDMDHTLIRYNSKNFESLVYDLVKERLAESFHYPEEIKKFKFNFDDAIRGLVIDSKNGNILKLSRYGAIRLSYHGTKQISFSDQKKIYRSIYVDLGDPNYMAIDTSFSIAFCILYGQLVDLKDTNPDKMPSYQAIAQDVQYCVDKVHSDGTLKNIIIKNLKKYVIREKEVVEGLKHFIRYGKKIFILTNSEYSYSKLLLDYALSPFLDKGEHWQGLFEFVITLANKPRFFYDNLRFLSVNPENGTMTNVHGPIVPGVYQGGNAKKFTEDLGVGGDEILYIGDHIYGDILRLKKDCNWRTALVVEELGEEIASQIRALPIEKKIGEAMAIKKELEQKYVDLCTRSIDESYDQEIHDLQLQISTVDLQISRLLQEQNSFYNPKWERVFRAGAEESYFAYQVDRFACIYMEKLSDLLEHSPMTYFRANRRLLAHDIDILEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytosolic IMP-GMP specific 5'-nucleotidase
publication title Allosteric regulation and substrate activation in cytosolic nucleotidase II from Legionella pneumophila.
pubmed doi rcsb
source organism Legionella pneumophila subsp. pneumophila
molecule tags Hydrolase
total genus 159
structure length 455
sequence length 461
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05761 5_nucleotid 5' nucleotidase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1160 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4ohfA03
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 4ohfA01
3I76A 1Q91A 3ZX5A 4C4RA 4UU1A 2P11A 4OCZA 3GYGA 1L8OA 5AKIA 5ALOA 2MU1A 4Y2YA 3QLEA 2WM8A 3QU2A 3J7TA 1U7OA 2IOFA 5AI9A 4BEWA 2I33A 4AS2A 2C4NA 3ZTWA 2HCFA 1J97A 5AVWA 4Y2UA 2G07A 1RRCA 4KNWA 1RC8A 2FUEA 3QUTA 1RMYA 5AHXA 3SKYA 2YJ5A 5IT0A 3L0YA 1QQ5A 5AVQA 3WK8A 4H1WA 1RLMA 4ZEXA 4YIHA 3UMCA 2FPSA 5ALQA 2FPWA 2R8XA 3QNMA 4Y2SA 2GHQA 2YMPA 1Q92A 3WK5A 3PGVA 5E0OA 1N8NA 1Z5GA 2DQSA 2Q5EA 3OTQA 4I9FA 1CR6A 2FEAA 3ZVLA 3FPSA 4AP9A 5ALFA 2W43A 4J2TA 3NASA 1RLTA 1RQNA 5AK6A 2FPUA 5AW8A 2JGAA 5AESA 5AIBA 2ODAA 5AW9A 1YS9A 3FPBA 4FFDA 2ZBGA 2QLTA 2EATA 5ALKA 3ZX4A 2R8ZA 3FM9A 5ALRA 3EPRA 3KZXA 5AKEA 1Z4KA 4BNDA 2R8EA 4KX3A 2B8JA 3KC2A 1TJ4A 1Z4IA 5AM3A 2HDOA 4XQ0A 3I6BA 3L8HA 2HHLA 2I55A 4ZEVA 1RDFA 2WHEA 1Z88A 2PKEA 2W11A 1L7OA 3IB6A 2Q4TA 3NIWA 2O9JA 3SF0A 4CF5A 2WF7A 3L8EA 1T5TA 1L7PA 3UMBA 2QYHA 5AVYA 5IS2A 3N28A 4L57A 1U7PA 2NO4A 3DNPA 1YV9A 2JAOA 1T5SA 1ZRMA 3A1DA 5ALZA 4Y2PA 3AR7A 3OCWA 3B9BA 1NRWA 2I54A 2CN1A 2WF8A 2AMYA 1QQ7A 3IJ5A 3VAYA 2I34A 2FUCA 3M9LA 1EK2A 2FDRA 1ZD3A 3EWIA 5ALWA 4XPZA 4J03A 3U7GA 3MN1A 4KX5A 3W5AA 4KNVA 1K1EA 5AKZA 2D2VA 2ZBEA 2G0AA 2OM6A 2ZG6A 4I9GA 2HO4A 1KYTA 1ZJJA 2ZBFA 3ZTYA 5AKYA 3BWVA 1Z4LA 3WKDA 5AI8A 2WFAA 3EF0A 3PCTA 4BX0A 1NF2A 3SKXA 3A1EA 2BDEA 1Z4MA 3QU4A 5AK5A 3B8EA 3AR6A 2IOHA 3RF6A 4FYPA 3QXGA 4C4SA 1L8LA 2W4MA 2FPRA 2HOQA 3U7HB 1XVIA 4DCCA 2YMMA 1RKQA 4DFDA 4UAVA 2ZXEA 2CFSA 3IRUA 3NANA 3U26A 1Z4PX 3DV9A 4BBJA 1ZRNA 2HX1A 4QQFA 1O08A 3WKBA 5AM1A 2B1QA 2EARA 1ZD5A 2G08A 4HAIA 1WPGA 2G80A 1JUDA 3E58A 1FEZA 1U02A 3ET5A 2O2XA 1TJ3A 4HGNA 2PQ0A 4Y2XA 1RMTA 2C8LA 1S2OA 4Y2TA 2NYVA 4JB3A 5IT4A 3NUQA 2R8YA 3MC1A 4IFTA 2BY4A 4Y2VA 4YGYA 1IWOA 1AQ6A 2B82A 2JARA 2WF9A 3CNHA 4AS3A 4QJBA 1J8DA 4UATA 1RKUA 5AIAA 3HLTA 3QGMA 2NO5A 3WKEA 3L5KA 5AVZA 3OCYA 1LTQA 5T41A 3U7EB 1LVHA 3KDPA 3WGUA 4UM5A 1RLOA 4CF4A 5AVUA 1Z5UA 2JAUA 4L6AA 4OHFA 4UMDA 2OYCA 1QH9A 1VFPA 1RPZA 3QUBA 5FP0A 4F72A 4UAUA 4CNQA 4MUMA 2FPXA 4Y2JA 5ALYA 3WGVA 3PGLA 3OCXA 5AVVA 1S8OA 4HGQA 3L0CA 5ALGA 5ALIA 2B1RA 4FE3A 5A3RA 2HF2A 1Z4JA 3L1VA 4Y3UA 3ZW7A 2ZBDA 3R4CA 4NAVA 5AVXA 4UMFA 2G06A 5AKKA 3QU7A 3SMVA 4JDPA 4GIBA 1L7MA 4NFLA 3KD3A 1YJ5A 2EAUA 4L6CA 4KN8A 2BDUA 1U2SA 3SD7A 1EK1A 4UMVA 2YFYA 3AR4A 4G9BA 4BEVA 4BX3A 3A3YA 5ALTA 5AW3A 3N8GA 2CFRA 5AI4A 2ZOSA 4EELA 4UU0A 1TE2A 3MPOA 4YIKA 2WF5A 1U2TA 3ESRA 4OFZA 3WKAA 4DWOA 2X4DA 3BA6A 4NV0A 4EX7A 4RESA 5AVSA 3ET4A 3DDHA 1T9ZA 3N07A 3ONNA 3P96A 4YCNA 5AM5A 2MSNA 2IYEA 4RETA 2HEGA 2G09A 3AR2A 3N5KA 4HGPA 2RB5A 1L7NA 4CF3A 1XP5A 3ESQA 3WK7A 3FZQA 3I28A 3B9RA 1YMQA 3FGOA 1XPJA 2YJ6A 3KOOA 4B6JA 5AKJA 2HI0A 1PW5A 5AKHA 4E88A 2WF6A 1ZS9A 3SHQA 1WVIA 5AW4A 4BX2A 2AUTA 5AICA 5AW1A 3F9RA 1Z4OA 3S6JA 4UM7A 1RKVA 3MMZA 4G63A 1ZD4A 3I1YA 1QQ6A 4GXTA 5ALLA 3WKCA 5ALDA 2B0CA 5AKLA 1YDFA 1CQZA 3OCZA 5ALEA 3SLRA 3TLMA 3E84A 5AI0A 2FI1A 3RFUA 3QUQA 1F5SA 4EEKA 2P69A 3WK6A 4HGOA 1VJRA 1WZCA 3E8MA 3ZUPA 2VKQA 3UM9A 5A3QA 4ZEWA 2P27A 2I6XA 3NRJA 1O03A 5AVTA 4Y2QA 2GMWA 1ZOLA 3QUCA 3QU5A 3ZI4A 2OBBA 1Z4NA 3AR5A 3ZWDA 3FVVA 3UMGA 5AW6A 4YH1A 1SWVA 3L8FA 2RAVA 3PDWA 2C8KA 3ZU6A 4Y2RA 3OCVA 1SWWA 5AI6A 3L1UA 2HSZA 2Q4RA 5ALSA 1TA0A 4YCLA 4XE5A 1YNSA 2YY6A 3ZVNA 1Y8AA 4UARA 2P9JA 3ED5A 3WK9A 1N9KA 5AW2A 3U7FB 1TJ5A 5ALVA 1Z4QA 2YN4A 3A1CA 5AKGA 3AR3A 5AM4A 2OA0A 3L8GA 3HYCA 4EX6A 1RQLA 3D6JA 5ALUA 3EF1A 4C4TA 1NNLA 3K1ZA 3ZVMA 4EENA 3R09A 5ALMA 1WR8A 5AK4A 4CE6A 5AW5A 3AR8A 1VJ5A 5AW7A 3W5DA 3WK4A 5AM0A 2AGVA 4NWIA 5ALXA 4KYTA 3R9KA 3U13A 2HF7A 2I7DA 2YMQA 3E81A 2YJ4A 2GO7A 5ALJA 5AVRA 3QYPA 4DW8A 5AI5A 4UW9A 5JJBA 2IA5A 2C9MA 2GHTA 2G1AA 3DAOA 4HGRA 5AKXA 4PNHA 3CZ4A 5ALPA 1X42A 3L0BA 2PR7A 2RBKA 3U19A 4IG4A 2YMLA 3ZWKA 3QX7A 4F71A 2IOFK 2JAWA 1ZD2P 2B8EA 3OCUA 4XOUA 3N1UA 3NAMA 2B30A 4HYTA 4O8CA 4YCMA 4BNDB 5AW0A 3KBBA 4UMEA 1RMQA 4UASA 4BKMA 3W5CA 5AM2A 1MH9A 5AK3A 3NALA 4EZEA 2YJ3A 3L7YA 5ALHA 1L6RA 3OPXA 1QYIA 2YBDA 2C88A 3QU9A 5ALNA 5A3SA 3AR9A 1SU4A 2GFHA 4NABA 4MWOA 2AH5A 4OD0A 3M1YA 2CFTA 2RARA 4BYGA 3W5BA
chains in the Genus database with same CATH superfamily
1KK1A 4KQJA 2X7HA 3KO8A 4N3GA 4Z4CA 3IGFA 2P6RA 2X1VA 1LC3A 1AU9A 1XJWA 1W0KD 2WPDA 5FLEX 3B53X 5CD1A 2CXOA 5FDFA 3FY4A 4MX8A 3UEOA 1UC5B 2NVWA 5EHNA 1MOQA 4L27A 1C1DA 2B99A 5FBQB 1ZN9A 5HMLA 3DFUA 1X38A 3ANNA 2ADFA 3V55A 2P30A 4ZZ1A 2OHVA 5ESXA 2GJ4A 3AP3A 2YY5A 2E4YA 1ZCJA 3C4JA 5FBVB 2PYDA 4FYKA 3OJXA 3LECA 3V4RA 4P31A 3CQGB 3F6YA 1JDSA 3OTHA 3B5JA 3CX6A 3EVAA 1WPRA 2XNJA 5KS2A 3KVBA 1CXZA 2KBEA 1UK6A 3H0KA 4UELA 1TKRA 3EC1A 3C8DA 3TQFA 1F14A 4RSGA 4AY5A 2BAGA 1D2EA 2UZ4A 5B2ZA 4BPBA 3HA5A 3OBBA 2I54A 4LZPA 4O63O 5TS2A 3W9UA 3RSOA 4HKTA 1KI1A 1BMDA 4C0WA 2PKQO 1BD3A 2E4XA 5A03A 2Q21A 2JATA 2BUBA 1ENOA 1TVEA 4CEIA 4HK4A 3C6YA 3IBYA 2IC9A 2R5NA 2AC4A 3T5PA 4ACBA 2WDZA 3MGGA 5JZMA 1U63A 2C3MA 4B6PA 4XZ3A 3CZQA 5KB3A 3OTOB 2VKHA 1ZVVA 1WMSA 1I94B 3GGPA 4M1MA 2WB2A 3OTGA 3IESA 2NZ8A 3PUHA 3E58A 3EUWA 2JC3A 2GERA 4AUNA 3LLMA 3SCZA 3PUXF 4QDKA 4R84A 2CUTA 5DWDA 4JB3A 4Y0NA 1JLMA 1OH5A 2ZJBA 4OL9A 2VNHA 2UVPB 5IXJA 3X1YA 1A5SB 4NKRA 3EGXB 4LGYA 1JXMA 1IPFA 1QTRA 3FCXA 4X62B 3FLAA 1P0PA 2D0DA 4GM4A 5BP7A 3EPPA 3ZZ1A 4ZP1A 5F3JA 3TOCA 3EZ2A 4JODA 1QR2A 1PLKA 1V8ZA 4UREA 2C3PA 4NBLA 4HSEA 2L69A 3WHLA 1UKYA 2CNDA 3HEBA 2YVKA 4C78A 2Y99A 3JQ7B 3PICA 4R5MA 2OFOA 1X1EA 1NLMA 3ONFA 1P5FA 2WSSV 3CO5A 2A3RA 1V4VA 4DHEA 2PJZA 1PCXA 3G23A 1KAMA 1J2TA 2YNMC 1CLEA 1T2FA 2HHJA 5ENDA 1QQAA 1HR0B 3L92A 2FPOA 3RRZA 3FHLA 8ABPA 3A5XA 4JT9A 3I28A 4P58A 3V2GA 3FGOA 2HTEA 4Q34A 3X2FA 2EG5A 2DETA 3JQ9A 1NVAA 1S7CA 2X9HA 3L07A 4X3OA 4H9GA 3OJWA 4D8TA 3QXHA 4IXTA 5CNMA 4JFRA 2R48A 2DHDA 2BFDA 5HIMA 3D6TB 3AA0B 4BN0A 4A10A 1R8IA 2E9XA 3PR2B 5A05A 1IZYA 5JJIA 3DVSX 3MIIA 4HD8A 4Y2RA 5F2KA 2DYKA 4Q47A 2V0NA 3T7CA 3EQ6A 1MCZA 5AR1A 3N6XA 3WLLA 4G5SA 4D6YA 2D2SA 1AK1A 1UXKA 1NF3A 3ZVMA 4IE6A 4UBJA 2VDPB 4G1CA 1U3DA 2RHWA 1QE3A 4W5NA 2VCYA 4F9TA 4BQRA 3WYAA 1RZRA 4LSZA 3F5FA 3MMNA 2C4TA 4RZSA 4AJ1A 1PQWA 1P6XA 3R44A 4LYEA 4PFJA 4ZYYA 2XKAA 3CBGA 2B8EA 4UHHA 4V24A 4FYIA 5AW0A 2ZYHA 2XAFB 2P9HA 1ISHA 2K5UA 1MH9A 1ZNXA 3P9RA 5DT2A 4KJXA 3RV3A 1PD1A 1T2EA 4XW2A 1MW9X 1HDOA 3EYWA 5F2EA 2Y6XA 4YMVA 1R8XA 3LCCA 2RB4A 1MKYA 4RM2A 3JTMA 3T3EA 3L7KA 5B58C 2ZXUA 1UZUA 4ALMA 1LW6E 1SD2A 1O95C 4ZI7F 1RABA 2DUMA 4ZGBA 5L3GB 3UOWA 4Y2UA 4OHUA 3KB2A 3L7MA 1KC1A 4PZUA 1T9AA 3SQMA 2L9QA 3T4PA 2HU7A 3M1AA 3A1TA 1N8NA 3M1IA 5MHTA 4J0HA 2QZJA 3PGA1 1O5OA 3PFGA 4ZEMA 1V45E 1UC4B 4ZHQF 4LX0A 2RAUA 1HF8A 2ZBGA 1G9SA 5KHOC 4OUDB 3NWOA 1PZFA 2C9ZA 1J4AA 1LDGA 1WU8A 4TT3A 4B79A 3CR3C 4HNSA 1HTTA 3FF4A 3PXGA 3R3WA 4A6DA 9ATCA 3NNSA 2H48A 2QORA 4F11A 4I9UA 4TS3A 4B3JA 3PTLA 1JGTA 1LEHA 4UBMA 1JDZA 3ES9A 3DE2X 1TQHA 4ZVNA 3JV7A 3U0BA 2E6UX 2BH9A 1TQ2A 3F3KA 1JIJA 3U6KA 3O4XE 5L95A 3FKQA 2G8NA 3ZDDA 3G8DA 3MJXA 3GUHA 1DRKA 4BFXA 4NONA 3MMXA 2BRUC 3TLKA 2IOHA 3DEIA 2YVUA 2OENG 5HWYA 5I9SA 2BHLA 3LQFA 1MXFA 1RWBA 3LJKA 2HADA 1E7RA 4ZPJA 1LLFA 2G5CA 4EY6A 3RK1A 1U8ZA 1ODKA 2WM9A 2VAMA 4KX6A 4HTFB 1TZBA 4I55A 3WMFA 3FDZB 1ISMA 4HLCA 5FXWA 4MS4B 3CPEA 2H0AA 5EP2A 5B3JC 1L0BA 4BO7A 3I2JA 4HAYA 1RXCA 4WXMA 3B2EA 1YHNA 4TYWA 1LF5A 3E70C 4X6LA 2RHGB 4E4YA 1QDUA 1T8WA 5AVUA 4TN7B 2IC5A 2X9QA 4UDYX 4DR4T 1N6NA 2JFGA 3L3BA 3KEGA 3G7UA 5ALGA 4L4UA 1ND5A 1Q7GA 2I03A 1P1HA 1P62B 1PP4A 4I4TF 5FTNA 3LCUA 2RCNA 4C6RA 1HYQA 1V0JA 1VECA 4R40A 3IBPA 3PNMA 4LCBA 4HL6A 4F92B 3BQ9A 3VSBA 1FBNA 5IVHA 4YMUA 2F9LA 2H52A 2QL5A 1CHNA 4RGQA 3M5CA 4HFJA 1RI5A 4EJFA 2J3JA 4GI5A 1E2QA 3FSRA 2JCYA 2UZIR 1FNSA 4V3CA 2E7ZA 1ADFA 4NNPA 3RQWA 1XHEA 2H08A 4OMUA 3QPDA 1OBVA 1FMLA 1DIAA 4KPUB 2NW8A 2B0CA 2ZUWA 3ZHSA 2VDNB 4C91A 1GIAA 5EE5B 1GPWB 3AEGA 1GRNA 2V4UA 3VNBA 4YTMA 2SECE 2L17A 3U4AA 1L7DA 1G98A 4IL9A 5EXTA 1F3OA 2Q4RA 4LI0A 5B1IA 3CEJA 4RY8A 2WQYA 1AK9A 1K89A 1LPBB 3I0NA 5SICE 2P9EA 1TQ4A 4OMCA 2G82A 3S0JA 2P5SA 1QYVA 1B74A 3VGPA 3ROKA 1E4EA 3D7KA 3EY9A 5BV1A 3M83A 5BW6B 1J2JA 2OCIA 1M34B 1V6CA 1QB8A 4C14A 4JQZA 4EPRA 3UFGA 4FU0A 3RRXA 4ILKA 2W2QA 4QYWA 2PMBA 4ETNA 4REQA 3DOUA 1CZHA 4ZEOA 2CMGA 4EMTA 1MR3F 3HXQA 1OROA 2YFKA 2Q3DA 3NYIA 1KJWA 1PS9A 1RWOA 3KLNA 5SZJA 4HDMB 3ER8A 3RFFA 5BN3A 5FOUA 3DO8A 5FR1A 1XQ9A 5T57A 5FFNA 2G7ZA 3CNEA 4K3VA 1KS2A 4RDHA 3M81A 4Y6QA 1HETA 1HSZA 4A16A 4CQLB 4GOKA 3ANXA 4K0KB 4PR0A 2FF5A 3JQFC 1CF2O 1PWYE 2NTYC 3WK8A 1T15A 3IUYA 2V03A 3G0HA 2WD7A 2WY2A 4LV8B 2FMTA 3GLRA 2OAEA 4LHXA 2Y27A 4D9KA 2AE2A 5ALFA 4ALJA 3N0RA 3I9FA 2V7XA 2PH5A 6NULA 4QOJA 4C0SA 2QRVA 1QU2A 1YO6A 1KFEB 3O5AA 4KX3A 1IIRA 4Z51A 4FCWA 3LNCA 3DEZA 3DHNA 2GJAA 1D1CA 3W6ZA 3FMVA 2FEXA 2TSYB 4JENA 5GINE 3A9UA 1YASA 3CKYA 5E9QA 2X0IA 1M3SA 4RTRA 4ZJYA 4RD0A 2YWRA 3G88A 2ZTHA 3PX7A 2WF8A 5EHIA 4ZIRA 2OHOA 1WZUA 5B5SA 2GI4A 2EBFX 4EFDA 4QPNA 1U1GA 4A8PA 1CDDA 3QVSA 2XCLA 1V11B 3VH3A 2JEZA 1K8YB 2QU7A 1U5BB 3HDHA 3MQ4A 2Q7DA 1VZ2A 4UEMA 1LLQA 4M8LA 3RLFA 2I7TA 4UOEA 4O2BA 4JL6A 1BFDA 1VKJA 3D0QA 3TIXB 5BURA 1ZD5A 4WVLA 3NBXX 1X1QA 4P54A 3K0KA 3K3QC 3HRKA 4HX9A 3D0RA 3T5CA 1UDRA 3L82B 3HFSA 3ORHA 1Y6JA 4COKA 1TVCA 5KWVA 1KGDA 3RTDA 1CUVA 4CBVA 4KE7A 3PC8C 2DE0X 1CP2A 4P6VF 8OHMA 3P4QA 4ASUA 5GOZA 5LQCA 5IZ4A 3T1HB 1OXKB 4GBMA 2E55A 2FMIA 4HRYA 3DHEA 1Z12A 2G06A 3AI1A 4NU0A 4M1TA 3W78A 4I43B 4Z2AA 5JDIA 5JJKA 3D1JA 2H1IA 1PT9A 2HCTA 1XRRA 2C4MA 5IUJC 3EE6A 1IXRC 4C7OA 3TL2A 4RD1A 5HFAA 1U81A 3G2LA 4GRAA 4MVJG 4C05A 2FWIA 3R3HA 3PNLA 4YJFB 5AM5A 3FUCA 5I7WA 3FHOA 2FWBA 1CUBA 3QJGA 4M0PA 1Z73A 2G5TA 3O2QB 1O58A 5EKXA 4XYLA 3DULA 4YAIA 3KBOA 3H5WA 2RC6A 2C59A 2G9UA 1PIWA 3KM0A 2G1JA 4QTXA 2Y66A 1APBA 1SHTX 4AKTA 2WWUA 3IQDB 1F1BA 2DL1A 1B8UA 1D4AA 4YROA 4HQKA 1KI4A 3O8NA 1PFYA 2QQ5A 3OSUA 4ND7A 2ACXA 1TLFA 4ID9A 4C0AC 3PEEA 1D07A 1G291 1DX6A 1J0BA 1BGVA 1XPOA 4RVUA 4M1YA 1QV7A 1T2DA 4CODB 2PBRA 1RZVA 3HPQA 2NNLD 4LGVA 1TYZA 3E2IA 1K4MA 1U7XA 1A71A 2OUKA 3ZBQA 5L40A 4D1YA 1N3LA 3SEZA 1AK2A 1OLSB 1M2FA 1T3SA 1PFKA 5DU2A 1TC2A 5GVSA 5CM2Z 2WZCA 2YCLA 2ONZA 3G6KA 4RZ2A 1AQNA 5FPPA 1U0LA 4JI1B 4C30A 3OZTA 4HZUB 5T7BA 3EQ7A 1SKYE 1PZMA 5E2AA 5B1HA 4LMRA 5T3UA 3CVRA 5EZQA 5HS4A 4X9XA 3GOQA 4AL4A 4UFOA 1VLJA 1I7PA 3W2IA 2DERA 1S4QA 2NSYA 3UU3A 4IIVA 1NG9A 1J97A 3SJCA 1Q2UA 1KDRA 2Y92A 1V7PC 3OVMA 3PDIB 2GZRA 3WOVA 4HFCA 4TXNA 1FLNA 4MUFA 1HC7A 5K8TA 1H3FA 1NDQA 1VHDA 4HMOA 1N92A 3UQZA 2W6JD 1NQXA 2OCPA 2C97A 4P36A 1WXGA 1KF0A 1TKBA 2AR7A 3QYAA 3R8XA 3CLTD 1MXHA 4YEDA 1NWMX 1G8SA 1KI6B 5HR5A 4FDVA 2XKBA 3NHUA 2GPNA 5JFOA 3HBFA 2XQ3A 4X1KA 3D7RA 3EASA 1XVLA 1T3LA 2DLDA 5AKYA 4G5FA 4U72A 2JMKA 2P4QA 2J6CA 5BNFA 1EXMA 4PN3A 1R00A 3KKEA 1G21A 4P93A 3W7AA 2HOQA 1JFFB 4LYAA 5KPJA 3OZDA 2IYZA 3SZGA 3SRZA 1Z5OA 2MOZA 3M6LA 3BUSA 1W4CA 4JT8A 5DCUA 4Z7QB 1G2IA 2E5WA 5LGNB 1W46A 4ML3A 2MWMA 2ERXA 4Z4EA 4CCWA 5JC8A 4CEHA 3FJYA 4HR7A 5KQPA 1ZBQA 4U74A 1PVVA 2BW0A 5A9SB 1A50B 4D4JA 4FBMA 3P4WA 3RRFA 2DF8A 1ENPA 2WHQA 5IKOA 2WWRA 3LKVA 3L5KA 4ZCLA 2DWKA 3KSRA 4YP1A 1Q7TA 2UUPA 2V7QA 4CF4A 1ZG3A 4NLLA 3KZNA 4RZIA 1E0KA 2P68A 3FKJA 2AX4A 3GRRA 2PFVA 3BZWA 3MWEB 4LYDA 3MK31 5KINB 4OXKA 3UJ6A 2F3SA 5KDMC 5F76A 3A6KA 2BFMA 5LB4A 3ZVRA 3JAKA 1QZ3A 4FMBB 1BHJA 2HK9A 3A2MA 5TGTA 4UTVA 2O3RA 1FJHA 1QU3A 1W8DA 3UWKA 3UWOA 2I9KA 1XZEA 3N75A 5IMBA 1ZA1A 4EX7A 1GADO 3I9V1 1MIWA 3AEXA 3IPAA 1Q0ZA 5FVKA 4JP5A 1XP5A 1N34T 3GR6A 4E88A 3AAIA 2VNSA 1WVIA 3V00A 1OH8A 4HWPA 3ELYA 3RIGA 3FOZA 3NI2A 3BCRA 4Z4FA 4YRZA 1FQWA 3C15C 1G9XA 2N3ZA 1VJRA 3I61A 1KNZA 3VYUB 3RVLA 3I64A 1MMDA 4DLTA 1FMVA 4ND5A 1NN0A 1KVTA 1M6VA 1ZK0A 4CQMD 4WZAA 3UGTA 5DN6A 4QECA 2XCQA 2QTHA 1ACJA 4WDQA 4F06A 1UP6A 2PA3A 5KSPA 3M5PA 4IJKA 1WR8A 1QDEA 1T8BA 3DWFA 4RK7A 3A6FA 4US0R 5A5GA 2FUPA 1MNAA 3ZEIA 1K0FA 1F38A 5K3CA 3ZLVA 1F20A 2UDPA 1DUVG 4AZ3B 4QM6A 3FKSD 4CW7A 4AECA 1ORWA 2BZGA 4I1OA 4M21A 1SG0A 1O3YA 3H0CA 4I50A 5FPKA 2FP3A 1VSTA 3E7WA 4J76A 2KLHA 2XBMA 1EXWA 4MUNA 2ODVA 2NTJA 2XUOA 3ZHCA 5KPDA 4LJ7A 2EKPA 1O2DA 3ER6A 2PX3A 3OTQA 2B4KA 5GGXA 1P9WA 2HHHT 1OWAA 1U31A 3EZXA 1VXOA 2BM8A 2V5DA 3ISJA 4E15A 4PXAA 5KYUB 4W1RA 1GFZA 2UUOA 4Z0HO 1KDOA 2ZTMA 1GPH1 1ZIDA 2VF8A 3HUFA 4ZJZA 1V5GA 1DTEA 1P2UA 2I2DA 5C5EA 3JVIA 4LJLA 2YTZA 2WAUA 5IKMA 2NN3C 3PRJA 4HN2A 3BYZA 3KSUA 1WMEA 2BEVB 2RGNA 4F4DA 1R9JA 2A5YB 5E1BA 4QOHA 1EFTA 2PD6A 1FRFS 5BVHA 3LC2O 1HY3A 1W36B 2VKJA 4QEZA 3IXQA 4OGWA 4PYLA 2PIDA 1PDWA 1Z8NA 1NVTA 2C95A 5K09A 4F60A 4DUYB 4DQUA 5CDFE 4HLNA 5CVUA 4I4TB 1R0RE 3N2GE 3TDNA 5KYTA 1NOIA 5AK0A 3MTEA 4RD2A 2X14A 3EA0A 2L82A 1JEYB 3PU8A 1F8FA 3QUJA 4KNVA 3W06A 2GYVA 2X9NA 3IEKA 1JW9B 3I1FA 1XZFA 5KNCH 1B8VA 4IGEA 4ZN6A 3EXEA 4AIUA 4MFRA 3AW9A 1AH2A 1QX3A 1RKQA 4QXBB 2UAGA 2B37A 2R6JA 1C7EA 5DW0A 3WKBA 2DXIA 2ZIVB 4DLKA 1SK9A 1XIVA 1CNFA 3ELDA 1LBHA 3JQAB 4O4IF 1VLLA 3BDVA 3AA6B 2R6DA 3KXKA 1QRTA 3HCBA 1KI2A 1YDWA 5C4GB 4AWXA 1BCRB 1QIFA 4RE6A 4JVOA 2WE8A 5A2GA 2UUBT 3V7UA 3E82A 4RIHA 4AWAA 4C21A 5HGJA 2OCLA 3NONA 3KAKA 5DNUA 4PG7A 4IAOA 2QQFA 5TR9A 2EFJA 3GRAA 1SIBE 3NMUF 2BH2A 4DLZA 1C4OA 2B1RA 1E1LA 1CUAA 3GNLA 4PEVA 2BGIA 4ZREA 3QSYA 3A4TA 2V6FA 3FWPA 3B20A 3WLIA 1GTL1 2FPPB 4G9BA 3W1WA 1XCPA 2GPBA 1TMOA 2WDQA 4CG3A 1W5EA 2GHRA 5LZ9A 1DCFA 5K0GA 1DAGA 3ZE0B 2O57A 3TQTA 4UBIA 5IYZE 3M82A 3VJMA 4U0KA 1F5NA 5BR8T 1VE3A 2PO7A 2XNCA 4E3WA 3SPXA 3W5JA 4PYMA 5LBIA 2AG1A 4I2NA 1X7GA 3TVDA 2QY6A 1CB7A 1GD1O 4C6SA 3LW8A 5C1BA 4F1JA 2AXPA 5FJJA 4NJMA 3OESA 5LYYA 1DBPA 3H5IA 2EX4A 2VSOA 3KYCA 4YUYA 4M0LA 1H4VB 3RUFA 4X65B 1SWWA 1F51E 1LBTA 1DFGA 3QI7A 1QJ4A 4EYEA 4ARSA 4UDOA 3V8QA 3H2BA 2GWHA 4W9NA 4DUPA 3ABVA 3QWFA 2VJLA 1YCHA 1C1DB 3EIEA 2YV1A 2VPTA 3CONA 4PVDA 3PP8A 4NZPA 1ZM9A 3EZ7A 1SUFA 2Q2NA 1ILWA 3KXPA 4CYMA 4MS3A 1UADA 2XUJA 3UMMA 1MVNA 3RFVA 4OOEA 3PQ6A 4AFNA 3O90A 1EBBA 3CQXC 3CX6B 3JCZA 5I51A 1II0A 3PUXA 10MHA 4HH4A 4JI6B 1JAIA 1XXLA 4CTKA 3FFTA 4X71A 3VR0A 2Z6QA 1KKMA 1SVLA 4OHWA 3DT6A 1ZR2A 1NV9A 4U2DA 1L8OA 3HB5X 2IZZA 1XT6A 1MB9A 3HU2A 1KO8A 2Z2XA 1PS8A 2VK2A 3LP6A 1K92A 1E8NA 2IJGX 5AVWA 1KMCA 3UUBA 1OBOA 5DDIP 3V1YA 5AUPB 4RX1A 4CEIB 4NSNA 3SZRA 3A4IA 4CFSA 3PXDA 1MMNA 3LLVA 1O95A 5D1HA 2R5FA 4AJHA 4RF4A 2AJBA 1P2DA 3L4BC 4DNPA 1UC9A 3R9XA 4E5SA 1C3JA 3SIPA 2JW5A 4KLRA 2B8JA 4DLNA 3ISTA 3UPTA 3V5SA 1J8MF 3C6MA 2V6IA 1MX3A 2RG7A 4CL8A 1QFYA 1UKBA 2PX5A 2C92A 4G24A 2P0EA 5JDHA 1E63A 2MR5A 5TPZA 1ZP6A 3VAYA 3IIIA 2ZYVX 1PLLA 5CEJA 3HDVA 3ND5A 1F2TA 1H2HA 2Q0QA 5DGXA 1N3YA 3LSYA 1Y7HA 5EA2A 2QLNA 2UVDA 1ZWKA 2ZE5A 1FTWA 2C9OA 2E0IA 4ZZCA 1WEKA 3RS8A 1YTLA 4QDOA 3PDHA 5E38A 4G5HA 3RQUA 1DQZA 5AQKB 4EOGA 3JQ8A 3MERA 3WRVA 2OKGA 2A2ZA 4DSNA 3BCSA 1F60A 1BYUA 2VHYA 5LFAA 1E0SA 3T3PB 4CTMA 1SQ6A 3R84B 4MP8A 4GL4A 1NM5C 3U37A 3HB0A 4F86A 1YI1A 1NYQA 1SA0A 2VG8A 3OKPA 5FRDA 4N7BA 1R1DA 3LP5A 4FCCA 1ISRA 1B6TA 5B3JA 3TR5A 2BFDB 3Q1LA 3BS4A 3H5AA 2QSJA 5FQNA 2E9XB 3SXUA 1DIOB 3QEMA 1PT6A 4O4LE 4LOAA 5TVGA 1N7HA 1Z82A 2F2TA 3SGLA 1RM0A 1LGYA 2SHKA 4IJVA 3QWBA 5ARCA 3IDSA 3KOMA 1N5LA 4DM7A 4ZI7A 2V96A 5AWFC 3WLHA 4C06A 2P4HX 3UIEA 2I22A 4J8PA 1A5ZA 1TW3A 4OJYA 4D6XA 4Y6PA 4MR9A 2YWGA 3BN3A 2KLQA 5J2TA 1BJTA 4JWKA 3KBUA 4NATA 1JILA 2NO9A 4ZHQA 3VKUA 4K6KA 2H2AA 3ICPA 1BHQ1 3TRHA 3A9SA 5I8PA 1E7YA 2H2GA 5M4YA 5KREA 3A26A 2FN8A 4HJRA 1NXXA 1Y63A 3KSDO 3KTDA 3DV0A 721PA 3IPCA 3MT8A 3CSSA 1TZMA 1J0AA 3IEXA 4FSDA 3ETHA 2ZRLA 4R2LA 4FLEA 4NY1A 2BMFA 1UJ6A 1IYZA 2X86A 3A28A 1GUAA 4A97A 2YWDA 3BWYA 1MGPA 3T7TA 4XQEA 2XYQA 5TSDA 1MG5A 3WLAA 4LY3A 2J4DA 3QLVA 3F8SA 4R4JA 3B85A 4MW9A 5HJ2A 4N82A 5M7EA 1H0SA 5KVQA 3A6EA 4JI5T 4ND4A 4BTEA 5H3HA 3O7WA 1AZSC 4MAFA 2HEIA 4IX9A 1VHTA 4NH4A 4DAEA 2VDMB 5AQPB 4EGWA 1WL8A 3T3OA 2QIPA 1I3OA 4JBHA 4UJ3A 4WOJA 3RTAA 4MTLA 1O6FA 5HKLA 4DIMA 1JX6A 4QICA 3NEPX 1IRIA 2LHNA 4H4EA 4C08A 1L7VC 4CCSA 3PHGA 1MB0A 1RMYA 3QW4B 4GRDA 1PJ2A 3I92A 3N9IA 5G0SA 3FUWA 1UKZA 1PV1A 4DV6B 3I6MA 3LL4A 1HE8B 1FDVA 4X66B 2XT0A 1C8VB 2IUYA 3IKVA 3TGPA 1E69A 5DQVA 1D3AA 2NTYA 3EZ6A 1EFDN 1W29A 2ODAA 3QBJA 1HX7A 5JTGA 1H6BA 3LUKA 4D57A 2WM9B 3Q6IA 5H83A 3L8CA 1RDFA 4I55B 1LQTA 2RHJA 3SF0A 5HUJA 1DFIA 1R74A 2GVZC 1Z63A 2WZQA 1TOAA 1YJAA 2BKOA 3DNPA 3UHOA 1KZ6A 2BG9C 1BCSA 4UE3S 1ORVA 2DPGA 1AX9A 1ZOIA 2A35A 1BVUA 1USIA 4RM3A 1E2MA 1Z18A 1QG4A 4K6GA 4XX0A 4M2LA 2CYAA 4XIJA 1ULBA 4ZZ3A 4ITUA 5JAIA 2PGAA 1WXDA 5FTWA 5EJAA 3QF7A 3A2KA 3EQZA 3RGGA 3L0OA 4FMCB 2Z8YM 1JVNA 4Z49A 5CM8B 1E1RA 4P0TA 4X7BA 2QTGA 1NI3A 3AE6A 3ZKWA 3LV8A 2WLSA 1JHQA 2H7CA 4LVCA 1BR1A 1E77A 2Q6TA 3UJ7A 5EHGA 1CUYA 1Z0IA 1GR1A 1VM6A 1ZK4A 2ZJAA 2FH5B 2MYNA 3RYIE 2O2DA 4HWSA 4BBPA 1P6QA 5JOQA 4N9QA 2ZPAA 3P9XA 2DQYA 3LT1A 3D2LA 4I4IA 3GIDA 1IIBA 3UAOA 2AHRA 1D03A 2VA9A 5FOXA 2HY7A 2CXDA 3RB8A 2BWJA 3FRHA 4I5GA 2PUVA 2A1IA 3MLBA 3HB9A 1ESMA 1ZMXA 1EGVB 2NU7A 3Q3VA 4NFLA 3GRZA 2ALJA 1XNGA 1YGYA 3TQOA 3QEOA 2OESA 5BYKA 4NICA 4OH1A 1TEVA 4RAOA 1EE9A 2MHCA 2GT1A 2AOTA 4YIKA 2XMDA 1BE6A 4MIKA 2X9GA 4MV6A 1E4EB 2JLVA 2A58A 1FE8A 1XF9A 2G09A 1MQAA 2WWVD 1OAAA 3FPCA 2LR0A 3HRHA 4JOBA 3NT4A 1NP3A 3QVUA 2ZT5A 3FTEA 4I99A 3R6GA 1EVZA 3L0DA 1CUCA 2VWAA 4REQB 4C4YA 5ESRA 1DAPA 1X0VA 4YFSA 4DV1T 4KIJA 2GILA 4C90A 4B3BA 2RGNC 3NHAA 2LOSA 5BN3B 5EPOA 5T3YA 2W2LD 4LC0A 4XGRA 2KE5A 4M1EA 3KCQA 7AT1A 2Q3LA 3BERA 2Q50A 4N5HX 3TEMA 4KEAA 5LXTA 3ADBA 3B12A 4UZEA 5FYDA 3R3XA 1UGOA 3F9IA 4Z7JA 4YR7A 1OKKD 1S35A 1W0BA 1O5TA 4ZVVA 1RPAA 1UK8A 3HN7A 3HXPA 2Z8YA 3I0ZA 5AW5A 3ADKA 3GEDA 3SIXA 3ETVA 1K5PA 4O4JE 1YU9A 1V4NA 4LC9A 3G0DA 4HQLA 3WL6A 3DL0A 1WZIA 2WD7B 4HE8A 4C7JA 3FN4A 5TLSA 2YDXA 4TZ6A 4F71A 5IARA 2JRKA 4TSFD 3UKDA 2QRVB 2J1LA 1XDOA 1V5EA 2GRAA 1IZ7A 3V48A 2DR2A 4EMSA 3DJYA 4HH1A 5ADWA 4HUQA 2QPLA 4Q37A 5JNSA 1NR5A 1FFDA 4LN1A 4L72A 1H23A 1UBJS 5GY7A 2E18A 1E2KA 5BYJA 3TNYA 4PHFA 3W4IA 2VP3A 3R7AA 4FDUA 2Z4SA 3GEHA 2JLZA 1R0BA 3ZWMA 4X54A 2OK7A 1JQKA 4ZIRB 1FUIA 1QFJA 5CMLA 1QYDA 4M87A 4JLJA 3E1KA 3REFA 2C1XA 2DQKA 4RPCA 4QT0A 3N59A 3TE6A 4OHPA 2C4HA 1WPQA 2AK2A 4DLPA 1DAHA 4YAKA 2QMZA 2DQSA 4JJZA 3RVKA 4HGAA 2X9WA 3QC9A 5EXSA 4HFDA 4O2BB 1TAGA 1SIWA 1ZD1A 2F67A 4B4OA 3IUQA 4MUGA 3DDNA 5GJCA 3CG4A 1AXRA 1J1IA 3AIOA 5IDYA 2ZYIA 2A5FA 3IHTA 4Y18A 5ED4A 2IEYA 2V55B 2B35A 2OM2A 5FYQA 5BWCA 5EUMA 3F49S 4CKCA 3LPDA 4L5CA 2WHRA 1B0PA 2H7XA 2IUEA 3T34A 3T7DA 2PMEA 5F1PA 4IQFA 2OAQ1 3NBMA 4EGJA 2DFLA 4IFBA 2ZWMA 2GD2A 1IOZA 2ZBRA 3MMSA 3ZWNA 2XI4A 4N12A 1M6HA 1NMEA 4J03A 1FRNA 3RVJA 1G4AE 4X7RA 4X61A 4U7WA 3BWVA 4TXLA 1MBZA 3CLUD 1LV8A 2DWUA 1KNXA 1TPYA 4G3XA 2PE5A 3TLSA 4FYPA 2ZI7A 3ZU5A 3DEAA 3H8SA 5H6QB 1FUKA 1ZMOA 1NU8A 5EJ2A 2AR9A 3IAAA 1LRZA 4C7OB 4MP6A 1ZVQA 3F97A 5DHAA 3IBSA 4XARA 5AJXA 2GEFA 5DGCA 1K2VN 4AYTA 3QQ5A 1XKTA 4CMKA 3C5EA 3RYHE 2GCNA 1T5DX 3RKSA 4U33A 1Q11A 2QTAA 3GARA 3UCEA 4H7EA 5AQNB 1FL9A 4W9NC 2EP7A 2BSQA 3HO8A 2CLIB 2IV2X 4YP5A 2IIVA 3AK4A 5HDQA 3STXA 5EG5A 3NVOA 1GDTA 5F5XA 3TINA 4WAUA 2IUFA 3TLGA 2CNLA 1VLQA 3C97A 3T5BA 1RIFA 3IP7A 3K6JA 3L6BA 4U0JA 4XB1A 1EGQA 4ZVTA 4H7IA 5BSWA 2DUJA 1XMXA 4AICA 1XHFA 3KR0A 4CI3B 1CG6A 3VYVA 4EJ2A 1XDUA 1NZDA 4K6MA 1FUYB 4JWTA 5LIRA 2Q8PA 3OF5A 1JXOA 2BFAA 2DLCX 3RTCA 5AJHA 1AMOA 5KVCA 3JD3A 3WWPA 4PHCA 5CCDA 4EW6A 3B82A 4QTZA 1GGMA 3HDGA 4GLJA 4XWOA 1JBEA 4WBNE 1P44A 1NI4A 1WMBA 2O3UA 1LV7A 3GJ7A 1CQZA 4TZTA 4BJ6A 3HY4A 2WMNA 1UJ5A 4GICA 2JS7A 3VZDA 5LG4A 1S2LA 2XJ7A 3KYIB 1JL3A 5AVTA 2IP1A 2XWSA 4B32A 1JDVA 3OWHA 5HEHA 4Q1BA 4BE9A 4IZOA 2DB3A 3VR9A 2HRCA 4TQGA 1NMYA 4G5YA 5J2TF 5ALVA 3JYOA 4QGHA 1EM8A 3HI4A 2GEKA 3LHKA 5HKAA 4XVQA 1W5AA 2OOKA 4IYRA 4U3CA 1K3TA 3BMQA 4DUZT 3O94A 2XQGA 4G65A 5EYPA 3FDXA 3MXTA 2VBFA 1Y1TA 3EBPA 4DA7A 4D5EA 2TMDA 2YU1A 2JBAA 2CCJA 3H5RA 5BORA 3DYBA 1BAPA 5K03A 1WUYA 1YXMA 2PT9A 3DTNA 4XAXB 4D9EA 1M8FA 1WWKA 1Z3CA 4BKQA 1KO1A 1NE2A 5L3BB 3NALA 1L6RA 3DD5A 4ZJUA 1HE1C 3C1AA 3IAS6 1YJXA 4PLYA 2DPXA 2YXNA 3HVRA 5EI5A 1SU8A 4PPYA 1K8ZB 3RS5A 4FKMA 4JA0A 5ICEA 5G2OA 3R3VA 3R3SA 4P4LA 1XTSA 4JJ8A 2P35A 2P4EA 2HCBA 3C5CA 4MMYB 4EPXA 5JNRA 4XWYA 3ZU2A 4AZ0A 4CM4A 5JBQA 4R9UC 4X1KB 3MT0A 4PF1A 1M6WA 1D2CA 3ZOKA 2QX9A 5CYPA 2Y0CA 1JG4A 4B47A 4ENRA 2OTCA 4ISCA 3HI6A 4CRWB 2KYRA 1G21B 3DNFA 2O5VA 3GNQA 2V65A 1FYFA 3CW9A 5IVPA 1PT7A 2QROA 3VU9A 3ZLJA 4JEUA 4RWEA 2CFCA 2C9DA 1GXSA 1NY5A 5SY9A 3OJEA 1QK3A 2XEXA 1W2WB 2C78A 3NC1C 1DOHA 2X1MA 2EQBA 3OX2A 4CEHB 4ZEVA 2WWIA 1CUNA 1DMRA 3A32A 4Q82A 4XIGS 2JG3A 4F38A 4HOYA 2RHCA 2CXUA 3BICA 3F4LA 3THWA 1EWKA 3CH7A 3FUXA 5JANA 1KPHA 4Q39A 5F52A 1XCMA 3ZC3A 1DLIA 5DYGA 4G4JA 4B6FA 3EUAA 3OF3A 3MN1A 3IE2A 3WI7A 3BM5A 4TL7A 5TJHA 2XXJA 3QIAA 3BE5A 3HYRA 1SOUA 4K05A 3D3JA 1LTHR 3BFJA 4MGEA 4H35A 3U4QA 1V37A 3RF6A 2R60A 3JAKB 2QZ9A 2HJWA 3K09C 1E2JA 1DT3A 4BWVA 1U65A 4X64T 3MTIA 3K9NA 2FDXA 3T61A 2QRKA 3O9ZA 1VCMA 5H8WA 4ZTBA 2A84A 5ADXL 1QNFA 2C96A 1RRMA 1C9JA 1HYHA 1Q2XA 1RR6A 1Q7BA 2H2FA 3KHTA 1J1UA 3LWNA 4YACA 4D97A 3N05A 5D01A 2BYTA 3WWCA 3CZCA 4ZHSA 3I8SA 3UUXB 4G86A 1Z83A 2PGLA 2Q4DA 4LBZA 2CMKA 1QAQA 2IHTA 1X1BA 3LUFA 1FLDA 3QLVC 4P09A 4ER0A 2B36A 4G0QA 4AXPA 2GTPA 4JUFA 1N7GA 5KU1A 4NP6A 3DCIA 1XAGA 4DA0A 3A6PC 4A2QA 5AKKA 3ZJ1A 1M6VB 5BR4A 3QE0A 4WZAB 3W5IA 1U2SA 2IF2A 1JKFA 1PU2A 2ID4A 1T0IA 1QGDA 5F77A 1SCIA 4EA9A 4B46A 4EG6A 3SJ7A 2BGMA 4S04A 1SM4A 1ITZA 3MBKA 4ERXA 5D7NA 2O0JA 2N47A 4C6TA 3EW7A 2XXBA 1ESCA 4KIGA 3UUGA 1RJ9A 3EA4A 2D8MA 1INLA 3BBLA 5ED0A 4I50B 3FCYA 3QMMA 3T3DA 1I4TD 5H16A 5FF9A 5D1NA 2CJYA 1TT7A 1RYNA 2R751 1FP4A 3QFRA 2W90A 1L6IA 3WGQA 3IULA 5AJTA 3AZOA 3RANA 4KZPA 1LDNA 3A4NA 4MK4A 2X0EA 2J08A 2QTZA 2VKOA 3SIRA 2A3DA 4TSRA 2FG6C 4NQZA 1E2GA 2DWGA 2HRBA 2JFYA 2VJNA 4OQQA 3W1EA 2AS0A 5H3CA 4WVFA 1M6NA 1NXOA 1KEWA 1IEQA 3GCDA 3G2JA 1SELA 3IBFA 3WLOA 5BUCA 2RIPA 2P3LA 1WA5A 2FF7A 3RAJA 5BVHB 3OKCA 5LXTF 4UVCB 3RUDA 4RJIA 1AA6A 4H7DA 4O4IA 5MFPA 3ANLA 3CZRA 4JKIA 1DXOA 5K6TA 1S2MA 4FX2A 2Q6LA 3AVYA 3RADC 3IAEA 1I13A 4WE3A 4I1PA 3RU3A 5A3VA 4RZHA 4KIWA 2FZCA 2Z1NA 2PL1A 1YZLA 2I59A 1NG1A 1ISSA 4JI3B 1G8XA 1WV1A 5ILGA 5C1DA 4LNUA 4H0NA 1C4WA 3H0EA 3STHA 1LX7A 2PAAA 1H8EA 2WJHA 3EZYA 4KFUA 2PSFA 1YRAA 5ALQA 5DW3A 2JFXA 5HIJA 4MVJI 3EVYA 4Q18A 4NYIR 3EXEB 1SG9A 4EW3A 2FVYA 2HGZA 2AE9A 1VYVA 3NASA 3I05A 2QLBA 4ZVRA 1R6DA 4C29A 3OFNA 3OUZA 2VHWA 1IEWA 3CEHA 3INTA 3FGZA 5JR9C 2BLNA 3ITDA 2HPVA 1II8A 3TH5A 3L4BA 2OEPA 5SZIA 4ZK6A 1L7OA 4YWJA 4EI2A 4DCNA 3URMA 2BF7A 1A95A 1YQUA 3PVZA 3F73A 2J3QA 3NKZA 5LJIA 4Y2PA 3R9IA 1A1SA 4JI2T 3SQWA 2A9OA 4J0GA 2I34A 3GPLA 1QK5A 4W9RA 1JA1A 1ZA2A 3ZWXA 4FBGA 5NULA 2VDOB 1YA6A 1BFKA 2PBZA 3AX6A 1KYTA 4NAUA 1HDZA 2GN9A 2QUZA 5HEUA 1U8EA 4RMNA 5JSYA 1P2BA 4YRQA 4P0AA 4N03A 4ZVMA 3DAHA 1BDMA 4I1VA 3A11A 1COWA 1RD4A 1BDBA 2LZ0A 3UENA 2O3JA 2E5FA 1UKAA 1CUWA 3OA0A 3KV1A 1RP1A 1Q1NA 2C00A 4K1LA 2XCIA 3NP9A 1UK7A 4Q1EA 3JD0A 1KSJA 2C42A 2AFHA 4BNGA 5TY0A 3D31A 2RK6A 4YHBA 1UDXA 2W0GA 5EFZA 4ZU6X 3Q6NA 3AE7A 1W76A 5ECGC 2EFEB 2B21A 1HE4A 2P9ZA 2AFRA 3UBMA 1XQYA 2ZJ2A 3NUZA 2QRLA 4MQEA 1RBQA 5JRDS 3STVA 3GYBA 1Z5UA 4NJMB 5HG0A 3NBKA 2V8OA 3QVKA 2QTRA 1NM5A 4GKKT 4B3RB 1SCBA 3GROA 1YXRA 3KYCB 3SXPA 5J47A 4IFEA 1MDBA 5FY0A 4YMIA 1IATA 5HILA 3LLSA 4B35A 4EKNB 2HM7A 4GP7A 1YRHA 4BB0A 4RPGA 1SUPA 4DGQA 1I51A 1X6VA 4EH1A 4RGBA 3IQEA 2GJ8A 5DBIA 4LCEA 3U4MA 2HO5A 2PZKA 4AJIA 4M9UA 1PE0A 5U4QA 3ZQ6A 1A82A 3AUYA 3EH1A 3GB9A 4Q1AA 4MS3B 1FJGB 1PNQA 3MELA 4CF3A 2FWNA 1IJFA 3MACA 4QUEA 3L3PA 3LK6A 1FQKA 3MUNA 3THRA 1P1KA 3L6RA 3EG5A 4ZCQA 3R5FA 4OQYA 2YV2A 4IUYA 3CW8X 3SLRA 4CMCA 4LXHA 2GPTA 1UDWA 4YAJA 4IE4A 4IQGA 2CLOB 2W6IA 3E7PA 4M0DA 4OU4A 4PHGA 1P60A 4U7FA 4BO8A 3RRNA 3O6VA 3KPUA 3BCHA 5LMNT 2Y1WA 1QO0D 3OFJA 3OQNA 3O0DA 4URZR 4E7SA 2F00A 4JQOA 4L51A 2NUTA 1G3IA 2BVLA 5CDHA 1KMQA 2GR9A 3CRVA 4CIBA 5H70A 4PYRA 1VJTA 2BJVA 2PLFA 4L5YA 2ETXA 4AN1A 1T9CA 4WH0A 3MPUA 5HS6A 3ZIUA 4UIGA 1HH4A 3C5VA 1UXGA 3WDLA 3R9XB 1FTQA 2PT6A 1ZD2P 1OZAA 5CEEA 4P80A 2HPAA 1W4AA 4DUGD 4RQAA 1ECCA 5KSWB 4UMEA 4N47A 2SBTA 2A9UA 2ONYA 4LHSA 1XK6A 4OD0A 1D7AA 4Q4DA 1QYRA 2E4VA 4IWYA 1W2GA 5EJGA 1ANKA 5ALOA 3LBIA 1E6LA 5BSFA 5G02A 1ID8A 2Q28A 1ZOOA 5GAJA 2GF9A 1V8FA 3GT7A 1OFHA 2HSGA 3SQLA 1H6CA 2PZEA 1N5DA 1F2TB 4ZQGA 1JIVA 2AW5A 1N0UA 3L7AA 2ZRIA 2Q3CA 4RKRA 1CZRA 4JC0A 3UC5A 4GIWA 1SN7A 4PSUA 1EFCA 1M66A 1RW4A 3EMBA 4PG4A 4XVHA 4HYEA 1QH0A 1KJJA 2LCFA 2P79A 3JQ8B 3KFXA 4LRXA 1S2GA 2VF4X 1T8SA 3BXHA 4L9IA 3D8NA 5AD1A 4DG8A 3C45A 1YOBA 4NPPA 4CLOA 1M2EA 1TYAE 3HKCA 3F6CA 1O4WA 1SA0B 3OETA 1M62A 4YCBA 2ZB7A 2ZIFA 4B3TB 1Y1SA 1DWUA 1OPXA 2XZEA 2ZJ1A 5E7MA 4QUGA 1Z4LA 4ZDKA 2BG9A 3L49A 5EIBC 5L4SA 3PV0F 4II7A 5HTKA 1UC8A 3SXUB 5BSHA 3K5IA 3QEMB 4EA6A 1L8LA 2O8BA 4KI0F 4XVCA 1OXVA 2ORIA 4HNQA 4ZI7B 2PRYA 3A3OA 2QRHA 3AGQA 1M75A 1ZM3A 4XYBA 4MUAA 3ZGZA 2QN2A 2Z6EA 3ZR4B 3T9CA 4MR9B 4HNAA 4ZK2A 4LF9T 5J2TB 4Y2VA 4YO7A 2V7TA 3RQSA 4OJKA 3MB5A 3G6WA 4DRYA 2IPMA 5C5DA 4ZHQB 4QBKA 5DJ5A 2NZVG 3TRFA 3SF8A 5MGBA 1GL9B 4JAVC 4UAJA 3ANSA 3MUOA 2WABA 3CG0A 1YZQA 3GWHA 3UUEA 2VQEB 2ZLBA 1U0HC 3NP7A 2QRJA 3QOWA 3TLZA 3DV0B 3V8PA 3S5UA 4WBOA 4M83A 1YQQA 3QU7A 2XR1A 2WTBA 3ROQA 4ND3A 3AV3A 2VNKA 4DCSA 1NQOA 4NPAA 2RHLA 1SUAA 3HVKA 3L01A 4NIMA 2RCYA 2X77A 1U3FA 3ZLBA 4LK2A 4NC9A 4LF6B 4DWOA 4QU9A 2OXRA 4EHAA 2GN2A 3GMTA 1JR3D 3E2PA 4XJSA 3DZGA 5ABFA 3QPAA 1E1HB 2RG1A 5JFGA 4FXPA 5I9TA 2HI0A 4HFEA 3R3YA 3TGLA 1ECBA 3IPRA 3A6LA 2Q2OA 2QNBA 4JLNA 1T25A 3PXXA 2WIGA 2QLLA 5G1PA 4PZPA 1R88A 3NV9A 2P27A 1IY0A 3ZBTA 1GAWA 1L5KA 1PJTA 4XQCA 4MQ5A 1N1MA 4CIAA 3CK6A 4BJHB 4MVWA 5FV7A 2VJAA 1Z4QA 1JLSA 3UT5E 2ZYSA 2B6HA 3GLGA 1FY2A 2I8AA 2O59A 1P9NA 4B76A 4IDHA 1H5NA 2JI9A 1VI6A 5IK2D 1L4MA 3WK4A 4MH0R 2H2WA 5AVOA 1IXZA 3AVTA 1E1CA 3WDKA 1PNVA 3FMIA 1ESEA 1QR6A 5D5HA 2BFEA 4MZXA 5JSQA 3ETNA 1V43A 1P80A 1LSJA 4PZEA 3WWEA 3HHPA 2ID8A 3VR6A 3U60B 2FR0A 3Q9LA 5F35A 1DDGA 2RHHA 2ILTA 1OI2A 3ZHRA 1GYQA 1ZUD1 5A1JA 1XU4A 5A5EA 3Q7IA 1ZO8A 4ZOAA 3P4RA 1POXA 4MOWA 5HIAA 4HB2A 1X8KA 1FMJA 3VPFA 4MGZR 3I5XA 1JR6A 1BCSB 2G6BA 2MU1A 2OZPA 2Q27A 2Y93A 1LZLA 4XX0B 1NR1A 1RRCA 3TX2A 3SKYA 1KRWA 1ECLA 4GL2A 1X80A 2ZSKA 3CYFA 4DJAA 3TF5A 1U2QA 1JKMA 4EUKA 1PGJA 1OLXA 1NU6A 2FZKA 1AN0A 2E5VA 1WR6A 1Z6TA 3B6EA 2F1KA 2GK6A 3W04A 5KX5A 1KKLA 4P3OA 4EUFA 2JQKA 4GPZA 1XALA 2PDAA 3BK2A 5C81A 2YXLA 5FTJA 5ALRA 5BOSA 3ZKWB 5HZKA 3LKDA 3BQLA 2V6XA 5SV2A 3EX7C 3RREA 2ZBUA 4CI0B 4DLLA 4JP2A 1ZVMA 2F1HA 3W5VA 2IT1A 2O14A 1KOJA 4YPVA 4S2UA 4LJ4A 1FTNA 2JDIA 3F57A 2XB2A 1T8TA 1V3VA 3ZJ4A 3U81A 5H82A 1YKFA 3W5UA 1VRBA 2Y4NA 2BMJA 2ZI3A 1YHYA 2E87A 1LPMA 1THZA 3WZMA 1LBSA 2ZBFA 3K3PA 1EP1B 3W7VA 4H9NC 3DFZA 2EVWX 5KNBH 4KPYA 1XO1A 3UA4A 2NU7B 3LY5A 2ZRCA 5MDHA 5EJ9A 1LS1A 3UOGA 3ABOB 2DPHA 3EIXA 5JQWA 3ONJA 5K0JA 4LG1A 1HZJA 2AOTB 1FFGA 3NFRA 2VYCA 1HTJF 2YZ2A 3RS2A 2KQUA 3GGSA 2RHTA 1S2OA 2WINI 4KNYA 5IN5A 1YUNA 2J30A 4HX5A 3JQRA 2H5LA 4M0CA 3PQCA 3WOHA 3VU3A 4AS3A 2GCEA 3MJRA 3HBAA 3R76A 2YVLA 3H6HA 4E1VA 3I4CA 3OE1A 3MD0A 4DCOA 3UJHA 3DR5A 3U1VA 4OFXA 3I39X 3R74A 1NHWA 4DKXA 3RSZA 2UXBT 4FI5A 5K45A 3PJGA 5AHRA 4UVBB 4QX8B 1R0SA 3PWZA 3FWNA 4UC0A 4M6WA 3UTDA 1EQUA 3U6BA 3NIFB 3CVXA 4MIYA 4XGNA 1M7BA 1JDUA 5LXTB 2W2UA 3VR4D 3TM4A 3W9YA 4TV9F 3WP1B 1EK1A 3UWDA 3Q88A 3EGEA 2P2NA 3HDYA 1FF9A 3DE3X 3EHZA 3I34X 1Z06A 3N7AA 4DPKA 1UM9A 3HZZA 1E94E 1ZQ1A 2HN1A 2C07A 3EDQA 1ATZA 1C3VA 4HEAA 4ARCA 3KVVA 2HRRA 3KU1A 3HEAA 3W2HA 2B1EA 1IBMT 5JIBA 4QG3A 1FU7A 5DASA 3F6SA 1R12A 3OEHA 1NLUA 4HUQB 2ISSD 4G09A 4FILA 3RU9A 1KZ1A 1NMXA 1WCWA 2ZJOA 2F59A 3M3HA 4ZEWA 4MRPA 1ZW1A 4QOFA 4A0GA 1VHQA 3DMYA 1Q0RA 3AILA 4DIBA 2OBBA 4W5TA 2HDNB 4YDRA 4ZV7A 1SVMA 1ZL0A 3IC5A 1Y8AA 3OOJA 3MHPA 4XYEA 2V8SV 1ZIOA 4KXFB 1QOQB 2R2GA 5JASA 3OX3A 3M7IA 4LZWA 1E89A 4NUUA 5AK4A 2BKNA 1N6RA 1WUTA 2PL9A 3R5XA 4UNNA 1H9AA 2I2BA 1L1RA 1CY6A 4ZQBA 4GYKA 2QYSA 2XXAA 5AOVA 2R6GF 2CRBA 5AKXA 1JLLA 4HY3A 5BWMA 2A59A 1XMJA 1OWOA 4GF5A 4BFLA 3QYFA 3AV0B 4P92A 2C99A 3OWXA 1QM5A 3KUXA 4LI3X 3GJRA 4JEMA 2ECQA 3IVCA 4HT3B 4KACA 1G59A 1G18A 4JVNA 1TUEA 4QNMA 4MYHA 4IXDA 4CKCB 5HXEA 1TU4A 3EDRA 3EXG1 3QX8A 2PT5A 2QAGC 4J3FA 1RWVA 3RUAA 3ACBA 1N4AA 5KIAA 5L7WA 4D82A 3UU4A 2ZJ0A 4DO0A 1CUGA 1NBAA 2LE0A 6AT1A 1SEPA 4FJ1A 2DKFA 4MCHA 4WN9A 3T3IA 1RC8A 3QUTA 4MIEA 1QGZA 4PANA 1QONA 2JFNA 1ULUA 3ZD6A 3QV2A 2B1JA 3RUHA 4KREA 3ZT6A 4ZANA 1K5GA 3Q4GA 3SZMA 4B4VA 4XM2A 1U0GA 4QRDA 3AH8A 3FLBA 3DZFA 1CBUA 1NT2A 3TZEA 1IZ9A 3LUDA 2JJMA 2DJ5A 1HQCA 1Z0DA 2CL6X 4K7JA 2GD6A 2PMKA 3GJSA 4CF5A 1LH0A 2QYHA 4EABA 4CIDA 1CUDA 3LVBA 2D2EA 3DOOA 2W5UA 3FOEC 2CN1A 1AQUA 3NEJA 4QUKA 4NYMR 4AU1A 1JT9A 1YSCA 2D2VA 3TLGB 1TZJA 4FSXA 4N3BA 3THXA 1IUNA 3B70A 2QV0A 2CBGA 1V8BA 4C89A 1PI3A 3BH7A 4ZI3C 2W62A 1G8HA 3UWPA 4PAMA 4QJ3A 1QSDA 4WY8A 4LISA 3WB9A 1WPGA 3VJLA 2Q3HA 2QKYA 1Y1KE 2CUZA 2P9GA 3DL4A 3K09A 4GDFA 5KYXA 1U7HA 1ZLXA 4BAGA 1NENA 3IMCA 2J0SA 1U4QA 4LWPA 2NO1A 2P2SA 4YX9A 2ZZMA 4HWCA 2GASA 1J8DA 3BSYA 4CHGA 1YTUA 5FO1A 4D8WA 4BA9A 2WMNB 1K6MA 3HL6A 1QIIA 2CHGA 3QPBA 4IIBA 1FZQA 1KRHA 3L79A 1WMAA 2AIRA 3L4SO 3PGLA 3H2JA 2P9FA 4CIXA 1AKTA 2ZQZA 3AJ8A 4Y3UA 4DCUA 2CLDX 1GL3A 4F6LA 4BMDA 4KP7A 2IZ0A 1FRZA 4S1OA 2FEWB 3MJCA 3DW3X 4H9QC 1EM8B 2FFQA 1Z6GA 3AVQA 3BWXA 3H7AA 3LDQB 2QX8A 4CN8A 2ZR8A 3BMQB 3O9VA 1RRKA 4FN5A 3OE5A 2JGKA 4IDAA 1N32T 5EYPB 3HU3A 3K1YA 3LFHA 4HGPA 4BLPA 1RI3A 2JK0A 2RHDA 5BNWA 1O77A 4PC1A 2QXTA 4MDFA 3P2YA 1CUSA 1ZC4A 3F0TA 2P2CA 4MKIA 1MNDA 1EFAA 1P3DA 3V5NA 5THQA 4DCJA 1ULHA 3ETGA 3RFUA 2AI2A 4IJ6A 1R3DA 3G7SA 3ZW9A 1SQFA 1IC6A 2FAXA 2JFUA 3NRJA 1N5JA 2P75A 3RUIA 2R6HA 3QU5A 3A10A 2VH2A 3BFKA 1JMVA 2Z58A 3IKLA 1B14A 1DPGA 4CM4B 4AZ0B 4O2AE 1RQLA 2GN0A 1A5BB 5HUHA 2V7EA 1Y89A 1MC8A 4RH0A 2JB9A 4QO7A 1V3TA 1GP2A 1GQ2A 5ITWA 3EXIA 5JS8A 4MALA 3IAHA 3IBTA 1UPCA 4B75A 1ZOSA 3VU9B 2DMRA 4JEUB 3MKDA 4MWTA 3PTRB 1Z6AA 1GXSB 2DFTA 3H04A 3UYLA 1D09A 4UJ5A 1RMQA 3LSTA 3I0MA 2Q3JA 4U5XA 4G5OA 3TLUA 4FEYA 3RX6A 1J24A 1RYBA 4MICA 4U6SA 4D43A 4EVIA 3JVEA 4LSWA 4IDQA 1A2BA 3THWB 4A82A 4PC2A 1B3BA 2NT4A 3WMEA 2A5LA 5HKKA 4U02A 3C2QA 2NWQA 2Y67A 4BKOA 2M98A 1JIQA 1N2HA 1L7RA 2PUTA 1P39A 1R8JA 3AF5A 3PJAA 2YIMA 2EGUA 4QJ5A 2GAIA 4QAQA 1U0OC 1ONOA 3GT3A 3TE7A 4LBWA 3U4QB 4DC0A 2AUMA 4KK3A 1YCDA 4L9RA 3VNAA 4DILA 3W77A 4J2TA 1U3CA 4DNQA 1TJYA 3GMSA 4C4OA 2IUBA 4P7BA 4D3SA 4BY9E 2JIOA 3C3XA 4XH9B 1XDZA 2GF0A 1DZIA 4PYNA 3LIPA 4P4SA 4DZZA 4PCVA 3U39A 2W22A 2BUAA 1SVUA 3M4NA 3N28A 1V3UA 1G9TA 1BGWA 3GDHA 3QMWA 3EZLA 1GHTA 5JR9A 2I7CA 5IAEA 1KE1A 2X5NA 5AQQB 3SEFA 2XDYA 5KX5F 2JRCA 1C9EA 1I4LD 2ZM2A 1N25A 2YRWA 1ZJJA 2NV2B 1Q1QA 3C6XA 3OJOA 5GPBA 3PWSA 4IVQA 1QCZA 2X6QA 1R7RA 5KJCA 1OH7A 3VPXA 1H2XA 1NDUA 3I1AA 1A8SA 4FDLA 5E8RA 5LQKA 1GPYA 4ONEA 4BNLA 3WFJA 4CDGA 4EO9A 1ECGA 3VKFA 3OFSA 3PNBA 4YALA 4JITA 4QULA 2DHCA 5A04A 1XD2A 4GQBA 1BE8A 1QLWA 2D5LA 2ZR9A 4MYDA 4XQGA 3RD5A 2Q2VA 3UQYS 1RJ9B 4CQJA 4M7PA 1YBFA 3NXKA 4MV9A 5GM1A 4YNBA 1LVHA 2YEVC 3OM1A 5DE3A 1T26A 1ZIXA 2JPDA 4FZ5A 2PSEA 4TNVA 1P5ZB 3OG9A 2KWHA 3B13A 1EDEA 3EULA 1FP4B 4RKEA 4DYVA 4U2CA 3HK2A 1HE3A 4XUEA 4JLVA 5FOVA 5FWDA 2AFVA 2HZBA 3O8OA 1B15A 1VP3A 2H1SA 4FZ3A 1J8QA 3CBQA 3D02A 4G0XA 5CLLA 5J58A 1NKTA 1PL0A 1BD4A 3FLEA 2I1QA 3KKLA 4MRNA 2P2DA 5IHPA 2FLVA 1IN7A 4YCNA 4XB2A 1XZBA 2IU0A 3D8RA 4ZYXA 1TPZA 2XGMA 3AC0A 5K4GA 2WPNA 4G01B 1HQKA 2ENUA 2CXNA 3MAJA 4PIVA 2H1HA 3ROXA 1M2KA 2DUUA 4O4IB 1Q7EA 1P1IA 1OBFO 1QCDA 1IMJA 3ZHTA 2CYCA 8MHTA 2LRHA 2AK3A 4EA8A 5ADVA 2YIVX 4Z7NB 2WUWE 1OJLA 2DWCA 1G20A 4YYZA 1XHLA 2E1PA 3T9AA 4AMBA 3AJ9A 1RJDA 3VDMA 5FV4A 2VQ6A 3IV7A 4G0VA 4XYGA 2XAJB 4F7WA 4F4IA 1WF3A 1UJCA 4LNUB 1DAEA 3A1CA 2YDYA 3K6RA 4QGSA 4B3XA 3WSTA 1AT1A 5BVGA 3WGHA 2JCXA 3GGOA 1TM1E 2JEOA 1FSFA 1G0NA 2V0GA 2G28A 2VXBA 4OBXA 5JJCA 1QUFA 5C8YF 3MXOA 1NT4A 5ALJA 3CU5A 5IBPA 3N9LA 1ODCA 1UIRA 3DMRA 4EFNA 2F1RA 4DR7T 4YRJA 1BS2A 3BD9A 1QMPA 2VJMA 1GNLA 5LUAA 3VI3B 1OZ0A 1UT6A 2O7RA 1II8B 1ORIA 2IK8A 2J3LA 4AZSA 4EG3A 3IP5A 1D9ZA 1PR1A 4HDNA 4AS1A 3V9PA 3GZ4A 3TJMA 5EXXA 3QXXA 2RH9B 2F3TA 2GTHA 4FHGA 4HAOA 1QHYA 4KQ1A 3EAGA 3U3XA 3IYLW 1AS2A 1WVGA 2P2LA 4BEWA 1BIFA 4R2WA 2C58A 2JFZA 4ZCMA 2FZLA 4KQMA 1R9NA 2CLKB 3C6QA 4BB9A 3CUTA 3UH0A 2A0WA 2R8XA 3X44A 1WCYA 1U3VA 4Z0PA 3KU4A 1W5SA 1G38A 5FNVF 5GONF 2OD2A 3TOVA 2GYWA 2VDQB 1BU8A 3SSAA 4L1KA 2D8AA 2PKQP 5G1NA 2A9KA 1H1LA 3OC0A 1NVVQ 3D2AA 2OAGA 3KQPA 3PWTA 4FWBA 1XL0A 2AFHB 3ESZA 2GH1A 3AU8A 2JIMA 4XUGB 1R37A 4P22A 5I6DA 2DCMA 5FWYA 1MX9A 4ZI2C 3F74A 5I7RA 5CH3A 4L2IA 1JYFA 5DABA 3EVNA 4XGKA 2V9ZA 4MQEB 3RSHA 3AB3A 4OP3A 2NSLA 4DLWA 2ZRDA 4F45A 3R9WA 1EQ2A 4KLZA 4DOMA 2VHXA 2PV0A 4EUHA 5CLHA 1L4UA 1IEXA 3ZE8A 3F71A 2ZJ5A 1DC6A 1L7EA 1VCNA 2P78A 3FTPA 4H4DA 1ATIA 1CV2A 2UZ0A 1A9SA 1EFLA 4RJ2A 4H1HA 2PZMA 3HBLA 1DG3A 3FWKA 3N2OA 4A1OA 1BKSB 2IVZA 1GPBA 1RRFA 3J81k 4L08A 2ODQA 3LUJA 3WJ7A 4HWRA 5TIIA 4HZIA 1MV5A 1MX1A 1XEXA 4MVJF 5EEGA 3ETDA 1BE1A 4GYYA 3PU6A 1AO3A 1DEKA 4MPRA 2N9UA 1RPNA 2OHIA 4GOND 2XM2A 2VHUA 2FR1A 3J81A 4IO0A 1YS1X 3OQPA 1U0NA 4V1CI 3UJNA 4MQUA 4KPFC 5BSVA 1PZHA 3K4QA 1A2KC 3RVDA 1HM5A 1S8OA 3ZQ4A 2JFFA 5ALIA 1M9NA 2I4OA 3AOEA 5LQAA 4J07A 3GLTA 1VYHA 4N5LA 3PUKA 3VXKA 2DSNA 4BOYA 4UEOA 2ZIUB 4OX9B 3UTKA 1OX4A 3FBGA 2VUIB 4YT2A 4BX3A 2YCBA 1KAQA 1OWMA 2G3YA 1KJNA 2OBLA 3DLIA 5JDCA 2NUTB 4ILEA 4ZGGA 5EGSA 2ZUTA 2HMSA 2HEGA 5JTUA 1M2WA 4IXMA 4GYSA 3EGVA 3BWBA 4X3PA 2A0YA 3LDHA 1CFZA 2OZEA 3MCAA 1N9ZA 5CHEA 3VRBA 1Z75A 3VZBA 1TD9A 2XB6A 3AWDA 3BMNA 3HFRA 1QS0A 2V4ZA 4JV5B 1M6YA 2C5LA 5F12A 3I9OA 3FHNA 4DC9A 5LBMA 1H0RA 2YQ4A 1YCFA 1ZYUA 2BL4A 4Y2QA 3IEVA 3EVGA 3QUCA 5FBWB 3DLPX 1CNEA 4JNCA 4CEJA 3IQFA 1FIOA 3SBEA 5ALSA 1E9EA 4QHSA 5FXVA 1J5PA 3E3OA 1UXIA 3FR7A 2YBEA 4G1EB 4EX6A 4Y9DA 4ZO6A 2ORYA 2MSKA 2DP4E 2G83A 3B8HA 2FG5A 2OHJA 3ZJ5A 3EEQA 5CEFA 2AGVA 3PV0A 4R3WA 4AIIA 3PKJA 1L5HA 1SCJA 3SK0A 5LZ2A 3L7JA 2BJWA 4YASA 3G5TA 2YU2A 2V3CC 4B4KA 4K0UA 2QAJA 4KI0A 4C03A 3ZWKA 2HBYA 4AQDA 2NYAA 4BB5A 4RQUA 3EQ8A 3I2IA 4UBKA 2FJAA 4NMLA 4DAOA 5C53B 4H7JA 3JRWA 1ECPA 2R6R1 3PCRB 1NW7A 2ON6A 1N5OX 4J0FA 2FN7A 5D6OA 5ALNA 5F33A 1SHJA 4HNRA 3KQWA 4CLOB 2ZTUA 3HKCB 3T3HA 2P11A 1N5MA 1U0RA 3OJ0A 4G1FA 1FVXA 3VR8A 2WM8A 1AQLA 3EVCA 3ZWCA 4R1NA 3DEJA 4JJIA 3Q3CA 3MIZA 1ULZA 1DC5A 4YREA 2BG9B 2L19A 5FEMA 1RLMA 5ADUS 3UA3A 2L3LA 4BO1A 3KJEA 1RLJA 2Z2JA 3PXBA 3L2OB 4PNIA 3HNOA 4DN6A 4MRMA 5U1PA 1RWKA 4E09A 5E6SA 2JIZD 4YPFA 2O8BB 4ZU1X 2I7XA 4BDSA 5FYMA 1RQNA 4US2R 3BE6A 4CM9A 1DP4A 1N77A 1KH2A 1PK9A 5IJZA 4OFBA 1W49A 2KSQA 1YFLA 5EXDA 3V4VB 3DNMA 4A8HA 5KQRA 1GWNA 2E4UA 3SJBA 2PKEA 3E08A 4HNAB 4J1SA 1TL7C 1S3IA 5BR1A 4JY7A 3PQ8A 3FMOB 4K9SA 5JNVA 1PX0A 5LU8A 2QT0A 3SF8B 2G0UA 2C5JA 3KE9A 2AMYA 2D5AA 1DX4A 2I87A 3DZJA 2G63A 3MNFA 3BRWD 5F9FA 2ZG6A 3TO5A 4CCYA 4O1HA 4FHZA 5LCYA 5L47A 4H6VA 2YW2A 3ZU4A 4G84A 3FZMB 4J0JA 2G6TA 5BN4A 4RO0A 2QT1A 2OY0A 5K0BA 2QP9X 2M6BA 5CD9A 4EI8A 3U7HB 5L3RA 1WABA 4DV2B 3LKBA 4NZZA 1NXPA 4HFMA 3ZGYA 3AZPA 2BFBA 2J6IA 5CXUA 2B5VA 2EARA 1GZHB 3TAHA 2VQ3A 4LOJA 4BLQA 1XCLA 1RADA 1T2AA 3RI5A 1UZAA 3NOQA 1A72A 2LJLA 4PTLA 1FNCA 5ABFB 4TWBA 2OLJA 3TLYA 2IPLA 1AA9A 5LWQA 1H6DA 3AEAA 3RHZA 3C1UA 4KITB 2PGIA 4ZOEA 1P0MA 3P2EA 2WFZA 1NPDA 4JC8A 3BD6A 5HRAA 3DDUA 2HNKA 4TTVA 2FETA 4H1VA 2D1YA 3BF8A 3MWDA 1T3GA 4R5HA 4OVKA 1KNQA 4GE3A 3KQMA 4L0QA 1DQSA 3MCUA 3BJEA 2FP4A 1X14A 5TMEA 2YC4C 3R7WA 4ZICA 3GLGB 4KRFA 4PGAA 2BFPA 1YZKA 1A4IA 1AS0A 3MWGA 4ZZBA 1UWLA 2HA3A 4F21A 2ERCA 1E1CB 1YD7A 2JI7A 3V6LA 1I4DD 3ZIDA 4QFMA 5ABGA 2BFEB 4F5WA 1CEXA 4IDBA 4HG2A 1D9XA 4UBNA 5LQSA 1IK4A 1Q1BA 1P5HA 4WLVA 1AZTA 3WISA 1Y6FA 3C4WA 5JDQA 3AE9A 3VH2A 1V9SA 2GBIA 4WJKB 4ARAA 3HJCA 2G7MC 4ARIA 2WDPA 3DB1A 1SY7A 4EOZB 1NC1A 4II2A 1R0WA 4HGYA 1GG5A 2AEMA 4FEEA 1SOMA 2J9GA 4UVAB 2G77B 4DPMA 1F0YA 5J9FA 1GKKA 3RVRA 2FUKA 5CURA 1OLXB 5CDTA 3QB5K 3DD1A 5JJBA 5LOVF 2JA1A 3VRAA 2Q9CA 5KX5B 2JZOA 2H9IA 2J67A 4B2IA 3HFJA 3O8QA 1UKEA 3QFTA 3CVYA 5BOSB 5LYJE 3NEYA 4JSTA 4KXQA 4A73A 3TTTA 1TUGA 3ZDRA 2I29A 2FMFA 1PSWA 3OM0A 4DIEA 3QU9A 2K87A 2HD4A 5FL7A 4M38A 4IH4A 4NZNA 4X00A 4QEKA 3IKTA 1B2RA 4E21A 2J0QA 2CLFB 1SZJG 3AUAA 2NXJA 1PNTA 4YTEA 2WYUA 2QAGA 1D6JA 1BWPA 3R2JA 4NCKA 1VJCA 1MRSA 2HU8A 1Q3KA 3AG5A 4MW2A 5MN5A 3HO6A 4TV9A 3BZBA 4AP9A 2HQSA 4LZLA 4P84A 4X7MA 3MBIA 3FPBA 4HMQA 3Q9SA 1W87A 3GVCA 2GQ0A 5F5NA 5LHGB 2QVZX 4KE6A 3W1VA 2W4IA 3KEFA 2XZLA 1I80A 5DSZA 1R4AA 3HWRA 4O8SA 1MQSA 3B3QA 3RROA 3FYSA 3ZIAD 2V97A 5H59A 5FJIA 2VYNA 3RK4A 2H16A 4TWZA 3DCYA 3PKIA 3SWHA 4ETMA 1FS4A 5HCNA 4NPCA 1E79D 1WSWA 2H0QA 4QWMA 4ME6A 2JASA 3TTSA 4XCQA 4C5BA 4CM6A 5AJYA 4M6WB 2OSBA 5AK5A 1O8BA 1VSBA 2QNRA 4ZMBA 3UAWA 3WGIA 4LY9A 1TM4E 2HLDA 2BSAA 2FSFA 1ZHFA 2IEBA 4ZCRA 2B1QA 3L7NA 2HQBA 1UM9B 5IW8A 4EZIA 4QDJA 4ZI3A 2NPFA 4XA8A 5C31A 1VLHA 1ZP0A 5TDHA 5IT4A 2C7BA 4BNWA 1ULTA 3AL3A 3LK3B 3BGVA 2R6GA 1IWOA 1N2CA 1FW8A 1NFFA 1JNRA 3P2JA 1OXBB 4H9RC 3LYAA 2EX0A 2IXBA 3PLAE 3L04A 4UEWA 2H57A 5TPWA 4LRUA 2CT8A 3W8RA 2QBYA 3P4SA 1YWGO 1DV2A 1PL7A 2D1TA 3S7TA 2V7IA 3SC2A 3VPBA 3VSAA 3CRMA 3TOXA 2NQ2C 1ZVJA 3OT1A 1L5FA 3VTFA 3PR1A 3FZHB 4IJMA 3QG1A 3USCS 2VUTA 3SD7A 3S70A 5K6AA 2X3YA 5A1TA 2GETA 1AC5A 3LI2A 3ESXA 3LTEA 1M0WA 3ZW8A 3ETUA 3RKGA 1Y82A 2SKEA 4N3CA 1Z6QA 2CMHA 4R6WA 4HEA1 3KQKA 1N2OA 2XXAB 2J0EA 1L7NA 1JLLB 1VGQA 3OKAA 1PQUA 3RVOA 1YMQA 4F3CA 1PDOA 5FBKA 3FB4A 1WUKS 4XCVA 1G5HA 3LDFA 1ZD4A 2ZS9A 4JBGA 1FSGA 4JXKA 2C7RA 1VIVA 2QG6A 3V2IA 4WEQA 1PVOA 4F4JA 1MB4A 1VG1A 4UVHA 2PKRA 3ZGNA 1V4BA 4R3NA 4URVR 2WMOA 3Q3GE 3H3AA 3I2GA 4AMGA 3D8SA 2ZB8A 4OIMA 2ZSHA 4BLUA 3ND8A 4H7HA 3A36A 3WIBA 3LX8A 2HWUA 3L1HA 3RASA 2QRPA 2CVHA 4XWTA 3SMQA 4WN9B 2PUGA 4U31A 1W47A 1CZLA 2CLLB 1UBLS 1SZPA 3EJWA 1A9RA 2WSMA 4TUYF 4YY3T 6ADHA 2H7OA 5AVRA 2GO7A 4DR2B 2EJTA 2P8SA 2IKSA 4Q24A 1POWA 1EINA 2XB4A 3TRIA 1KL7A 3CT6A 3GT0A 5FL1A 1XJCA 3V42A 1XG5A 4MYUA 2WYOA 3QNWA 2OFXA 4EW1A 2O8EA 5JRCA 2UUAB 1LJ8A 4LOLA 3D3EA 3HP1A 3FTQA 2NADA 3M9WA 1U3WA 2JIQA 4D2IA 1VRWA 3HKDA 4W5JA 2W93A 4EYSA 3R6TA 2OVFA 4CKXA 2HDHA 4ARUA 3PHIA 1IM2A 4H17A 1I4OA 4LGCA 1VE9A 4WDRA 3PPWA 4NH0A 1V8DA 4ENTA 1TQ6A 3CINA 5SYAA 1OI4A 4ZU3A 3THXB 3GWGA 1YU6A 3N3BC 3TAXA 1KMIY 2X9LA 3PGVA 2OA5A 1MP0A 2XRFA 2QWXA 3AFIA 3ZVLA 2ZJZA 5J2UE 2GGSA 3FH0A 1NUHA 3OEYA 1G5TA 3IP1A 3FOAA 3LQRA 1SAYA 4A6PA 1MJNA 3K2QA 4O2RA 4FHEA 3ZYCA 1KE2A 2XA9A 2K2QB 3UANA 1KF6A 3AOEC 3GJ5A 3DT8A 5KYXB 1OWPA 3WADA 2ZJ3A 4Z3DA 2ZAMA 2WK1A 3DC7A 2QX4A 1DG9A 5AYVA 3LUHA 1BTOA 2DUWA 2YJGA 2NYRA 1X13A 5FUBA 5JDCC 3I58A 1XZPA 2GFQA 6CHYA 1X1DA 3TPFA 4LE0A 4FFRA 3UN1A 3RUCA 5ENZA 1CS4C 3M4YA 2YZGA 4KXNA 2F64A 3OQ6A 3PWKA 5LNK1 3DH0A 3VM6A 5I9MA 3SR4A 3QU4A 3SBOA 1RHQA 2RKBA 2D5IA 2WQ6A 3O21A 1HYEA 2P9YA 2OP0A 1LTKA 4BV8A 1R5NA 2VUHB 4GS5A 3FZFB 1WDWB 5IWAT 4PZ9A 2A0UA 1EXNA 1VL0A 2DWOA 5LQDA 1AJ3A 1FMTA 4LUCA 3KQYA 1SRRA 4WINA 1DRWA 3ICVA 5CTAA 1GGNA 5LG3A 1QGAA 5KOHA 3ZH2A 2VPZA 4W8OA 2G4VA 3HJBA 2YRFA 2OSVA 4R0VA 3LPAA 1C7IA 2IYUA 3VPAA 3LJCA 2MYSA 1QRUA 3VHRA 3UXMA 5HUQA 2DFDA 2P6UA 4KMOA 4ILCA 1T6ZA 1WDMA 4L9WA 5JD6A 4E03A 4UHDA 4GECA 1OHHA 2KBFA 1T6XA 2YV4A 1GRVA 3PUAA 1J5WA 4MDHA 1I33A 1FU4A 3RIYA 2XVYA 4DR3B 4CXMA 1EJ0A 3HJAA 1SBZA 2K7FA 1OZHA 4L6CA 4MEBA 1CQIA 2OCBA 3PYLA 3UICA 4ZAXA 1JR3E 2YV5A 1KTVA 2J9FA 4G1UC 4LW8A 5EGNA 4OQNA 2ADMA 3EXIB 3E7FA 5TMDA 2OO3A 2XGSA 3VZQA 3JC6D 5C7OO 1BQ4A 3H16A 1FOEB 1JH8A 2FFAA 5A62A 3R0QA 2KW5A 1L4YA 3KHUA 1RAEA 4DNXA 4I6GA 3MS7A 3EMKA 3P9SA 2WQ7A 1JHRA 3FJ1A 1F5SA 4MZDA 1ZH0A 3ZUPA 1M10A 3WMXA 2WU0A 5L4NA 3ZWQA 2PVPA 3HYSA 4CI2B 2R47A 3STUA 4DA8A 4IGIA 1IU9A 1K5HA 1RAIA 1JKIA 2ZJ7A 3AUUA 2ZSBA 2TS1A 3FDJA 2WILA 3GX1A 3ZQKA 3ZGOA 1R3UA 4TLEA 4PZAA 3LXRA 3O4FA 3NYQA 2PIAA 1P73A 1ILEA 3NUGA 1XL1A 4MWGA 3F6PA 2P5UA 3OMWA 1O97D 4O25A 4CKWA 1L1QA 2HA7A 3ZS8A 4AQYB 1XX6A 1JEDA 4ZO4A 4OA5A 2WSBA 2Q9QA 2X41A 3BC1A 4BEBA 3IUSA 4P4SB 2JCSA 4YT8A 4J2HA 1SG6A 1MW8X 4Q7JB 4A0SA 3O93A 2EZTA 4WT7A 4JUIA 1LLUA 2V5CA 4NAVA 1JZTA 1FLAA 1KHTA 5JR9B 2P2YA 1KIAA 4B8YA 1SVKA 4DPLA 1R0KA 1OXUA 3I9V6 2X9XA 1DAMA 5JDFA 7YASA 4BFZA 3T4XA 4NRDA 1E98A 4W6QA 4BFCA 2FDCA 3LFTA 4PJNA 3TZCA 4Q5IA 2Y8DA 1C2TA 3I5YA 2Y2UA 5TGZA 4Q4JA 1OW3B 2QJTA 1KK0A 3D8HA 2VSXA 4R6XA 2Q5EA 2V5UA 4ODIA 1LC0A 5E2BA 3SZOA 4D41A 4W5QA 1R8SA 3HC7A 3GD5A 3O26A 2CWOA 1FB5A 2VYVD 1W0JA 1LPOA 4WUVA 1XD2B 2JLSA 4X62T 4OYHA 3BX1A 4H63V 1PSZA 2G1KA 2RGEA 1KFJB 1S0UA 5AQHB 1GCOA 2CE7A 5WRFA 1CQJA 3CNNA 3UH1A 1NMQA 1RYDA 4X7PA 1GNSA 1ONPA 3L05A 1ULAA 3TW4A 4RMGA 4YCDA 1NKVA 4N6GA 1NNUA 1TRHA 1E6EA 4ZI2A