4U7IA

Structure of the complex of spartin mit and ist1 mim
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
93
structure length
93
Chain Sequence
EPAEIKIIREAYKKAFLFVNKGLNTDELGQKEEAKNYYKQGIGHLLRGISISSKESEHTGPGWESARQMQQKMKETLQNVRTRLEILEKGLAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein transport
molecule keywords Spartin
publication title Distinct Mechanisms of Recognizing Endosomal Sorting Complex Required for Transport III (ESCRT-III) Protein IST1 by Different Microtubule Interacting and Trafficking (MIT) Domains.
pubmed doi rcsb
source organism Homo sapiens
total genus 40
structure length 93
sequence length 93
ec nomenclature
pdb deposition date 2014-07-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.280 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Hypothetical protein 1500032h18. 4u7iA00
2LRLA 2V6YA 2XZEA 3ZSSA 4IT4A 4U3CA 2MPKA 1WFDA 3ZT6A 2W2UA 1WR0A 2CRBA 3K1SA 2WWVA 2JQKA 2A9UA 4U2ZA 3ZT5A 2V6YB 4CN1A 3ZSTA 5FVLA 4WZXA 2JQ9A 2RPAA 5FVKA 4U7IA 4U33A 5CGMA 4A5XA 4CN6A 2CPTA 2LRKA 4CN4A 4U2YA 2DL1A 4U7YA 4ZEYA 1WCRA 2K3WA 1YXRA 2WY2A 4P1NA 2JQHA 4U31A 3ZT7A 3EABA 4NIQA 5CJ5A 5LB7B 2V6XA
chains in the Genus database with same CATH superfamily
1FEWA 1IZNB 3C4XA 5FKYA 4E7SA 4LF9T 3DTOA 4TN7B 1UX4A 2A9UA 4X62T 4FJOA 5FXWA 3P4RA 1OWAA 4ZXLA 2VL0A 3SFDA 1I6ZA 1YD8G 4TUYE 5HEJA 4QKNA 2PG8A 1HX8A 3KVAA 1WFDA 5HAXA 5HEHA 2BG9B 4AIUA 2FUPA 1D0ZA 2HN1A 3AA7B 2YDQA 3PJAA 2XY8B 1WYCA 5KMGP 4H63H 4TNVA 4AISA 5L3EB 5HCJA 2XSAA 4ZHQE 5AQSB 3IBPA 5E0OA 4XAXB 1W0BA 4GKKT 5LBMA 4DV6T 5JQGE 3BQKA 2PFVA 1LVKA 3CWZB 5JVDE 2CEAA 3AB3B 4K0UA 4WNKA 4EYUA 4ISTA 2WS3A 4MFRA 2IC6A 2AXDS 2Q9QB 3Q5EA 3KBTA 5HEGA 1XZYA 5FP3A 3PUAA 2QA7A 4PJLA 4YSYA 2ODUA 4UVCB 1WCRA 3N9PA 5FY0A 2YU2A 3QB5K 2LM9A 2XM2A 3PU3A 1NWMX 4MBQA 5HWXA 2ZLYA 2H89A 4DR2T 3GMIA 3CVRA 2OV9A 3EDUA 3N2GE 5FVKA 3AE4A 2BVMA 2KLQA 2WQYA 2LRKA 2E9XB 1D1CA 3HKCE 4PAGA 2DHRA 3OJAA 2WP9A 3F31A 3JAEA 3E0ZA 2W00A 2XSBA 4PFPA 1HG5A 4TWDA 3CX6B 1W09A 1HS7A 2RA1A 4O4LE 5H6RB 3VKHA 5HXHA 3RQWA 5HXEA 2EHOD 4EV6A 3RRWA 1E2AA 3HKDE 4ERRA 5LMNT 4IL4A 4U7IA 1WR6A 2CE7A 4LFCT 3RH3A 1IAPA 1KFYA 4KP3C 2XM1A 3W15B 3N9NA 2RP4A 2I6HA 4HN9A 3LBXA 4I0UA 3IF8B 3AA6B 2Y48B 4ZI2C 5JRCA 2FJEA 4H9RC 3PUSA 3CQXC 1E7PA 3N5LA 1S35A 3EVYA 4DIDB 2XQ7A 2DWKA 4YTPA 3BK9A 3AE9A 4U7YA 3P50A 1J5WA 4YSZA 4IE0A 2JMKA 4LF7T 2WB5A 3ZMVB 4K0KT 2HPLA 3ZT6A 4YJ3E 3K1SA 2D5UA 2BS4A 5HXSA 5BR8T 3VU7H 2V7IA 3RYFE 2LKHA 3UFEA 3RC8A 1Z8UA 4ZI3D 4TX5A 3MKDA 2YDSA 3N9OA 4DBQA 4QHOA 2B76A 3ONXA 1QLBA 1XMOT 4NXMT 3QOFA 3UU8A 4PNIA 3LK3B 3OVUA 4ILBA 4HTEA 2C5KT 2D0TA 2NP9A 1HNXT 3PU8A 5CB4E 5AQRB 4O2AE 3P7IA 3ZMSB 4O4JE 5LHIB 3AVRA 5JR9B 1G8XA 2NW7A 2XQ3A 4KX6A 4P0AA 2XQAA 5GONE 2CLYB 4NUUA 3G06A 3MA9A 3N9LA 2VURA 3K3NA 4HKAA 3HI2A 5LOVE 3CK6A 3AE5A 5F5WA 2B1EA 3ZSTA 4GOUA 3NZQA 2UXBT 4LMLA 2E5VA 5KXJA 4IDNA 4AQYT 1MMDA 3A5XA 3N2OA 3OYXA 5LYJE 2VKDA 3I9WA 2JJ9A 2J4GA 1OEDE 2BKNA 4TV9E 4CI1B 1T8BA 4H9QC 2V6YB 4AQGA 4HFEA 4HFVA 4UF0A 4AKLA 5IWAT 4XBFB 3LJCA 5LGNB 2K24A 3IHRA 4ASKA 4OFZA 4QH4A 3VR9A 2Z6EA 4HFDA 4DV0T 1N32T 2M6BA 3AAIA 1Y01A 1CHUA 2IMLA 1SUMB 3HA4A 3GN5A 3JCFA 3C98B 5AQPB 2BKPA 3V5UA 4AKRB 3MJXA 3RKOA 5JDNA 2L9QA 5AQHB 2W63A 2JQQA 4HFCA 2UXDT 3UU3A 1O3XA 3ANWA 4OX9T 4JLEA 3OYZA 2WDRA 1DU2A 3M65A 3L8RA 2W67A 4M1PA 3N9MA 4TWFA 2I59A 2J47A 2YDRA 4IT4A 1UUSA 2L3LA 1ZHCA 2V7MA 4TWHA 5F8PA 1HX1B 2ZM6T 1JNZA 5L3FB 1X9BA 3UUNA 3HR0A 4IE4A 2CXLA 2XQ5A 2XAGB 3ZJ2A 5AQNB 2KINB 3AEEA 3I0QA 2XQ4A 2YOEA 3OPCA 3Q9DA 1OEDC 4NUVA 1S94A 3A8YC 5AQOB 3VKGA 2IAKA 4ZS2A 2FBWA 2LOPA 4U72A 2NW9A 2LRLA 2XZEA 3O1JA 1US7B 1N34T 3P4WA 3FZHB 1HG2A 4JYAT 2CCQA 2LOSA 3PTRB 3UQ4A 2FJDA 2UXXB 4NPPA 2E2AA 4AKHA 3CX8B 2E9XC 4JI2T 2MBGA 1UCUA 3E22E 3CQGB 2G0UA 2EHOB 1ZOYA 5C8YE 5ABFA 3PURA 3PJAJ 2VKJA 4IL9A 2WY2A 4EYYR 2V7JA 4YHHT 1IJ5A 4LF6T 5L47A 2V6XA 4EXTA 1NAFA 4YHJA 2WZHA 3PUYF 4OHFA 3GA8A 4P0BA 1OEDA 3P4QA 1MNEA 3PV0F 1E1HB 2OA5A 3NVOA 2DI4A 2BS2A 5LXTE 1FIOA 2XASB 2Y8DA 5BMVE 3QK6A 4Z8XA 2E8IA 2F4VT 3LSVA 5LCYA 3RKGA 1ZP0A 4UV9B 2W4XA 3AXJB 3H37A 5J0ZA 3MZKB 5EK3A 3OKQA 5FVLA 4I55E 4CI2B 4AXPA 5CA1E 2ACXA 1IBLT 4LF4T 5EK2A 4B3RT 2XJ7A 4P09A 3ZT5A 3KV6A 3RF1A 4DR6T 5AFUL 2FJAA 1UURA 1Z0PA 2SPCA 3KV9A 2C0SA 4KBMB 2DCFA 3EABA 1W0AA 2X9HA 4JBWF 3ZMUB 1KF6A 4HFBA 4MALA 4DV1T 3FXEB 5FY1A 3SOLA 4QH5A 1I94T 3ZLIA 1J1JA 2X68A 5EK4A 1VCSA 4IHJE 1YQ4A 4MLKA 2H7VC 1T7SA 4P1NA 2ES0A 4YT0A 4OYJA 4EIWA 1V9DA 4L5GA 2XQ9A 2CRBA 2H7OA 5HXRA 5L4HA 3FBLA 4BJNA 3BQLA 1BR4A 1IBMT 5J2UE 3TLVA 1HNWT 4IDQA 4GIWA 3AA0B 4U74A 2CBIA 3M3ZB 1N36T 3NRXA 3AEAA 2YU1A 2UUCT 2WZIA 4ZOLE 4TZ4C 2W62A 5AQFB 3CPZA 5L3DB 3AEFA 2UU9T 2QVAA 4TV8E 3BQIA 4DV2T 5FXXA 4YSXA 3UTKA 3PUGA 3O4XE 2X0YA 3PUQA 2DL1A 4JI6T 5KX5E 4YXDA 1OXZA 3ZT7A 4UV8B 4EZ4A 3I1AA 5JH7E 2ODVA 4CXWA 4DMWA 3L39A 3TKLB 4LFAT 3AEGA 3ESLA 3KINB 3ONLC 3TLUA 1BR0A 1YW0A 3ZC1A 1Y64B 1B7TA 2LKGA 2XAHB 2VKHA 4CI3B 4IDZA 4CXXA 4EZHA 4Q25A 5FL1A 5LA6E 1KNRA 3K3QC 2CHNA 3ZYKA 4ILUA 2UXCT 3R84B 3TLSA 2V7LA 4NIQA 4HGAA 4HWHA 3ZEFB 5JTGA 3QB5A 2WMOA 2WCAA 4J2CA 1HR0T 3ZPOA 5DJQC 1MMAA 5M4YA 2VVNA 1M7KA 5AQJB 4X1YE 3U3IA 4JV5T 3KVBA 5FXZA 3VRAA 2WMNA 2XAJB 3MXZA 4B6XA 3H3AA 4V1Av 4LF8T 1HTJF 3JC6D 4A97A 4DUZT 2V1DB 1YKEB 2KMFA 2BS3A 4H63V 5L3CB 2QYWA 4DUYT 3FXDB 2BG9E 1QUUA 3B57A 2D0UA 3EAMA 5CJ5A 4DV7T 2YEVC 4Z90A 3HKBE 3ZC0A 1WR0A 4QH1A 2KWHA 4HFHA 4DBRA 3LFMA 4QWNB 4Z91A 1MMNA 3DJBA 5HCMA 4CN6A 1XNQT 5AQKB 4QX7B 2VVSA 4WBNE 2N1GA 3AEBA 5JDMA 3SS1A 4DV4T 3JAFA 2CA5A 4ANJA 2K5BB 3WI3A 3FB2A 2EHOC 3S4UA 1MIYA 2JMHA 4B3TT 2W66A 4FI5A 2M6IA 2IHR1 1U4QA 2LHNA 2VASA 4XZCA 5LG4A 3AE7A 3FHNA 1FMVA 3UQ7A 1VCTA 3LBXB 4X64T 3X1DA 5JRCB 3SWHA 3QC9A 4ISSA 2JRKA 2CWOA 3VHLA 2LHRA 5LHGB 4QX8B 4X5TA 4EEDA 1HF8A 2LSIA 5DQVA 3LG7A 2C5JA 4O8SA 4H9NC 3PUZF 4AKGA 3CMLA 2KWIB 3J9X1 4AKIA 3ZJ1A 2HHHT 3EHZA 3RIAA 4HEAA 2KNDA 3AECA 1EZ3A 2CXDA 3ZYLA 3UUMA 3QUJA 3SRZA 4KHZF 5FNVE 5JDFA 3AE2A 5CGMA 1VRBA 2H3RA 3N2KE 3EDVA 1MIWA 4X1KE 1UX5A 4I43B 5JDGA 3A7MA 4L0RA 3EI0A 2NR4A 2NTXA 3J7Yq 1D1BA 2DNXA 2BG9C 2KT9A 3K8PC 5J1GA 2M67A 5ETWA 4DR7T 3MACA 2WM9A 5LMUT 3RQUA 2A72A 2WDVA 3JADA 3E08A 2X51A 4ZI3C 2YKSA 1G73A 5JDLA 4JI1T 5FY7A 4DMVA 3R6NA 4BJMA 4JUYA 4A56A 2BKOA 2Q9QC 4KI0F 4ILCA 4DR5T 4DO0A 2X0LB 4WBOA 3F57A 3L3PA 2LM2A 1LKXA 4X1IE 3Q5DA 2KSRA 2BBJA 1CUNA 1UK5A 1M62A 3UUBA 2BG9A 3T1YT 1MMGA 2FJBA 4HWFA 2ZMAA 1U5PA 3ZCJA 4PK6A 2WSSV 3RYIE 4UF0B 5ADXL 4LF5T 2CBJA 1LRZA 2ZM2A 2VQFT 5LNKA 2LSYA 1R8IA 2Q9QA 2XUEA 2R6GF 5C3JA 5ABGA 3ZKRA 4E7ZA 3GN5B 2X66A 2V7KA 1ZEEA 2X9YA 2JQ9A 5AQVB 2ACZA 3TLTA 3ZN1B 2XHEB 3P8CD 3ANWB 4ZZBA 1T98A 1FMWA 3OBVE 3FZLB 5HEOA 2BVLA 2DLRA 3LDQB 2VB6A 3C4ZA 1NEKA 2UUAT 3FBZA 1WYBA 2E9XA 2XTLA 1YKHB 4C91A 2BDEA 2LEHA 2JQHA 3QNUA 2CHOA 4U31A 2KZ7B 3PUVF 3RHWA 2LT3A 4PJJA 5CA0E 4YJ2E 3O1IA 3C51A 4IE7A 1T72A 5J2TE 1JNRA 4A5XA 5F3JA 5HXCA 4PK5A 3FZKB 4GYRA 4UVBB 5LHHB 3MK7C 2N2NA 2VWAA 4UEMA 4IGUA 3RIUC 4ZI7E 3ETUA 2WDQA 1VOMA 5FL0A 4CZZB 4YLHA 4BA9A 2D9DA 4ZI2D 3KFWX 4B3ST 2PJQA 2MTQA 3F2EA 3ZN0B 4YTNA 3VRBA 5LB7B 2MOZA 5L3GB 1KK7A 2WWVA 2VQET 4GYSA 1W9RA 3O1HA 4ZS3A 4X20E 4DVDA 3ETVA 4WW0A 5ABFB 3LK2B 4JI4T 2MAWA 2XAFB 2N9DA 2D2SA 3SFEA 5AQTB 3C4WA 1HNZT 4ILAA 2XQ6A 4EEBA 3B13A 2NOXA 5HYAA 1XMQT 1GQEA 4PW8A 1OEDB 5JR9C 2J62A 4HE8A 4JEUB 3RPUA 2XPKA 4ZEYA 4DNDA 3RIUA 2WBLA 1XNRT 4X65T 2CLYC 2QGSA 1XWMA 4O4HE 4IIJE 2IC9A 2UUBT 4EGWA 1SA0E 4YTMA 4CN1A 3V5SA 4I4TE 2YK0A 3PUXF 2XAQB 1X79A 3Q5XA 4MHCA 1KNZA 3VR8A 1L0VA 3Q2MA 3RI5A 3WAKA 4CQIA 2V5DA 3AEDA 1KEYA 4U3CA 1LVFA 4DR1T 4U2ZA 4QXBB 4KMCA 4EB6E 2WU5A 4UVAB 3I9YA 2K48A 3RC3A 1ZKEA 2VKOA 4JI7T 1XDPA 2J1DG 4QXCB 2GK9A 5L3BB 3AE6A 5JR9A 4I50E 3NRYA 3P4PA 4L9IA 5A1LA 2NW8A 1IBKT 3NKZA 2NTYA 4HFIA 5ABHA 4ADZA 3T1HT 2K3WA 2UXNB 2NWBA 2OLTA 1WRDA 4YY3T 3ZSSA 4HWDA 4C90A 2W61A 4DR4T 4G63A 3RLFF 2YINA 3ZMTB 2HN2A 4X66T 2PBIA 2X9XA 3HKEE 2V6YA 3AAEB 3I0OA 2BZBA 5DQWA 3KV4A 5LJNA 2KXPB 3UT5E 3Q5WA 1XDOA 5TAOA 4U2YA 2X9WA 5FYMA 3AAAB 1ZV4X 5LP6E 3UU6A 5HWYA 3RX6A 4AI6A 5LG3A 3H3MA 5AQUB 2WU2A 3UU4A 2LJLA 4GK5E 5EZYE 2IIUA 3AA1B 2YN6A 3UUXB 2HH7A 5LBQB 3RYCE 3N9QA 2AE9A 3UU5A 3P4SA 2I0MA 1N33T 2LSKA 2Y6XA 4U33A 5AQQB 5L4EA 3AE1A 2V26A 5JREA 2Q9QD 4IDOA 4JEHB 3UULA 4LMKA 4KUMB 2W2UA 4H9PC 3FZFB 3RIFA 5FMNA 2VL8A 1FJGT 4TNWA 4EAHA 2WAUA 2CM0A 1NENA 4QXHB 3AE8A 3CIRA 5FXVA 2A2FX 5AQGB 4PK4A 2V5CA 3L09A 1MNDA 3B5MA 2LSJA 3IA3A 2C5IT 5HEUA 1D0XA 2E9XD 4H9OC 1BR2A 3AVSA 3ZMZB 4DV5T 3C50A 4GK0E 1UGOA 3PE0A 3ZYMA 3RRCA 4OK0A 1D0YA 4UELA 3KV5A 1BR1A 3UFGA 4HWIB 4LMJA 3U78A 3O9XA 3AE3A 2IUBA 3CX7B 4LFBT 4YFSA 4B3MT 5LJMA 2WWUA 3TLWA 2H88A 1WLXA 3NBXX 3RGLA 2EHOA 4OYKA 2QRXA 2PTFA 4O2BE 4PJNA 3NZPA 2JQKA 3CKDA 2DWGA 4IREA 4NXNT 2XQ8A 2X67A 5L2LA 4CN4A 4F8HA 1YXRA 2VK9A 4JI0T 4O4IE 1IJ6A 4JI5T 2P9BA 4DV3T 2JPFA 2LE8A 5KDMC 1J5ET 3C64A 2IW5B 3JC6C 3PUWF 3OTOT 5AQLB 4IE6A 5C2TA 4HWCA 5AQMB 1QSDA 3DP7A 2XQYA 5JDQA 2A3DA 5DABA 2V8SV 3NWIA 4WYVA 2L8KA 3WAJA 4IDPA 3CQCB 4ZZCA 3K3OA 4N78D 4A98A 3AXJA 5CFBA 3ZCIA 1SHZC 1HFAA 2MYSA 4AQFC 1D1AA 4UR9A 5LGTB 2HPJA 2CWYA 5H6QB 5AQIB 2ZM8A 1H7CA 4EOZB 2LLYA 4GKJT 4WZXA 2RPAA 5IUXA 5IHYA 2CMRA 5JDHA 2CXFA 3IEEA 2MPKA 5ABEA 5IYZE 2W0GA 2BBHA 1SE7A 2E5LT 3HL6A 2CPTA 4JI3T 1YQ3A 3EUHA 1MIVA 4IE5A 3ABVA 3PDYA 2ZM0A 2K9AA 4PFOA 4AQFA 3RYHE 4BAYB 2IDOB 3KBUA 4DR3T 3FZMB 1AJ3A 3KDSE 3T8OA 2JIWA 4H9SE 2X0HA 4F6RC 4KHPT 4COFA 4UIGA 4G2AA 4UXNB 2LSGA 3ONJA 4JI8T 4PJMA 1HCIA 5LGUB 3LK42 4CXYA 3GWHA 1KNPA 3D0TA
chains in the Genus database with same CATH topology
2LRLA 2V6YA 2XZEA 3ZSSA 4IT4A 4U3CA 2MPKA 1WFDA 3ZT6A 2W2UA 1WR0A 2CRBA 3K1SA 2WWVA 2JQKA 2A9UA 4U2ZA 3ZT5A 2V6YB 4CN1A 3ZSTA 5FVLA 4WZXA 2JQ9A 2RPAA 5FVKA 4U7IA 4U33A 5CGMA 4A5XA 4CN6A 2CPTA 2LRKA 4CN4A 4U2YA 2DL1A 4U7YA 4ZEYA 1WCRA 2K3WA 1YXRA 2WY2A 4P1NA 2JQHA 4U31A 3ZT7A 3EABA 4NIQA 5CJ5A 5LB7B 2V6XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LRL A;  2V6Y A;  2XZE A;  3ZSS A;  4IT4 A;  4U3C A;  2MPK A;  1WFD A;  3ZT6 A;  2W2U A;  1WR0 A;  2CRB A;  3K1S A;  2WWV A;  2JQK A;  2A9U A;  4U2Z A;  3ZT5 A;  2V6Y B;  4CN1 A;  3ZST A;  5FVL A;  4WZX A;  2JQ9 A;  2RPA A;  5FVK A;  4U7I A;  4U33 A;  5CGM A;  4A5X A;  4CN6 A;  2CPT A;  2LRK A;  4CN4 A;  4U2Y A;  2DL1 A;  4U7Y A;  4ZEY A;  1WCR A;  2K3W A;  1YXR A;  2WY2 A;  4P1N A;  2JQH A;  4U31 A;  3ZT7 A;  3EAB A;  4NIQ A;  5CJ5 A;  5LB7 B;  2V6X A; 
#chains in the Genus database with same CATH topology
 1FEW A;  1IZN B;  3C4X A;  5FKY A;  4E7S A;  4LF9 T;  3DTO A;  4TN7 B;  1UX4 A;  2A9U A;  4X62 T;  4FJO A;  5FXW A;  3P4R A;  1OWA A;  4ZXL A;  2VL0 A;  3SFD A;  1I6Z A;  1YD8 G;  4TUY E;  5HEJ A;  4QKN A;  2PG8 A;  1HX8 A;  3KVA A;  1WFD A;  5HAX A;  5HEH A;  2BG9 B;  4AIU A;  2FUP A;  1D0Z A;  2HN1 A;  3AA7 B;  2YDQ A;  3PJA A;  2XY8 B;  1WYC A;  5KMG P;  4H63 H;  4TNV A;  4AIS A;  5L3E B;  5HCJ A;  2XSA A;  4ZHQ E;  5AQS B;  3IBP A;  5E0O A;  4XAX B;  1W0B A;  4GKK T;  5LBM A;  4DV6 T;  5JQG E;  3BQK A;  2PFV A;  1LVK A;  3CWZ B;  5JVD E;  2CEA A;  3AB3 B;  4K0U A;  4WNK A;  4EYU A;  4IST A;  2WS3 A;  4MFR A;  2IC6 A;  2AXD S;  2Q9Q B;  3Q5E A;  3KBT A;  5HEG A;  1XZY A;  5FP3 A;  3PUA A;  2QA7 A;  4PJL A;  4YSY A;  2ODU A;  4UVC B;  1WCR A;  3N9P A;  5FY0 A;  2YU2 A;  3QB5 K;  2LM9 A;  2XM2 A;  3PU3 A;  1NWM X;  4MBQ A;  5HWX A;  2ZLY A;  2H89 A;  4DR2 T;  3GMI A;  3CVR A;  2OV9 A;  3EDU A;  3N2G E;  5FVK A;  3AE4 A;  2BVM A;  2KLQ A;  2WQY A;  2LRK A;  2E9X B;  1D1C A;  3HKC E;  4PAG A;  2DHR A;  3OJA A;  2WP9 A;  3F31 A;  3JAE A;  3E0Z A;  2W00 A;  2XSB A;  4PFP A;  1HG5 A;  4TWD A;  3CX6 B;  1W09 A;  1HS7 A;  2RA1 A;  4O4L E;  5H6R B;  3VKH A;  5HXH A;  3RQW A;  5HXE A;  2EHO D;  4EV6 A;  3RRW A;  1E2A A;  3HKD E;  4ERR A;  5LMN T;  4IL4 A;  4U7I A;  1WR6 A;  2CE7 A;  4LFC T;  3RH3 A;  1IAP A;  1KFY A;  4KP3 C;  2XM1 A;  3W15 B;  3N9N A;  2RP4 A;  2I6H A;  4HN9 A;  3LBX A;  4I0U A;  3IF8 B;  3AA6 B;  2Y48 B;  4ZI2 C;  5JRC A;  2FJE A;  4H9R C;  3PUS A;  3CQX C;  1E7P A;  3N5L A;  1S35 A;  3EVY A;  4DID B;  2XQ7 A;  2DWK A;  4YTP A;  3BK9 A;  3AE9 A;  4U7Y A;  3P50 A;  1J5W A;  4YSZ A;  4IE0 A;  2JMK A;  4LF7 T;  2WB5 A;  3ZMV B;  4K0K T;  2HPL A;  3ZT6 A;  4YJ3 E;  3K1S A;  2D5U A;  2BS4 A;  5HXS A;  5BR8 T;  3VU7 H;  2V7I A;  3RYF E;  2LKH A;  3UFE A;  3RC8 A;  1Z8U A;  4ZI3 D;  4TX5 A;  3MKD A;  2YDS A;  3N9O A;  4DBQ A;  4QHO A;  2B76 A;  3ONX A;  1QLB A;  1XMO T;  4NXM T;  3QOF A;  3UU8 A;  4PNI A;  3LK3 B;  3OVU A;  4ILB A;  4HTE A;  2C5K T;  2D0T A;  2NP9 A;  1HNX T;  3PU8 A;  5CB4 E;  5AQR B;  4O2A E;  3P7I A;  3ZMS B;  4O4J E;  5LHI B;  3AVR A;  5JR9 B;  1G8X A;  2NW7 A;  2XQ3 A;  4KX6 A;  4P0A A;  2XQA A;  5GON E;  2CLY B;  4NUU A;  3G06 A;  3MA9 A;  3N9L A;  2VUR A;  3K3N A;  4HKA A;  3HI2 A;  5LOV E;  3CK6 A;  3AE5 A;  5F5W A;  2B1E A;  3ZST A;  4GOU A;  3NZQ A;  2UXB T;  4LML A;  2E5V A;  5KXJ A;  4IDN A;  4AQY T;  1MMD A;  3A5X A;  3N2O A;  3OYX A;  5LYJ E;  2VKD A;  3I9W A;  2JJ9 A;  2J4G A;  1OED E;  2BKN A;  4TV9 E;  4CI1 B;  1T8B A;  4H9Q C;  2V6Y B;  4AQG A;  4HFE A;  4HFV A;  4UF0 A;  4AKL A;  5IWA T;  4XBF B;  3LJC A;  5LGN B;  2K24 A;  3IHR A;  4ASK A;  4OFZ A;  4QH4 A;  3VR9 A;  2Z6E A;  4HFD A;  4DV0 T;  1N32 T;  2M6B A;  3AAI A;  1Y01 A;  1CHU A;  2IML A;  1SUM B;  3HA4 A;  3GN5 A;  3JCF A;  3C98 B;  5AQP B;  2BKP A;  3V5U A;  4AKR B;  3MJX A;  3RKO A;  5JDN A;  2L9Q A;  5AQH B;  2W63 A;  2JQQ A;  4HFC A;  2UXD T;  3UU3 A;  1O3X A;  3ANW A;  4OX9 T;  4JLE A;  3OYZ A;  2WDR A;  1DU2 A;  3M65 A;  3L8R A;  2W67 A;  4M1P A;  3N9M A;  4TWF A;  2I59 A;  2J47 A;  2YDR A;  4IT4 A;  1UUS A;  2L3L A;  1ZHC A;  2V7M A;  4TWH A;  5F8P A;  1HX1 B;  2ZM6 T;  1JNZ A;  5L3F B;  1X9B A;  3UUN A;  3HR0 A;  4IE4 A;  2CXL A;  2XQ5 A;  2XAG B;  3ZJ2 A;  5AQN B;  2KIN B;  3AEE A;  3I0Q A;  2XQ4 A;  2YOE A;  3OPC A;  3Q9D A;  1OED C;  4NUV A;  1S94 A;  3A8Y C;  5AQO B;  3VKG A;  2IAK A;  4ZS2 A;  2FBW A;  2LOP A;  4U72 A;  2NW9 A;  2LRL A;  2XZE A;  3O1J A;  1US7 B;  1N34 T;  3P4W A;  3FZH B;  1HG2 A;  4JYA T;  2CCQ A;  2LOS A;  3PTR B;  3UQ4 A;  2FJD A;  2UXX B;  4NPP A;  2E2A A;  4AKH A;  3CX8 B;  2E9X C;  4JI2 T;  2MBG A;  1UCU A;  3E22 E;  3CQG B;  2G0U A;  2EHO B;  1ZOY A;  5C8Y E;  5ABF A;  3PUR A;  3PJA J;  2VKJ A;  4IL9 A;  2WY2 A;  4EYY R;  2V7J A;  4YHH T;  1IJ5 A;  4LF6 T;  5L47 A;  2V6X A;  4EXT A;  1NAF A;  4YHJ A;  2WZH A;  3PUY F;  4OHF A;  3GA8 A;  4P0B A;  1OED A;  3P4Q A;  1MNE A;  3PV0 F;  1E1H B;  2OA5 A;  3NVO A;  2DI4 A;  2BS2 A;  5LXT E;  1FIO A;  2XAS B;  2Y8D A;  5BMV E;  3QK6 A;  4Z8X A;  2E8I A;  2F4V T;  3LSV A;  5LCY A;  3RKG A;  1ZP0 A;  4UV9 B;  2W4X A;  3AXJ B;  3H37 A;  5J0Z A;  3MZK B;  5EK3 A;  3OKQ A;  5FVL A;  4I55 E;  4CI2 B;  4AXP A;  5CA1 E;  2ACX A;  1IBL T;  4LF4 T;  5EK2 A;  4B3R T;  2XJ7 A;  4P09 A;  3ZT5 A;  3KV6 A;  3RF1 A;  4DR6 T;  5AFU L;  2FJA A;  1UUR A;  1Z0P A;  2SPC A;  3KV9 A;  2C0S A;  4KBM B;  2DCF A;  3EAB A;  1W0A A;  2X9H A;  4JBW F;  3ZMU B;  1KF6 A;  4HFB A;  4MAL A;  4DV1 T;  3FXE B;  5FY1 A;  3SOL A;  4QH5 A;  1I94 T;  3ZLI A;  1J1J A;  2X68 A;  5EK4 A;  1VCS A;  4IHJ E;  1YQ4 A;  4MLK A;  2H7V C;  1T7S A;  4P1N A;  2ES0 A;  4YT0 A;  4OYJ A;  4EIW A;  1V9D A;  4L5G A;  2XQ9 A;  2CRB A;  2H7O A;  5HXR A;  5L4H A;  3FBL A;  4BJN A;  3BQL A;  1BR4 A;  1IBM T;  5J2U E;  3TLV A;  1HNW T;  4IDQ A;  4GIW A;  3AA0 B;  4U74 A;  2CBI A;  3M3Z B;  1N36 T;  3NRX A;  3AEA A;  2YU1 A;  2UUC T;  2WZI A;  4ZOL E;  4TZ4 C;  2W62 A;  5AQF B;  3CPZ A;  5L3D B;  3AEF A;  2UU9 T;  2QVA A;  4TV8 E;  3BQI A;  4DV2 T;  5FXX A;  4YSX A;  3UTK A;  3PUG A;  3O4X E;  2X0Y A;  3PUQ A;  2DL1 A;  4JI6 T;  5KX5 E;  4YXD A;  1OXZ A;  3ZT7 A;  4UV8 B;  4EZ4 A;  3I1A A;  5JH7 E;  2ODV A;  4CXW A;  4DMW A;  3L39 A;  3TKL B;  4LFA T;  3AEG A;  3ESL A;  3KIN B;  3ONL C;  3TLU A;  1BR0 A;  1YW0 A;  3ZC1 A;  1Y64 B;  1B7T A;  2LKG A;  2XAH B;  2VKH A;  4CI3 B;  4IDZ A;  4CXX A;  4EZH A;  4Q25 A;  5FL1 A;  5LA6 E;  1KNR A;  3K3Q C;  2CHN A;  3ZYK A;  4ILU A;  2UXC T;  3R84 B;  3TLS A;  2V7L A;  4NIQ A;  4HGA A;  4HWH A;  3ZEF B;  5JTG A;  3QB5 A;  2WMO A;  2WCA A;  4J2C A;  1HR0 T;  3ZPO A;  5DJQ C;  1MMA A;  5M4Y A;  2VVN A;  1M7K A;  5AQJ B;  4X1Y E;  3U3I A;  4JV5 T;  3KVB A;  5FXZ A;  3VRA A;  2WMN A;  2XAJ B;  3MXZ A;  4B6X A;  3H3A A;  4V1A v;  4LF8 T;  1HTJ F;  3JC6 D;  4A97 A;  4DUZ T;  2V1D B;  1YKE B;  2KMF A;  2BS3 A;  4H63 V;  5L3C B;  2QYW A;  4DUY T;  3FXD B;  2BG9 E;  1QUU A;  3B57 A;  2D0U A;  3EAM A;  5CJ5 A;  4DV7 T;  2YEV C;  4Z90 A;  3HKB E;  3ZC0 A;  1WR0 A;  4QH1 A;  2KWH A;  4HFH A;  4DBR A;  3LFM A;  4QWN B;  4Z91 A;  1MMN A;  3DJB A;  5HCM A;  4CN6 A;  1XNQ T;  5AQK B;  4QX7 B;  2VVS A;  4WBN E;  2N1G A;  3AEB A;  5JDM A;  3SS1 A;  4DV4 T;  3JAF A;  2CA5 A;  4ANJ A;  2K5B B;  3WI3 A;  3FB2 A;  2EHO C;  3S4U A;  1MIY A;  2JMH A;  4B3T T;  2W66 A;  4FI5 A;  2M6I A;  2IHR 1;  1U4Q A;  2LHN A;  2VAS A;  4XZC A;  5LG4 A;  3AE7 A;  3FHN A;  1FMV A;  3UQ7 A;  1VCT A;  3LBX B;  4X64 T;  3X1D A;  5JRC B;  3SWH A;  3QC9 A;  4ISS A;  2JRK A;  2CWO A;  3VHL A;  2LHR A;  5LHG B;  4QX8 B;  4X5T A;  4EED A;  1HF8 A;  2LSI A;  5DQV A;  3LG7 A;  2C5J A;  4O8S A;  4H9N C;  3PUZ F;  4AKG A;  3CML A;  2KWI B;  3J9X 1;  4AKI A;  3ZJ1 A;  2HHH T;  3EHZ A;  3RIA A;  4HEA A;  2KND A;  3AEC A;  1EZ3 A;  2CXD A;  3ZYL A;  3UUM A;  3QUJ A;  3SRZ A;  4KHZ F;  5FNV E;  5JDF A;  3AE2 A;  5CGM A;  1VRB A;  2H3R A;  3N2K E;  3EDV A;  1MIW A;  4X1K E;  1UX5 A;  4I43 B;  5JDG A;  3A7M A;  4L0R A;  3EI0 A;  2NR4 A;  2NTX A;  3J7Y q;  1D1B A;  2DNX A;  2BG9 C;  2KT9 A;  3K8P C;  5J1G A;  2M67 A;  5ETW A;  4DR7 T;  3MAC A;  2WM9 A;  5LMU T;  3RQU A;  2A72 A;  2WDV A;  3JAD A;  3E08 A;  2X51 A;  4ZI3 C;  2YKS A;  1G73 A;  5JDL A;  4JI1 T;  5FY7 A;  4DMV A;  3R6N A;  4BJM A;  4JUY A;  4A56 A;  2BKO A;  2Q9Q C;  4KI0 F;  4ILC A;  4DR5 T;  4DO0 A;  2X0L B;  4WBO A;  3F57 A;  3L3P A;  2LM2 A;  1LKX A;  4X1I E;  3Q5D A;  2KSR A;  2BBJ A;  1CUN A;  1UK5 A;  1M62 A;  3UUB A;  2BG9 A;  3T1Y T;  1MMG A;  2FJB A;  4HWF A;  2ZMA A;  1U5P A;  3ZCJ A;  4PK6 A;  2WSS V;  3RYI E;  4UF0 B;  5ADX L;  4LF5 T;  2CBJ A;  1LRZ A;  2ZM2 A;  2VQF T;  5LNK A;  2LSY A;  1R8I A;  2Q9Q A;  2XUE A;  2R6G F;  5C3J A;  5ABG A;  3ZKR A;  4E7Z A;  3GN5 B;  2X66 A;  2V7K A;  1ZEE A;  2X9Y A;  2JQ9 A;  5AQV B;  2ACZ A;  3TLT A;  3ZN1 B;  2XHE B;  3P8C D;  3ANW B;  4ZZB A;  1T98 A;  1FMW A;  3OBV E;  3FZL B;  5HEO A;  2BVL A;  2DLR A;  3LDQ B;  2VB6 A;  3C4Z A;  1NEK A;  2UUA T;  3FBZ A;  1WYB A;  2E9X A;  2XTL A;  1YKH B;  4C91 A;  2BDE A;  2LEH A;  2JQH A;  3QNU A;  2CHO A;  4U31 A;  2KZ7 B;  3PUV F;  3RHW A;  2LT3 A;  4PJJ A;  5CA0 E;  4YJ2 E;  3O1I A;  3C51 A;  4IE7 A;  1T72 A;  5J2T E;  1JNR A;  4A5X A;  5F3J A;  5HXC A;  4PK5 A;  3FZK B;  4GYR A;  4UVB B;  5LHH B;  3MK7 C;  2N2N A;  2VWA A;  4UEM A;  4IGU A;  3RIU C;  4ZI7 E;  3ETU A;  2WDQ A;  1VOM A;  5FL0 A;  4CZZ B;  4YLH A;  4BA9 A;  2D9D A;  4ZI2 D;  3KFW X;  4B3S T;  2PJQ A;  2MTQ A;  3F2E A;  3ZN0 B;  4YTN A;  3VRB A;  5LB7 B;  2MOZ A;  5L3G B;  1KK7 A;  2WWV A;  2VQE T;  4GYS A;  1W9R A;  3O1H A;  4ZS3 A;  4X20 E;  4DVD A;  3ETV A;  4WW0 A;  5ABF B;  3LK2 B;  4JI4 T;  2MAW A;  2XAF B;  2N9D A;  2D2S A;  3SFE A;  5AQT B;  3C4W A;  1HNZ T;  4ILA A;  2XQ6 A;  4EEB A;  3B13 A;  2NOX A;  5HYA A;  1XMQ T;  1GQE A;  4PW8 A;  1OED B;  5JR9 C;  2J62 A;  4HE8 A;  4JEU B;  3RPU A;  2XPK A;  4ZEY A;  4DND A;  3RIU A;  2WBL A;  1XNR T;  4X65 T;  2CLY C;  2QGS A;  1XWM A;  4O4H E;  4IIJ E;  2IC9 A;  2UUB T;  4EGW A;  1SA0 E;  4YTM A;  4CN1 A;  3V5S A;  4I4T E;  2YK0 A;  3PUX F;  2XAQ B;  1X79 A;  3Q5X A;  4MHC A;  1KNZ A;  3VR8 A;  1L0V A;  3Q2M A;  3RI5 A;  3WAK A;  4CQI A;  2V5D A;  3AED A;  1KEY A;  4U3C A;  1LVF A;  4DR1 T;  4U2Z A;  4QXB B;  4KMC A;  4EB6 E;  2WU5 A;  4UVA B;  3I9Y A;  2K48 A;  3RC3 A;  1ZKE A;  2VKO A;  4JI7 T;  1XDP A;  2J1D G;  4QXC B;  2GK9 A;  5L3B B;  3AE6 A;  5JR9 A;  4I50 E;  3NRY A;  3P4P A;  4L9I A;  5A1L A;  2NW8 A;  1IBK T;  3NKZ A;  2NTY A;  4HFI A;  5ABH A;  4ADZ A;  3T1H T;  2K3W A;  2UXN B;  2NWB A;  2OLT A;  1WRD A;  4YY3 T;  3ZSS A;  4HWD A;  4C90 A;  2W61 A;  4DR4 T;  4G63 A;  3RLF F;  2YIN A;  3ZMT B;  2HN2 A;  4X66 T;  2PBI A;  2X9X A;  3HKE E;  2V6Y A;  3AAE B;  3I0O A;  2BZB A;  5DQW A;  3KV4 A;  5LJN A;  2KXP B;  3UT5 E;  3Q5W A;  1XDO A;  5TAO A;  4U2Y A;  2X9W A;  5FYM A;  3AAA B;  1ZV4 X;  5LP6 E;  3UU6 A;  5HWY A;  3RX6 A;  4AI6 A;  5LG3 A;  3H3M A;  5AQU B;  2WU2 A;  3UU4 A;  2LJL A;  4GK5 E;  5EZY E;  2IIU A;  3AA1 B;  2YN6 A;  3UUX B;  2HH7 A;  5LBQ B;  3RYC E;  3N9Q A;  2AE9 A;  3UU5 A;  3P4S A;  2I0M A;  1N33 T;  2LSK A;  2Y6X A;  4U33 A;  5AQQ B;  5L4E A;  3AE1 A;  2V26 A;  5JRE A;  2Q9Q D;  4IDO A;  4JEH B;  3UUL A;  4LMK A;  4KUM B;  2W2U A;  4H9P C;  3FZF B;  3RIF A;  5FMN A;  2VL8 A;  1FJG T;  4TNW A;  4EAH A;  2WAU A;  2CM0 A;  1NEN A;  4QXH B;  3AE8 A;  3CIR A;  5FXV A;  2A2F X;  5AQG B;  4PK4 A;  2V5C A;  3L09 A;  1MND A;  3B5M A;  2LSJ A;  3IA3 A;  2C5I T;  5HEU A;  1D0X A;  2E9X D;  4H9O C;  1BR2 A;  3AVS A;  3ZMZ B;  4DV5 T;  3C50 A;  4GK0 E;  1UGO A;  3PE0 A;  3ZYM A;  3RRC A;  4OK0 A;  1D0Y A;  4UEL A;  3KV5 A;  1BR1 A;  3UFG A;  4HWI B;  4LMJ A;  3U78 A;  3O9X A;  3AE3 A;  2IUB A;  3CX7 B;  4LFB T;  4YFS A;  4B3M T;  5LJM A;  2WWU A;  3TLW A;  2H88 A;  1WLX A;  3NBX X;  3RGL A;  2EHO A;  4OYK A;  2QRX A;  2PTF A;  4O2B E;  4PJN A;  3NZP A;  2JQK A;  3CKD A;  2DWG A;  4IRE A;  4NXN T;  2XQ8 A;  2X67 A;  5L2L A;  4CN4 A;  4F8H A;  1YXR A;  2VK9 A;  4JI0 T;  4O4I E;  1IJ6 A;  4JI5 T;  2P9B A;  4DV3 T;  2JPF A;  2LE8 A;  5KDM C;  1J5E T;  3C64 A;  2IW5 B;  3JC6 C;  3PUW F;  3OTO T;  5AQL B;  4IE6 A;  5C2T A;  4HWC A;  5AQM B;  1QSD A;  3DP7 A;  2XQY A;  5JDQ A;  2A3D A;  5DAB A;  2V8S V;  3NWI A;  4WYV A;  2L8K A;  3WAJ A;  4IDP A;  3CQC B;  4ZZC A;  3K3O A;  4N78 D;  4A98 A;  3AXJ A;  5CFB A;  3ZCI A;  1SHZ C;  1HFA A;  2MYS A;  4AQF C;  1D1A A;  4UR9 A;  5LGT B;  2HPJ A;  2CWY A;  5H6Q B;  5AQI B;  2ZM8 A;  1H7C A;  4EOZ B;  2LLY A;  4GKJ T;  4WZX A;  2RPA A;  5IUX A;  5IHY A;  2CMR A;  5JDH A;  2CXF A;  3IEE A;  2MPK A;  5ABE A;  5IYZ E;  2W0G A;  2BBH A;  1SE7 A;  2E5L T;  3HL6 A;  2CPT A;  4JI3 T;  1YQ3 A;  3EUH A;  1MIV A;  4IE5 A;  3ABV A;  3PDY A;  2ZM0 A;  2K9A A;  4PFO A;  4AQF A;  3RYH E;  4BAY B;  2IDO B;  3KBU A;  4DR3 T;  3FZM B;  1AJ3 A;  3KDS E;  3T8O A;  2JIW A;  4H9S E;  2X0H A;  4F6R C;  4KHP T;  4COF A;  4UIG A;  4G2A A;  4UXN B;  2LSG A;  3ONJ A;  4JI8 T;  4PJM A;  1HCI A;  5LGU B;  3LK4 2;  4CXY A;  3GWH A;  1KNP A;  3D0T A; 
#chains in the Genus database with same CATH homology
 2LRL A;  2V6Y A;  2XZE A;  3ZSS A;  4IT4 A;  4U3C A;  2MPK A;  1WFD A;  3ZT6 A;  2W2U A;  1WR0 A;  2CRB A;  3K1S A;  2WWV A;  2JQK A;  2A9U A;  4U2Z A;  3ZT5 A;  2V6Y B;  4CN1 A;  3ZST A;  5FVL A;  4WZX A;  2JQ9 A;  2RPA A;  5FVK A;  4U7I A;  4U33 A;  5CGM A;  4A5X A;  4CN6 A;  2CPT A;  2LRK A;  4CN4 A;  4U2Y A;  2DL1 A;  4U7Y A;  4ZEY A;  1WCR A;  2K3W A;  1YXR A;  2WY2 A;  4P1N A;  2JQH A;  4U31 A;  3ZT7 A;  3EAB A;  4NIQ A;  5CJ5 A;  5LB7 B;  2V6X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...