4U7IA

Structure of the complex of spartin mit and ist1 mim
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
93
structure length
93
Chain Sequence
EPAEIKIIREAYKKAFLFVNKGLNTDELGQKEEAKNYYKQGIGHLLRGISISSKESEHTGPGWESARQMQQKMKETLQNVRTRLEILEKGLAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Spartin
publication title Distinct Mechanisms of Recognizing Endosomal Sorting Complex Required for Transport III (ESCRT-III) Protein IST1 by Different Microtubule Interacting and Trafficking (MIT) Domains.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 40
structure length 93
sequence length 93
ec nomenclature
pdb deposition date 2014-07-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.280 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Hypothetical protein 1500032h18. 4u7iA00
5CJ5A 2WWVA 4U7IA 5LB7B 2WY2A 4U31A 2A9UA 5FVKA 4IT4A 4A5XA 2LRKA 3EABA 3ZSSA 5FVLA 3ZT6A 5CGMA 4U3CA 4CN6A 4U2YA 2XZEA 2JQKA 4U2ZA 2MPKA 4CN4A 2LRLA 2K3WA 1WR0A 3ZSTA 4P1NA 2W2UA 1YXRA 4NIQA 2CRBA 2DL1A 4ZEYA 4CN1A 4WZXA 4U33A 1WFDA 3ZT7A 2CPTA 3K1SA 2JQHA 2V6XA 2V6YB 2V6YA 4U7YA 3ZT5A 1WCRA 2JQ9A 2RPAA
chains in the Genus database with same CATH superfamily
4AKLA 5HWYA 3QUJA 2ES0A 4HE8A 2XQ9A 3ABVA 4DR1T 1X9BA 1DU2A 3VHLA 1WLXA 2WCAA 3H3AA 4O4JE 2V7MA 2E9XD 5DJQC 2H7OA 1HCIA 3TLWA 2VKHA 4OYKA 2YU2A 2C0SA 3OYXA 4L5GA 2YN6A 2VKDA 2XM1A 2YK0A 3E08A 5LP6E 4ILBA 2V5CA 1MMGA 2ZM0A 4ASKA 3Q2MA 3DJBA 3RIUA 4O4HE 3ZYMA 1KFYA 2WMOA 2C5JA 5L4EA 1B7TA 5HCMA 1WCRA 5LA6E 4ANJA 4Z91A 1SE7A 3ZMZB 3CVRA 4NXMT 3AEDA 5LCYA 3Q9DA 1T72A 2H88A 3OTOT 2XQ4A 5J1GA 3RYHE 5AFUL 1XDOA 4IE5A 3O1IA 3CPZA 3Q5EA 3ZJ2A 2FJAA 1HFAA 3LJCA 5HEJA 3PUZF 4UVAB 3AE6A 4A98A 2K5BB 4J2CA 2VK9A 3G06A 2XUEA 3X1DA 4IDPA 4NUVA 2FJBA 3UUNA 3UFEA 1H7CA 3U78A 4G2AA 2IMLA 3VKGA 2WQYA 3LFMA 1W9RA 3KVAA 2XM2A 3IF8B 3SOLA 2LJLA 5TAOA 3O9XA 4GYSA 3WAJA 5LMUT 2L3LA 1HNXT 2PBIA 2KXPB 5HXSA 1D0YA 2MPKA 2NW9A 1VCTA 5AQNB 1J1JA 3AE7A 4YY3T 1VRBA 5DABA 4WYVA 3FXEB 3OJAA 3HKBE 4UV8B 1X79A 2WP9A 2Q9QB 3FBZA 4LMKA 2VKJA 3KINB 4F8HA 3BQKA 1UGOA 4GK5E 1LVFA 1O3XA 4DR2T 3P4WA 2CM0A 3A8YC 1M62A 2LRKA 4TWFA 3AXJA 3ZCJA 4ERRA 4AKHA 2M6IA 4KX6A 4WZXA 3AE3A 4IGUA 4UV9B 1CHUA 3PU8A 4HFVA 4JEHB 3QB5A 2LSIA 1XMQT 1W0AA 5H6QB 1T8BA 1YXRA 5DQWA 4YFSA 2YINA 2QRXA 1UK5A 2WU2A 3JAEA 3CQGB 1ZEEA 3AEGA 2OA5A 3SS1A 2CBIA 1MNEA 2H7VC 4GYRA 3C98B 2BS3A 3ZJ1A 2KMFA 2WDQA 4X65T 4UR9A 3OVUA 4BAYB 2RPAA 3GWHA 3PJAA 3FZMB 2FUPA 2JQQA 4NUUA 3IHRA 5F5WA 2NR4A 4B3RT 4ZEYA 4O2BE 3TLVA 5IUXA 2XHEB 4QXCB 3N9MA 4LF4T 3AE5A 3PUXF 3JC6C 2JMHA 2JRKA 2NWBA 2XAHB 4CI2B 4DO0A 2EHOD 5KX5E 2W63A 4EEBA 4YLHA 3K1SA 2VQET 4EV6A 3GA8A 3MJXA 3C4WA 4JI4T 3N9NA 2DCFA 4PFPA 4AQGA 2JIWA 3WI3A 4MALA 1HNZT 3ONLC 2PTFA 2XSAA 4DMWA 5JTGA 2ZMAA 1D1CA 4UEMA 2ZM8A 1QUUA 5AQQB 2V7LA 3CQXC 2XPKA 5FNVE 4PK4A 2V6YA 4H9PC 4QH5A 5FMNA 1YQ3A 4H9OC 5HXEA 5JDNA 2LSKA 3NZQA 4DR6T 2E5LT 5F3JA 3UUMA 4JLEA 3K3OA 3AA7B 4YJ3E 2I59A 2VWAA 3PUYF 1L0VA 4QX8B 1ZV4X 4DUYT 2LM9A 2GK9A 1D1AA 2FBWA 4PNIA 5HXCA 3HL6A 4YJ2E 4MFRA 2IC9A 4GKJT 5ADXL 3L09A 4HFEA 4DV4T 4V1Av 5LHIB 3HA4A 5AQOB 3ZC1A 4ZS2A 1WR0A 4DNDA 3AE4A 4LFAT 5FY0A 4WBNE 4X1IE 5LGTB 3MACA 4QKNA 4ZZBA 2LE8A 5AQTB 3RIAA 2PG8A 4PJJA 1HG5A 3UQ4A 2YDSA 3HKCE 1M7KA 3RLFF 2LM2A 4U33A 3J7Yq 3H37A 4JV5T 5FY1A 3I1AA 1HF8A 4U31A 2J1DG 2UXNB 3F31A 3UU4A 3ZPOA 4FJOA 5GONE 3K3NA 4O4IE 3B13A 3N9QA 1ZKEA 2LSGA 3AA0B 3RKOA 1I6ZA 2DHRA 5AQGB 2UUBT 3QC9A 2V6XA 4KHZF 1QSDA 2QYWA 5ABFA 2E2AA 1HS7A 4JI1T 2ZM6T 4HN9A 4MHCA 2XQ6A 1N36T 4X1KE 4HWDA 4U7YA 4M1PA 1XDPA 3RI5A 3Q5WA 3Q5DA 1QLBA 2Y8DA 3KBUA 4QXBB 2R6GF 2KLQA 2E9XA 1E2AA 2DNXA 2UXDT 4DV6T 4XBFB 2X9HA 4IE6A 3VU7H 4I55E 2WZHA 5AQMB 3ONJA 3JADA 1KNRA 1Z0PA 3NRXA 2I0MA 3KDSE 3AEBA 3GMIA 3LBXA 4B3MT 3LDQB 5EK3A 2W2UA 3AB3B 5JDHA 2Q9QD 4DV1T 1VCSA 4UIGA 1JNZA 5LOVE 4TN7B 4LF5T 3LK42 2LKHA 4BJNA 4EAHA 2IIUA 5HXHA 4KHPT 1WR6A 1MMAA 4IE7A 2LRLA 2Z6EA 3ETUA 4H9NC 1NEKA 2CMRA 5L3FB 2D0TA 2W4XA 2NTYA 2J47A 5L4HA 3NVOA 4O8SA 3RYCE 3PDYA 4AKIA 2YU1A 2WS3A 4JI6T 5ABHA 2CRBA 3NZPA 1YKHB 3EI0A 4AQFA 2QA7A 3ZMTB 1UX5A 3ZSSA 1S94A 2UUCT 1BR4A 2IDOB 2V26A 1E7PA 5KMGP 5JR9C 4JUYA 5BR8T 3MKDA 3EAMA 3LSVA 3H3MA 2V6YB 3N9OA 2SPCA 4AISA 1KNZA 3RF1A 4X62T 4U2YA 2HH7A 3TLUA 1UUSA 3RPUA 1Y01A 2A3DA 3FXDB 3K8PC 2VL8A 1OXZA 3ESLA 3ZYKA 3O1HA 3N2GE 4O2AE 4DBQA 3ZT6A 3FZKB 3K3QC 2DWKA 3VKHA 4IL9A 4LMJA 2W67A 4ZS3A 4B3TT 5L3CB 2LOSA 3AECA 2CXDA 1E1HB 4PK6A 2XJ7A 3PURA 1MMNA 2N2NA 5LHGB 3ZC0A 5M4YA 5JDGA 2XQ7A 1W09A 5H6RB 2LLYA 3AE8A 1ZHCA 4JI5T 4K0UA 2V5DA 5J2TE 3AEAA 4TWHA 4ZI3C 2LSJA 5E0OA 2F4VT 4X1YE 1UX4A 3SFEA 2VKOA 4UVBB 2M67A 2DLRA 3EDVA 4OHFA 2KINB 3T1YT 4HGAA 5AQSB 4H9QC 3RYIE 2BG9C 2YDQA 3OYZA 5ABFB 2CA5A 1OEDC 4L0RA 3VRBA 5AQRB 2JQKA 5EZYE 3TLTA 1HX8A 3KBTA 5L47A 3PV0F 3RRWA 2BZBA 4HWFA 4G63A 4ZOLE 2Y6XA 2JQ9A 2BKPA 3UUBA 5BMVE 4AIUA 4E7SA 5FXZA 3P50A 2E9XB 2XZEA 3RRCA 4EZ4A 5ABEA 2BVLA 3KV4A 4GKKT 5AQFB 5CFBA 2V8SV 2XY8B 1WFDA 2K9AA 5JDLA 3BK9A 1AJ3A 3BQIA 3N9LA 5LXTE 3LBXB 2ODVA 4KBMB 3O1JA 2W66A 5HCJA 2NP9A 2LHRA 5IHYA 4NXNT 4DR4T 3EVYA 2V1DB 2UXCT 4DV5T 2E5VA 4DIDB 2YKSA 3RHWA 1FJGT 4HWCA 1WYCA 2X66A 3E22E 1YW0A 2KT9A 2RP4A 1XMOT 3ZN0B 2L9QA 5F8PA 4ILCA 2VL0A 2WSSV 4I0UA 1KF6A 5JR9A 3KV9A 2YOEA 2CWYA 3CKDA 4WBOA 2CBJA 1SUMB 2CLYC 5AQJB 2BG9E 2OV9A 4ZI2D 2E9XC 3V5UA 2WZIA 3MZKB 3RC3A 1OEDE 4KP3C 1JNRA 1LRZA 5HXRA 3OPCA 5C3JA 3PUVF 5CJ5A 2WWVA 4QWNB 2LT3A 3ETVA 2AXDS 3FBLA 3ANWA 2WAUA 3AVSA 5IWAT 4PJMA 4ZZCA 2X51A 1D1BA 4LF7T 2XAFB 4DV3T 4PAGA 2BVMA 5JQGE 4YTPA 3SFDA 1Z8UA 2HPJA 4CN6A 3P4QA 4JI7T 3T1HT 3C4XA 1SHZC 3QK6A 4EB6E 3AE9A 4PK5A 4PW8A 2HN1A 4WNKA 2L8KA 5HEHA 5L3BB 3IA3A 5JH7E 3P4SA 4TNVA 2KWIB 4JBWF 2VURA 3ZLIA 1FMVA 3P4RA 3AAEB 4QH4A 4CN1A 3ZKRA 4AQFC 3M3ZB 2IUBA 1IZNB 3N2KE 1XZYA 3UT5E 2ZLYA 4EYYR 2BG9A 4CI1B 4EGWA 2IC6A 2WM9A 2QGSA 4DV7T 1OEDA 3BQLA 5AQKB 4YT0A 4YXDA 1IJ6A 4YHHT 3FHNA 2WB5A 3AE1A 4QHOA 3P7IA 4MLKA 4DMVA 4IHJE 4TUYE 4LF6T 2BBHA 4CXYA 5J0ZA 1N32T 1BR0A 3PUGA 2DWGA 3E0ZA 1S35A 4LF9T 5LHHB 5LBMA 3CWZB 3C4ZA 3NBXX 3EDUA 2C5KT 4DV2T 3AE2A 3TKLB 2CEAA 2E8IA 3EABA 3AXJB 3GN5A 2WWUA 4U3CA 1FIOA 5L2LA 4B3ST 1UURA 1BR2A 5KXJA 2UUAT 4ILAA 5HEOA 3ZSTA 2XASB 3D0TA 1D0XA 4IE0A 3UU8A 3OKQA 5L3DB 4X64T 5LG3A 1SA0E 1MMDA 3IBPA 1NENA 5CGMA 1YD8G 4IDZA 2Q9QA 4X20E 3KFWX 3AEFA 4CXWA 3B5MA 2XAGB 5ETWA 2CXFA 1HNWT 3JCFA 3EUHA 4I50E 3S4UA 2NW8A 3L3PA 2H89A 3HI2A 4HFBA 3T8OA 2BBJA 1LVKA 3RC8A 5JDFA 2HN2A 4EYUA 3R84B 3KV6A 2KNDA 5EK4A 4AQYT 5JDQA 4ZXLA 2XAJB 3V5SA 3F57A 4DVDA 4PFOA 4COFA 2A72A 4U72A 5CA1E 4GK0E 4DV0T 1D0ZA 5JRCA 3CQCB 4C90A 1NAFA 2UU9T 5JR9B 4EZHA 2LHNA 2CHNA 3CX8B 1BR1A 1KK7A 3FZFB 5AQVB 2MYSA 4HWHA 4HEAA 4HFHA 5FP3A 3FZHB 2D5UA 3PUWF 1G73A 2LOPA 2X0LB 3VR9A 3UULA 2EHOC 3NRYA 4BJMA 4DR7T 4U74A 4DBRA 2YDRA 3ANWB 3JC6D 2CCQA 2IW5B 4CXXA 3PTRB 5C8YE 4FI5A 2FJDA 2XQYA 4MBQA 3P8CD 4AKGA 3Q5XA 3UU3A 1VOMA 2X67A 4H9SE 4QXHB 5AQIB 1WRDA 3L39A 4JI2T 4YSYA 3ZEFB 5FXXA 2ODUA 2KSRA 2BKOA 4UXNB 1NWMX 3PUQA 2XTLA 2B1EA 1HX1B 4ISSA 3F2EA 4TV9E 3LK3B 2J4GA 3C50A 5LJMA 3UUXB 2D2SA 1U4QA 5FXVA 2V7KA 4IREA 4A56A 1YKEB 5FY7A 4IDOA 2VVSA 4ISTA 3AAIA 1FMWA 2X68A 5LNKA 2Y48B 2B76A 4OK0A 2HPLA 5CA0E 4IIJE 3NKZA 2BG9B 2RA1A 2XAQB 1IBKT 3N2OA 1GQEA 4H63V 2LKGA 4LF8T 3FZLB 1OEDB 4JI3T 1ZOYA 5HEGA 5A1LA 5FL0A 5AQPB 3CIRA 2WDVA 5LG4A 3CMLA 3MK7C 3RQWA 4HFIA 5HEUA 4CQIA 3A7MA 3CX6B 2VB6A 4HWIB 3I0OA 3U3IA 4IE4A 4JEUB 2IAKA 2N9DA 4P1NA 3MXZA 2WDRA 2W00A 4AKRB 4DR5T 3UU5A 2UXBT 2K48A 3LK2B 3ZYLA 2BS2A 3GN5B 4LFBT 4PJNA 2D9DA 2VVNA 1KNPA 5LBQB 5ABGA 3B57A 2IHR1 2XQ3A 4KUMB 3MA9A 3PE0A 3QOFA 4WW0A 2CE7A 4KI0F 4Z8XA 5LYJE 2DI4A 4U2ZA 5FXWA 3ZMUB 4EOZB 4B6XA 4LMLA 2VQFT 2XQAA 1KEYA 1CUNA 1T98A 2AE9A 1IAPA 3HKDE 2LEHA 1HTJF 2K24A 2CLYB 2A2FX 4F6RC 1W0BA 1LKXA 4OYJA 2JMKA 3C51A 4TZ4C 5C2TA 4YTNA 3LG7A 4ZHQE 4DUZT 2W61A 1MIWA 4ZI7E 2UXXB 2XQ5A 3ZCIA 2EHOA 2BDEA 4CN4A 5JRCB 1U5PA 3KVBA 3RX6A 4NIQA 3AEEA 3UTKA 5JVDE 4E7ZA 4GIWA 2PFVA 3CK6A 4UF0A 4A5XA 4YHJA 3RH3A 2Q9QC 3KV5A 2X0HA 4XZCA 5AQLB 4TX5A 3RKGA 2JJ9A 2NTXA 5HAXA 3RQUA 3HR0A 4I4TE 3DP7A 4HKAA 4HTEA 3FB2A 4EXTA 3I9YA 4OX9T 4I43B 2JPFA 4PJLA 2NOXA 1R8IA 4A97A 4KMCA 2D0UA 5IYZE 1G8XA 4Z90A 2J62A 2KZ7B 3HKEE 3ZT5A 4EEDA 4TNWA 3A5XA 1J5WA 4H9RC 2A9UA 4UVCB 4H63H 3SRZA 3WAKA 5LGNB 4K0KT 2P9BA 3AAAB 4P0BA 3NWIA 5EK2A 5DQVA 2W0GA 3UFGA 4HFDA 5FL1A 3RGLA 4N78D 4ILUA 3PU3A 5LMNT 2XSBA 2ZM2A 4AXPA 1HG2A 2N1GA 2CPTA 2CHOA 4OFZA 4EIWA 5J2UE 1Y64B 1FEWA 4NPPA 4C91A 3TLSA 2VASA 4X5TA 2I6HA 4GOUA 1T7SA 2V7IA 1OWAA 1MIYA 5CB4E 3OBVE 3R6NA 1N34T 1XNQT 1IJ5A 1I94T 2X9XA 2OLTA 4YSZA 3P4PA 5FKYA 3ZMSB 4TWDA 4JYAT 3N9PA 2C5IT 5FVLA 2PJQA 3RIUC 1HR0T 4AI6A 3RYFE 2V7JA 2X9WA 2QVAA 2X0YA 2W62A 3ZT7A 5AQUB 5JREA 4JI8T 1MNDA 3QB5K 3L8RA 1MIVA 2WY2A 2BS4A 4BA9A 2NW7A 3AVRA 4IT4A 5L3EB 4HFCA 2XQ8A 2X9YA 2MOZA 4JI0T 2CWOA 3I0QA 2CXLA 3PUAA 3ONXA 5HYAA 3QNUA 3UU6A 4QX7B 2LSYA 2MBGA 4ADZA 1N33T 2G0UA 4ZI3D 3AA1B 2ACXA 4TV8E 2MTQA 2FJEA 3C64A 4CI3B 5AQHB 3ZN1B 4CZZB 3AA6B 1IBLT 4IL4A 1EZ3A 3IEEA 4IDQA 5JDMA 4P0AA 1US7B 5L3GB 2DL1A 4YSXA 4LFCT 2HHHT 3N5LA 2JQHA 3DTOA 2WU5A 5LB7B 1WYBA 4QH1A 1ZP0A 3VRAA 2EHOB 3ZMVB 3PJAJ 3CX7B 3SWHA 4P09A 2KWHA 4O4LE 3UQ7A 3JAFA 1XNRT 2WMNA 4Q25A 4UELA 2WBLA 5FYMA 4UF0B 5FVKA 3O4XE 1J5ET 3I9WA 4DR3T 2K3WA 3W15B 3PUSA 2ACZA 1XWMA 5HWXA 3RIFA 1V9DA 2YEVC 4L9IA 1YQ4A 4YTMA 4U7IA 4IDNA 2BKNA 2MAWA 5LGUB 4X66T 2M6BA 3M65A 4XAXB 3EHZA 3VR8A 5KDMC 1IBMT 2H3RA 3J9X1 4ZI2C 1UCUA 5LJNA
chains in the Genus database with same CATH topology
5CJ5A 2WWVA 4U7IA 5LB7B 2WY2A 4U31A 2A9UA 5FVKA 4IT4A 4A5XA 2LRKA 3EABA 3ZSSA 5FVLA 3ZT6A 5CGMA 4U3CA 4CN6A 4U2YA 2XZEA 2JQKA 4U2ZA 2MPKA 4CN4A 2LRLA 2K3WA 1WR0A 3ZSTA 4P1NA 2W2UA 1YXRA 4NIQA 2CRBA 2DL1A 4ZEYA 4CN1A 4WZXA 4U33A 1WFDA 3ZT7A 2CPTA 3K1SA 2JQHA 2V6XA 2V6YB 2V6YA 4U7YA 3ZT5A 1WCRA 2JQ9A 2RPAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CJ5 A;  2WWV A;  4U7I A;  5LB7 B;  2WY2 A;  4U31 A;  2A9U A;  5FVK A;  4IT4 A;  4A5X A;  2LRK A;  3EAB A;  3ZSS A;  5FVL A;  3ZT6 A;  5CGM A;  4U3C A;  4CN6 A;  4U2Y A;  2XZE A;  2JQK A;  4U2Z A;  2MPK A;  4CN4 A;  2LRL A;  2K3W A;  1WR0 A;  3ZST A;  4P1N A;  2W2U A;  1YXR A;  4NIQ A;  2CRB A;  2DL1 A;  4ZEY A;  4CN1 A;  4WZX A;  4U33 A;  1WFD A;  3ZT7 A;  2CPT A;  3K1S A;  2JQH A;  2V6X A;  2V6Y B;  2V6Y A;  4U7Y A;  3ZT5 A;  1WCR A;  2JQ9 A;  2RPA A; 
#chains in the Genus database with same CATH topology
 4AKL A;  5HWY A;  3QUJ A;  2ES0 A;  4HE8 A;  2XQ9 A;  3ABV A;  4DR1 T;  1X9B A;  1DU2 A;  3VHL A;  1WLX A;  2WCA A;  3H3A A;  4O4J E;  2V7M A;  2E9X D;  5DJQ C;  2H7O A;  1HCI A;  3TLW A;  2VKH A;  4OYK A;  2YU2 A;  2C0S A;  3OYX A;  4L5G A;  2YN6 A;  2VKD A;  2XM1 A;  2YK0 A;  3E08 A;  5LP6 E;  4ILB A;  2V5C A;  1MMG A;  2ZM0 A;  4ASK A;  3Q2M A;  3DJB A;  3RIU A;  4O4H E;  3ZYM A;  1KFY A;  2WMO A;  2C5J A;  5L4E A;  1B7T A;  5HCM A;  1WCR A;  5LA6 E;  4ANJ A;  4Z91 A;  1SE7 A;  3ZMZ B;  3CVR A;  4NXM T;  3AED A;  5LCY A;  3Q9D A;  1T72 A;  2H88 A;  3OTO T;  2XQ4 A;  5J1G A;  3RYH E;  5AFU L;  1XDO A;  4IE5 A;  3O1I A;  3CPZ A;  3Q5E A;  3ZJ2 A;  2FJA A;  1HFA A;  3LJC A;  5HEJ A;  3PUZ F;  4UVA B;  3AE6 A;  4A98 A;  2K5B B;  4J2C A;  2VK9 A;  3G06 A;  2XUE A;  3X1D A;  4IDP A;  4NUV A;  2FJB A;  3UUN A;  3UFE A;  1H7C A;  3U78 A;  4G2A A;  2IML A;  3VKG A;  2WQY A;  3LFM A;  1W9R A;  3KVA A;  2XM2 A;  3IF8 B;  3SOL A;  2LJL A;  5TAO A;  3O9X A;  4GYS A;  3WAJ A;  5LMU T;  2L3L A;  1HNX T;  2PBI A;  2KXP B;  5HXS A;  1D0Y A;  2MPK A;  2NW9 A;  1VCT A;  5AQN B;  1J1J A;  3AE7 A;  4YY3 T;  1VRB A;  5DAB A;  4WYV A;  3FXE B;  3OJA A;  3HKB E;  4UV8 B;  1X79 A;  2WP9 A;  2Q9Q B;  3FBZ A;  4LMK A;  2VKJ A;  3KIN B;  4F8H A;  3BQK A;  1UGO A;  4GK5 E;  1LVF A;  1O3X A;  4DR2 T;  3P4W A;  2CM0 A;  3A8Y C;  1M62 A;  2LRK A;  4TWF A;  3AXJ A;  3ZCJ A;  4ERR A;  4AKH A;  2M6I A;  4KX6 A;  4WZX A;  3AE3 A;  4IGU A;  4UV9 B;  1CHU A;  3PU8 A;  4HFV A;  4JEH B;  3QB5 A;  2LSI A;  1XMQ T;  1W0A A;  5H6Q B;  1T8B A;  1YXR A;  5DQW A;  4YFS A;  2YIN A;  2QRX A;  1UK5 A;  2WU2 A;  3JAE A;  3CQG B;  1ZEE A;  3AEG A;  2OA5 A;  3SS1 A;  2CBI A;  1MNE A;  2H7V C;  4GYR A;  3C98 B;  2BS3 A;  3ZJ1 A;  2KMF A;  2WDQ A;  4X65 T;  4UR9 A;  3OVU A;  4BAY B;  2RPA A;  3GWH A;  3PJA A;  3FZM B;  2FUP A;  2JQQ A;  4NUU A;  3IHR A;  5F5W A;  2NR4 A;  4B3R T;  4ZEY A;  4O2B E;  3TLV A;  5IUX A;  2XHE B;  4QXC B;  3N9M A;  4LF4 T;  3AE5 A;  3PUX F;  3JC6 C;  2JMH A;  2JRK A;  2NWB A;  2XAH B;  4CI2 B;  4DO0 A;  2EHO D;  5KX5 E;  2W63 A;  4EEB A;  4YLH A;  3K1S A;  2VQE T;  4EV6 A;  3GA8 A;  3MJX A;  3C4W A;  4JI4 T;  3N9N A;  2DCF A;  4PFP A;  4AQG A;  2JIW A;  3WI3 A;  4MAL A;  1HNZ T;  3ONL C;  2PTF A;  2XSA A;  4DMW A;  5JTG A;  2ZMA A;  1D1C A;  4UEM A;  2ZM8 A;  1QUU A;  5AQQ B;  2V7L A;  3CQX C;  2XPK A;  5FNV E;  4PK4 A;  2V6Y A;  4H9P C;  4QH5 A;  5FMN A;  1YQ3 A;  4H9O C;  5HXE A;  5JDN A;  2LSK A;  3NZQ A;  4DR6 T;  2E5L T;  5F3J A;  3UUM A;  4JLE A;  3K3O A;  3AA7 B;  4YJ3 E;  2I59 A;  2VWA A;  3PUY F;  1L0V A;  4QX8 B;  1ZV4 X;  4DUY T;  2LM9 A;  2GK9 A;  1D1A A;  2FBW A;  4PNI A;  5HXC A;  3HL6 A;  4YJ2 E;  4MFR A;  2IC9 A;  4GKJ T;  5ADX L;  3L09 A;  4HFE A;  4DV4 T;  4V1A v;  5LHI B;  3HA4 A;  5AQO B;  3ZC1 A;  4ZS2 A;  1WR0 A;  4DND A;  3AE4 A;  4LFA T;  5FY0 A;  4WBN E;  4X1I E;  5LGT B;  3MAC A;  4QKN A;  4ZZB A;  2LE8 A;  5AQT B;  3RIA A;  2PG8 A;  4PJJ A;  1HG5 A;  3UQ4 A;  2YDS A;  3HKC E;  1M7K A;  3RLF F;  2LM2 A;  4U33 A;  3J7Y q;  3H37 A;  4JV5 T;  5FY1 A;  3I1A A;  1HF8 A;  4U31 A;  2J1D G;  2UXN B;  3F31 A;  3UU4 A;  3ZPO A;  4FJO A;  5GON E;  3K3N A;  4O4I E;  3B13 A;  3N9Q A;  1ZKE A;  2LSG A;  3AA0 B;  3RKO A;  1I6Z A;  2DHR A;  5AQG B;  2UUB T;  3QC9 A;  2V6X A;  4KHZ F;  1QSD A;  2QYW A;  5ABF A;  2E2A A;  1HS7 A;  4JI1 T;  2ZM6 T;  4HN9 A;  4MHC A;  2XQ6 A;  1N36 T;  4X1K E;  4HWD A;  4U7Y A;  4M1P A;  1XDP A;  3RI5 A;  3Q5W A;  3Q5D A;  1QLB A;  2Y8D A;  3KBU A;  4QXB B;  2R6G F;  2KLQ A;  2E9X A;  1E2A A;  2DNX A;  2UXD T;  4DV6 T;  4XBF B;  2X9H A;  4IE6 A;  3VU7 H;  4I55 E;  2WZH A;  5AQM B;  3ONJ A;  3JAD A;  1KNR A;  1Z0P A;  3NRX A;  2I0M A;  3KDS E;  3AEB A;  3GMI A;  3LBX A;  4B3M T;  3LDQ B;  5EK3 A;  2W2U A;  3AB3 B;  5JDH A;  2Q9Q D;  4DV1 T;  1VCS A;  4UIG A;  1JNZ A;  5LOV E;  4TN7 B;  4LF5 T;  3LK4 2;  2LKH A;  4BJN A;  4EAH A;  2IIU A;  5HXH A;  4KHP T;  1WR6 A;  1MMA A;  4IE7 A;  2LRL A;  2Z6E A;  3ETU A;  4H9N C;  1NEK A;  2CMR A;  5L3F B;  2D0T A;  2W4X A;  2NTY A;  2J47 A;  5L4H A;  3NVO A;  4O8S A;  3RYC E;  3PDY A;  4AKI A;  2YU1 A;  2WS3 A;  4JI6 T;  5ABH A;  2CRB A;  3NZP A;  1YKH B;  3EI0 A;  4AQF A;  2QA7 A;  3ZMT B;  1UX5 A;  3ZSS A;  1S94 A;  2UUC T;  1BR4 A;  2IDO B;  2V26 A;  1E7P A;  5KMG P;  5JR9 C;  4JUY A;  5BR8 T;  3MKD A;  3EAM A;  3LSV A;  3H3M A;  2V6Y B;  3N9O A;  2SPC A;  4AIS A;  1KNZ A;  3RF1 A;  4X62 T;  4U2Y A;  2HH7 A;  3TLU A;  1UUS A;  3RPU A;  1Y01 A;  2A3D A;  3FXD B;  3K8P C;  2VL8 A;  1OXZ A;  3ESL A;  3ZYK A;  3O1H A;  3N2G E;  4O2A E;  4DBQ A;  3ZT6 A;  3FZK B;  3K3Q C;  2DWK A;  3VKH A;  4IL9 A;  4LMJ A;  2W67 A;  4ZS3 A;  4B3T T;  5L3C B;  2LOS A;  3AEC A;  2CXD A;  1E1H B;  4PK6 A;  2XJ7 A;  3PUR A;  1MMN A;  2N2N A;  5LHG B;  3ZC0 A;  5M4Y A;  5JDG A;  2XQ7 A;  1W09 A;  5H6R B;  2LLY A;  3AE8 A;  1ZHC A;  4JI5 T;  4K0U A;  2V5D A;  5J2T E;  3AEA A;  4TWH A;  4ZI3 C;  2LSJ A;  5E0O A;  2F4V T;  4X1Y E;  1UX4 A;  3SFE A;  2VKO A;  4UVB B;  2M67 A;  2DLR A;  3EDV A;  4OHF A;  2KIN B;  3T1Y T;  4HGA A;  5AQS B;  4H9Q C;  3RYI E;  2BG9 C;  2YDQ A;  3OYZ A;  5ABF B;  2CA5 A;  1OED C;  4L0R A;  3VRB A;  5AQR B;  2JQK A;  5EZY E;  3TLT A;  1HX8 A;  3KBT A;  5L47 A;  3PV0 F;  3RRW A;  2BZB A;  4HWF A;  4G63 A;  4ZOL E;  2Y6X A;  2JQ9 A;  2BKP A;  3UUB A;  5BMV E;  4AIU A;  4E7S A;  5FXZ A;  3P50 A;  2E9X B;  2XZE A;  3RRC A;  4EZ4 A;  5ABE A;  2BVL A;  3KV4 A;  4GKK T;  5AQF B;  5CFB A;  2V8S V;  2XY8 B;  1WFD A;  2K9A A;  5JDL A;  3BK9 A;  1AJ3 A;  3BQI A;  3N9L A;  5LXT E;  3LBX B;  2ODV A;  4KBM B;  3O1J A;  2W66 A;  5HCJ A;  2NP9 A;  2LHR A;  5IHY A;  4NXN T;  4DR4 T;  3EVY A;  2V1D B;  2UXC T;  4DV5 T;  2E5V A;  4DID B;  2YKS A;  3RHW A;  1FJG T;  4HWC A;  1WYC A;  2X66 A;  3E22 E;  1YW0 A;  2KT9 A;  2RP4 A;  1XMO T;  3ZN0 B;  2L9Q A;  5F8P A;  4ILC A;  2VL0 A;  2WSS V;  4I0U A;  1KF6 A;  5JR9 A;  3KV9 A;  2YOE A;  2CWY A;  3CKD A;  4WBO A;  2CBJ A;  1SUM B;  2CLY C;  5AQJ B;  2BG9 E;  2OV9 A;  4ZI2 D;  2E9X C;  3V5U A;  2WZI A;  3MZK B;  3RC3 A;  1OED E;  4KP3 C;  1JNR A;  1LRZ A;  5HXR A;  3OPC A;  5C3J A;  3PUV F;  5CJ5 A;  2WWV A;  4QWN B;  2LT3 A;  3ETV A;  2AXD S;  3FBL A;  3ANW A;  2WAU A;  3AVS A;  5IWA T;  4PJM A;  4ZZC A;  2X51 A;  1D1B A;  4LF7 T;  2XAF B;  4DV3 T;  4PAG A;  2BVM A;  5JQG E;  4YTP A;  3SFD A;  1Z8U A;  2HPJ A;  4CN6 A;  3P4Q A;  4JI7 T;  3T1H T;  3C4X A;  1SHZ C;  3QK6 A;  4EB6 E;  3AE9 A;  4PK5 A;  4PW8 A;  2HN1 A;  4WNK A;  2L8K A;  5HEH A;  5L3B B;  3IA3 A;  5JH7 E;  3P4S A;  4TNV A;  2KWI B;  4JBW F;  2VUR A;  3ZLI A;  1FMV A;  3P4R A;  3AAE B;  4QH4 A;  4CN1 A;  3ZKR A;  4AQF C;  3M3Z B;  2IUB A;  1IZN B;  3N2K E;  1XZY A;  3UT5 E;  2ZLY A;  4EYY R;  2BG9 A;  4CI1 B;  4EGW A;  2IC6 A;  2WM9 A;  2QGS A;  4DV7 T;  1OED A;  3BQL A;  5AQK B;  4YT0 A;  4YXD A;  1IJ6 A;  4YHH T;  3FHN A;  2WB5 A;  3AE1 A;  4QHO A;  3P7I A;  4MLK A;  4DMV A;  4IHJ E;  4TUY E;  4LF6 T;  2BBH A;  4CXY A;  5J0Z A;  1N32 T;  1BR0 A;  3PUG A;  2DWG A;  3E0Z A;  1S35 A;  4LF9 T;  5LHH B;  5LBM A;  3CWZ B;  3C4Z A;  3NBX X;  3EDU A;  2C5K T;  4DV2 T;  3AE2 A;  3TKL B;  2CEA A;  2E8I A;  3EAB A;  3AXJ B;  3GN5 A;  2WWU A;  4U3C A;  1FIO A;  5L2L A;  4B3S T;  1UUR A;  1BR2 A;  5KXJ A;  2UUA T;  4ILA A;  5HEO A;  3ZST A;  2XAS B;  3D0T A;  1D0X A;  4IE0 A;  3UU8 A;  3OKQ A;  5L3D B;  4X64 T;  5LG3 A;  1SA0 E;  1MMD A;  3IBP A;  1NEN A;  5CGM A;  1YD8 G;  4IDZ A;  2Q9Q A;  4X20 E;  3KFW X;  3AEF A;  4CXW A;  3B5M A;  2XAG B;  5ETW A;  2CXF A;  1HNW T;  3JCF A;  3EUH A;  4I50 E;  3S4U A;  2NW8 A;  3L3P A;  2H89 A;  3HI2 A;  4HFB A;  3T8O A;  2BBJ A;  1LVK A;  3RC8 A;  5JDF A;  2HN2 A;  4EYU A;  3R84 B;  3KV6 A;  2KND A;  5EK4 A;  4AQY T;  5JDQ A;  4ZXL A;  2XAJ B;  3V5S A;  3F57 A;  4DVD A;  4PFO A;  4COF A;  2A72 A;  4U72 A;  5CA1 E;  4GK0 E;  4DV0 T;  1D0Z A;  5JRC A;  3CQC B;  4C90 A;  1NAF A;  2UU9 T;  5JR9 B;  4EZH A;  2LHN A;  2CHN A;  3CX8 B;  1BR1 A;  1KK7 A;  3FZF B;  5AQV B;  2MYS A;  4HWH A;  4HEA A;  4HFH A;  5FP3 A;  3FZH B;  2D5U A;  3PUW F;  1G73 A;  2LOP A;  2X0L B;  3VR9 A;  3UUL A;  2EHO C;  3NRY A;  4BJM A;  4DR7 T;  4U74 A;  4DBR A;  2YDR A;  3ANW B;  3JC6 D;  2CCQ A;  2IW5 B;  4CXX A;  3PTR B;  5C8Y E;  4FI5 A;  2FJD A;  2XQY A;  4MBQ A;  3P8C D;  4AKG A;  3Q5X A;  3UU3 A;  1VOM A;  2X67 A;  4H9S E;  4QXH B;  5AQI B;  1WRD A;  3L39 A;  4JI2 T;  4YSY A;  3ZEF B;  5FXX A;  2ODU A;  2KSR A;  2BKO A;  4UXN B;  1NWM X;  3PUQ A;  2XTL A;  2B1E A;  1HX1 B;  4ISS A;  3F2E A;  4TV9 E;  3LK3 B;  2J4G A;  3C50 A;  5LJM A;  3UUX B;  2D2S A;  1U4Q A;  5FXV A;  2V7K A;  4IRE A;  4A56 A;  1YKE B;  5FY7 A;  4IDO A;  2VVS A;  4IST A;  3AAI A;  1FMW A;  2X68 A;  5LNK A;  2Y48 B;  2B76 A;  4OK0 A;  2HPL A;  5CA0 E;  4IIJ E;  3NKZ A;  2BG9 B;  2RA1 A;  2XAQ B;  1IBK T;  3N2O A;  1GQE A;  4H63 V;  2LKG A;  4LF8 T;  3FZL B;  1OED B;  4JI3 T;  1ZOY A;  5HEG A;  5A1L A;  5FL0 A;  5AQP B;  3CIR A;  2WDV A;  5LG4 A;  3CML A;  3MK7 C;  3RQW A;  4HFI A;  5HEU A;  4CQI A;  3A7M A;  3CX6 B;  2VB6 A;  4HWI B;  3I0O A;  3U3I A;  4IE4 A;  4JEU B;  2IAK A;  2N9D A;  4P1N A;  3MXZ A;  2WDR A;  2W00 A;  4AKR B;  4DR5 T;  3UU5 A;  2UXB T;  2K48 A;  3LK2 B;  3ZYL A;  2BS2 A;  3GN5 B;  4LFB T;  4PJN A;  2D9D A;  2VVN A;  1KNP A;  5LBQ B;  5ABG A;  3B57 A;  2IHR 1;  2XQ3 A;  4KUM B;  3MA9 A;  3PE0 A;  3QOF A;  4WW0 A;  2CE7 A;  4KI0 F;  4Z8X A;  5LYJ E;  2DI4 A;  4U2Z A;  5FXW A;  3ZMU B;  4EOZ B;  4B6X A;  4LML A;  2VQF T;  2XQA A;  1KEY A;  1CUN A;  1T98 A;  2AE9 A;  1IAP A;  3HKD E;  2LEH A;  1HTJ F;  2K24 A;  2CLY B;  2A2F X;  4F6R C;  1W0B A;  1LKX A;  4OYJ A;  2JMK A;  3C51 A;  4TZ4 C;  5C2T A;  4YTN A;  3LG7 A;  4ZHQ E;  4DUZ T;  2W61 A;  1MIW A;  4ZI7 E;  2UXX B;  2XQ5 A;  3ZCI A;  2EHO A;  2BDE A;  4CN4 A;  5JRC B;  1U5P A;  3KVB A;  3RX6 A;  4NIQ A;  3AEE A;  3UTK A;  5JVD E;  4E7Z A;  4GIW A;  2PFV A;  3CK6 A;  4UF0 A;  4A5X A;  4YHJ A;  3RH3 A;  2Q9Q C;  3KV5 A;  2X0H A;  4XZC A;  5AQL B;  4TX5 A;  3RKG A;  2JJ9 A;  2NTX A;  5HAX A;  3RQU A;  3HR0 A;  4I4T E;  3DP7 A;  4HKA A;  4HTE A;  3FB2 A;  4EXT A;  3I9Y A;  4OX9 T;  4I43 B;  2JPF A;  4PJL A;  2NOX A;  1R8I A;  4A97 A;  4KMC A;  2D0U A;  5IYZ E;  1G8X A;  4Z90 A;  2J62 A;  2KZ7 B;  3HKE E;  3ZT5 A;  4EED A;  4TNW A;  3A5X A;  1J5W A;  4H9R C;  2A9U A;  4UVC B;  4H63 H;  3SRZ A;  3WAK A;  5LGN B;  4K0K T;  2P9B A;  3AAA B;  4P0B A;  3NWI A;  5EK2 A;  5DQV A;  2W0G A;  3UFG A;  4HFD A;  5FL1 A;  3RGL A;  4N78 D;  4ILU A;  3PU3 A;  5LMN T;  2XSB A;  2ZM2 A;  4AXP A;  1HG2 A;  2N1G A;  2CPT A;  2CHO A;  4OFZ A;  4EIW A;  5J2U E;  1Y64 B;  1FEW A;  4NPP A;  4C91 A;  3TLS A;  2VAS A;  4X5T A;  2I6H A;  4GOU A;  1T7S A;  2V7I A;  1OWA A;  1MIY A;  5CB4 E;  3OBV E;  3R6N A;  1N34 T;  1XNQ T;  1IJ5 A;  1I94 T;  2X9X A;  2OLT A;  4YSZ A;  3P4P A;  5FKY A;  3ZMS B;  4TWD A;  4JYA T;  3N9P A;  2C5I T;  5FVL A;  2PJQ A;  3RIU C;  1HR0 T;  4AI6 A;  3RYF E;  2V7J A;  2X9W A;  2QVA A;  2X0Y A;  2W62 A;  3ZT7 A;  5AQU B;  5JRE A;  4JI8 T;  1MND A;  3QB5 K;  3L8R A;  1MIV A;  2WY2 A;  2BS4 A;  4BA9 A;  2NW7 A;  3AVR A;  4IT4 A;  5L3E B;  4HFC A;  2XQ8 A;  2X9Y A;  2MOZ A;  4JI0 T;  2CWO A;  3I0Q A;  2CXL A;  3PUA A;  3ONX A;  5HYA A;  3QNU A;  3UU6 A;  4QX7 B;  2LSY A;  2MBG A;  4ADZ A;  1N33 T;  2G0U A;  4ZI3 D;  3AA1 B;  2ACX A;  4TV8 E;  2MTQ A;  2FJE A;  3C64 A;  4CI3 B;  5AQH B;  3ZN1 B;  4CZZ B;  3AA6 B;  1IBL T;  4IL4 A;  1EZ3 A;  3IEE A;  4IDQ A;  5JDM A;  4P0A A;  1US7 B;  5L3G B;  2DL1 A;  4YSX A;  4LFC T;  2HHH T;  3N5L A;  2JQH A;  3DTO A;  2WU5 A;  5LB7 B;  1WYB A;  4QH1 A;  1ZP0 A;  3VRA A;  2EHO B;  3ZMV B;  3PJA J;  3CX7 B;  3SWH A;  4P09 A;  2KWH A;  4O4L E;  3UQ7 A;  3JAF A;  1XNR T;  2WMN A;  4Q25 A;  4UEL A;  2WBL A;  5FYM A;  4UF0 B;  5FVK A;  3O4X E;  1J5E T;  3I9W A;  4DR3 T;  2K3W A;  3W15 B;  3PUS A;  2ACZ A;  1XWM A;  5HWX A;  3RIF A;  1V9D A;  2YEV C;  4L9I A;  1YQ4 A;  4YTM A;  4U7I A;  4IDN A;  2BKN A;  2MAW A;  5LGU B;  4X66 T;  2M6B A;  3M65 A;  4XAX B;  3EHZ A;  3VR8 A;  5KDM C;  1IBM T;  2H3R A;  3J9X 1;  4ZI2 C;  1UCU A;  5LJN A; 
#chains in the Genus database with same CATH homology
 5CJ5 A;  2WWV A;  4U7I A;  5LB7 B;  2WY2 A;  4U31 A;  2A9U A;  5FVK A;  4IT4 A;  4A5X A;  2LRK A;  3EAB A;  3ZSS A;  5FVL A;  3ZT6 A;  5CGM A;  4U3C A;  4CN6 A;  4U2Y A;  2XZE A;  2JQK A;  4U2Z A;  2MPK A;  4CN4 A;  2LRL A;  2K3W A;  1WR0 A;  3ZST A;  4P1N A;  2W2U A;  1YXR A;  4NIQ A;  2CRB A;  2DL1 A;  4ZEY A;  4CN1 A;  4WZX A;  4U33 A;  1WFD A;  3ZT7 A;  2CPT A;  3K1S A;  2JQH A;  2V6X A;  2V6Y B;  2V6Y A;  4U7Y A;  3ZT5 A;  1WCR A;  2JQ9 A;  2RPA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...