4U7IA

Structure of the complex of spartin mit and ist1 mim
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
93
structure length
93
Chain Sequence
EPAEIKIIREAYKKAFLFVNKGLNTDELGQKEEAKNYYKQGIGHLLRGISISSKESEHTGPGWESARQMQQKMKETLQNVRTRLEILEKGLAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Distinct Mechanisms of Recognizing Endosomal Sorting Complex Required for Transport III (ESCRT-III) Protein IST1 by Different Microtubule Interacting and Trafficking (MIT) Domains.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
molecule keywords Spartin
total genus 40
structure length 93
sequence length 93
ec nomenclature
pdb deposition date 2014-07-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.280 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Hypothetical protein 1500032h18. 4u7iA00
4U2ZA 4P1NA 4CN6A 4U3CA 1WFDA 2WY2A 3K1SA 3ZSSA 5CJ5A 5LB7B 3ZT7A 2RPAA 3ZT6A 4U33A 2CPTA 4WZXA 2A9UA 4IT4A 2DL1A 4U7YA 1WR0A 2V6YB 4A5XA 2V6YA 4U31A 2W2UA 2K3WA 4U2YA 5FVLA 2JQHA 3ZSTA 2MPKA 4U7IA 5FVKA 3ZT5A 4CN1A 2JQ9A 4ZEYA 4NIQA 2CRBA 2V6XA 4CN4A 1WCRA 2WWVA 3EABA 2JQKA 2LRKA 2XZEA 5CGMA 2LRLA 1YXRA
chains in the Genus database with same CATH superfamily
4PK5A 1BR1A 3ZJ1A 4QH1A 1FMVA 3A5XA 3M3ZB 5H6QB 2N1GA 5FYMA 3AE4A 5AQPB 3J9X1 3ZC1A 1IJ6A 1CHUA 2EHOA 2XQAA 2K24A 3KVBA 5L4HA 4H9SE 3DJBA 1BR4A 2BG9A 3JAEA 2IDOB 3HL6A 5LOVE 3RPUA 1QUUA 5HXEA 3Q2MA 3ETVA 3W15B 4ILBA 5JRCB 5AQQB 2I6HA 4O4HE 1HFAA 5IUXA 2H89A 1U4QA 2BBHA 2W4XA 3NZQA 4DMVA 2ODVA 3AA7B 4QX8B 1MIVA 4CI1B 2G0UA 4IL4A 3EHZA 4CN4A 1M7KA 2XASB 3OVUA 4ASKA 4X66T 1FJGT 3UUNA 4PAGA 2I59A 3O1IA 4DBRA 3RC8A 2X0YA 4J2CA 4DUYT 2W61A 5AQLB 2YDSA 4ADZA 5CA0E 2V5CA 4G2AA 5JR9B 3I0QA 1YXRA 3RQUA 1L0VA 3N9PA 4O4IE 2XM2A 4CN6A 5TAOA 2HH7A 3NVOA 4MHCA 5DABA 3ZSSA 4XBFB 4UXNB 5AQFB 5HEGA 5LG4A 4KHPT 4U33A 2EHOB 5HXRA 2LM9A 4NXMT 4ERRA 2V7IA 4LFBT 2V6YB 2E9XA 1KNRA 3OPCA 2UUAT 2ODUA 1FIOA 3AA6B 4MFRA 2AE9A 5EK3A 1SA0E 2LSYA 3CPZA 2BZBA 2WBLA 4HE8A 5LGUB 3P4QA 5J0ZA 1D0ZA 4H63V 4NPPA 4EYUA 2N2NA 2RA1A 4B3ST 3UUXB 2WSSV 3P4PA 1Y64B 5BMVE 2E5VA 3Q5XA 4PJMA 4V1Av 1WCRA 3V5UA 1HNWT 2BS4A 2JQQA 2W63A 3EABA 2WCAA 2CXLA 2NW7A 5F8PA 4JI8T 3T1YT 1UK5A 4TX5A 5FY7A 1UX4A 3VR8A 1MMDA 3SFDA 3RHWA 4KHZF 4HFHA 4PJJA 5JR9C 3RQWA 5JVDE 3MKDA 4YXDA 1KF6A 5CJ5A 4ZXLA 3RKOA 3N5LA 1E1HB 5AQTB 1D0XA 4U72A 2CHOA 2CWYA 2XJ7A 3UQ4A 4IDNA 5FY1A 2F4VT 4Q25A 4JV5T 2SPCA 5AQOB 2CE7A 3ZPOA 3AEDA 3K3NA 3NZPA 3VHLA 4P0AA 3SS1A 3MK7C 4PJNA 2V8SV 5J1GA 5L3GB 3PE0A 1MMAA 2ACXA 4YSZA 3WI3A 5LHHB 4JI0T 2K9AA 1NWMX 1M62A 2YOEA 4UVBB 3ZT5A 3MZKB 1MIWA 1XMQT 4IDZA 5E0OA 4AKRB 4YHHT 4KI0F 3VR9A 3VRBA 2ZM6T 1IBMT 4GYSA 1MNDA 1MMGA 3AA1B 3PTRB 3QUJA 1SE7A 4ZI2D 5AFUL 1T8BA 4JYAT 1T98A 2L3LA 3TLSA 2B76A 2OLTA 2HHHT 3N9MA 1KNZA 2C0SA 4LMLA 2KWHA 5GONE 4AKGA 2YEVC 3IHRA 2AXDS 5AQHB 3QNUA 4PNIA 3RI5A 4ZS3A 5LNKA 5IYZE 4DV3T 3C51A 3IA3A 4X1YE 2LLYA 2DHRA 2BDEA 2CEAA 2XQ6A 4IT4A 4UV9B 4EXTA 4GKJT 3K3QC 5AQRB 4TZ4C 4C90A 3LBXB 4HWFA 3HA4A 2XAJB 1AJ3A 2VB6A 3OYZA 5DQWA 4DR1T 2LSKA 4NUVA 2LJLA 3ZKRA 3L3PA 5JRCA 2B1EA 1CUNA 3AEFA 4I55E 2X67A 3KBTA 4A98A 4DV2T 4LMKA 4U74A 2PG8A 3UU6A 2MAWA 3JC6D 3RX6A 4PJLA 4Z90A 2NW9A 4EZHA 5LJNA 4JI1T 2XM1A 4IIJE 5L2LA 4GIWA 1UX5A 3AE2A 3PUQA 5KXJA 3RRCA 3N2KE 3IF8B 2X66A 3E08A 1SHZC 2Q9QB 1U5PA 2X0LB 4DO0A 4F8HA 1W09A 1B7TA 3G06A 2PTFA 2MTQA 4DIDB 4DUZT 2UXCT 3C4XA 2XSBA 1XNRT 3RYIE 4P1NA 3WAJA 4QXBB 2XUEA 3AAEB 3F57A 3PJAA 4CXYA 5FKYA 2CXFA 3LFMA 5M4YA 4JEHB 3ZMTB 3ZMSB 5FXWA 2CHNA 3RYFE 4NUUA 5JH7E 4DV0T 2H3RA 2VVSA 3AEAA 3KV4A 4WZXA 1WR0A 2KINB 2E9XC 3FXDB 3AE9A 5L4EA 1BR0A 2V5DA 4UR9A 2JMHA 1IZNB 3HKEE 2H88A 2YU2A 5FMNA 4KUMB 4PK6A 2W2UA 4LFAT 3AA0B 2W0GA 3AE8A 3EDUA 1IJ5A 1MNEA 2K48A 3AEBA 3RYCE 3P8CD 4WBOA 1X9BA 2VWAA 2V6XA 5JDLA 4HWCA 2WWVA 1T7SA 4DR2T 1ZHCA 2CXDA 2WDQA 5LBQB 3VU7H 2VQET 3F31A 3PU8A 2Q9QC 1ZOYA 3CKDA 4LF8T 2KXPB 2WMOA 2BVMA 4GKKT 1XDPA 3RLFF 2VKJA 2WM9A 2XY8B 1IBKT 1HF8A 2JJ9A 3M65A 4X1IE 4X65T 2CM0A 4X1KE 1DU2A 2IMLA 2CA5A 2Q9QD 1D1CA 2A9UA 2NTXA 2UXNB 2V7LA 2A3DA 2PBIA 2XQ4A 1X79A 3JAFA 4HGAA 3JADA 4IE5A 1OEDE 2N9DA 3LK2B 4WW0A 4Z8XA 3GMIA 4U31A 2ZM2A 1S35A 4TV9E 2K3WA 2J47A 2IUBA 4MBQA 2NOXA 2IIUA 1VRBA 4U2YA 4UVCB 3CQXC 3WAKA 2FUPA 1BR2A 2M6IA 2X68A 4A56A 2E5LT 2BVLA 4PFOA 1ZV4X 1LVFA 4YSYA 3BK9A 4YHJA 4QX7B 2GK9A 2LM2A 2A72A 2QVAA 4NIQA 4I0UA 4EEBA 2ZM8A 2ES0A 2DCFA 1HG5A 2ZMAA 1W0AA 2YDQA 3P4SA 2NTYA 2J62A 3PJAJ 4DR7T 4H9RC 4X62T 4HFBA 4CXXA 2X9YA 3SWHA 3K1SA 1YD8G 1UCUA 1HTJF 3FZHB 5LCYA 3ZT7A 1J5WA 4YJ3E 5CFBA 1UGOA 2WDVA 5L3CB 3CX7B 4AKLA 4L5GA 3EUHA 4YTNA 4PW8A 2XQ5A 2VKDA 2DWKA 3PUWF 2UUCT 3C98B 1XZYA 1GQEA 1R8IA 2C5JA 3H3AA 4TV8E 5LHGB 1LRZA 3K3OA 5HEJA 2V1DB 1I6ZA 4AISA 4CI3B 1N33T 4ZEYA 2ZLYA 3SFEA 3UFGA 3ONLC 1HX1B 2UXXB 4LF5T 2QGSA 3LJCA 4HTEA 4L9IA 4QH4A 5DJQC 1D1AA 2JQKA 2Q9QA 3ZN1B 2LSIA 5FL1A 1MMNA 4JEUB 5JDMA 4O2AE 3RGLA 3EDVA 3AVSA 2Y6XA 4OFZA 3KVAA 4IE7A 4CI2B 4WBNE 4PK4A 3DTOA 3ZT6A 5A1LA 4IE0A 4G63A 2CPTA 5FXVA 4QH5A 4ANJA 5L3FB 4WNKA 4DMWA 3RH3A 2C5KT 5LA6E 4E7SA 3MACA 4JLEA 2ACZA 3TLTA 4ZI3D 4JI6T 3KBUA 4OYKA 4UV8B 2JPFA 5FL0A 4QWNB 3ZC0A 2BBJA 3QB5A 3ZJ2A 4XZCA 3NBXX 4A97A 3A8YC 2W62A 3N9QA 5HCJA 4YSXA 1NAFA 3ZYMA 5LMNT 3MXZA 3L39A 5LXTE 1ZKEA 3HKCE 3RIFA 2LOPA 2VQFT 3LG7A 3B13A 1XNQT 3LBXA 5FVLA 2VKOA 1VCTA 1WLXA 2XZEA 3D0TA 2BKPA 1QSDA 3FZKB 4YTMA 4F6RC 3ZMUB 3QC9A 1N32T 2WZIA 3L8RA 3N9NA 3Q5EA 2HN1A 2OV9A 4OYJA 4KX6A 4UF0A 4EV6A 3N9LA 3NRXA 5HXHA 5JDGA 5H6RB 4ILAA 2K5BB 4KMCA 5CA1E 3VRAA 4ZS2A 4YJ2E 2D5UA 3BQIA 4CQIA 2LE8A 3C50A 4AQFA 4U7YA 3C64A 5JDNA 4DV4T 3HKDE 2WWUA 2A2FX 4HN9A 3PUGA 2VASA 3F2EA 4GK0E 3GA8A 3I9YA 3UUBA 4YT0A 5J2TE 3I0OA 5JR9A 2UUBT 2XAHB 3C4WA 4FJOA 2JQHA 4GOUA 4X20E 3RIAA 1WYCA 2VL8A 4B3TT 3SOLA 1FMWA 2W00A 2X9WA 4CN1A 2X9HA 5EZYE 3AE1A 5AQJB 4HWIB 1IAPA 3PUZF 3ONJA 5AQSB 2HPJA 4COFA 1OEDA 3RIUC 4JI4T 3AE7A 3Q5DA 4IREA 4P09A 4UEMA 1IBLT 4HFVA 3AXJA 2M67A 3EVYA 1HX8A 3KV9A 5DQVA 5JDQA 3IBPA 5AQKB 4HFEA 4H9NC 3B57A 2CBJA 2LKHA 2EHOD 2JMKA 1WFDA 4U3CA 4DR6T 4JBWF 4EAHA 2QRXA 2RPAA 2XAFB 4IE4A 5JDHA 1OWAA 2CWOA 4DNDA 1SUMB 2BG9C 2WZHA 2YK0A 3GN5A 4O2BE 5JTGA 4AQGA 4UVAB 2BKOA 2PFVA 4BJMA 2M6BA 3HI2A 3KDSE 3UT5E 3UULA 5L3BB 4DR3T 1HR0T 2CLYB 5FY0A 3ABVA 2E9XD 2E2AA 3H37A 3J7Yq 1HG2A 4GK5E 4JUYA 4TWDA 4OK0A 4X5TA 3I9WA 5HYAA 4HFIA 3OJAA 3TKLB 1KFYA 2KNDA 3HR0A 2BG9E 5F5WA 1W0BA 1YKHB 2XQ8A 4TNVA 4YFSA 1HCIA 4I4TE 2L8KA 5HCMA 1WRDA 4NXNT 4AQYT 3P4RA 2UU9T 1KEYA 3AXJB 3FXEB 4L0RA 3C4ZA 4BJNA 2KZ7B 1YQ3A 2V7MA 3CWZB 3OYXA 4H9OC 3E0ZA 4CZZB 3ZEFB 5KDMC 4ZZCA 3LSVA 4LF7T 2XQ3A 2LHNA 3Q5WA 3RRWA 1I94T 5AQMB 4IL9A 5EK4A 5FXZA 3AB3B 2DLRA 4JI7T 1T72A 3I1AA 4QXHB 3ESLA 4TUYE 3FBZA 1Z8UA 2FBWA 3HKBE 4GYRA 4HWDA 2MOZA 3NRYA 3PU3A 4A5XA 2VURA 4DV1T 4ZZBA 2JIWA 2HPLA 2D0UA 5JDFA 4X64T 2CLYC 1S94A 2CMRA 4ILCA 2I0MA 1OXZA 2MPKA 4U7IA 1LVKA 4EIWA 2MYSA 4DVDA 3PUXF 2NR4A 4HWHA 1OEDC 2BS2A 3CMLA 5KX5E 4DV5T 4OX9T 4B3RT 1J1JA 3KINB 3QOFA 2D2SA 4IGUA 4AQFC 2YKSA 4AI6A 4CXWA 4EGWA 4LMJA 5C2TA 2WAUA 3AAIA 3SRZA 5ABEA 4YTPA 5CGMA 3N2OA 2LOSA 1G73A 1E7PA 3AVRA 5AQGB 1NENA 5HEOA 3R84B 5L3DB 1JNZA 1ZP0A 5LG3A 2X51A 1QLBA 3BQKA 2Y48B 4DR4T 3MA9A 2WDRA 3NWIA 3P7IA 1KNPA 3EI0A 2DL1A 3R6NA 4JI3T 3AE5A 3FZFB 3FZLB 5LP6E 4AIUA 2VK9A 3CVRA 2YDRA 2MBGA 3TLUA 2D9DA 1N34T 2Y8DA 2YINA 4LF4T 3S4UA 4BAYB 1V9DA 2YU1A 4DV6T 3U3IA 1XMOT 3IEEA 4DR5T 4ISSA 4DBQA 4IDOA 2ZM0A 2X0HA 1OEDB 3LK3B 1G8XA 3B5MA 5BR8T 2VVNA 1US7B 2IC6A 4IE6A 4O4LE 4OHFA 2RP4A 4IDPA 5F3JA 3UQ7A 2CCQA 5JREA 2LRKA 4E7ZA 2WP9A 3ZLIA 5FP3A 2H7VC 3ONXA 3PV0F 3PUYF 4QHOA 3UU8A 4EEDA 3N2GE 1HNXT 5LGTB 4LFCT 3FBLA 2WY2A 3H3MA 2KMFA 5LB7B 2KSRA 2BKNA 2FJBA 2XSAA 4UELA 2FJEA 3CK6A 5AQIB 3ANWA 2V7JA 4UIGA 1J5ET 2UXBT 3ETUA 2R6GF 3AE3A 4ZI3C 4ILUA 3UTKA 2LT3A 1YKEB 5FVKA 5LJMA 3OTOT 2JQ9A 4KBMB 3AECA 3TLWA 3T1HT 4AXPA 5LBMA 3ZCJA 4O4JE 3AEEA 3PUAA 2PJQA 5ABFA 2YN6A 3U78A 2NWBA 2WS3A 4N78D 3RYHE 2D0TA 3MJXA 3V5SA 2WB5A 2KT9A 3FB2A 2V7KA 5ADXL 3NKZA 4HEAA 3PDYA 4TN7B 4TNWA 3FHNA 4DV7T 4LF6T 4U2ZA 3Q9DA 3DP7A 4YY3T 1Z0PA 3TLVA 5L3EB 3CQCB 3ZMVB 1NEKA 3BQLA 4M1PA 4ZOLE 2JRKA 5IHYA 3ZYLA 4ZHQE 3RIUA 5KMGP 2J4GA 5EK2A 2X9XA 1VCSA 5ETWA 1WYBA 1JNRA 4EB6E 1D0YA 2NW8A 4QKNA 4JI2T 1H7CA 1UURA 3OBVE 1VOMA 3ZMZB 3KV6A 2P9BA 1HNZT 3QK6A 4EZ4A 3KV5A 3ZSTA 5C3JA 5C8YE 4HFCA 2C5IT 3N9OA 5LYJE 1EZ3A 1MIYA 2W66A 4TWFA 5HEHA 2LHRA 5CB4E 3UUMA 3O4XE 3VKHA 2XAGB 3ANWB 2QYWA 2XQ9A 4IHJE 4KP3C 3GN5B 5FNVE 1E2AA 1W9RA 2L9QA 2WMNA 2XHEB 3AEGA 3AE6A 3LK42 3PUSA 4H63H 4I43B 5HEUA 5HWYA 3RKGA 4HFDA 2BS3A 4C91A 1FEWA 2WU5A 2QA7A 4AKIA 4AKHA 2NP9A 5HXSA 1ZEEA 4ZI2C 5LMUT 1YQ4A 2XQ7A 4O8SA 3UFEA 1KK7A 3P4WA 2XTLA 4BA9A 2CBIA 5FXXA 3A7MA 3CQGB 2OA5A 3L09A 2KLQA 2E9XB 2V6YA 1UUSA 3QB5K 4HKAA 4WYVA 2IW5B 3T8OA 5LHIB 2DI4A 5HWXA 3PUVF 3RF1A 4ZI7E 3UU3A 3FZMB 4B3MT 5AQVB 2VKHA 4FI5A 4Z91A 5IWAT 2HN2A 2FJAA 2IAKA 3K8PC 4XAXB 5ABGA 3X1DA 3ZN0B 4H9PC 2J1DG 3UU4A 3PURA 5LGNB 2WU2A 4K0UA 4JI5T 2DNXA 5ABHA 1LKXA 2V26A 3JCFA 2FJDA 1O3XA 4MALA 3E22E 1Y01A 3JC6C 3KFWX 4UF0B 2KWIB 4K0KT 4ISTA 1YW0A 4QXCB 2XAQB 4P0BA 3P50A 4YLHA 2WQYA 2EHOC 2VL0A 1N36T 3O1JA 5AQNB 5J2UE 5JQGE 1HS7A 1XWMA 5AQUB 3RC3A 3CIRA 2BG9B 3ZYKA 4LF9T 1WR6A 3CX8B 2H7OA 3LDQB 4PFPA 4EOZB 3AAAB 4MLKA 3CX6B 1XDOA 2XPKA 3ZCIA 5L47A 4IDQA 5HXCA 2W67A 1D1BA 2LKGA 3O9XA 5ABFB 3OKQA 2CRBA 2LEHA 3GWHA 3O1HA 5HAXA 3UU5A 2UXDT 3VKGA 2IC9A 2LSJA 2XQYA 2DWGA 2Z6EA 4I50E 4H9QC 4EYYR 2LSGA 2E8IA 4TWHA 4B6XA 2LRLA 3EAMA 2IHR1
chains in the Genus database with same CATH topology
4U2ZA 4P1NA 4CN6A 4U3CA 1WFDA 2WY2A 3K1SA 3ZSSA 5CJ5A 5LB7B 3ZT7A 2RPAA 3ZT6A 4U33A 2CPTA 4WZXA 2A9UA 4IT4A 2DL1A 4U7YA 1WR0A 2V6YB 4A5XA 2V6YA 4U31A 2W2UA 2K3WA 4U2YA 5FVLA 2JQHA 3ZSTA 2MPKA 4U7IA 5FVKA 3ZT5A 4CN1A 2JQ9A 4ZEYA 4NIQA 2CRBA 2V6XA 4CN4A 1WCRA 2WWVA 3EABA 2JQKA 2LRKA 2XZEA 5CGMA 2LRLA 1YXRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4U2Z A;  4P1N A;  4CN6 A;  4U3C A;  1WFD A;  2WY2 A;  3K1S A;  3ZSS A;  5CJ5 A;  5LB7 B;  3ZT7 A;  2RPA A;  3ZT6 A;  4U33 A;  2CPT A;  4WZX A;  2A9U A;  4IT4 A;  2DL1 A;  4U7Y A;  1WR0 A;  2V6Y B;  4A5X A;  2V6Y A;  4U31 A;  2W2U A;  2K3W A;  4U2Y A;  5FVL A;  2JQH A;  3ZST A;  2MPK A;  4U7I A;  5FVK A;  3ZT5 A;  4CN1 A;  2JQ9 A;  4ZEY A;  4NIQ A;  2CRB A;  2V6X A;  4CN4 A;  1WCR A;  2WWV A;  3EAB A;  2JQK A;  2LRK A;  2XZE A;  5CGM A;  2LRL A;  1YXR A; 
#chains in the Genus database with same CATH topology
 4PK5 A;  1BR1 A;  3ZJ1 A;  4QH1 A;  1FMV A;  3A5X A;  3M3Z B;  5H6Q B;  2N1G A;  5FYM A;  3AE4 A;  5AQP B;  3J9X 1;  3ZC1 A;  1IJ6 A;  1CHU A;  2EHO A;  2XQA A;  2K24 A;  3KVB A;  5L4H A;  4H9S E;  3DJB A;  1BR4 A;  2BG9 A;  3JAE A;  2IDO B;  3HL6 A;  5LOV E;  3RPU A;  1QUU A;  5HXE A;  3Q2M A;  3ETV A;  3W15 B;  4ILB A;  5JRC B;  5AQQ B;  2I6H A;  4O4H E;  1HFA A;  5IUX A;  2H89 A;  1U4Q A;  2BBH A;  2W4X A;  3NZQ A;  4DMV A;  2ODV A;  3AA7 B;  4QX8 B;  1MIV A;  4CI1 B;  2G0U A;  4IL4 A;  3EHZ A;  4CN4 A;  1M7K A;  2XAS B;  3OVU A;  4ASK A;  4X66 T;  1FJG T;  3UUN A;  4PAG A;  2I59 A;  3O1I A;  4DBR A;  3RC8 A;  2X0Y A;  4J2C A;  4DUY T;  2W61 A;  5AQL B;  2YDS A;  4ADZ A;  5CA0 E;  2V5C A;  4G2A A;  5JR9 B;  3I0Q A;  1YXR A;  3RQU A;  1L0V A;  3N9P A;  4O4I E;  2XM2 A;  4CN6 A;  5TAO A;  2HH7 A;  3NVO A;  4MHC A;  5DAB A;  3ZSS A;  4XBF B;  4UXN B;  5AQF B;  5HEG A;  5LG4 A;  4KHP T;  4U33 A;  2EHO B;  5HXR A;  2LM9 A;  4NXM T;  4ERR A;  2V7I A;  4LFB T;  2V6Y B;  2E9X A;  1KNR A;  3OPC A;  2UUA T;  2ODU A;  1FIO A;  3AA6 B;  4MFR A;  2AE9 A;  5EK3 A;  1SA0 E;  2LSY A;  3CPZ A;  2BZB A;  2WBL A;  4HE8 A;  5LGU B;  3P4Q A;  5J0Z A;  1D0Z A;  4H63 V;  4NPP A;  4EYU A;  2N2N A;  2RA1 A;  4B3S T;  3UUX B;  2WSS V;  3P4P A;  1Y64 B;  5BMV E;  2E5V A;  3Q5X A;  4PJM A;  4V1A v;  1WCR A;  3V5U A;  1HNW T;  2BS4 A;  2JQQ A;  2W63 A;  3EAB A;  2WCA A;  2CXL A;  2NW7 A;  5F8P A;  4JI8 T;  3T1Y T;  1UK5 A;  4TX5 A;  5FY7 A;  1UX4 A;  3VR8 A;  1MMD A;  3SFD A;  3RHW A;  4KHZ F;  4HFH A;  4PJJ A;  5JR9 C;  3RQW A;  5JVD E;  3MKD A;  4YXD A;  1KF6 A;  5CJ5 A;  4ZXL A;  3RKO A;  3N5L A;  1E1H B;  5AQT B;  1D0X A;  4U72 A;  2CHO A;  2CWY A;  2XJ7 A;  3UQ4 A;  4IDN A;  5FY1 A;  2F4V T;  4Q25 A;  4JV5 T;  2SPC A;  5AQO B;  2CE7 A;  3ZPO A;  3AED A;  3K3N A;  3NZP A;  3VHL A;  4P0A A;  3SS1 A;  3MK7 C;  4PJN A;  2V8S V;  5J1G A;  5L3G B;  3PE0 A;  1MMA A;  2ACX A;  4YSZ A;  3WI3 A;  5LHH B;  4JI0 T;  2K9A A;  1NWM X;  1M62 A;  2YOE A;  4UVB B;  3ZT5 A;  3MZK B;  1MIW A;  1XMQ T;  4IDZ A;  5E0O A;  4AKR B;  4YHH T;  4KI0 F;  3VR9 A;  3VRB A;  2ZM6 T;  1IBM T;  4GYS A;  1MND A;  1MMG A;  3AA1 B;  3PTR B;  3QUJ A;  1SE7 A;  4ZI2 D;  5AFU L;  1T8B A;  4JYA T;  1T98 A;  2L3L A;  3TLS A;  2B76 A;  2OLT A;  2HHH T;  3N9M A;  1KNZ A;  2C0S A;  4LML A;  2KWH A;  5GON E;  4AKG A;  2YEV C;  3IHR A;  2AXD S;  5AQH B;  3QNU A;  4PNI A;  3RI5 A;  4ZS3 A;  5LNK A;  5IYZ E;  4DV3 T;  3C51 A;  3IA3 A;  4X1Y E;  2LLY A;  2DHR A;  2BDE A;  2CEA A;  2XQ6 A;  4IT4 A;  4UV9 B;  4EXT A;  4GKJ T;  3K3Q C;  5AQR B;  4TZ4 C;  4C90 A;  3LBX B;  4HWF A;  3HA4 A;  2XAJ B;  1AJ3 A;  2VB6 A;  3OYZ A;  5DQW A;  4DR1 T;  2LSK A;  4NUV A;  2LJL A;  3ZKR A;  3L3P A;  5JRC A;  2B1E A;  1CUN A;  3AEF A;  4I55 E;  2X67 A;  3KBT A;  4A98 A;  4DV2 T;  4LMK A;  4U74 A;  2PG8 A;  3UU6 A;  2MAW A;  3JC6 D;  3RX6 A;  4PJL A;  4Z90 A;  2NW9 A;  4EZH A;  5LJN A;  4JI1 T;  2XM1 A;  4IIJ E;  5L2L A;  4GIW A;  1UX5 A;  3AE2 A;  3PUQ A;  5KXJ A;  3RRC A;  3N2K E;  3IF8 B;  2X66 A;  3E08 A;  1SHZ C;  2Q9Q B;  1U5P A;  2X0L B;  4DO0 A;  4F8H A;  1W09 A;  1B7T A;  3G06 A;  2PTF A;  2MTQ A;  4DID B;  4DUZ T;  2UXC T;  3C4X A;  2XSB A;  1XNR T;  3RYI E;  4P1N A;  3WAJ A;  4QXB B;  2XUE A;  3AAE B;  3F57 A;  3PJA A;  4CXY A;  5FKY A;  2CXF A;  3LFM A;  5M4Y A;  4JEH B;  3ZMT B;  3ZMS B;  5FXW A;  2CHN A;  3RYF E;  4NUU A;  5JH7 E;  4DV0 T;  2H3R A;  2VVS A;  3AEA A;  3KV4 A;  4WZX A;  1WR0 A;  2KIN B;  2E9X C;  3FXD B;  3AE9 A;  5L4E A;  1BR0 A;  2V5D A;  4UR9 A;  2JMH A;  1IZN B;  3HKE E;  2H88 A;  2YU2 A;  5FMN A;  4KUM B;  4PK6 A;  2W2U A;  4LFA T;  3AA0 B;  2W0G A;  3AE8 A;  3EDU A;  1IJ5 A;  1MNE A;  2K48 A;  3AEB A;  3RYC E;  3P8C D;  4WBO A;  1X9B A;  2VWA A;  2V6X A;  5JDL A;  4HWC A;  2WWV A;  1T7S A;  4DR2 T;  1ZHC A;  2CXD A;  2WDQ A;  5LBQ B;  3VU7 H;  2VQE T;  3F31 A;  3PU8 A;  2Q9Q C;  1ZOY A;  3CKD A;  4LF8 T;  2KXP B;  2WMO A;  2BVM A;  4GKK T;  1XDP A;  3RLF F;  2VKJ A;  2WM9 A;  2XY8 B;  1IBK T;  1HF8 A;  2JJ9 A;  3M65 A;  4X1I E;  4X65 T;  2CM0 A;  4X1K E;  1DU2 A;  2IML A;  2CA5 A;  2Q9Q D;  1D1C A;  2A9U A;  2NTX A;  2UXN B;  2V7L A;  2A3D A;  2PBI A;  2XQ4 A;  1X79 A;  3JAF A;  4HGA A;  3JAD A;  4IE5 A;  1OED E;  2N9D A;  3LK2 B;  4WW0 A;  4Z8X A;  3GMI A;  4U31 A;  2ZM2 A;  1S35 A;  4TV9 E;  2K3W A;  2J47 A;  2IUB A;  4MBQ A;  2NOX A;  2IIU A;  1VRB A;  4U2Y A;  4UVC B;  3CQX C;  3WAK A;  2FUP A;  1BR2 A;  2M6I A;  2X68 A;  4A56 A;  2E5L T;  2BVL A;  4PFO A;  1ZV4 X;  1LVF A;  4YSY A;  3BK9 A;  4YHJ A;  4QX7 B;  2GK9 A;  2LM2 A;  2A72 A;  2QVA A;  4NIQ A;  4I0U A;  4EEB A;  2ZM8 A;  2ES0 A;  2DCF A;  1HG5 A;  2ZMA A;  1W0A A;  2YDQ A;  3P4S A;  2NTY A;  2J62 A;  3PJA J;  4DR7 T;  4H9R C;  4X62 T;  4HFB A;  4CXX A;  2X9Y A;  3SWH A;  3K1S A;  1YD8 G;  1UCU A;  1HTJ F;  3FZH B;  5LCY A;  3ZT7 A;  1J5W A;  4YJ3 E;  5CFB A;  1UGO A;  2WDV A;  5L3C B;  3CX7 B;  4AKL A;  4L5G A;  3EUH A;  4YTN A;  4PW8 A;  2XQ5 A;  2VKD A;  2DWK A;  3PUW F;  2UUC T;  3C98 B;  1XZY A;  1GQE A;  1R8I A;  2C5J A;  3H3A A;  4TV8 E;  5LHG B;  1LRZ A;  3K3O A;  5HEJ A;  2V1D B;  1I6Z A;  4AIS A;  4CI3 B;  1N33 T;  4ZEY A;  2ZLY A;  3SFE A;  3UFG A;  3ONL C;  1HX1 B;  2UXX B;  4LF5 T;  2QGS A;  3LJC A;  4HTE A;  4L9I A;  4QH4 A;  5DJQ C;  1D1A A;  2JQK A;  2Q9Q A;  3ZN1 B;  2LSI A;  5FL1 A;  1MMN A;  4JEU B;  5JDM A;  4O2A E;  3RGL A;  3EDV A;  3AVS A;  2Y6X A;  4OFZ A;  3KVA A;  4IE7 A;  4CI2 B;  4WBN E;  4PK4 A;  3DTO A;  3ZT6 A;  5A1L A;  4IE0 A;  4G63 A;  2CPT A;  5FXV A;  4QH5 A;  4ANJ A;  5L3F B;  4WNK A;  4DMW A;  3RH3 A;  2C5K T;  5LA6 E;  4E7S A;  3MAC A;  4JLE A;  2ACZ A;  3TLT A;  4ZI3 D;  4JI6 T;  3KBU A;  4OYK A;  4UV8 B;  2JPF A;  5FL0 A;  4QWN B;  3ZC0 A;  2BBJ A;  3QB5 A;  3ZJ2 A;  4XZC A;  3NBX X;  4A97 A;  3A8Y C;  2W62 A;  3N9Q A;  5HCJ A;  4YSX A;  1NAF A;  3ZYM A;  5LMN T;  3MXZ A;  3L39 A;  5LXT E;  1ZKE A;  3HKC E;  3RIF A;  2LOP A;  2VQF T;  3LG7 A;  3B13 A;  1XNQ T;  3LBX A;  5FVL A;  2VKO A;  1VCT A;  1WLX A;  2XZE A;  3D0T A;  2BKP A;  1QSD A;  3FZK B;  4YTM A;  4F6R C;  3ZMU B;  3QC9 A;  1N32 T;  2WZI A;  3L8R A;  3N9N A;  3Q5E A;  2HN1 A;  2OV9 A;  4OYJ A;  4KX6 A;  4UF0 A;  4EV6 A;  3N9L A;  3NRX A;  5HXH A;  5JDG A;  5H6R B;  4ILA A;  2K5B B;  4KMC A;  5CA1 E;  3VRA A;  4ZS2 A;  4YJ2 E;  2D5U A;  3BQI A;  4CQI A;  2LE8 A;  3C50 A;  4AQF A;  4U7Y A;  3C64 A;  5JDN A;  4DV4 T;  3HKD E;  2WWU A;  2A2F X;  4HN9 A;  3PUG A;  2VAS A;  3F2E A;  4GK0 E;  3GA8 A;  3I9Y A;  3UUB A;  4YT0 A;  5J2T E;  3I0O A;  5JR9 A;  2UUB T;  2XAH B;  3C4W A;  4FJO A;  2JQH A;  4GOU A;  4X20 E;  3RIA A;  1WYC A;  2VL8 A;  4B3T T;  3SOL A;  1FMW A;  2W00 A;  2X9W A;  4CN1 A;  2X9H A;  5EZY E;  3AE1 A;  5AQJ B;  4HWI B;  1IAP A;  3PUZ F;  3ONJ A;  5AQS B;  2HPJ A;  4COF A;  1OED A;  3RIU C;  4JI4 T;  3AE7 A;  3Q5D A;  4IRE A;  4P09 A;  4UEM A;  1IBL T;  4HFV A;  3AXJ A;  2M67 A;  3EVY A;  1HX8 A;  3KV9 A;  5DQV A;  5JDQ A;  3IBP A;  5AQK B;  4HFE A;  4H9N C;  3B57 A;  2CBJ A;  2LKH A;  2EHO D;  2JMK A;  1WFD A;  4U3C A;  4DR6 T;  4JBW F;  4EAH A;  2QRX A;  2RPA A;  2XAF B;  4IE4 A;  5JDH A;  1OWA A;  2CWO A;  4DND A;  1SUM B;  2BG9 C;  2WZH A;  2YK0 A;  3GN5 A;  4O2B E;  5JTG A;  4AQG A;  4UVA B;  2BKO A;  2PFV A;  4BJM A;  2M6B A;  3HI2 A;  3KDS E;  3UT5 E;  3UUL A;  5L3B B;  4DR3 T;  1HR0 T;  2CLY B;  5FY0 A;  3ABV A;  2E9X D;  2E2A A;  3H37 A;  3J7Y q;  1HG2 A;  4GK5 E;  4JUY A;  4TWD A;  4OK0 A;  4X5T A;  3I9W A;  5HYA A;  4HFI A;  3OJA A;  3TKL B;  1KFY A;  2KND A;  3HR0 A;  2BG9 E;  5F5W A;  1W0B A;  1YKH B;  2XQ8 A;  4TNV A;  4YFS A;  1HCI A;  4I4T E;  2L8K A;  5HCM A;  1WRD A;  4NXN T;  4AQY T;  3P4R A;  2UU9 T;  1KEY A;  3AXJ B;  3FXE B;  4L0R A;  3C4Z A;  4BJN A;  2KZ7 B;  1YQ3 A;  2V7M A;  3CWZ B;  3OYX A;  4H9O C;  3E0Z A;  4CZZ B;  3ZEF B;  5KDM C;  4ZZC A;  3LSV A;  4LF7 T;  2XQ3 A;  2LHN A;  3Q5W A;  3RRW A;  1I94 T;  5AQM B;  4IL9 A;  5EK4 A;  5FXZ A;  3AB3 B;  2DLR A;  4JI7 T;  1T72 A;  3I1A A;  4QXH B;  3ESL A;  4TUY E;  3FBZ A;  1Z8U A;  2FBW A;  3HKB E;  4GYR A;  4HWD A;  2MOZ A;  3NRY A;  3PU3 A;  4A5X A;  2VUR A;  4DV1 T;  4ZZB A;  2JIW A;  2HPL A;  2D0U A;  5JDF A;  4X64 T;  2CLY C;  1S94 A;  2CMR A;  4ILC A;  2I0M A;  1OXZ A;  2MPK A;  4U7I A;  1LVK A;  4EIW A;  2MYS A;  4DVD A;  3PUX F;  2NR4 A;  4HWH A;  1OED C;  2BS2 A;  3CML A;  5KX5 E;  4DV5 T;  4OX9 T;  4B3R T;  1J1J A;  3KIN B;  3QOF A;  2D2S A;  4IGU A;  4AQF C;  2YKS A;  4AI6 A;  4CXW A;  4EGW A;  4LMJ A;  5C2T A;  2WAU A;  3AAI A;  3SRZ A;  5ABE A;  4YTP A;  5CGM A;  3N2O A;  2LOS A;  1G73 A;  1E7P A;  3AVR A;  5AQG B;  1NEN A;  5HEO A;  3R84 B;  5L3D B;  1JNZ A;  1ZP0 A;  5LG3 A;  2X51 A;  1QLB A;  3BQK A;  2Y48 B;  4DR4 T;  3MA9 A;  2WDR A;  3NWI A;  3P7I A;  1KNP A;  3EI0 A;  2DL1 A;  3R6N A;  4JI3 T;  3AE5 A;  3FZF B;  3FZL B;  5LP6 E;  4AIU A;  2VK9 A;  3CVR A;  2YDR A;  2MBG A;  3TLU A;  2D9D A;  1N34 T;  2Y8D A;  2YIN A;  4LF4 T;  3S4U A;  4BAY B;  1V9D A;  2YU1 A;  4DV6 T;  3U3I A;  1XMO T;  3IEE A;  4DR5 T;  4ISS A;  4DBQ A;  4IDO A;  2ZM0 A;  2X0H A;  1OED B;  3LK3 B;  1G8X A;  3B5M A;  5BR8 T;  2VVN A;  1US7 B;  2IC6 A;  4IE6 A;  4O4L E;  4OHF A;  2RP4 A;  4IDP A;  5F3J A;  3UQ7 A;  2CCQ A;  5JRE A;  2LRK A;  4E7Z A;  2WP9 A;  3ZLI A;  5FP3 A;  2H7V C;  3ONX A;  3PV0 F;  3PUY F;  4QHO A;  3UU8 A;  4EED A;  3N2G E;  1HNX T;  5LGT B;  4LFC T;  3FBL A;  2WY2 A;  3H3M A;  2KMF A;  5LB7 B;  2KSR A;  2BKN A;  2FJB A;  2XSA A;  4UEL A;  2FJE A;  3CK6 A;  5AQI B;  3ANW A;  2V7J A;  4UIG A;  1J5E T;  2UXB T;  3ETU A;  2R6G F;  3AE3 A;  4ZI3 C;  4ILU A;  3UTK A;  2LT3 A;  1YKE B;  5FVK A;  5LJM A;  3OTO T;  2JQ9 A;  4KBM B;  3AEC A;  3TLW A;  3T1H T;  4AXP A;  5LBM A;  3ZCJ A;  4O4J E;  3AEE A;  3PUA A;  2PJQ A;  5ABF A;  2YN6 A;  3U78 A;  2NWB A;  2WS3 A;  4N78 D;  3RYH E;  2D0T A;  3MJX A;  3V5S A;  2WB5 A;  2KT9 A;  3FB2 A;  2V7K A;  5ADX L;  3NKZ A;  4HEA A;  3PDY A;  4TN7 B;  4TNW A;  3FHN A;  4DV7 T;  4LF6 T;  4U2Z A;  3Q9D A;  3DP7 A;  4YY3 T;  1Z0P A;  3TLV A;  5L3E B;  3CQC B;  3ZMV B;  1NEK A;  3BQL A;  4M1P A;  4ZOL E;  2JRK A;  5IHY A;  3ZYL A;  4ZHQ E;  3RIU A;  5KMG P;  2J4G A;  5EK2 A;  2X9X A;  1VCS A;  5ETW A;  1WYB A;  1JNR A;  4EB6 E;  1D0Y A;  2NW8 A;  4QKN A;  4JI2 T;  1H7C A;  1UUR A;  3OBV E;  1VOM A;  3ZMZ B;  3KV6 A;  2P9B A;  1HNZ T;  3QK6 A;  4EZ4 A;  3KV5 A;  3ZST A;  5C3J A;  5C8Y E;  4HFC A;  2C5I T;  3N9O A;  5LYJ E;  1EZ3 A;  1MIY A;  2W66 A;  4TWF A;  5HEH A;  2LHR A;  5CB4 E;  3UUM A;  3O4X E;  3VKH A;  2XAG B;  3ANW B;  2QYW A;  2XQ9 A;  4IHJ E;  4KP3 C;  3GN5 B;  5FNV E;  1E2A A;  1W9R A;  2L9Q A;  2WMN A;  2XHE B;  3AEG A;  3AE6 A;  3LK4 2;  3PUS A;  4H63 H;  4I43 B;  5HEU A;  5HWY A;  3RKG A;  4HFD A;  2BS3 A;  4C91 A;  1FEW A;  2WU5 A;  2QA7 A;  4AKI A;  4AKH A;  2NP9 A;  5HXS A;  1ZEE A;  4ZI2 C;  5LMU T;  1YQ4 A;  2XQ7 A;  4O8S A;  3UFE A;  1KK7 A;  3P4W A;  2XTL A;  4BA9 A;  2CBI A;  5FXX A;  3A7M A;  3CQG B;  2OA5 A;  3L09 A;  2KLQ A;  2E9X B;  2V6Y A;  1UUS A;  3QB5 K;  4HKA A;  4WYV A;  2IW5 B;  3T8O A;  5LHI B;  2DI4 A;  5HWX A;  3PUV F;  3RF1 A;  4ZI7 E;  3UU3 A;  3FZM B;  4B3M T;  5AQV B;  2VKH A;  4FI5 A;  4Z91 A;  5IWA T;  2HN2 A;  2FJA A;  2IAK A;  3K8P C;  4XAX B;  5ABG A;  3X1D A;  3ZN0 B;  4H9P C;  2J1D G;  3UU4 A;  3PUR A;  5LGN B;  2WU2 A;  4K0U A;  4JI5 T;  2DNX A;  5ABH A;  1LKX A;  2V26 A;  3JCF A;  2FJD A;  1O3X A;  4MAL A;  3E22 E;  1Y01 A;  3JC6 C;  3KFW X;  4UF0 B;  2KWI B;  4K0K T;  4IST A;  1YW0 A;  4QXC B;  2XAQ B;  4P0B A;  3P50 A;  4YLH A;  2WQY A;  2EHO C;  2VL0 A;  1N36 T;  3O1J A;  5AQN B;  5J2U E;  5JQG E;  1HS7 A;  1XWM A;  5AQU B;  3RC3 A;  3CIR A;  2BG9 B;  3ZYK A;  4LF9 T;  1WR6 A;  3CX8 B;  2H7O A;  3LDQ B;  4PFP A;  4EOZ B;  3AAA B;  4MLK A;  3CX6 B;  1XDO A;  2XPK A;  3ZCI A;  5L47 A;  4IDQ A;  5HXC A;  2W67 A;  1D1B A;  2LKG A;  3O9X A;  5ABF B;  3OKQ A;  2CRB A;  2LEH A;  3GWH A;  3O1H A;  5HAX A;  3UU5 A;  2UXD T;  3VKG A;  2IC9 A;  2LSJ A;  2XQY A;  2DWG A;  2Z6E A;  4I50 E;  4H9Q C;  4EYY R;  2LSG A;  2E8I A;  4TWH A;  4B6X A;  2LRL A;  3EAM A;  2IHR 1; 
#chains in the Genus database with same CATH homology
 4U2Z A;  4P1N A;  4CN6 A;  4U3C A;  1WFD A;  2WY2 A;  3K1S A;  3ZSS A;  5CJ5 A;  5LB7 B;  3ZT7 A;  2RPA A;  3ZT6 A;  4U33 A;  2CPT A;  4WZX A;  2A9U A;  4IT4 A;  2DL1 A;  4U7Y A;  1WR0 A;  2V6Y B;  4A5X A;  2V6Y A;  4U31 A;  2W2U A;  2K3W A;  4U2Y A;  5FVL A;  2JQH A;  3ZST A;  2MPK A;  4U7I A;  5FVK A;  3ZT5 A;  4CN1 A;  2JQ9 A;  4ZEY A;  4NIQ A;  2CRB A;  2V6X A;  4CN4 A;  1WCR A;  2WWV A;  3EAB A;  2JQK A;  2LRK A;  2XZE A;  5CGM A;  2LRL A;  1YXR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...