4U7IA

Structure of the complex of spartin mit and ist1 mim
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
93
structure length
93
Chain Sequence
EPAEIKIIREAYKKAFLFVNKGLNTDELGQKEEAKNYYKQGIGHLLRGISISSKESEHTGPGWESARQMQQKMKETLQNVRTRLEILEKGLAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Distinct Mechanisms of Recognizing Endosomal Sorting Complex Required for Transport III (ESCRT-III) Protein IST1 by Different Microtubule Interacting and Trafficking (MIT) Domains.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
molecule keywords Spartin
total genus 40
structure length 93
sequence length 93
ec nomenclature
pdb deposition date 2014-07-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.280 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Hypothetical protein 1500032h18. 4u7iA00
2XZEA 2A9UA 4U7IA 2JQHA 4U2YA 5LB7B 3ZT7A 4WZXA 2JQ9A 4U33A 2WY2A 2W2UA 2JQKA 5FVKA 3EABA 5CJ5A 4CN1A 5CGMA 2DL1A 4ZEYA 3ZT5A 2K3WA 3ZT6A 4U3CA 2WWVA 2MPKA 2V6YA 4U2ZA 2V6XA 2LRLA 4IT4A 4CN4A 4NIQA 1YXRA 1WCRA 1WR0A 4U7YA 4U31A 5FVLA 4P1NA 2RPAA 4CN6A 2V6YB 2CPTA 4A5XA 2CRBA 2LRKA 1WFDA 3ZSSA 3K1SA 3ZSTA
chains in the Genus database with same CATH superfamily
2YEVC 2CM0A 1KNZA 3EAMA 4O4IE 3PTRB 2BVLA 4IE0A 5AQRB 1N32T 2CXLA 2LHNA 2MBGA 5AQTB 4ZI3D 4JV5T 2BKNA 2Q9QB 2DLRA 3LBXA 3MK7C 4EV6A 2VQET 2WAUA 2V7LA 3ETVA 3GA8A 4YT0A 5IWAT 3N9OA 3CQXC 4PJLA 5FKYA 5AQMB 3EI0A 4YTPA 4YXDA 1VRBA 3HA4A 3ZJ2A 4YTNA 1XDPA 3Q5DA 2LSGA 1NENA 3ABVA 2V8SV 4CN4A 4LF5T 3CWZB 1ZKEA 4ZS3A 4ZI2C 4ZZCA 4I0UA 1CUNA 4IL9A 4U7YA 2D9DA 3MACA 3AE7A 2E2AA 4DMVA 5C3JA 3FXEB 1HG2A 2NW9A 4ZHQE 5AQOB 2IHR1 1FIOA 4ILCA 2WM9A 4UF0A 2EHOB 4B3TT 2JRKA 4DBRA 1NWMX 4UR9A 1Z8UA 3U3IA 3AB3B 5L3BB 3Q5WA 3E22E 3PJAJ 4Z90A 3N9LA 3ONXA 4DO0A 4LF4T 2WMOA 2XJ7A 4EGWA 3FBZA 3AE2A 2N9DA 3NRYA 3RQUA 3EUHA 3UU3A 1US7B 3RI5A 2H88A 3M3ZB 4ZEYA 3ZMSB 4YTMA 2WWVA 4MBQA 3UULA 3PUAA 2XHEB 4H9SE 1UCUA 1T8BA 2BBJA 3RC8A 3I9YA 3UQ4A 3CVRA 4DR1T 3RYFE 2XQAA 2Y8DA 4DV7T 1KK7A 4X1IE 4H63V 4Q25A 5AQNB 3TLUA 4YSXA 2RPAA 3F2EA 2C0SA 2WQYA 2FUPA 4QXBB 4ZZBA 5CFBA 2XQ8A 2W66A 1ZOYA 3UFEA 3P4SA 5HCMA 3ZSTA 4CZZB 4YJ2E 2IAKA 4YLHA 4JI5T 3LJCA 5HXHA 3AVRA 2A9UA 3N9QA 4CI3B 5FY7A 3HR0A 4B3RT 3LK42 5LB7B 1QUUA 2VURA 3F57A 2UXCT 4ZI2D 2QGSA 3QB5A 3D0TA 4HFIA 4IHJE 5AQJB 3RF1A 2FJEA 3E08A 5HEHA 5HEGA 2N1GA 2LM2A 3ESLA 2IIUA 1UX5A 4PK4A 3AE3A 2WCAA 2QYWA 4U3CA 3RRWA 5GONE 4JI8T 1IJ5A 4H9QC 5BMVE 2ACXA 4X20E 4EOZB 2X66A 3ZPOA 2ZM8A 4U72A 2Q9QA 3UU4A 5ADXL 1YKHB 4X5TA 4TUYE 4MALA 3CX6B 3PUVF 4PJNA 5EK2A 5M4YA 2CBJA 3Q5XA 3RKOA 2IC6A 2X9WA 4TV9E 2NWBA 2OA5A 2ODVA 4EB6E 3PV0F 4GK0E 3H3AA 2J62A 4TWFA 5FXXA 3ZEFB 5ABFA 3CK6A 4QKNA 3ZYMA 2EHOD 2WZIA 3HL6A 4DR3T 4NPPA 2W67A 1N34T 4HKAA 3VHLA 3AVSA 3DJBA 2XSAA 3EVYA 3C51A 4O4LE 2IDOB 3PU3A 1KFYA 4OX9T 1N33T 2LOPA 3ANWA 3P7IA 5LXTE 5JRCB 2YN6A 5FY0A 3AAIA 5CA1E 1MIVA 2V6YA 1MMGA 3FB2A 5HWXA 2FBWA 4IE7A 4AKHA 2BZBA 2CEAA 2Y48B 2BVMA 3RX6A 2XASB 4B6XA 5LHHB 3IBPA 1I6ZA 2VVNA 4GIWA 3KVBA 2E5VA 4KMCA 4ANJA 3RRCA 1G73A 2XY8B 1D0XA 4I55E 4KHZF 2ODUA 5KXJA 4AKLA 3ZKRA 3HKEE 3V5SA 4KP3C 2WU5A 2LT3A 2J47A 3OPCA 5JVDE 4UVAB 5LG3A 2YDSA 1OEDE 2V5CA 1L0VA 2E9XC 1WR6A 3O1JA 5H6RB 3UFGA 1XNQT 2HN2A 2W00A 4NUUA 5IHYA 2VASA 3B5MA 3VR8A 3KFWX 1D1CA 3KBTA 2VVSA 3MXZA 4TN7B 4ADZA 5FVKA 2BKPA 4JUYA 5JTGA 3EABA 4JI4T 1MMNA 2UXBT 2YDQA 5LA6E 3AE4A 3ZT6A 2K3WA 3VKHA 2H89A 2CMRA 3O4XE 2CLYB 1T72A 2NTXA 5DQVA 4DNDA 5J1GA 3FZHB 2V7JA 3PJAA 4IDZA 5AQSB 5F8PA 2LE8A 1WYBA 2XPKA 3ZYKA 4ZI7E 2NW7A 5LP6E 1VOMA 4OK0A 1XZYA 4FI5A 2X9HA 4WNKA 5AQFB 1WFDA 3UQ7A 4DV0T 3T1HT 5KMGP 4DUZT 2A3DA 4HTEA 3X1DA 4NXNT 5AQPB 2CLYC 2XZEA 2RP4A 5AQIB 5HXCA 5LJMA 1LVFA 2L8KA 2WB5A 2YU1A 5A1LA 1VCTA 1M7KA 4ILUA 3NVOA 5FL0A 1I94T 2V26A 1MMDA 3HI2A 4H9NC 2WSSV 5H6QB 2D0UA 4TZ4C 3AAEB 3OTOT 3MKDA 2ZLYA 3PUXF 3PURA 3C64A 4CI1B 4J2CA 1ZV4X 4X64T 2WDQA 1R8IA 1U4QA 2L9QA 4WBOA 5AFUL 2CHOA 2XAFB 4JEUB 4O4JE 5C8YE 2JJ9A 3ANWB 2UUCT 4JI0T 4JBWF 4L0RA 5FYMA 3UT5E 4B3MT 4XBFB 4HEAA 2LKGA 4U31A 3UU6A 5JDGA 3ZCJA 2VKHA 3M65A 1MNEA 4TX5A 3ZC1A 1S94A 3K3QC 2V6YB 2J1DG 2LRKA 2VB6A 3L3PA 1E7PA 3FZMB 2I59A 2ZMAA 2XSBA 1FMVA 4LF7T 3RLFF 4ERRA 4ZOLE 3RYCE 2JMKA 2CCQA 2WS3A 5FXWA 1GQEA 2H3RA 3AEFA 1OEDB 4CXXA 4O4HE 3J9X1 4X1YE 3JAEA 5KDMC 4JYAT 2KSRA 4I43B 3VKGA 2X68A 3AE5A 3L09A 3E0ZA 1O3XA 4HWDA 2DCFA 2DWKA 2OV9A 5LMNT 2ZM0A 3FZLB 4K0KT 1MIYA 3WAKA 5JR9A 4AQYT 1DU2A 3AAAB 3LK2B 1W0AA 1BR4A 3AEGA 3CMLA 3FXDB 2CHNA 3FZKB 3JADA 4ZS2A 5ETWA 4ZI3C 4AQGA 5HXEA 4P0AA 4AI6A 4XAXB 4JI7T 4ISTA 2X67A 2XTLA 4DBQA 4YHHT 4LFBT 4H9OC 3TLTA 3V5UA 2W61A 1HCIA 5L3FB 3LK3B 1W0BA 2UXXB 2SPCA 4B3ST 2CA5A 4IE5A 1XWMA 1J1JA 3ZMTB 3UUNA 4CXWA 3AEBA 3L8RA 4AKIA 1D0YA 3AEEA 2LSIA 4K0UA 3RIAA 3NZQA 3AE6A 3ZT7A 4IE6A 4QH1A 4LMLA 2BBHA 2YINA 3O1IA 5JDHA 3NKZA 3QK6A 1YW0A 4GYRA 4QWNB 1T98A 3NBXX 5AQUB 2DL1A 4JLEA 5JR9B 2KINB 4XZCA 2W0GA 3TLWA 5DJQC 3W15B 1QLBA 3PE0A 1UK5A 3EDVA 2H7VC 1YQ3A 1Z0PA 2LSKA 3AEAA 4IT4A 1BR0A 4QHOA 4OYKA 3UUXB 2Y6XA 4PW8A 2H7OA 4PJJA 3VRBA 4DMWA 3P8CD 3S4UA 4LFCT 1FJGT 3LSVA 5BR8T 4IDPA 3IHRA 4ASKA 5LBQB 5JR9C 4DR6T 2X51A 4HWCA 5E0OA 3PU8A 5ABGA 4O2BE 2WDVA 3UTKA 1XMOT 3B57A 3U78A 2CXDA 3PUQA 1E2AA 1KNRA 1MIWA 2CE7A 2ES0A 2P9BA 5L3GB 5JDFA 1QSDA 4HE8A 4EZHA 5LCYA 1V9DA 2JQKA 3ZJ1A 3PUZF 3ZMVB 2WDRA 1OEDA 5CA0E 2QA7A 2FJBA 4IDOA 2ACZA 2N2NA 2D0TA 4FJOA 3ZYLA 2WMNA 2X0LB 2MPKA 2XAHB 5HXRA 2NOXA 5LJNA 1IBMT 4TWDA 4N78D 4EXTA 4F6RC 4DV5T 3LFMA 1YXRA 1ZEEA 2XQ6A 4NIQA 2JPFA 4O8SA 4PK5A 3NWIA 2BS4A 4AXPA 3NRXA 2LSYA 3QUJA 4EYYR 1IZNB 5HYAA 3PUWF 5AQKB 3I0OA 5LNKA 3K8PC 3ZSSA 1B7TA 3HKCE 3ZC0A 3KVAA 1XMQT 3KV9A 4PFPA 5HXSA 2NR4A 1W9RA 3O1HA 3A7MA 3BK9A 4UEMA 4WZXA 5C2TA 4DR5T 4HWFA 5JH7E 1WLXA 4UF0B 5HEJA 2IUBA 3T1YT 1IJ6A 2VK9A 3EHZA 3OKQA 3RIUA 1Y01A 3LBXB 5FMNA 2X0YA 2JMHA 4HFVA 3OYXA 5HCJA 4U2ZA 4TWHA 4WW0A 3VRAA 4DV1T 2WU2A 2YU2A 4PNIA 4IREA 2ZM6T 1BR1A 3C50A 3C4XA 3N2GE 1HNWT 2W4XA 2C5JA 2L3LA 3AXJA 5LHIB 5JREA 2XM1A 1MNDA 4CN6A 4CXYA 4BA9A 1UX4A 3HKBE 4GYSA 2CWYA 4YY3T 2XUEA 4YSYA 5L3DB 2HH7A 4X65T 3KV4A 3ZLIA 2UUBT 4GK5E 3MA9A 3JCFA 3ETUA 5J2TE 3JAFA 3MJXA 2B76A 4BAYB 2HPLA 4QH5A 1MMAA 5FXVA 5LHGB 3AECA 3H37A 4LF8T 4A97A 4YSZA 4DV3T 1HX8A 4IDQA 1VCSA 3OVUA 2QVAA 4YFSA 2FJDA 2K5BB 4BJNA 5CJ5A 1HFAA 1M62A 2YOEA 1UUSA 5FY1A 2NTYA 2Q9QD 1HG5A 3AXJB 5DQWA 2E5LT 1HTJF 1SUMB 2UXNB 3SFDA 1H7CA 3R6NA 2LKHA 4UIGA 5EZYE 5AQLB 1YKEB 2E9XD 1E1HB 3C98B 2KNDA 3B13A 2DHRA 4QX7B 3SRZA 1WR0A 2PFVA 3CQCB 1D0ZA 2E8IA 3R84B 3UU5A 4AQFA 4HWHA 4MFRA 3BQKA 5AQGB 4BJMA 5J2UE 2WP9A 1JNRA 1UURA 3AE8A 5IYZE 2CRBA 3P4WA 3VR9A 4A5XA 5LGNB 4DR4T 2K24A 5ABEA 5LGTB 4EYUA 2BDEA 5TAOA 2D5UA 5J0ZA 1WRDA 4DIDB 2M6IA 4P09A 1JNZA 3GWHA 4H9RC 1ZP0A 1EZ3A 3G06A 3QC9A 1HNZT 5EK3A 3I0QA 3OYZA 4WYVA 1U5PA 5HAXA 4DVDA 2K9AA 3A8YC 4OHFA 5HWYA 3RHWA 3SFEA 3Q9DA 4CN1A 1G8XA 2YK0A 3A5XA 2W63A 1HS7A 1KEYA 4TNVA 4QXCB 3RIFA 3RQWA 3ZN0B 3ZMUB 5IUXA 2VQFT 3QNUA 4LF9T 4QH4A 4ZXLA 2HPJA 2EHOC 2B1EA 2KZ7B 1BR2A 2V7IA 2XAQB 2MTQA 3CX7B 4OYJA 1HF8A 2KMFA 3CQGB 3NZPA 3FHNA 1OEDC 3RYIE 4JI6T 2LM9A 2PJQA 3UUBA 2LHRA 3CX8B 5FVLA 5DABA 3AA7B 4DR2T 1IBKT 4KUMB 4E7SA 2VL0A 4ISSA 3DP7A 2V5DA 3LG7A 4MHCA 4Z91A 3RGLA 3RH3A 3J7Yq 2RA1A 4IIJE 1SHZC 4JI3T 4LF6T 2GK9A 4TNWA 2VKOA 4NUVA 3IEEA 2DWGA 2XAGB 3OBVE 3Q5EA 2KWHA 4CQIA 1UGOA 4Z8XA 4EEBA 3WAJA 2UU9T 4AQFC 3IF8B 4KHPT 1YD8G 4PK6A 5F5WA 2JIWA 3AEDA 3RYHE 3ZMZB 2BG9A 4UV9B 4A56A 1HX1B 3AE1A 5ABFB 4MLKA 2IW5B 2VWAA 2FJAA 4QX8B 5FP3A 2E9XA 3C4WA 2XQ4A 4UVBB 5LYJE 1LVKA 3GN5B 4DR7T 1OWAA 3N9MA 4IE4A 4LMKA 1X79A 2XQ5A 2PBIA 4L5GA 2IC9A 3KV6A 5ABHA 4DV4T 2I6HA 3KINB 4L9IA 2BS2A 3VU7H 5LMUT 2KT9A 1AJ3A 2A72A 3UU8A 4PAGA 3T8OA 4X66T 3I1AA 5F3JA 5FL1A 1KNPA 1WCRA 2AXDS 4P0BA 5L3EB 5LGUB 4X62T 4HGAA 4P1NA 5JDQA 1XNRT 3OJAA 5FNVE 4WBNE 2VKJA 3F31A 2BG9E 4E7ZA 4IL4A 4DV6T 3KDSE 3N5LA 5L4HA 3KV5A 3N2KE 5JDNA 3K3NA 5EK4A 4C91A 5LBMA 4IDNA 2KWIB 4EAHA 2LOSA 4C90A 2XQYA 2WZHA 3ONJA 2V7KA 3C4ZA 2JQHA 2XAJB 2CWOA 3N9PA 4LMJA 4YJ3E 3CIRA 2ZM2A 2V7MA 3CKDA 1HNXT 4TV8E 1NAFA 2KLQA 3L39A 4COFA 2KXPB 4HN9A 2C5IT 2J4GA 3BQLA 2VL8A 1SE7A 3AE9A 3P4RA 3JC6D 3P4PA 4PJMA 4HFHA 3DTOA 2X9XA 5AQVB 3RC3A 3SOLA 5JQGE 1LRZA 2LLYA 4CI2B 2V6XA 1T7SA 3N9NA 2DI4A 1CHUA 3QB5K 4HFEA 1OXZA 3ZN1B 2QRXA 1HR0T 3P50A 4AKGA 4DUYT 2BG9C 3PDYA 2WBLA 2NW8A 3K3OA 4JI2T 4HFDA 4I4TE 4JEHB 1D1AA 1WYCA 3JC6C 3O9XA 3GMIA 5L4EA 4F8HA 4UXNB 2WWUA 5AQQB 3SWHA 2XQ9A 4KI0F 4ILBA 2LSJA 1D1BA 4U7IA 4U2YA 4UELA 4EIWA 2G0UA 2R6GF 1S35A 2VKDA 4OFZA 5LG4A 2JQ9A 2M6BA 2BS3A 2WY2A 4PFOA 1XDOA 2AE9A 4U33A 4AIUA 1IBLT 2CBIA 2BG9B 2W62A 2PG8A 4HFBA 3ZT5A 4M1PA 5JRCA 1N36T 2XM2A 1Y64B 4A98A 3H3MA 3AA6B 1FMWA 2X9YA 5JDLA 2NP9A 3BQIA 3SS1A 1W09A 5FXZA 2UXDT 2E9XB 1J5WA 1X9BA 2LRLA 2MOZA 3GN5A 3Q2MA 4AKRB 1NEKA 3PUYF 4G63A 2CXFA 2IMLA 3AA0B 4IGUA 5HEUA 3LDQB 3TLVA 4AISA 1J5ET 2EHOA 4NXMT 3WI3A 2CPTA 3MZKB 4DV2T 4HWIB 2XQ3A 4GKJT 4V1Av 3QOFA 4GKKT 2LJLA 2C5KT 2HHHT 3K1SA 4UV8B 4QXHB 2I0MA 3FZFB 4LFAT 1FEWA 2V1DB 3IA3A 1ZHCA 4G2AA 5LOVE 4ILAA 2A2FX 3I9WA 3EDUA 3PUGA 4EEDA 2M67A 2LEHA 2YDRA 1KF6A 3TLSA 5L47A 3HKDE 2W2UA 4H9PC 5KX5E 4HFCA 2K48A 2BKOA 2XQ7A 3UUMA 4I50E 5CGMA 3CPZA 2X0HA 4YHJA 1IAPA 2D2SA 2JQQA 1YQ4A 3KBUA 4X1KE 5HEOA 4EZ4A 2UUAT 2F4VT 3PUSA 3AA1B 3N2OA 4KX6A 4KBMB 5JDMA 4H63H 3P4QA 4O2AE 5L3CB 2Z6EA 3RIUC 2YKSA 3RKGA 3FBLA 2Q9QC 3TKLB 2DNXA 3RPUA 5AQHB 3ONLC 3ZCIA 1SA0E 4GOUA 2OLTA 4UVCB 2HN1A 2MYSA 5L2LA 4JI1T 2PTFA 4U74A 2MAWA 1LKXA 5CB4E
chains in the Genus database with same CATH topology
2XZEA 2A9UA 4U7IA 2JQHA 4U2YA 5LB7B 3ZT7A 4WZXA 2JQ9A 4U33A 2WY2A 2W2UA 2JQKA 5FVKA 3EABA 5CJ5A 4CN1A 5CGMA 2DL1A 4ZEYA 3ZT5A 2K3WA 3ZT6A 4U3CA 2WWVA 2MPKA 2V6YA 4U2ZA 2V6XA 2LRLA 4IT4A 4CN4A 4NIQA 1YXRA 1WCRA 1WR0A 4U7YA 4U31A 5FVLA 4P1NA 2RPAA 4CN6A 2V6YB 2CPTA 4A5XA 2CRBA 2LRKA 1WFDA 3ZSSA 3K1SA 3ZSTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XZE A;  2A9U A;  4U7I A;  2JQH A;  4U2Y A;  5LB7 B;  3ZT7 A;  4WZX A;  2JQ9 A;  4U33 A;  2WY2 A;  2W2U A;  2JQK A;  5FVK A;  3EAB A;  5CJ5 A;  4CN1 A;  5CGM A;  2DL1 A;  4ZEY A;  3ZT5 A;  2K3W A;  3ZT6 A;  4U3C A;  2WWV A;  2MPK A;  2V6Y A;  4U2Z A;  2V6X A;  2LRL A;  4IT4 A;  4CN4 A;  4NIQ A;  1YXR A;  1WCR A;  1WR0 A;  4U7Y A;  4U31 A;  5FVL A;  4P1N A;  2RPA A;  4CN6 A;  2V6Y B;  2CPT A;  4A5X A;  2CRB A;  2LRK A;  1WFD A;  3ZSS A;  3K1S A;  3ZST A; 
#chains in the Genus database with same CATH topology
 2YEV C;  2CM0 A;  1KNZ A;  3EAM A;  4O4I E;  3PTR B;  2BVL A;  4IE0 A;  5AQR B;  1N32 T;  2CXL A;  2LHN A;  2MBG A;  5AQT B;  4ZI3 D;  4JV5 T;  2BKN A;  2Q9Q B;  2DLR A;  3LBX A;  3MK7 C;  4EV6 A;  2VQE T;  2WAU A;  2V7L A;  3ETV A;  3GA8 A;  4YT0 A;  5IWA T;  3N9O A;  3CQX C;  4PJL A;  5FKY A;  5AQM B;  3EI0 A;  4YTP A;  4YXD A;  1VRB A;  3HA4 A;  3ZJ2 A;  4YTN A;  1XDP A;  3Q5D A;  2LSG A;  1NEN A;  3ABV A;  2V8S V;  4CN4 A;  4LF5 T;  3CWZ B;  1ZKE A;  4ZS3 A;  4ZI2 C;  4ZZC A;  4I0U A;  1CUN A;  4IL9 A;  4U7Y A;  2D9D A;  3MAC A;  3AE7 A;  2E2A A;  4DMV A;  5C3J A;  3FXE B;  1HG2 A;  2NW9 A;  4ZHQ E;  5AQO B;  2IHR 1;  1FIO A;  4ILC A;  2WM9 A;  4UF0 A;  2EHO B;  4B3T T;  2JRK A;  4DBR A;  1NWM X;  4UR9 A;  1Z8U A;  3U3I A;  3AB3 B;  5L3B B;  3Q5W A;  3E22 E;  3PJA J;  4Z90 A;  3N9L A;  3ONX A;  4DO0 A;  4LF4 T;  2WMO A;  2XJ7 A;  4EGW A;  3FBZ A;  3AE2 A;  2N9D A;  3NRY A;  3RQU A;  3EUH A;  3UU3 A;  1US7 B;  3RI5 A;  2H88 A;  3M3Z B;  4ZEY A;  3ZMS B;  4YTM A;  2WWV A;  4MBQ A;  3UUL A;  3PUA A;  2XHE B;  4H9S E;  1UCU A;  1T8B A;  2BBJ A;  3RC8 A;  3I9Y A;  3UQ4 A;  3CVR A;  4DR1 T;  3RYF E;  2XQA A;  2Y8D A;  4DV7 T;  1KK7 A;  4X1I E;  4H63 V;  4Q25 A;  5AQN B;  3TLU A;  4YSX A;  2RPA A;  3F2E A;  2C0S A;  2WQY A;  2FUP A;  4QXB B;  4ZZB A;  5CFB A;  2XQ8 A;  2W66 A;  1ZOY A;  3UFE A;  3P4S A;  5HCM A;  3ZST A;  4CZZ B;  4YJ2 E;  2IAK A;  4YLH A;  4JI5 T;  3LJC A;  5HXH A;  3AVR A;  2A9U A;  3N9Q A;  4CI3 B;  5FY7 A;  3HR0 A;  4B3R T;  3LK4 2;  5LB7 B;  1QUU A;  2VUR A;  3F57 A;  2UXC T;  4ZI2 D;  2QGS A;  3QB5 A;  3D0T A;  4HFI A;  4IHJ E;  5AQJ B;  3RF1 A;  2FJE A;  3E08 A;  5HEH A;  5HEG A;  2N1G A;  2LM2 A;  3ESL A;  2IIU A;  1UX5 A;  4PK4 A;  3AE3 A;  2WCA A;  2QYW A;  4U3C A;  3RRW A;  5GON E;  4JI8 T;  1IJ5 A;  4H9Q C;  5BMV E;  2ACX A;  4X20 E;  4EOZ B;  2X66 A;  3ZPO A;  2ZM8 A;  4U72 A;  2Q9Q A;  3UU4 A;  5ADX L;  1YKH B;  4X5T A;  4TUY E;  4MAL A;  3CX6 B;  3PUV F;  4PJN A;  5EK2 A;  5M4Y A;  2CBJ A;  3Q5X A;  3RKO A;  2IC6 A;  2X9W A;  4TV9 E;  2NWB A;  2OA5 A;  2ODV A;  4EB6 E;  3PV0 F;  4GK0 E;  3H3A A;  2J62 A;  4TWF A;  5FXX A;  3ZEF B;  5ABF A;  3CK6 A;  4QKN A;  3ZYM A;  2EHO D;  2WZI A;  3HL6 A;  4DR3 T;  4NPP A;  2W67 A;  1N34 T;  4HKA A;  3VHL A;  3AVS A;  3DJB A;  2XSA A;  3EVY A;  3C51 A;  4O4L E;  2IDO B;  3PU3 A;  1KFY A;  4OX9 T;  1N33 T;  2LOP A;  3ANW A;  3P7I A;  5LXT E;  5JRC B;  2YN6 A;  5FY0 A;  3AAI A;  5CA1 E;  1MIV A;  2V6Y A;  1MMG A;  3FB2 A;  5HWX A;  2FBW A;  4IE7 A;  4AKH A;  2BZB A;  2CEA A;  2Y48 B;  2BVM A;  3RX6 A;  2XAS B;  4B6X A;  5LHH B;  3IBP A;  1I6Z A;  2VVN A;  4GIW A;  3KVB A;  2E5V A;  4KMC A;  4ANJ A;  3RRC A;  1G73 A;  2XY8 B;  1D0X A;  4I55 E;  4KHZ F;  2ODU A;  5KXJ A;  4AKL A;  3ZKR A;  3HKE E;  3V5S A;  4KP3 C;  2WU5 A;  2LT3 A;  2J47 A;  3OPC A;  5JVD E;  4UVA B;  5LG3 A;  2YDS A;  1OED E;  2V5C A;  1L0V A;  2E9X C;  1WR6 A;  3O1J A;  5H6R B;  3UFG A;  1XNQ T;  2HN2 A;  2W00 A;  4NUU A;  5IHY A;  2VAS A;  3B5M A;  3VR8 A;  3KFW X;  1D1C A;  3KBT A;  2VVS A;  3MXZ A;  4TN7 B;  4ADZ A;  5FVK A;  2BKP A;  4JUY A;  5JTG A;  3EAB A;  4JI4 T;  1MMN A;  2UXB T;  2YDQ A;  5LA6 E;  3AE4 A;  3ZT6 A;  2K3W A;  3VKH A;  2H89 A;  2CMR A;  3O4X E;  2CLY B;  1T72 A;  2NTX A;  5DQV A;  4DND A;  5J1G A;  3FZH B;  2V7J A;  3PJA A;  4IDZ A;  5AQS B;  5F8P A;  2LE8 A;  1WYB A;  2XPK A;  3ZYK A;  4ZI7 E;  2NW7 A;  5LP6 E;  1VOM A;  4OK0 A;  1XZY A;  4FI5 A;  2X9H A;  4WNK A;  5AQF B;  1WFD A;  3UQ7 A;  4DV0 T;  3T1H T;  5KMG P;  4DUZ T;  2A3D A;  4HTE A;  3X1D A;  4NXN T;  5AQP B;  2CLY C;  2XZE A;  2RP4 A;  5AQI B;  5HXC A;  5LJM A;  1LVF A;  2L8K A;  2WB5 A;  2YU1 A;  5A1L A;  1VCT A;  1M7K A;  4ILU A;  3NVO A;  5FL0 A;  1I94 T;  2V26 A;  1MMD A;  3HI2 A;  4H9N C;  2WSS V;  5H6Q B;  2D0U A;  4TZ4 C;  3AAE B;  3OTO T;  3MKD A;  2ZLY A;  3PUX F;  3PUR A;  3C64 A;  4CI1 B;  4J2C A;  1ZV4 X;  4X64 T;  2WDQ A;  1R8I A;  1U4Q A;  2L9Q A;  4WBO A;  5AFU L;  2CHO A;  2XAF B;  4JEU B;  4O4J E;  5C8Y E;  2JJ9 A;  3ANW B;  2UUC T;  4JI0 T;  4JBW F;  4L0R A;  5FYM A;  3UT5 E;  4B3M T;  4XBF B;  4HEA A;  2LKG A;  4U31 A;  3UU6 A;  5JDG A;  3ZCJ A;  2VKH A;  3M65 A;  1MNE A;  4TX5 A;  3ZC1 A;  1S94 A;  3K3Q C;  2V6Y B;  2J1D G;  2LRK A;  2VB6 A;  3L3P A;  1E7P A;  3FZM B;  2I59 A;  2ZMA A;  2XSB A;  1FMV A;  4LF7 T;  3RLF F;  4ERR A;  4ZOL E;  3RYC E;  2JMK A;  2CCQ A;  2WS3 A;  5FXW A;  1GQE A;  2H3R A;  3AEF A;  1OED B;  4CXX A;  4O4H E;  3J9X 1;  4X1Y E;  3JAE A;  5KDM C;  4JYA T;  2KSR A;  4I43 B;  3VKG A;  2X68 A;  3AE5 A;  3L09 A;  3E0Z A;  1O3X A;  4HWD A;  2DCF A;  2DWK A;  2OV9 A;  5LMN T;  2ZM0 A;  3FZL B;  4K0K T;  1MIY A;  3WAK A;  5JR9 A;  4AQY T;  1DU2 A;  3AAA B;  3LK2 B;  1W0A A;  1BR4 A;  3AEG A;  3CML A;  3FXD B;  2CHN A;  3FZK B;  3JAD A;  4ZS2 A;  5ETW A;  4ZI3 C;  4AQG A;  5HXE A;  4P0A A;  4AI6 A;  4XAX B;  4JI7 T;  4IST A;  2X67 A;  2XTL A;  4DBQ A;  4YHH T;  4LFB T;  4H9O C;  3TLT A;  3V5U A;  2W61 A;  1HCI A;  5L3F B;  3LK3 B;  1W0B A;  2UXX B;  2SPC A;  4B3S T;  2CA5 A;  4IE5 A;  1XWM A;  1J1J A;  3ZMT B;  3UUN A;  4CXW A;  3AEB A;  3L8R A;  4AKI A;  1D0Y A;  3AEE A;  2LSI A;  4K0U A;  3RIA A;  3NZQ A;  3AE6 A;  3ZT7 A;  4IE6 A;  4QH1 A;  4LML A;  2BBH A;  2YIN A;  3O1I A;  5JDH A;  3NKZ A;  3QK6 A;  1YW0 A;  4GYR A;  4QWN B;  1T98 A;  3NBX X;  5AQU B;  2DL1 A;  4JLE A;  5JR9 B;  2KIN B;  4XZC A;  2W0G A;  3TLW A;  5DJQ C;  3W15 B;  1QLB A;  3PE0 A;  1UK5 A;  3EDV A;  2H7V C;  1YQ3 A;  1Z0P A;  2LSK A;  3AEA A;  4IT4 A;  1BR0 A;  4QHO A;  4OYK A;  3UUX B;  2Y6X A;  4PW8 A;  2H7O A;  4PJJ A;  3VRB A;  4DMW A;  3P8C D;  3S4U A;  4LFC T;  1FJG T;  3LSV A;  5BR8 T;  4IDP A;  3IHR A;  4ASK A;  5LBQ B;  5JR9 C;  4DR6 T;  2X51 A;  4HWC A;  5E0O A;  3PU8 A;  5ABG A;  4O2B E;  2WDV A;  3UTK A;  1XMO T;  3B57 A;  3U78 A;  2CXD A;  3PUQ A;  1E2A A;  1KNR A;  1MIW A;  2CE7 A;  2ES0 A;  2P9B A;  5L3G B;  5JDF A;  1QSD A;  4HE8 A;  4EZH A;  5LCY A;  1V9D A;  2JQK A;  3ZJ1 A;  3PUZ F;  3ZMV B;  2WDR A;  1OED A;  5CA0 E;  2QA7 A;  2FJB A;  4IDO A;  2ACZ A;  2N2N A;  2D0T A;  4FJO A;  3ZYL A;  2WMN A;  2X0L B;  2MPK A;  2XAH B;  5HXR A;  2NOX A;  5LJN A;  1IBM T;  4TWD A;  4N78 D;  4EXT A;  4F6R C;  4DV5 T;  3LFM A;  1YXR A;  1ZEE A;  2XQ6 A;  4NIQ A;  2JPF A;  4O8S A;  4PK5 A;  3NWI A;  2BS4 A;  4AXP A;  3NRX A;  2LSY A;  3QUJ A;  4EYY R;  1IZN B;  5HYA A;  3PUW F;  5AQK B;  3I0O A;  5LNK A;  3K8P C;  3ZSS A;  1B7T A;  3HKC E;  3ZC0 A;  3KVA A;  1XMQ T;  3KV9 A;  4PFP A;  5HXS A;  2NR4 A;  1W9R A;  3O1H A;  3A7M A;  3BK9 A;  4UEM A;  4WZX A;  5C2T A;  4DR5 T;  4HWF A;  5JH7 E;  1WLX A;  4UF0 B;  5HEJ A;  2IUB A;  3T1Y T;  1IJ6 A;  2VK9 A;  3EHZ A;  3OKQ A;  3RIU A;  1Y01 A;  3LBX B;  5FMN A;  2X0Y A;  2JMH A;  4HFV A;  3OYX A;  5HCJ A;  4U2Z A;  4TWH A;  4WW0 A;  3VRA A;  4DV1 T;  2WU2 A;  2YU2 A;  4PNI A;  4IRE A;  2ZM6 T;  1BR1 A;  3C50 A;  3C4X A;  3N2G E;  1HNW T;  2W4X A;  2C5J A;  2L3L A;  3AXJ A;  5LHI B;  5JRE A;  2XM1 A;  1MND A;  4CN6 A;  4CXY A;  4BA9 A;  1UX4 A;  3HKB E;  4GYS A;  2CWY A;  4YY3 T;  2XUE A;  4YSY A;  5L3D B;  2HH7 A;  4X65 T;  3KV4 A;  3ZLI A;  2UUB T;  4GK5 E;  3MA9 A;  3JCF A;  3ETU A;  5J2T E;  3JAF A;  3MJX A;  2B76 A;  4BAY B;  2HPL A;  4QH5 A;  1MMA A;  5FXV A;  5LHG B;  3AEC A;  3H37 A;  4LF8 T;  4A97 A;  4YSZ A;  4DV3 T;  1HX8 A;  4IDQ A;  1VCS A;  3OVU A;  2QVA A;  4YFS A;  2FJD A;  2K5B B;  4BJN A;  5CJ5 A;  1HFA A;  1M62 A;  2YOE A;  1UUS A;  5FY1 A;  2NTY A;  2Q9Q D;  1HG5 A;  3AXJ B;  5DQW A;  2E5L T;  1HTJ F;  1SUM B;  2UXN B;  3SFD A;  1H7C A;  3R6N A;  2LKH A;  4UIG A;  5EZY E;  5AQL B;  1YKE B;  2E9X D;  1E1H B;  3C98 B;  2KND A;  3B13 A;  2DHR A;  4QX7 B;  3SRZ A;  1WR0 A;  2PFV A;  3CQC B;  1D0Z A;  2E8I A;  3R84 B;  3UU5 A;  4AQF A;  4HWH A;  4MFR A;  3BQK A;  5AQG B;  4BJM A;  5J2U E;  2WP9 A;  1JNR A;  1UUR A;  3AE8 A;  5IYZ E;  2CRB A;  3P4W A;  3VR9 A;  4A5X A;  5LGN B;  4DR4 T;  2K24 A;  5ABE A;  5LGT B;  4EYU A;  2BDE A;  5TAO A;  2D5U A;  5J0Z A;  1WRD A;  4DID B;  2M6I A;  4P09 A;  1JNZ A;  3GWH A;  4H9R C;  1ZP0 A;  1EZ3 A;  3G06 A;  3QC9 A;  1HNZ T;  5EK3 A;  3I0Q A;  3OYZ A;  4WYV A;  1U5P A;  5HAX A;  4DVD A;  2K9A A;  3A8Y C;  4OHF A;  5HWY A;  3RHW A;  3SFE A;  3Q9D A;  4CN1 A;  1G8X A;  2YK0 A;  3A5X A;  2W63 A;  1HS7 A;  1KEY A;  4TNV A;  4QXC B;  3RIF A;  3RQW A;  3ZN0 B;  3ZMU B;  5IUX A;  2VQF T;  3QNU A;  4LF9 T;  4QH4 A;  4ZXL A;  2HPJ A;  2EHO C;  2B1E A;  2KZ7 B;  1BR2 A;  2V7I A;  2XAQ B;  2MTQ A;  3CX7 B;  4OYJ A;  1HF8 A;  2KMF A;  3CQG B;  3NZP A;  3FHN A;  1OED C;  3RYI E;  4JI6 T;  2LM9 A;  2PJQ A;  3UUB A;  2LHR A;  3CX8 B;  5FVL A;  5DAB A;  3AA7 B;  4DR2 T;  1IBK T;  4KUM B;  4E7S A;  2VL0 A;  4ISS A;  3DP7 A;  2V5D A;  3LG7 A;  4MHC A;  4Z91 A;  3RGL A;  3RH3 A;  3J7Y q;  2RA1 A;  4IIJ E;  1SHZ C;  4JI3 T;  4LF6 T;  2GK9 A;  4TNW A;  2VKO A;  4NUV A;  3IEE A;  2DWG A;  2XAG B;  3OBV E;  3Q5E A;  2KWH A;  4CQI A;  1UGO A;  4Z8X A;  4EEB A;  3WAJ A;  2UU9 T;  4AQF C;  3IF8 B;  4KHP T;  1YD8 G;  4PK6 A;  5F5W A;  2JIW A;  3AED A;  3RYH E;  3ZMZ B;  2BG9 A;  4UV9 B;  4A56 A;  1HX1 B;  3AE1 A;  5ABF B;  4MLK A;  2IW5 B;  2VWA A;  2FJA A;  4QX8 B;  5FP3 A;  2E9X A;  3C4W A;  2XQ4 A;  4UVB B;  5LYJ E;  1LVK A;  3GN5 B;  4DR7 T;  1OWA A;  3N9M A;  4IE4 A;  4LMK A;  1X79 A;  2XQ5 A;  2PBI A;  4L5G A;  2IC9 A;  3KV6 A;  5ABH A;  4DV4 T;  2I6H A;  3KIN B;  4L9I A;  2BS2 A;  3VU7 H;  5LMU T;  2KT9 A;  1AJ3 A;  2A72 A;  3UU8 A;  4PAG A;  3T8O A;  4X66 T;  3I1A A;  5F3J A;  5FL1 A;  1KNP A;  1WCR A;  2AXD S;  4P0B A;  5L3E B;  5LGU B;  4X62 T;  4HGA A;  4P1N A;  5JDQ A;  1XNR T;  3OJA A;  5FNV E;  4WBN E;  2VKJ A;  3F31 A;  2BG9 E;  4E7Z A;  4IL4 A;  4DV6 T;  3KDS E;  3N5L A;  5L4H A;  3KV5 A;  3N2K E;  5JDN A;  3K3N A;  5EK4 A;  4C91 A;  5LBM A;  4IDN A;  2KWI B;  4EAH A;  2LOS A;  4C90 A;  2XQY A;  2WZH A;  3ONJ A;  2V7K A;  3C4Z A;  2JQH A;  2XAJ B;  2CWO A;  3N9P A;  4LMJ A;  4YJ3 E;  3CIR A;  2ZM2 A;  2V7M A;  3CKD A;  1HNX T;  4TV8 E;  1NAF A;  2KLQ A;  3L39 A;  4COF A;  2KXP B;  4HN9 A;  2C5I T;  2J4G A;  3BQL A;  2VL8 A;  1SE7 A;  3AE9 A;  3P4R A;  3JC6 D;  3P4P A;  4PJM A;  4HFH A;  3DTO A;  2X9X A;  5AQV B;  3RC3 A;  3SOL A;  5JQG E;  1LRZ A;  2LLY A;  4CI2 B;  2V6X A;  1T7S A;  3N9N A;  2DI4 A;  1CHU A;  3QB5 K;  4HFE A;  1OXZ A;  3ZN1 B;  2QRX A;  1HR0 T;  3P50 A;  4AKG A;  4DUY T;  2BG9 C;  3PDY A;  2WBL A;  2NW8 A;  3K3O A;  4JI2 T;  4HFD A;  4I4T E;  4JEH B;  1D1A A;  1WYC A;  3JC6 C;  3O9X A;  3GMI A;  5L4E A;  4F8H A;  4UXN B;  2WWU A;  5AQQ B;  3SWH A;  2XQ9 A;  4KI0 F;  4ILB A;  2LSJ A;  1D1B A;  4U7I A;  4U2Y A;  4UEL A;  4EIW A;  2G0U A;  2R6G F;  1S35 A;  2VKD A;  4OFZ A;  5LG4 A;  2JQ9 A;  2M6B A;  2BS3 A;  2WY2 A;  4PFO A;  1XDO A;  2AE9 A;  4U33 A;  4AIU A;  1IBL T;  2CBI A;  2BG9 B;  2W62 A;  2PG8 A;  4HFB A;  3ZT5 A;  4M1P A;  5JRC A;  1N36 T;  2XM2 A;  1Y64 B;  4A98 A;  3H3M A;  3AA6 B;  1FMW A;  2X9Y A;  5JDL A;  2NP9 A;  3BQI A;  3SS1 A;  1W09 A;  5FXZ A;  2UXD T;  2E9X B;  1J5W A;  1X9B A;  2LRL A;  2MOZ A;  3GN5 A;  3Q2M A;  4AKR B;  1NEK A;  3PUY F;  4G63 A;  2CXF A;  2IML A;  3AA0 B;  4IGU A;  5HEU A;  3LDQ B;  3TLV A;  4AIS A;  1J5E T;  2EHO A;  4NXM T;  3WI3 A;  2CPT A;  3MZK B;  4DV2 T;  4HWI B;  2XQ3 A;  4GKJ T;  4V1A v;  3QOF A;  4GKK T;  2LJL A;  2C5K T;  2HHH T;  3K1S A;  4UV8 B;  4QXH B;  2I0M A;  3FZF B;  4LFA T;  1FEW A;  2V1D B;  3IA3 A;  1ZHC A;  4G2A A;  5LOV E;  4ILA A;  2A2F X;  3I9W A;  3EDU A;  3PUG A;  4EED A;  2M67 A;  2LEH A;  2YDR A;  1KF6 A;  3TLS A;  5L47 A;  3HKD E;  2W2U A;  4H9P C;  5KX5 E;  4HFC A;  2K48 A;  2BKO A;  2XQ7 A;  3UUM A;  4I50 E;  5CGM A;  3CPZ A;  2X0H A;  4YHJ A;  1IAP A;  2D2S A;  2JQQ A;  1YQ4 A;  3KBU A;  4X1K E;  5HEO A;  4EZ4 A;  2UUA T;  2F4V T;  3PUS A;  3AA1 B;  3N2O A;  4KX6 A;  4KBM B;  5JDM A;  4H63 H;  3P4Q A;  4O2A E;  5L3C B;  2Z6E A;  3RIU C;  2YKS A;  3RKG A;  3FBL A;  2Q9Q C;  3TKL B;  2DNX A;  3RPU A;  5AQH B;  3ONL C;  3ZCI A;  1SA0 E;  4GOU A;  2OLT A;  4UVC B;  2HN1 A;  2MYS A;  5L2L A;  4JI1 T;  2PTF A;  4U74 A;  2MAW A;  1LKX A;  5CB4 E; 
#chains in the Genus database with same CATH homology
 2XZE A;  2A9U A;  4U7I A;  2JQH A;  4U2Y A;  5LB7 B;  3ZT7 A;  4WZX A;  2JQ9 A;  4U33 A;  2WY2 A;  2W2U A;  2JQK A;  5FVK A;  3EAB A;  5CJ5 A;  4CN1 A;  5CGM A;  2DL1 A;  4ZEY A;  3ZT5 A;  2K3W A;  3ZT6 A;  4U3C A;  2WWV A;  2MPK A;  2V6Y A;  4U2Z A;  2V6X A;  2LRL A;  4IT4 A;  4CN4 A;  4NIQ A;  1YXR A;  1WCR A;  1WR0 A;  4U7Y A;  4U31 A;  5FVL A;  4P1N A;  2RPA A;  4CN6 A;  2V6Y B;  2CPT A;  4A5X A;  2CRB A;  2LRK A;  1WFD A;  3ZSS A;  3K1S A;  3ZST A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...