4U7IA

Structure of the complex of spartin mit and ist1 mim
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
93
structure length
93
Chain Sequence
EPAEIKIIREAYKKAFLFVNKGLNTDELGQKEEAKNYYKQGIGHLLRGISISSKESEHTGPGWESARQMQQKMKETLQNVRTRLEILEKGLAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Spartin
publication title Distinct Mechanisms of Recognizing Endosomal Sorting Complex Required for Transport III (ESCRT-III) Protein IST1 by Different Microtubule Interacting and Trafficking (MIT) Domains.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 40
structure length 93
sequence length 93
ec nomenclature
pdb deposition date 2014-07-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.280 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Hypothetical protein 1500032h18. 4u7iA00
4WZXA 5LB7B 1YXRA 4CN1A 4P1NA 4NIQA 1WR0A 2DL1A 4CN6A 2WY2A 2CRBA 5FVLA 3ZT5A 2V6YA 2JQHA 2CPTA 1WCRA 4U7YA 5FVKA 2V6XA 2A9UA 2LRLA 3EABA 3ZSSA 2JQ9A 4A5XA 2K3WA 3ZSTA 3ZT7A 4U3CA 4ZEYA 2LRKA 2MPKA 1WFDA 5CGMA 5CJ5A 2W2UA 4U31A 4U2ZA 4U33A 2WWVA 4CN4A 2JQKA 4U2YA 3K1SA 2XZEA 3ZT6A 4IT4A 2RPAA 2V6YB 4U7IA
chains in the Genus database with same CATH superfamily
1IBLT 3IHRA 5HXCA 3UUXB 4ASKA 2NTYA 1BR2A 3NKZA 1SHZC 2B1EA 2Q9QC 4ZXLA 3LFMA 3P4QA 3N9MA 4NXNT 2Q9QA 5DJQC 1UUSA 4YTPA 4IDZA 2VKJA 5JDQA 4EIWA 2V6XA 2Z6EA 5AQNB 1NEKA 3MKDA 1MMGA 2JQKA 1J1JA 4HFDA 5LNKA 1OEDE 1QUUA 2VL0A 2L8KA 3NRXA 3LG7A 3AE3A 4KUMB 4L0RA 1T98A 3CKDA 4OYKA 4U74A 4AI6A 2DNXA 5CJ5A 5E0OA 3N9LA 3RI5A 2WWVA 2LM9A 3ETUA 4A56A 1I94T 2LKGA 4HFHA 4YTMA 1VCSA 4H9NC 3KINB 3UU6A 4DIDB 1MNEA 2XPKA 4LF6T 4IE4A 2B76A 2E5LT 3V5UA 3W15B 3RIUA 4HTEA 3ZMTB 4B3TT 2CCQA 3MXZA 2G0UA 5LMNT 4YSYA 4AKHA 3DTOA 3VKGA 5J2TE 3AE1A 4UVBB 2LHRA 4U7YA 3ZJ1A 1AJ3A 3LBXB 5EZYE 3AE9A 2WP9A 5LGUB 3RKOA 2HHHT 4UVCB 4P1NA 2JIWA 3ZC1A 3ABVA 5HXHA 2AXDS 3C98B 3AEGA 2XSAA 5FMNA 4PK6A 2NOXA 3N5LA 2YN6A 2V7KA 2EHOB 3RF1A 3K3QC 3MK7C 2M6BA 2OLTA 1XDOA 4IE0A 2LRLA 2WB5A 1FMVA 4YHHT 5L2LA 4QKNA 2A72A 3EHZA 4DO0A 3FB2A 3OBVE 1CUNA 1KF6A 4X5TA 3QNUA 3C64A 3AVSA 2WDRA 2UXDT 5C8YE 3NVOA 5AQQB 5LG4A 5JDGA 2DWKA 1XDPA 5AQRB 3PUXF 3FZMB 2VVNA 4P0AA 3D0TA 3PUVF 1BR4A 2VKDA 2QGSA 3RQWA 2ODVA 3T1HT 4YT0A 3ESLA 2J1DG 2QA7A 4AKIA 2LRKA 4IHJE 2WZHA 4JYAT 3PV0F 2X0LB 3I0OA 3WAKA 2RA1A 5IUXA 2ZM2A 3B13A 5HAXA 5LHHB 1UURA 2BS2A 4DNDA 2DLRA 2KINB 2PG8A 2WQYA 4JI6T 1NAFA 4HKAA 4AKLA 1E2AA 4UV8B 4GKKT 3PUSA 1HX8A 4AQYT 4MHCA 4IL9A 2NR4A 2ODUA 2WBLA 3AB3B 4OX9T 4IDOA 3KV4A 3ZT7A 2KT9A 3PDYA 4UELA 1V9DA 4QXBB 3LSVA 5AQLB 5JDFA 2V7JA 2CRBA 1D1AA 4DR7T 2LJLA 2CXLA 2W61A 1KNPA 2UXBT 5DABA 4TNWA 2A3DA 3O1IA 5H6RB 2H7VC 5ABEA 3C4ZA 4YSXA 5EK4A 5L4EA 3QB5A 2N9DA 5CA0E 2L9QA 2DWGA 1XMQT 1M7KA 2BKPA 4A5XA 3UUMA 4KHZF 2CWYA 3CX7B 3SFDA 4OYJA 5ABFA 3MA9A 3B57A 1T7SA 1FIOA 1UX5A 2XY8B 4HFCA 4XAXB 2YEVC 1S94A 4HE8A 4PK4A 3L09A 4U2ZA 2XQ3A 2WMOA 1HX1B 5M4YA 2W00A 3ZN1B 1MNDA 3AA1B 3I9WA 1J5ET 4MBQA 2WU5A 5HXSA 2CXDA 4HEAA 5LG3A 3T8OA 2IW5B 2XQ8A 1YQ4A 4OHFA 2XQ7A 3KFWX 3I9YA 3DP7A 2Y6XA 4A97A 4ADZA 3LDQB 3TLSA 1WCRA 3CVRA 4EV6A 5JTGA 4DUZT 3UU5A 2BG9B 1OEDC 2PBIA 4EOZB 4YHJA 3R84B 4ZS2A 1OEDA 1M62A 3RRCA 4CI1B 3UT5E 4WZXA 4I4TE 5L4HA 3U3IA 2J47A 5L47A 4EEDA 2XAHB 1HCIA 3GN5A 4H9QC 3ONXA 2H3RA 3RX6A 4HWHA 3NZQA 4NIQA 4K0KT 3Q9DA 3KV9A 1XZYA 3VU7H 3EDUA 4ZI7E 1HNZT 4DR6T 3OJAA 4ZZCA 3IBPA 2KWHA 4LF4T 2DHRA 2CMRA 4X1KE 1ZKEA 2UUAT 2W66A 3ZEFB 2JQ9A 2K9AA 2V6YB 1Z8UA 5JR9A 3AEBA 5FYMA 5HCJA 3TLVA 4JI1T 5AQSB 5H6QB 1HG5A 4WBOA 5HXEA 1HFAA 3PUAA 5ABFB 3KVBA 2I59A 5KDMC 4HFEA 1IZNB 3PTRB 3JC6D 2LKHA 4JEUB 1JNRA 5FNVE 2V7MA 3QK6A 3E22E 3L39A 1BR1A 3UULA 3AAIA 3AAEB 3O1JA 3PUGA 5ABHA 2VWAA 4O2BE 2VKHA 2VVSA 4KI0F 3CX6B 2WAUA 4UXNB 1JNZA 4PJMA 2CLYB 2OV9A 3PJAA 2MAWA 4U3CA 1WYBA 4K0UA 2IDOB 2LSJA 5CA1E 2FBWA 3I0QA 1HNWT 3CQCB 5CB4E 3QUJA 2V5CA 4IL4A 2E9XD 5J1GA 3RC8A 3ANWB 4DBQA 2JPFA 5ETWA 2NP9A 2CE7A 1VRBA 3O4XE 3RYCE 2EHOC 4ANJA 4KX6A 4CZZB 2QYWA 5LHGB 1YKHB 1GQEA 2XM1A 4J2CA 2Y8DA 2PTFA 2WWUA 3PURA 3F2EA 3P4WA 4JI0T 4TWHA 3UUBA 2X9XA 4O4IE 3J7Yq 2CBIA 3OPCA 1W09A 3HKEE 4PNIA 4DVDA 3N9OA 2H7OA 4U72A 5JDNA 4DBRA 2C5IT 4MALA 4JUYA 2KMFA 1HG2A 2LSIA 2XQYA 4HN9A 2BZBA 3O1HA 2W2UA 5JR9B 5DQWA 4L9IA 3AAAB 2KSRA 4BAYB 3KBTA 2WM9A 2CHNA 1LVFA 2MYSA 2WDVA 2CPTA 1MMNA 4EYUA 5HEJA 3OVUA 4ISSA 4TWFA 4QWNB 4FJOA 3KBUA 3ZPOA 2BVMA 4TZ4C 5AQKB 2UU9T 1QLBA 4QX7B 1FEWA 2XQ5A 2NW9A 4GYRA 3UU3A 1FMWA 3PUZF 2V7IA 5JDLA 3N9PA 2CXFA 4XBFB 3JC6C 2WS3A 5AFUL 3HI2A 4PFPA 4CI2B 4FI5A 2NWBA 1BR0A 3KV6A 1D0ZA 1E1HB 4GIWA 2LHNA 1D1CA 4I55E 2V5DA 1XNQT 4XZCA 1HR0T 2H89A 3FZHB 2Q9QB 4EZHA 2YU1A 4ILCA 3N9QA 2UXXB 4LF5T 2V1DB 4EB6E 3GWHA 5LB7B 2JRKA 3EVYA 5LA6E 4JI7T 3ZYKA 4GOUA 2E9XC 3ZJ2A 2MBGA 3WAJA 4LF8T 3HKCE 2E9XA 1UGOA 4LMLA 4B3RT 3CX8B 4ISTA 3AE6A 3ZKRA 1IBMT 4CN1A 1WR0A 2V8SV 2IUBA 4ZZBA 2WSSV 5AQGB 4AIUA 1XNRT 2ZM6T 3P4PA 1R8IA 2IC9A 5AQJB 3P7IA 4M1PA 3VR8A 4TNVA 1NWMX 2PJQA 1KFYA 2DL1A 4DMVA 3V5SA 3VR9A 2ACZA 4I50E 1LRZA 3UFGA 5ABGA 4JI2T 4KHPT 5EK2A 3BQLA 2VASA 4H9SE 4U31A 2X66A 3RRWA 2R6GF 2X51A 2RPAA 5L3DB 4QHOA 2X9HA 4HWCA 4NUVA 4ZI2C 1VCTA 4O4LE 4WYVA 1IJ6A 3L8RA 2KZ7B 4CQIA 2XUEA 1G73A 3JCFA 5HEOA 4IE6A 2UUCT 4UF0A 2I0MA 3HKBE 2M6IA 2M67A 4QX8B 1N32T 4L5GA 4ZI3D 5KX5E 4HWDA 2BVLA 3ZT6A 2OA5A 3T1YT 4JV5T 2FUPA 3FBLA 3AEAA 2HPLA 1B7TA 4HFVA 3NWIA 2JMKA 2KXPB 2L3LA 3PE0A 3S4UA 3HKDE 1IJ5A 4IDQA 1UCUA 3PUYF 4DUYT 2IHR1 2XZEA 5FY1A 5ADXL 2CHOA 2J62A 2XTLA 4EYYR 1KNRA 5GONE 1OXZA 3HL6A 3N2OA 5CFBA 1KNZA 4PJLA 1QSDA 5AQUB 5FVKA 2LEHA 1X79A 1KEYA 3MJXA 5JVDE 1IBKT 3AA0B 4HGAA 5L3EB 3P8CD 2XSBA 2D0TA 3AE7A 2EHOD 1D1BA 4UV9B 3UU4A 3SFEA 2WMNA 4KP3C 4EZ4A 3RH3A 2QVAA 1Y64B 2CLYC 3HA4A 5L3FB 4E7SA 3SRZA 4I0UA 2LSYA 5FL1A 5JRCA 4JI5T 4LFCT 4IT4A 4U7IA 4QH1A 3RC3A 2FJEA 4B3ST 5IHYA 2VQET 3RPUA 2RP4A 4UEMA 4TV9E 2LT3A 4E7ZA 2KNDA 4V1Av 3EDVA 5AQMB 4DR1T 2Y48B 2JJ9A 1YW0A 4LFAT 3AE8A 4NXMT 2V7LA 4DV6T 1NENA 2CA5A 2A9UA 3QOFA 3SWHA 2K3WA 5FY0A 4PAGA 2MPKA 5LOVE 4LF9T 2XASB 2SPCA 3H37A 4YLHA 2ZLYA 3GMIA 4GK5E 2BG9E 3AVRA 4IE5A 4QH5A 3Q5WA 5JDMA 2W4XA 1UX4A 4UR9A 4EEBA 3BQIA 5HWXA 4ZI3C 3C4XA 4PJJA 3TKLB 5HYAA 2YKSA 2LE8A 3LK2B 4JBWF 2XM2A 3AE2A 4DV2T 1WFDA 4TWDA 1N33T 3BK9A 2VQFT 2ZMAA 3H3MA 5HWYA 2WY2A 1N36T 4NPPA 4ILUA 4GKJT 3LBXA 2X67A 5AQHB 4TV8E 3F57A 2XAGB 1OWAA 5JDHA 3ZC0A 5LJNA 3Q5XA 3AEDA 4H63V 3QB5K 1L0VA 3E0ZA 4P0BA 1ZV4X 1ZEEA 3FXDB 1OEDB 4DR4T 3DJBA 3B5MA 3A8YC 2YU2A 3FZFB 2VL8A 4IDNA 5J2UE 4CXYA 4HFBA 2EHOA 5AQVB 2IMLA 2FJDA 5KXJA 3G06A 2YINA 3RGLA 5FXWA 3ZSTA 3GN5B 3UQ7A 3U78A 3FBZA 4JI4T 4EGWA 4IGUA 3CQGB 5L3BB 4DMWA 2VB6A 2JMHA 2BDEA 3AXJA 4P09A 2E8IA 2VK9A 2YOEA 3SOLA 4X66T 1T72A 5A1LA 5L3GB 4KBMB 4COFA 4Q25A 3RIFA 4F8HA 2IAKA 3A5XA 3RHWA 1WRDA 3SS1A 4DV5T 4HWIB 2XHEB 1LKXA 5C2TA 4O4HE 4ZI2D 4O2AE 5HEGA 2X9WA 3CQXC 2CWOA 3OTOT 2P9BA 1ZOYA 2KWIB 1HTJF 3TLTA 3ZLIA 4ZS3A 5HCMA 2J4GA 4BJNA 1U5PA 4YY3T 2XQAA 4YSZA 3RYIE 1D0YA 5AQFB 2I6HA 4CXXA 2N1GA 3ZYMA 4JEHB 3UFEA 3RIUC 2N2NA 3H3AA 2C5JA 2LM2A 3N9NA 2FJBA 2X9YA 3VRBA 3PU3A 2NW7A 3OYZA 1XWMA 4CN6A 3N2KE 4ERRA 1D0XA 3NRYA 2K24A 2XQ6A 5LCYA 3ZSSA 2GK9A 1CHUA 2XAFB 3IA3A 2KLQA 2F4VT 3RQUA 4CN4A 3CWZB 3O9XA 4QXHB 3CPZA 5LGTB 4EAHA 4DR3T 2NTXA 4AQFC 5FXZA 2IC6A 1T8BA 4EXTA 4AQFA 3PUWF 3UU8A 2WZIA 4QH4A 3VRAA 2LLYA 3FHNA 3K1SA 3E08A 2HPJA 4PFOA 2X0YA 4X65T 4X1YE 4G2AA 3EAMA 3ZMZB 4JI8T 4OFZA 3LK42 3KV5A 2BS4A 4YTNA 2BS3A 3AXJB 3KVAA 4H63H 1S35A 3FZLB 4AXPA 1G8XA 2BBJA 3M3ZB 3ZN0B 3J9X1 3PJAJ 1E7PA 1X9BA 5BR8T 2ZM0A 5LBMA 3EABA 5FY7A 4DV0T 3R6NA 3UQ4A 3PUQA 4U33A 2HN2A 5LJMA 3RLFF 5LP6E 5FL0A 4CXWA 3Q5DA 2E2AA 2UXCT 2QRXA 3GA8A 4X20E 3HR0A 4ILAA 2BBHA 4TN7B 4JI3T 4G63A 1HNXT 3VHLA 5TAOA 2CEAA 3JAFA 5EK3A 3TLUA 4H9RC 4YJ2E 3AA7B 4BJMA 4GK0E 2XQ4A 2LSKA 2LSGA 1N34T 2BG9C 5F8PA 1LVKA 4OK0A 2ES0A 5JH7E 1ZP0A 3P4SA 2BG9A 3KDSE 2LOPA 4TX5A 3AA6B 2VURA 3Q5EA 3A7MA 3CK6A 4HWFA 2A2FX 4ILBA 2YK0A 1W0BA 5DQVA 1J5WA 2AE9A 1Z0PA 3IF8B 4AQGA 4X62T 5JREA 2D0UA 2D2SA 2VKOA 3ETVA 5C3JA 1MMDA 3CIRA 5LMUT 3AE5A 2NW8A 5LBQB 3PU8A 2XQ9A 3LJCA 4ZOLE 1W9RA 4H9PC 4DV4T 3ZYLA 2MOZA 4LF7T 5AQIB 4UVAB 1XMOT 5LYJE 1WR6A 4IE7A 1DU2A 2YDSA 2BKNA 4HFIA 2V6YA 2E9XB 2WU2A 3C4WA 2D9DA 4I43B 3UTKA 2UXNB 1YQ3A 3EI0A 4Z91A 5KMGP 5AQPB 3UUNA 4JLEA 3LK3B 1ZHCA 3RKGA 2K48A 3AECA 4TUYE 3OKQA 1HF8A 4PK5A 2DCFA 5LXTE 3P50A 1W0AA 2JQQA 3RIAA 5AQTB 4AKRB 3RYFE 3ZMVB 3ONLC 3Q2MA 2ZM8A 4DR5T 3I1AA 4ZEYA 3QC9A 3MACA 4CI3B 5CGMA 4N78D 2E5VA 5HEHA 4YJ3E 1UK5A 2CBJA 2ACXA 5IWAT 2W63A 3ONJA 4YXDA 5FP3A 4QXCB 3ZMSB 2X68A 3N2GE 5F5WA 4H9OC 4PJNA 1FJGT 4GYSA 2BKOA 3AEEA 1I6ZA 5AQOB 3K8PC 3CMLA 3ZMUB 1MIYA 2CM0A 3C51A 2K5BB 2Q9QD 4DR2T 3TLWA 4NUUA 4DV7T 1U4QA 4C90A 1MMAA 4UIGA 4U2YA 4ZHQE 4WBNE 5F3JA 5L3CB 3ZT5A 4LFBT 3AE4A 2X0HA 4AKGA 2C0SA 3C50A 5HEUA 5FKYA 2DI4A 2LOSA 3AEFA 3ANWA 2IIUA 4WW0A 3F31A 2H88A 3FZKB 4X64T 4UF0B 5FXVA 3FXEB 4Z90A 5IYZE 2HH7A 3EUHA 1KK7A 5HXRA 4O8SA 4LMKA 1SE7A 4C91A 3MZKB 2PFVA 1H7CA 4B6XA 3K3OA 3M65A 2MTQA 5LGNB 2YDQA 3NZPA 4O4JE 3K3NA 4Z8XA 3X1DA 2XAQB 2YDRA 5FVLA 3ZCJA 2JQHA 3NBXX 1WLXA 1YD8G 4YFSA 5JQGE 3IEEA 3RYHE 4LMJA 5JR9C 1SUMB 1US7B 4X1IE 4F6RC 3JADA 3L3PA 2FJAA 4A98A 2WCAA 3VKHA 4WNKA 2D5UA 4IDPA 2HN1A 1MIVA 3OYXA 1WYCA 5BMVE 1O3XA 4BA9A 4AISA 1YXRA 3ZCIA 1SA0E 4MFRA 1Y01A 2XJ7A 3BQKA 1HS7A 1VOMA 2W67A 1EZ3A 1MIWA 2W0GA 2WDQA 3P4RA 1YKEB 3JAEA 2W62A 4MLKA 4B3MT 4IIJE 1IAPA 2V26A 4IREA 5FXXA 4DV1T 2C5KT 3WI3A 5LHIB 5JRCB 5J0ZA 4PW8A 2UUBT 2XAJB 4KMCA 4DV3T
chains in the Genus database with same CATH topology
4WZXA 5LB7B 1YXRA 4CN1A 4P1NA 4NIQA 1WR0A 2DL1A 4CN6A 2WY2A 2CRBA 5FVLA 3ZT5A 2V6YA 2JQHA 2CPTA 1WCRA 4U7YA 5FVKA 2V6XA 2A9UA 2LRLA 3EABA 3ZSSA 2JQ9A 4A5XA 2K3WA 3ZSTA 3ZT7A 4U3CA 4ZEYA 2LRKA 2MPKA 1WFDA 5CGMA 5CJ5A 2W2UA 4U31A 4U2ZA 4U33A 2WWVA 4CN4A 2JQKA 4U2YA 3K1SA 2XZEA 3ZT6A 4IT4A 2RPAA 2V6YB 4U7IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WZX A;  5LB7 B;  1YXR A;  4CN1 A;  4P1N A;  4NIQ A;  1WR0 A;  2DL1 A;  4CN6 A;  2WY2 A;  2CRB A;  5FVL A;  3ZT5 A;  2V6Y A;  2JQH A;  2CPT A;  1WCR A;  4U7Y A;  5FVK A;  2V6X A;  2A9U A;  2LRL A;  3EAB A;  3ZSS A;  2JQ9 A;  4A5X A;  2K3W A;  3ZST A;  3ZT7 A;  4U3C A;  4ZEY A;  2LRK A;  2MPK A;  1WFD A;  5CGM A;  5CJ5 A;  2W2U A;  4U31 A;  4U2Z A;  4U33 A;  2WWV A;  4CN4 A;  2JQK A;  4U2Y A;  3K1S A;  2XZE A;  3ZT6 A;  4IT4 A;  2RPA A;  2V6Y B;  4U7I A; 
#chains in the Genus database with same CATH topology
 1IBL T;  3IHR A;  5HXC A;  3UUX B;  4ASK A;  2NTY A;  1BR2 A;  3NKZ A;  1SHZ C;  2B1E A;  2Q9Q C;  4ZXL A;  3LFM A;  3P4Q A;  3N9M A;  4NXN T;  2Q9Q A;  5DJQ C;  1UUS A;  4YTP A;  4IDZ A;  2VKJ A;  5JDQ A;  4EIW A;  2V6X A;  2Z6E A;  5AQN B;  1NEK A;  3MKD A;  1MMG A;  2JQK A;  1J1J A;  4HFD A;  5LNK A;  1OED E;  1QUU A;  2VL0 A;  2L8K A;  3NRX A;  3LG7 A;  3AE3 A;  4KUM B;  4L0R A;  1T98 A;  3CKD A;  4OYK A;  4U74 A;  4AI6 A;  2DNX A;  5CJ5 A;  5E0O A;  3N9L A;  3RI5 A;  2WWV A;  2LM9 A;  3ETU A;  4A56 A;  1I94 T;  2LKG A;  4HFH A;  4YTM A;  1VCS A;  4H9N C;  3KIN B;  3UU6 A;  4DID B;  1MNE A;  2XPK A;  4LF6 T;  4IE4 A;  2B76 A;  2E5L T;  3V5U A;  3W15 B;  3RIU A;  4HTE A;  3ZMT B;  4B3T T;  2CCQ A;  3MXZ A;  2G0U A;  5LMN T;  4YSY A;  4AKH A;  3DTO A;  3VKG A;  5J2T E;  3AE1 A;  4UVB B;  2LHR A;  4U7Y A;  3ZJ1 A;  1AJ3 A;  3LBX B;  5EZY E;  3AE9 A;  2WP9 A;  5LGU B;  3RKO A;  2HHH T;  4UVC B;  4P1N A;  2JIW A;  3ZC1 A;  3ABV A;  5HXH A;  2AXD S;  3C98 B;  3AEG A;  2XSA A;  5FMN A;  4PK6 A;  2NOX A;  3N5L A;  2YN6 A;  2V7K A;  2EHO B;  3RF1 A;  3K3Q C;  3MK7 C;  2M6B A;  2OLT A;  1XDO A;  4IE0 A;  2LRL A;  2WB5 A;  1FMV A;  4YHH T;  5L2L A;  4QKN A;  2A72 A;  3EHZ A;  4DO0 A;  3FB2 A;  3OBV E;  1CUN A;  1KF6 A;  4X5T A;  3QNU A;  3C64 A;  3AVS A;  2WDR A;  2UXD T;  5C8Y E;  3NVO A;  5AQQ B;  5LG4 A;  5JDG A;  2DWK A;  1XDP A;  5AQR B;  3PUX F;  3FZM B;  2VVN A;  4P0A A;  3D0T A;  3PUV F;  1BR4 A;  2VKD A;  2QGS A;  3RQW A;  2ODV A;  3T1H T;  4YT0 A;  3ESL A;  2J1D G;  2QA7 A;  4AKI A;  2LRK A;  4IHJ E;  2WZH A;  4JYA T;  3PV0 F;  2X0L B;  3I0O A;  3WAK A;  2RA1 A;  5IUX A;  2ZM2 A;  3B13 A;  5HAX A;  5LHH B;  1UUR A;  2BS2 A;  4DND A;  2DLR A;  2KIN B;  2PG8 A;  2WQY A;  4JI6 T;  1NAF A;  4HKA A;  4AKL A;  1E2A A;  4UV8 B;  4GKK T;  3PUS A;  1HX8 A;  4AQY T;  4MHC A;  4IL9 A;  2NR4 A;  2ODU A;  2WBL A;  3AB3 B;  4OX9 T;  4IDO A;  3KV4 A;  3ZT7 A;  2KT9 A;  3PDY A;  4UEL A;  1V9D A;  4QXB B;  3LSV A;  5AQL B;  5JDF A;  2V7J A;  2CRB A;  1D1A A;  4DR7 T;  2LJL A;  2CXL A;  2W61 A;  1KNP A;  2UXB T;  5DAB A;  4TNW A;  2A3D A;  3O1I A;  5H6R B;  2H7V C;  5ABE A;  3C4Z A;  4YSX A;  5EK4 A;  5L4E A;  3QB5 A;  2N9D A;  5CA0 E;  2L9Q A;  2DWG A;  1XMQ T;  1M7K A;  2BKP A;  4A5X A;  3UUM A;  4KHZ F;  2CWY A;  3CX7 B;  3SFD A;  4OYJ A;  5ABF A;  3MA9 A;  3B57 A;  1T7S A;  1FIO A;  1UX5 A;  2XY8 B;  4HFC A;  4XAX B;  2YEV C;  1S94 A;  4HE8 A;  4PK4 A;  3L09 A;  4U2Z A;  2XQ3 A;  2WMO A;  1HX1 B;  5M4Y A;  2W00 A;  3ZN1 B;  1MND A;  3AA1 B;  3I9W A;  1J5E T;  4MBQ A;  2WU5 A;  5HXS A;  2CXD A;  4HEA A;  5LG3 A;  3T8O A;  2IW5 B;  2XQ8 A;  1YQ4 A;  4OHF A;  2XQ7 A;  3KFW X;  3I9Y A;  3DP7 A;  2Y6X A;  4A97 A;  4ADZ A;  3LDQ B;  3TLS A;  1WCR A;  3CVR A;  4EV6 A;  5JTG A;  4DUZ T;  3UU5 A;  2BG9 B;  1OED C;  2PBI A;  4EOZ B;  4YHJ A;  3R84 B;  4ZS2 A;  1OED A;  1M62 A;  3RRC A;  4CI1 B;  3UT5 E;  4WZX A;  4I4T E;  5L4H A;  3U3I A;  2J47 A;  5L47 A;  4EED A;  2XAH B;  1HCI A;  3GN5 A;  4H9Q C;  3ONX A;  2H3R A;  3RX6 A;  4HWH A;  3NZQ A;  4NIQ A;  4K0K T;  3Q9D A;  3KV9 A;  1XZY A;  3VU7 H;  3EDU A;  4ZI7 E;  1HNZ T;  4DR6 T;  3OJA A;  4ZZC A;  3IBP A;  2KWH A;  4LF4 T;  2DHR A;  2CMR A;  4X1K E;  1ZKE A;  2UUA T;  2W66 A;  3ZEF B;  2JQ9 A;  2K9A A;  2V6Y B;  1Z8U A;  5JR9 A;  3AEB A;  5FYM A;  5HCJ A;  3TLV A;  4JI1 T;  5AQS B;  5H6Q B;  1HG5 A;  4WBO A;  5HXE A;  1HFA A;  3PUA A;  5ABF B;  3KVB A;  2I59 A;  5KDM C;  4HFE A;  1IZN B;  3PTR B;  3JC6 D;  2LKH A;  4JEU B;  1JNR A;  5FNV E;  2V7M A;  3QK6 A;  3E22 E;  3L39 A;  1BR1 A;  3UUL A;  3AAI A;  3AAE B;  3O1J A;  3PUG A;  5ABH A;  2VWA A;  4O2B E;  2VKH A;  2VVS A;  4KI0 F;  3CX6 B;  2WAU A;  4UXN B;  1JNZ A;  4PJM A;  2CLY B;  2OV9 A;  3PJA A;  2MAW A;  4U3C A;  1WYB A;  4K0U A;  2IDO B;  2LSJ A;  5CA1 E;  2FBW A;  3I0Q A;  1HNW T;  3CQC B;  5CB4 E;  3QUJ A;  2V5C A;  4IL4 A;  2E9X D;  5J1G A;  3RC8 A;  3ANW B;  4DBQ A;  2JPF A;  5ETW A;  2NP9 A;  2CE7 A;  1VRB A;  3O4X E;  3RYC E;  2EHO C;  4ANJ A;  4KX6 A;  4CZZ B;  2QYW A;  5LHG B;  1YKH B;  1GQE A;  2XM1 A;  4J2C A;  2Y8D A;  2PTF A;  2WWU A;  3PUR A;  3F2E A;  3P4W A;  4JI0 T;  4TWH A;  3UUB A;  2X9X A;  4O4I E;  3J7Y q;  2CBI A;  3OPC A;  1W09 A;  3HKE E;  4PNI A;  4DVD A;  3N9O A;  2H7O A;  4U72 A;  5JDN A;  4DBR A;  2C5I T;  4MAL A;  4JUY A;  2KMF A;  1HG2 A;  2LSI A;  2XQY A;  4HN9 A;  2BZB A;  3O1H A;  2W2U A;  5JR9 B;  5DQW A;  4L9I A;  3AAA B;  2KSR A;  4BAY B;  3KBT A;  2WM9 A;  2CHN A;  1LVF A;  2MYS A;  2WDV A;  2CPT A;  1MMN A;  4EYU A;  5HEJ A;  3OVU A;  4ISS A;  4TWF A;  4QWN B;  4FJO A;  3KBU A;  3ZPO A;  2BVM A;  4TZ4 C;  5AQK B;  2UU9 T;  1QLB A;  4QX7 B;  1FEW A;  2XQ5 A;  2NW9 A;  4GYR A;  3UU3 A;  1FMW A;  3PUZ F;  2V7I A;  5JDL A;  3N9P A;  2CXF A;  4XBF B;  3JC6 C;  2WS3 A;  5AFU L;  3HI2 A;  4PFP A;  4CI2 B;  4FI5 A;  2NWB A;  1BR0 A;  3KV6 A;  1D0Z A;  1E1H B;  4GIW A;  2LHN A;  1D1C A;  4I55 E;  2V5D A;  1XNQ T;  4XZC A;  1HR0 T;  2H89 A;  3FZH B;  2Q9Q B;  4EZH A;  2YU1 A;  4ILC A;  3N9Q A;  2UXX B;  4LF5 T;  2V1D B;  4EB6 E;  3GWH A;  5LB7 B;  2JRK A;  3EVY A;  5LA6 E;  4JI7 T;  3ZYK A;  4GOU A;  2E9X C;  3ZJ2 A;  2MBG A;  3WAJ A;  4LF8 T;  3HKC E;  2E9X A;  1UGO A;  4LML A;  4B3R T;  3CX8 B;  4IST A;  3AE6 A;  3ZKR A;  1IBM T;  4CN1 A;  1WR0 A;  2V8S V;  2IUB A;  4ZZB A;  2WSS V;  5AQG B;  4AIU A;  1XNR T;  2ZM6 T;  3P4P A;  1R8I A;  2IC9 A;  5AQJ B;  3P7I A;  4M1P A;  3VR8 A;  4TNV A;  1NWM X;  2PJQ A;  1KFY A;  2DL1 A;  4DMV A;  3V5S A;  3VR9 A;  2ACZ A;  4I50 E;  1LRZ A;  3UFG A;  5ABG A;  4JI2 T;  4KHP T;  5EK2 A;  3BQL A;  2VAS A;  4H9S E;  4U31 A;  2X66 A;  3RRW A;  2R6G F;  2X51 A;  2RPA A;  5L3D B;  4QHO A;  2X9H A;  4HWC A;  4NUV A;  4ZI2 C;  1VCT A;  4O4L E;  4WYV A;  1IJ6 A;  3L8R A;  2KZ7 B;  4CQI A;  2XUE A;  1G73 A;  3JCF A;  5HEO A;  4IE6 A;  2UUC T;  4UF0 A;  2I0M A;  3HKB E;  2M6I A;  2M67 A;  4QX8 B;  1N32 T;  4L5G A;  4ZI3 D;  5KX5 E;  4HWD A;  2BVL A;  3ZT6 A;  2OA5 A;  3T1Y T;  4JV5 T;  2FUP A;  3FBL A;  3AEA A;  2HPL A;  1B7T A;  4HFV A;  3NWI A;  2JMK A;  2KXP B;  2L3L A;  3PE0 A;  3S4U A;  3HKD E;  1IJ5 A;  4IDQ A;  1UCU A;  3PUY F;  4DUY T;  2IHR 1;  2XZE A;  5FY1 A;  5ADX L;  2CHO A;  2J62 A;  2XTL A;  4EYY R;  1KNR A;  5GON E;  1OXZ A;  3HL6 A;  3N2O A;  5CFB A;  1KNZ A;  4PJL A;  1QSD A;  5AQU B;  5FVK A;  2LEH A;  1X79 A;  1KEY A;  3MJX A;  5JVD E;  1IBK T;  3AA0 B;  4HGA A;  5L3E B;  3P8C D;  2XSB A;  2D0T A;  3AE7 A;  2EHO D;  1D1B A;  4UV9 B;  3UU4 A;  3SFE A;  2WMN A;  4KP3 C;  4EZ4 A;  3RH3 A;  2QVA A;  1Y64 B;  2CLY C;  3HA4 A;  5L3F B;  4E7S A;  3SRZ A;  4I0U A;  2LSY A;  5FL1 A;  5JRC A;  4JI5 T;  4LFC T;  4IT4 A;  4U7I A;  4QH1 A;  3RC3 A;  2FJE A;  4B3S T;  5IHY A;  2VQE T;  3RPU A;  2RP4 A;  4UEM A;  4TV9 E;  2LT3 A;  4E7Z A;  2KND A;  4V1A v;  3EDV A;  5AQM B;  4DR1 T;  2Y48 B;  2JJ9 A;  1YW0 A;  4LFA T;  3AE8 A;  4NXM T;  2V7L A;  4DV6 T;  1NEN A;  2CA5 A;  2A9U A;  3QOF A;  3SWH A;  2K3W A;  5FY0 A;  4PAG A;  2MPK A;  5LOV E;  4LF9 T;  2XAS B;  2SPC A;  3H37 A;  4YLH A;  2ZLY A;  3GMI A;  4GK5 E;  2BG9 E;  3AVR A;  4IE5 A;  4QH5 A;  3Q5W A;  5JDM A;  2W4X A;  1UX4 A;  4UR9 A;  4EEB A;  3BQI A;  5HWX A;  4ZI3 C;  3C4X A;  4PJJ A;  3TKL B;  5HYA A;  2YKS A;  2LE8 A;  3LK2 B;  4JBW F;  2XM2 A;  3AE2 A;  4DV2 T;  1WFD A;  4TWD A;  1N33 T;  3BK9 A;  2VQF T;  2ZMA A;  3H3M A;  5HWY A;  2WY2 A;  1N36 T;  4NPP A;  4ILU A;  4GKJ T;  3LBX A;  2X67 A;  5AQH B;  4TV8 E;  3F57 A;  2XAG B;  1OWA A;  5JDH A;  3ZC0 A;  5LJN A;  3Q5X A;  3AED A;  4H63 V;  3QB5 K;  1L0V A;  3E0Z A;  4P0B A;  1ZV4 X;  1ZEE A;  3FXD B;  1OED B;  4DR4 T;  3DJB A;  3B5M A;  3A8Y C;  2YU2 A;  3FZF B;  2VL8 A;  4IDN A;  5J2U E;  4CXY A;  4HFB A;  2EHO A;  5AQV B;  2IML A;  2FJD A;  5KXJ A;  3G06 A;  2YIN A;  3RGL A;  5FXW A;  3ZST A;  3GN5 B;  3UQ7 A;  3U78 A;  3FBZ A;  4JI4 T;  4EGW A;  4IGU A;  3CQG B;  5L3B B;  4DMW A;  2VB6 A;  2JMH A;  2BDE A;  3AXJ A;  4P09 A;  2E8I A;  2VK9 A;  2YOE A;  3SOL A;  4X66 T;  1T72 A;  5A1L A;  5L3G B;  4KBM B;  4COF A;  4Q25 A;  3RIF A;  4F8H A;  2IAK A;  3A5X A;  3RHW A;  1WRD A;  3SS1 A;  4DV5 T;  4HWI B;  2XHE B;  1LKX A;  5C2T A;  4O4H E;  4ZI2 D;  4O2A E;  5HEG A;  2X9W A;  3CQX C;  2CWO A;  3OTO T;  2P9B A;  1ZOY A;  2KWI B;  1HTJ F;  3TLT A;  3ZLI A;  4ZS3 A;  5HCM A;  2J4G A;  4BJN A;  1U5P A;  4YY3 T;  2XQA A;  4YSZ A;  3RYI E;  1D0Y A;  5AQF B;  2I6H A;  4CXX A;  2N1G A;  3ZYM A;  4JEH B;  3UFE A;  3RIU C;  2N2N A;  3H3A A;  2C5J A;  2LM2 A;  3N9N A;  2FJB A;  2X9Y A;  3VRB A;  3PU3 A;  2NW7 A;  3OYZ A;  1XWM A;  4CN6 A;  3N2K E;  4ERR A;  1D0X A;  3NRY A;  2K24 A;  2XQ6 A;  5LCY A;  3ZSS A;  2GK9 A;  1CHU A;  2XAF B;  3IA3 A;  2KLQ A;  2F4V T;  3RQU A;  4CN4 A;  3CWZ B;  3O9X A;  4QXH B;  3CPZ A;  5LGT B;  4EAH A;  4DR3 T;  2NTX A;  4AQF C;  5FXZ A;  2IC6 A;  1T8B A;  4EXT A;  4AQF A;  3PUW F;  3UU8 A;  2WZI A;  4QH4 A;  3VRA A;  2LLY A;  3FHN A;  3K1S A;  3E08 A;  2HPJ A;  4PFO A;  2X0Y A;  4X65 T;  4X1Y E;  4G2A A;  3EAM A;  3ZMZ B;  4JI8 T;  4OFZ A;  3LK4 2;  3KV5 A;  2BS4 A;  4YTN A;  2BS3 A;  3AXJ B;  3KVA A;  4H63 H;  1S35 A;  3FZL B;  4AXP A;  1G8X A;  2BBJ A;  3M3Z B;  3ZN0 B;  3J9X 1;  3PJA J;  1E7P A;  1X9B A;  5BR8 T;  2ZM0 A;  5LBM A;  3EAB A;  5FY7 A;  4DV0 T;  3R6N A;  3UQ4 A;  3PUQ A;  4U33 A;  2HN2 A;  5LJM A;  3RLF F;  5LP6 E;  5FL0 A;  4CXW A;  3Q5D A;  2E2A A;  2UXC T;  2QRX A;  3GA8 A;  4X20 E;  3HR0 A;  4ILA A;  2BBH A;  4TN7 B;  4JI3 T;  4G63 A;  1HNX T;  3VHL A;  5TAO A;  2CEA A;  3JAF A;  5EK3 A;  3TLU A;  4H9R C;  4YJ2 E;  3AA7 B;  4BJM A;  4GK0 E;  2XQ4 A;  2LSK A;  2LSG A;  1N34 T;  2BG9 C;  5F8P A;  1LVK A;  4OK0 A;  2ES0 A;  5JH7 E;  1ZP0 A;  3P4S A;  2BG9 A;  3KDS E;  2LOP A;  4TX5 A;  3AA6 B;  2VUR A;  3Q5E A;  3A7M A;  3CK6 A;  4HWF A;  2A2F X;  4ILB A;  2YK0 A;  1W0B A;  5DQV A;  1J5W A;  2AE9 A;  1Z0P A;  3IF8 B;  4AQG A;  4X62 T;  5JRE A;  2D0U A;  2D2S A;  2VKO A;  3ETV A;  5C3J A;  1MMD A;  3CIR A;  5LMU T;  3AE5 A;  2NW8 A;  5LBQ B;  3PU8 A;  2XQ9 A;  3LJC A;  4ZOL E;  1W9R A;  4H9P C;  4DV4 T;  3ZYL A;  2MOZ A;  4LF7 T;  5AQI B;  4UVA B;  1XMO T;  5LYJ E;  1WR6 A;  4IE7 A;  1DU2 A;  2YDS A;  2BKN A;  4HFI A;  2V6Y A;  2E9X B;  2WU2 A;  3C4W A;  2D9D A;  4I43 B;  3UTK A;  2UXN B;  1YQ3 A;  3EI0 A;  4Z91 A;  5KMG P;  5AQP B;  3UUN A;  4JLE A;  3LK3 B;  1ZHC A;  3RKG A;  2K48 A;  3AEC A;  4TUY E;  3OKQ A;  1HF8 A;  4PK5 A;  2DCF A;  5LXT E;  3P50 A;  1W0A A;  2JQQ A;  3RIA A;  5AQT B;  4AKR B;  3RYF E;  3ZMV B;  3ONL C;  3Q2M A;  2ZM8 A;  4DR5 T;  3I1A A;  4ZEY A;  3QC9 A;  3MAC A;  4CI3 B;  5CGM A;  4N78 D;  2E5V A;  5HEH A;  4YJ3 E;  1UK5 A;  2CBJ A;  2ACX A;  5IWA T;  2W63 A;  3ONJ A;  4YXD A;  5FP3 A;  4QXC B;  3ZMS B;  2X68 A;  3N2G E;  5F5W A;  4H9O C;  4PJN A;  1FJG T;  4GYS A;  2BKO A;  3AEE A;  1I6Z A;  5AQO B;  3K8P C;  3CML A;  3ZMU B;  1MIY A;  2CM0 A;  3C51 A;  2K5B B;  2Q9Q D;  4DR2 T;  3TLW A;  4NUU A;  4DV7 T;  1U4Q A;  4C90 A;  1MMA A;  4UIG A;  4U2Y A;  4ZHQ E;  4WBN E;  5F3J A;  5L3C B;  3ZT5 A;  4LFB T;  3AE4 A;  2X0H A;  4AKG A;  2C0S A;  3C50 A;  5HEU A;  5FKY A;  2DI4 A;  2LOS A;  3AEF A;  3ANW A;  2IIU A;  4WW0 A;  3F31 A;  2H88 A;  3FZK B;  4X64 T;  4UF0 B;  5FXV A;  3FXE B;  4Z90 A;  5IYZ E;  2HH7 A;  3EUH A;  1KK7 A;  5HXR A;  4O8S A;  4LMK A;  1SE7 A;  4C91 A;  3MZK B;  2PFV A;  1H7C A;  4B6X A;  3K3O A;  3M65 A;  2MTQ A;  5LGN B;  2YDQ A;  3NZP A;  4O4J E;  3K3N A;  4Z8X A;  3X1D A;  2XAQ B;  2YDR A;  5FVL A;  3ZCJ A;  2JQH A;  3NBX X;  1WLX A;  1YD8 G;  4YFS A;  5JQG E;  3IEE A;  3RYH E;  4LMJ A;  5JR9 C;  1SUM B;  1US7 B;  4X1I E;  4F6R C;  3JAD A;  3L3P A;  2FJA A;  4A98 A;  2WCA A;  3VKH A;  4WNK A;  2D5U A;  4IDP A;  2HN1 A;  1MIV A;  3OYX A;  1WYC A;  5BMV E;  1O3X A;  4BA9 A;  4AIS A;  1YXR A;  3ZCI A;  1SA0 E;  4MFR A;  1Y01 A;  2XJ7 A;  3BQK A;  1HS7 A;  1VOM A;  2W67 A;  1EZ3 A;  1MIW A;  2W0G A;  2WDQ A;  3P4R A;  1YKE B;  3JAE A;  2W62 A;  4MLK A;  4B3M T;  4IIJ E;  1IAP A;  2V26 A;  4IRE A;  5FXX A;  4DV1 T;  2C5K T;  3WI3 A;  5LHI B;  5JRC B;  5J0Z A;  4PW8 A;  2UUB T;  2XAJ B;  4KMC A;  4DV3 T; 
#chains in the Genus database with same CATH homology
 4WZX A;  5LB7 B;  1YXR A;  4CN1 A;  4P1N A;  4NIQ A;  1WR0 A;  2DL1 A;  4CN6 A;  2WY2 A;  2CRB A;  5FVL A;  3ZT5 A;  2V6Y A;  2JQH A;  2CPT A;  1WCR A;  4U7Y A;  5FVK A;  2V6X A;  2A9U A;  2LRL A;  3EAB A;  3ZSS A;  2JQ9 A;  4A5X A;  2K3W A;  3ZST A;  3ZT7 A;  4U3C A;  4ZEY A;  2LRK A;  2MPK A;  1WFD A;  5CGM A;  5CJ5 A;  2W2U A;  4U31 A;  4U2Z A;  4U33 A;  2WWV A;  4CN4 A;  2JQK A;  4U2Y A;  3K1S A;  2XZE A;  3ZT6 A;  4IT4 A;  2RPA A;  2V6Y B;  4U7I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...