4U7IA

Structure of the complex of spartin mit and ist1 mim
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
93
structure length
93
Chain Sequence
b'EPAEIKIIREAYKKAFLFVNKGLNTDELGQKEEAKNYYKQGIGHLLRGISISSKESEHTGPGWESARQMQQKMKETLQNVRTRLEILEKGLAT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Spartin
publication title Distinct Mechanisms of Recognizing Endosomal Sorting Complex Required for Transport III (ESCRT-III) Protein IST1 by Different Microtubule Interacting and Trafficking (MIT) Domains.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 40
structure length 93
sequence length 93
ec nomenclature
pdb deposition date 2014-07-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.280 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Hypothetical protein 1500032h18. 4u7iA00
4U33A 2DL1A 4WZXA 2XZEA 2CRBA 4U2YA 5FVKA 4U3CA 2W2UA 2A9UA 5CJ5A 2JQ9A 2V6YB 4CN1A 1WCRA 1WR0A 2WWVA 2CPTA 5CGMA 2WY2A 2K3WA 4U7YA 3ZT7A 4ZEYA 3ZSTA 2V6YA 3ZT6A 2LRKA 3EABA 4A5XA 4IT4A 2JQHA 2RPAA 2JQKA 4U2ZA 1WFDA 4U31A 4CN6A 3K1SA 3ZSSA 3ZT5A 4CN4A 5FVLA 4P1NA 2V6XA 5LB7B 2MPKA 4U7IA 2LRLA 4NIQA 1YXRA
chains in the Genus database with same CATH superfamily
2Z6EA 2KWHA 2MBGA 3R6NA 4QHOA 2XAHB 2CWOA 3AAAB 2LSKA 2VKHA 2HPLA 1LVKA 2RP4A 3B5MA 1X9BA 2K3WA 2FJAA 1YQ4A 2LEHA 3CK6A 2H7VC 2R6GF 3JADA 1OXZA 4EEDA 4K0KT 3ZYLA 2LM9A 2LLYA 3KV5A 3LBXB 5AQSB 4C91A 3I9YA 5DJQC 2V5CA 2HH7A 5L3GB 3ZMTB 1IZNB 2X0HA 3UT5E 3CVRA 4EOZB 3Q5XA 1ZKEA 3NVOA 2V7MA 3NKZA 1CHUA 3RGLA 5ABFA 5ABHA 3P7IA 2L3LA 5AQFB 3AVSA 5L3FB 3OKQA 2WDVA 3MA9A 2X9XA 4A56A 4XBFB 5FVLA 4QKNA 2AE9A 1HG2A 1N32T 5FXXA 4WBNE 5ETWA 2NOXA 3I0QA 5ABEA 4AI6A 4F8HA 3NZQA 2PBIA 3OJAA 2VQET 3JAFA 2C5JA 4LF5T 3DP7A 3ONXA 2A72A 4AKHA 1Y64B 1WFDA 4CXYA 4DR3T 2K9AA 2XQ5A 2E2AA 5LA6E 5JR9B 3H3MA 4DV3T 5AQVB 2HN2A 4IDNA 2EHOA 2X51A 1XMQT 3F31A 1E2AA 4HTEA 5AQJB 5LG4A 4UIGA 1VCTA 3PUYF 1YQ3A 2YKSA 2WWVA 3ZT7A 1HTJF 2LHRA 2YINA 3PJAJ 3KV9A 2YK0A 3T8OA 2XY8B 1VCSA 2Q9QA 2MTQA 1US7B 4IE7A 4C90A 4AKLA 5FMNA 1HR0T 3OYXA 3OPCA 4OHFA 4JI8T 2L8KA 1HNWT 4BA9A 2K5BB 3ABVA 4X1YE 4XAXB 3NWIA 3ZPOA 1IJ6A 4H9RC 3AAEB 4ILUA 4IE0A 4DR7T 4IE6A 3AXJB 1FMVA 2BG9C 3RYFE 2IHR1 2W61A 5FXVA 5JDMA 3B13A 5JVDE 2VKOA 5H6RB 5E0OA 4P09A 3WAKA 2IDOB 1OWAA 5LMUT 1V9DA 5FXZA 1UUSA 3AVRA 4O8SA 4G63A 1UGOA 2H7OA 4CN4A 5L4HA 1XWMA 5J0ZA 1XDPA 2E9XC 4HGAA 5CJ5A 5IUXA 2CA5A 4DV6T 3ETVA 1N36T 3PUQA 2V6YA 4HFIA 4XZCA 4YTNA 1SUMB 2X68A 2Y6XA 4AKRB 5L4EA 2LRLA 4JI4T 2F4VT 4O4IE 3FBLA 4JYAT 4JI1T 3ANWB 3QB5K 4YHJA 4UVCB 2XSAA 3AEBA 5JDQA 4KBMB 3Q5DA 4ASKA 4ADZA 3VKHA 5EK2A 2V7LA 1Z0PA 4IDOA 4DR6T 3A8YC 1LVFA 4EYUA 5FL1A 3FBZA 3RX6A 2MAWA 3AA1B 3DTOA 1M7KA 4MALA 1MNEA 4KMCA 4HWCA 1WLXA 3AE5A 3FHNA 3KINB 2KT9A 3PU8A 2DNXA 5FY1A 2YEVC 3RYIE 4QXBB 2MOZA 2E8IA 3MKDA 3RKGA 1B7TA 3LK2B 1Y01A 3VKGA 5LJMA 1UX4A 5HYAA 3C4ZA 2K24A 3NZPA 3ONJA 3UU5A 1I6ZA 2XAFB 3IA3A 2CXFA 4QH4A 3FZMB 2V6XA 1T72A 2PJQA 3Q9DA 2FJEA 2XUEA 3EDVA 3RIUA 4MBQA 1HNXT 2KLQA 1MMGA 2CLYB 3OBVE 2V5DA 3K3QC 3IF8B 2RPAA 2FBWA 4JLEA 4E7SA 5HEUA 5ABFB 3N9LA 2QGSA 3IHRA 3HKEE 3L3PA 3S4UA 5EK3A 2CMRA 2PFVA 2LSGA 5FY0A 2ACZA 2XQYA 3SS1A 5AQNB 2JJ9A 4TZ4C 3B57A 2KWIB 1HFAA 4YJ2E 4ZOLE 4LMKA 1I94T 1T98A 2WY2A 4DV5T 3GN5B 2LRKA 2IIUA 5IHYA 1AJ3A 4P0AA 3ZN1B 2DL1A 3RLFF 2V8SV 3J9X1 3CIRA 3PE0A 3CX8B 1WR6A 2XTLA 2XAGB 3KBTA 3QB5A 4N78D 3ETUA 2XQ9A 5J2TE 2Q9QB 3NRXA 3ZCIA 4DBRA 4YFSA 2E9XA 1XDOA 4EXTA 2YDSA 2HN1A 2AXDS 4U2YA 5F3JA 5FP3A 5J2UE 5KMGP 2BVMA 2VL0A 4ZI2D 5F8PA 1O3XA 4CI3B 4OYJA 3ZEFB 3PUSA 3N9MA 3CMLA 3RH3A 5L47A 4OX9T 4AXPA 4PAGA 5LGUB 2CCQA 5KDMC 2JIWA 4ILBA 2VWAA 2VURA 2D0UA 3U3IA 1J1JA 1WR0A 3RYHE 1IBMT 2QA7A 4BJMA 3LFMA 3UQ4A 2H89A 3P4PA 2WZIA 3ESLA 5LB7B 1BR2A 2XASB 4NXNT 1HX1B 2W2UA 4OK0A 1DU2A 2IW5B 3UU4A 3SFDA 2ODVA 1D0YA 1S94A 5LXTE 3VHLA 3BQKA 2J47A 5H6QB 2W4XA 5CFBA 5HEHA 3N2OA 4EIWA 3L8RA 3SRZA 3C51A 5DABA 2HHHT 2UUCT 5JRCB 2WB5A 4EEBA 4QXCB 2P9BA 5LP6E 3R84B 2UXNB 2V7JA 3ZYKA 2IUBA 2BKNA 2WM9A 5HEJA 1R8IA 5JDNA 3FZLB 1XZYA 1NAFA 2UXDT 5HXHA 2BDEA 4E7ZA 3FXEB 3FZFB 3P4SA 4LFBT 3AA7B 3SOLA 5C8YE 2PG8A 4B3MT 4IDZA 5LJNA 1OEDB 3PUXF 3RIAA 4CN1A 3VRAA 4HWDA 5HCJA 2WQYA 5FYMA 4AQYT 3RPUA 3ZN0B 2X9YA 2WCAA 2CRBA 3AE7A 2N1GA 3I1AA 1HF8A 2CHNA 4BJNA 2DLRA 3V5UA 3ZMZB 2WMOA 3DJBA 4UV9B 4ZI3C 3HKDE 2FJBA 2I6HA 2WWUA 1HG5A 3CWZB 2A3DA 1BR1A 2OLTA 4MHCA 5CB4E 4ZZBA 1D1BA 4KHPT 1OEDE 3ZJ2A 4DV4T 4JI0T 1D0XA 4O4LE 4YHHT 3PDYA 3ZKRA 4PK5A 2VL8A 1UURA 5DQWA 3TLVA 4B3TT 2N9DA 4P1NA 2NTXA 2ZM0A 3AECA 3LDQB 4QX8B 3K3NA 3UFEA 4GK0E 4P0BA 5JR9C 3OVUA 4HFBA 4EYYR 4UXNB 3BQIA 4IE4A 5FY7A 4YT0A 3PU3A 4EZ4A 3C98B 3UUMA 4IHJE 4U7IA 3AB3B 2BZBA 3KVBA 3P4RA 3UFGA 5AQKB 2XAQB 2ZM8A 1BR0A 1UX5A 3JAEA 2CXDA 3EABA 3E22E 1SHZC 4U2ZA 4KHZF 2HPJA 5TAOA 4DO0A 5JTGA 4LFCT 1N33T 2LOSA 4L9IA 3N2GE 4Q25A 5C3JA 5AQIB 2QVAA 4LF9T 4I50E 3I0OA 2RA1A 3EI0A 4WW0A 3ZMVB 3BQLA 4U33A 3RC3A 3BK9A 3PUWF 3MXZA 1ZOYA 5J1GA 5LNKA 4B6XA 5FKYA 2XQ4A 3QC9A 4ZI2C 5LCYA 4GIWA 5C2TA 4UVBB 2LOPA 3UUBA 5GONE 2WMNA 5CA0E 2XZEA 1QUUA 3LSVA 4NUUA 1ZHCA 2DWKA 2NW8A 4ANJA 2BVLA 3TLSA 2M6BA 5HAXA 3JC6D 3IEEA 4NUVA 4X20E 4EZHA 4TWDA 3UQ7A 4FI5A 1NEKA 2XQ6A 3T1HT 3ZCJA 2CE7A 4DMWA 4YSYA 4CZZB 5AQUB 2LHNA 4EV6A 5IWAT 2NP9A 2MPKA 4KI0F 3UU3A 1KFYA 1YKEB 4I4TE 5LG3A 2H3RA 4X62T 3LG7A 3TLWA 3LBXA 2L9QA 3OTOT 1LRZA 3MZKB 4B3ST 1FEWA 4JI6T 4TN7B 3C4XA 4X66T 4JUYA 4ZI7E 3AEFA 4ZI3D 3EDUA 3A5XA 2J62A 2NW7A 2NTYA 5AQHB 4GYSA 1HS7A 3PUVF 4IIJE 1QSDA 3AE4A 5AQMB 2XQ3A 2WU2A 2JPFA 4LFAT 5L2LA 4UVAB 4UEMA 1IAPA 2DI4A 1T7SA 5AQRB 3LK42 4PJNA 4DMVA 4HN9A 2VK9A 3C50A 1FMWA 4L5GA 4U31A 2CEAA 2X0YA 2NWBA 4HEAA 2QYWA 3KDSE 2BS3A 3O9XA 1MMNA 2KXPB 4H9OC 1MMDA 5AQPB 4HWFA 2VQFT 5IYZE 4O2AE 2D2SA 4DV2T 5HWYA 3CKDA 3UU8A 4K0UA 2DWGA 1D1CA 3K3OA 4V1Av 3LK3B 2CLYC 4WZXA 2BG9A 1L0VA 4G2AA 2C5KT 5JDGA 4H9QC 2CPTA 4EB6E 3O1JA 2VB6A 2EHOB 1N34T 4X1IE 4M1PA 2IC6A 3UULA 4JI7T 4CXXA 4I0UA 2YN6A 1U4QA 3U78A 5CA1E 4U3CA 4B3RT 2K48A 1LKXA 1HNZT 2JQHA 1KF6A 3TLTA 2CM0A 1KNPA 4HFVA 3SFEA 5HCMA 2WDQA 2ZMAA 3JCFA 4WYVA 5JDFA 3RHWA 2LE8A 3AEDA 5JQGE 2KSRA 5LOVE 4PFPA 3RQWA 4CI1B 4ERRA 1FIOA 2ACXA 5LBQB 2YDQA 4Z91A 4GYRA 4BAYB 1MIWA 3EHZA 2XHEB 2SPCA 4HWIB 2FUPA 2N2NA 1NWMX 1W0AA 4PK4A 1FJGT 3FZKB 3RIFA 3CPZA 5LMNT 4H9SE 2XM2A 2WU5A 4HKAA 4TWFA 2W62A 3ANWA 4YXDA 2W0GA 3CX6B 3GWHA 2WS3A 2XQ8A 3O4XE 3WAJA 4PFOA 3PURA 3ZYMA 5LGNB 1NENA 4AQGA 3AE6A 4ISSA 2V6YB 3AE2A 3AEGA 5LHHB 2YU2A 4JBWF 2XAJB 4HFEA 3SWHA 4Z8XA 1MMAA 4NIQA 5DQVA 2BBHA 4OYKA 1KEYA 4KP3C 4DBQA 3RKOA 1HCIA 3M3ZB 4LF8T 3UUNA 4GOUA 2LSJA 4DV0T 4X65T 2CBJA 3JC6C 4U74A 3AA0B 4LMLA 3PV0F 5FXWA 3N9OA 2ZLYA 1D1AA 2M6IA 4A5XA 1SE7A 2CXLA 1ZP0A 3CQCB 3FXDB 2Y48B 3EAMA 4UELA 4UR9A 3Q5EA 5BMVE 4PJJA 4JI5T 2XQAA 4IDPA 2JQKA 1IJ5A 4O4JE 1S35A 4H9PC 1OEDC 2KMFA 3PUAA 1X79A 5FVKA 2LT3A 3L09A 2X9HA 3CQGB 5AQLB 3M65A 2UXBT 4ISTA 4AQFC 4H63H 3QNUA 4PJLA 4KX6A 1KNZA 3FB2A 1VRBA 2NR4A 2W00A 4X1KE 2X66A 3RRWA 3N9PA 2IMLA 1XMOT 4DV1T 4HFHA 2UUBT 2Y8DA 4A97A 5FL0A 2H88A 4GKKT 3ZJ1A 2X0LB 2CWYA 2JRKA 4QH1A 1XNRT 2V26A 3GN5A 3Q5WA 3CX7B 4LMJA 4TV9E 4LF4T 2VKJA 5JH7E 2J1DG 1W09A 2EHOD 3ONLC 4HFCA 1MIVA 3RF1A 3KVAA 5AQGB 3RIUC 4IT4A 5LGTB 2BG9B 2LSIA 2BKPA 4ZS3A 2D9DA 4TUYE 5EZYE 2Q9QD 2E5LT 1XNQT 3O1HA 4AIUA 1IBKT 4TWHA 1WCRA 3HL6A 4DIDB 2W66A 3PUGA 4A98A 1J5ET 2V7IA 4CN6A 2VKDA 3I9WA 4QWNB 2PTFA 2C5IT 3WI3A 2YDRA 3NBXX 1KNRA 2C0SA 4J2CA 2WDRA 2D5UA 2ODUA 5HXRA 3TKLB 3P50A 4COFA 3MACA 4UF0A 2WAUA 1E1HB 2E9XB 1MIYA 3K1SA 3VU7H 4UV8B 3VR8A 3G06A 2X67A 3F57A 5HXCA 2BG9E 3T1YT 4FJOA 4DR4T 2XPKA 2YOEA 4ZZCA 3W15B 1WRDA 1G8XA 4KUMB 4PK6A 4U7YA 1YXRA 3ZSTA 2BKOA 1YKHB 5L3BB 2W67A 2OA5A 4MFRA 3N5LA 3AE1A 2BBJA 2A2FX 2I0MA 1EZ3A 4DR2T 4ILAA 5JRCA 4QX7B 4YLHA 4IGUA 4JV5T 2DCFA 2DHRA 4PNIA 3KFWX 4X5TA 3D0TA 3F2EA 1Z8UA 3ZC0A 2E5VA 2V7KA 4TV8E 1JNZA 4MLKA 3HA4A 4DVDA 3AE3A 3AAIA 4LF6T 5HEGA 3V5SA 2JQ9A 2WSSV 4TX5A 5CGMA 1W9RA 1OEDA 4PW8A 3HI2A 4WBOA 4AQFA 3KBUA 4ILCA 4YJ3E 4AISA 2KZ7B 5FNVE 2LKHA 2M67A 5JDLA 5JREA 1UCUA 5KX5E 4NXMT 3QUJA 5AQQB 1QLBA 3ZMSB 4ZHQE 3ZSSA 3A7MA 5ABGA 5JDHA 3ZMUB 5AFUL 3UUXB 1G73A 1IBLT 1VOMA 2WZHA 2ES0A 4JEUB 3EUHA 3LJCA 3HKCE 2GK9A 4H63V 3AEEA 2G0UA 1BR4A 1D0ZA 5HXSA 2UXCT 3RRCA 4ZS2A 2UU9T 2UUAT 4Z90A 5JR9A 5A1LA 4YSXA 4HE8A 1M62A 4DNDA 4CXWA 2NW9A 2ZM2A 4H9NC 5HEOA 3ZLIA 2KINB 5M4YA 3QK6A 1YW0A 2VVSA 3AA6B 4JI3T 4YY3T 3MK7C 3X1DA 5AQTB 2OV9A 3UTKA 4IE5A 4GKJT 4I55E 3IBPA 2I59A 4NPPA 3GMIA 4IDQA 3MJXA 3P4WA 1UK5A 3ZT6A 4CQIA 3VRBA 5L3CB 3NRYA 3H3AA 4GK5E 2FJDA 4DV7T 2JMKA 1GQEA 1H7CA 2WBLA 2D0TA 2YU1A 3KV6A 4X64T 3EVYA 2BS4A 3ZC1A 5HXEA 4LF7T 3AXJA 4IREA 3RQUA 5L3EB 2WP9A 2VASA 1WYCA 2CHOA 3CQXC 2XM1A 2UXXB 3L39A 4HWHA 1J5WA 3AE8A 4O2BE 3OYZA 4DR1T 2MYSA 4DR5T 2W63A 5LHGB 2A9UA 5AQOB 4AKIA 3K8PC 1HX8A 2EHOC 5LBMA 1W0BA 3C64A 4IL4A 5HWXA 4YTMA 2ZM6T 3N9QA 1YD8G 4ZXLA 3C4WA 5LHIB 2XJ7A 1MNDA 4F6RC 4YTPA 2E9XD 4WNKA 3RYCE 4IL9A 4QH5A 2J4GA 2LJLA 2Q9QC 1U5PA 2V1DB 2VVNA 4QXHB 5KXJA 2CBIA 4YSZA 4O4HE 4AKGA 2JMHA 3HKBE 4DUYT 1KK7A 4CI2B 2X9WA 5ADXL 3Q2MA 2QRXA 3HR0A 4L0RA 3QOFA 2B76A 3P8CD 4OFZA 4UF0B 5BR8T 5EK4A 1ZV4X 3N9NA 4ZEYA 3FZHB 4TNWA 3RC8A 2KNDA 4DUZT 3VR9A 3UU6A 1WYBA 3N2KE 2JQQA 2BS2A 4I43B 4HFDA 2LKGA 3E0ZA 2XQ7A 3P4QA 3AE9A 2XSBA 3H37A 4U72A 4PJMA 3GA8A 3TLUA 3ZT5A 1T8BA 1E7PA 3AEAA 2LM2A 1ZEEA 1SA0E 4EGWA 2IAKA 3J7Yq 3KV4A 3O1IA 3PJAA 5F5WA 3RI5A 3PUZF 4JEHB 3E08A 1JNRA 5LYJE 5L3DB 2LSYA 1CUNA 2IC9A 3PTRB 4EAHA 2B1EA 4JI2T 4TNVA
chains in the Genus database with same CATH topology
4U33A 2DL1A 4WZXA 2XZEA 2CRBA 4U2YA 5FVKA 4U3CA 2W2UA 2A9UA 5CJ5A 2JQ9A 2V6YB 4CN1A 1WCRA 1WR0A 2WWVA 2CPTA 5CGMA 2WY2A 2K3WA 4U7YA 3ZT7A 4ZEYA 3ZSTA 2V6YA 3ZT6A 2LRKA 3EABA 4A5XA 4IT4A 2JQHA 2RPAA 2JQKA 4U2ZA 1WFDA 4U31A 4CN6A 3K1SA 3ZSSA 3ZT5A 4CN4A 5FVLA 4P1NA 2V6XA 5LB7B 2MPKA 4U7IA 2LRLA 4NIQA 1YXRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4U33 A;  2DL1 A;  4WZX A;  2XZE A;  2CRB A;  4U2Y A;  5FVK A;  4U3C A;  2W2U A;  2A9U A;  5CJ5 A;  2JQ9 A;  2V6Y B;  4CN1 A;  1WCR A;  1WR0 A;  2WWV A;  2CPT A;  5CGM A;  2WY2 A;  2K3W A;  4U7Y A;  3ZT7 A;  4ZEY A;  3ZST A;  2V6Y A;  3ZT6 A;  2LRK A;  3EAB A;  4A5X A;  4IT4 A;  2JQH A;  2RPA A;  2JQK A;  4U2Z A;  1WFD A;  4U31 A;  4CN6 A;  3K1S A;  3ZSS A;  3ZT5 A;  4CN4 A;  5FVL A;  4P1N A;  2V6X A;  5LB7 B;  2MPK A;  4U7I A;  2LRL A;  4NIQ A;  1YXR A; 
#chains in the Genus database with same CATH topology
 2Z6E A;  2KWH A;  2MBG A;  3R6N A;  4QHO A;  2XAH B;  2CWO A;  3AAA B;  2LSK A;  2VKH A;  2HPL A;  1LVK A;  2RP4 A;  3B5M A;  1X9B A;  2K3W A;  2FJA A;  1YQ4 A;  2LEH A;  3CK6 A;  2H7V C;  2R6G F;  3JAD A;  1OXZ A;  4EED A;  4K0K T;  3ZYL A;  2LM9 A;  2LLY A;  3KV5 A;  3LBX B;  5AQS B;  4C91 A;  3I9Y A;  5DJQ C;  2V5C A;  2HH7 A;  5L3G B;  3ZMT B;  1IZN B;  2X0H A;  3UT5 E;  3CVR A;  4EOZ B;  3Q5X A;  1ZKE A;  3NVO A;  2V7M A;  3NKZ A;  1CHU A;  3RGL A;  5ABF A;  5ABH A;  3P7I A;  2L3L A;  5AQF B;  3AVS A;  5L3F B;  3OKQ A;  2WDV A;  3MA9 A;  2X9X A;  4A56 A;  4XBF B;  5FVL A;  4QKN A;  2AE9 A;  1HG2 A;  1N32 T;  5FXX A;  4WBN E;  5ETW A;  2NOX A;  3I0Q A;  5ABE A;  4AI6 A;  4F8H A;  3NZQ A;  2PBI A;  3OJA A;  2VQE T;  3JAF A;  2C5J A;  4LF5 T;  3DP7 A;  3ONX A;  2A72 A;  4AKH A;  1Y64 B;  1WFD A;  4CXY A;  4DR3 T;  2K9A A;  2XQ5 A;  2E2A A;  5LA6 E;  5JR9 B;  3H3M A;  4DV3 T;  5AQV B;  2HN2 A;  4IDN A;  2EHO A;  2X51 A;  1XMQ T;  3F31 A;  1E2A A;  4HTE A;  5AQJ B;  5LG4 A;  4UIG A;  1VCT A;  3PUY F;  1YQ3 A;  2YKS A;  2WWV A;  3ZT7 A;  1HTJ F;  2LHR A;  2YIN A;  3PJA J;  3KV9 A;  2YK0 A;  3T8O A;  2XY8 B;  1VCS A;  2Q9Q A;  2MTQ A;  1US7 B;  4IE7 A;  4C90 A;  4AKL A;  5FMN A;  1HR0 T;  3OYX A;  3OPC A;  4OHF A;  4JI8 T;  2L8K A;  1HNW T;  4BA9 A;  2K5B B;  3ABV A;  4X1Y E;  4XAX B;  3NWI A;  3ZPO A;  1IJ6 A;  4H9R C;  3AAE B;  4ILU A;  4IE0 A;  4DR7 T;  4IE6 A;  3AXJ B;  1FMV A;  2BG9 C;  3RYF E;  2IHR 1;  2W61 A;  5FXV A;  5JDM A;  3B13 A;  5JVD E;  2VKO A;  5H6R B;  5E0O A;  4P09 A;  3WAK A;  2IDO B;  1OWA A;  5LMU T;  1V9D A;  5FXZ A;  1UUS A;  3AVR A;  4O8S A;  4G63 A;  1UGO A;  2H7O A;  4CN4 A;  5L4H A;  1XWM A;  5J0Z A;  1XDP A;  2E9X C;  4HGA A;  5CJ5 A;  5IUX A;  2CA5 A;  4DV6 T;  3ETV A;  1N36 T;  3PUQ A;  2V6Y A;  4HFI A;  4XZC A;  4YTN A;  1SUM B;  2X68 A;  2Y6X A;  4AKR B;  5L4E A;  2LRL A;  4JI4 T;  2F4V T;  4O4I E;  3FBL A;  4JYA T;  4JI1 T;  3ANW B;  3QB5 K;  4YHJ A;  4UVC B;  2XSA A;  3AEB A;  5JDQ A;  4KBM B;  3Q5D A;  4ASK A;  4ADZ A;  3VKH A;  5EK2 A;  2V7L A;  1Z0P A;  4IDO A;  4DR6 T;  3A8Y C;  1LVF A;  4EYU A;  5FL1 A;  3FBZ A;  3RX6 A;  2MAW A;  3AA1 B;  3DTO A;  1M7K A;  4MAL A;  1MNE A;  4KMC A;  4HWC A;  1WLX A;  3AE5 A;  3FHN A;  3KIN B;  2KT9 A;  3PU8 A;  2DNX A;  5FY1 A;  2YEV C;  3RYI E;  4QXB B;  2MOZ A;  2E8I A;  3MKD A;  3RKG A;  1B7T A;  3LK2 B;  1Y01 A;  3VKG A;  5LJM A;  1UX4 A;  5HYA A;  3C4Z A;  2K24 A;  3NZP A;  3ONJ A;  3UU5 A;  1I6Z A;  2XAF B;  3IA3 A;  2CXF A;  4QH4 A;  3FZM B;  2V6X A;  1T72 A;  2PJQ A;  3Q9D A;  2FJE A;  2XUE A;  3EDV A;  3RIU A;  4MBQ A;  1HNX T;  2KLQ A;  1MMG A;  2CLY B;  3OBV E;  2V5D A;  3K3Q C;  3IF8 B;  2RPA A;  2FBW A;  4JLE A;  4E7S A;  5HEU A;  5ABF B;  3N9L A;  2QGS A;  3IHR A;  3HKE E;  3L3P A;  3S4U A;  5EK3 A;  2CMR A;  2PFV A;  2LSG A;  5FY0 A;  2ACZ A;  2XQY A;  3SS1 A;  5AQN B;  2JJ9 A;  4TZ4 C;  3B57 A;  2KWI B;  1HFA A;  4YJ2 E;  4ZOL E;  4LMK A;  1I94 T;  1T98 A;  2WY2 A;  4DV5 T;  3GN5 B;  2LRK A;  2IIU A;  5IHY A;  1AJ3 A;  4P0A A;  3ZN1 B;  2DL1 A;  3RLF F;  2V8S V;  3J9X 1;  3CIR A;  3PE0 A;  3CX8 B;  1WR6 A;  2XTL A;  2XAG B;  3KBT A;  3QB5 A;  4N78 D;  3ETU A;  2XQ9 A;  5J2T E;  2Q9Q B;  3NRX A;  3ZCI A;  4DBR A;  4YFS A;  2E9X A;  1XDO A;  4EXT A;  2YDS A;  2HN1 A;  2AXD S;  4U2Y A;  5F3J A;  5FP3 A;  5J2U E;  5KMG P;  2BVM A;  2VL0 A;  4ZI2 D;  5F8P A;  1O3X A;  4CI3 B;  4OYJ A;  3ZEF B;  3PUS A;  3N9M A;  3CML A;  3RH3 A;  5L47 A;  4OX9 T;  4AXP A;  4PAG A;  5LGU B;  2CCQ A;  5KDM C;  2JIW A;  4ILB A;  2VWA A;  2VUR A;  2D0U A;  3U3I A;  1J1J A;  1WR0 A;  3RYH E;  1IBM T;  2QA7 A;  4BJM A;  3LFM A;  3UQ4 A;  2H89 A;  3P4P A;  2WZI A;  3ESL A;  5LB7 B;  1BR2 A;  2XAS B;  4NXN T;  1HX1 B;  2W2U A;  4OK0 A;  1DU2 A;  2IW5 B;  3UU4 A;  3SFD A;  2ODV A;  1D0Y A;  1S94 A;  5LXT E;  3VHL A;  3BQK A;  2J47 A;  5H6Q B;  2W4X A;  5CFB A;  5HEH A;  3N2O A;  4EIW A;  3L8R A;  3SRZ A;  3C51 A;  5DAB A;  2HHH T;  2UUC T;  5JRC B;  2WB5 A;  4EEB A;  4QXC B;  2P9B A;  5LP6 E;  3R84 B;  2UXN B;  2V7J A;  3ZYK A;  2IUB A;  2BKN A;  2WM9 A;  5HEJ A;  1R8I A;  5JDN A;  3FZL B;  1XZY A;  1NAF A;  2UXD T;  5HXH A;  2BDE A;  4E7Z A;  3FXE B;  3FZF B;  3P4S A;  4LFB T;  3AA7 B;  3SOL A;  5C8Y E;  2PG8 A;  4B3M T;  4IDZ A;  5LJN A;  1OED B;  3PUX F;  3RIA A;  4CN1 A;  3VRA A;  4HWD A;  5HCJ A;  2WQY A;  5FYM A;  4AQY T;  3RPU A;  3ZN0 B;  2X9Y A;  2WCA A;  2CRB A;  3AE7 A;  2N1G A;  3I1A A;  1HF8 A;  2CHN A;  4BJN A;  2DLR A;  3V5U A;  3ZMZ B;  2WMO A;  3DJB A;  4UV9 B;  4ZI3 C;  3HKD E;  2FJB A;  2I6H A;  2WWU A;  1HG5 A;  3CWZ B;  2A3D A;  1BR1 A;  2OLT A;  4MHC A;  5CB4 E;  4ZZB A;  1D1B A;  4KHP T;  1OED E;  3ZJ2 A;  4DV4 T;  4JI0 T;  1D0X A;  4O4L E;  4YHH T;  3PDY A;  3ZKR A;  4PK5 A;  2VL8 A;  1UUR A;  5DQW A;  3TLV A;  4B3T T;  2N9D A;  4P1N A;  2NTX A;  2ZM0 A;  3AEC A;  3LDQ B;  4QX8 B;  3K3N A;  3UFE A;  4GK0 E;  4P0B A;  5JR9 C;  3OVU A;  4HFB A;  4EYY R;  4UXN B;  3BQI A;  4IE4 A;  5FY7 A;  4YT0 A;  3PU3 A;  4EZ4 A;  3C98 B;  3UUM A;  4IHJ E;  4U7I A;  3AB3 B;  2BZB A;  3KVB A;  3P4R A;  3UFG A;  5AQK B;  2XAQ B;  2ZM8 A;  1BR0 A;  1UX5 A;  3JAE A;  2CXD A;  3EAB A;  3E22 E;  1SHZ C;  4U2Z A;  4KHZ F;  2HPJ A;  5TAO A;  4DO0 A;  5JTG A;  4LFC T;  1N33 T;  2LOS A;  4L9I A;  3N2G E;  4Q25 A;  5C3J A;  5AQI B;  2QVA A;  4LF9 T;  4I50 E;  3I0O A;  2RA1 A;  3EI0 A;  4WW0 A;  3ZMV B;  3BQL A;  4U33 A;  3RC3 A;  3BK9 A;  3PUW F;  3MXZ A;  1ZOY A;  5J1G A;  5LNK A;  4B6X A;  5FKY A;  2XQ4 A;  3QC9 A;  4ZI2 C;  5LCY A;  4GIW A;  5C2T A;  4UVB B;  2LOP A;  3UUB A;  5GON E;  2WMN A;  5CA0 E;  2XZE A;  1QUU A;  3LSV A;  4NUU A;  1ZHC A;  2DWK A;  2NW8 A;  4ANJ A;  2BVL A;  3TLS A;  2M6B A;  5HAX A;  3JC6 D;  3IEE A;  4NUV A;  4X20 E;  4EZH A;  4TWD A;  3UQ7 A;  4FI5 A;  1NEK A;  2XQ6 A;  3T1H T;  3ZCJ A;  2CE7 A;  4DMW A;  4YSY A;  4CZZ B;  5AQU B;  2LHN A;  4EV6 A;  5IWA T;  2NP9 A;  2MPK A;  4KI0 F;  3UU3 A;  1KFY A;  1YKE B;  4I4T E;  5LG3 A;  2H3R A;  4X62 T;  3LG7 A;  3TLW A;  3LBX A;  2L9Q A;  3OTO T;  1LRZ A;  3MZK B;  4B3S T;  1FEW A;  4JI6 T;  4TN7 B;  3C4X A;  4X66 T;  4JUY A;  4ZI7 E;  3AEF A;  4ZI3 D;  3EDU A;  3A5X A;  2J62 A;  2NW7 A;  2NTY A;  5AQH B;  4GYS A;  1HS7 A;  3PUV F;  4IIJ E;  1QSD A;  3AE4 A;  5AQM B;  2XQ3 A;  2WU2 A;  2JPF A;  4LFA T;  5L2L A;  4UVA B;  4UEM A;  1IAP A;  2DI4 A;  1T7S A;  5AQR B;  3LK4 2;  4PJN A;  4DMV A;  4HN9 A;  2VK9 A;  3C50 A;  1FMW A;  4L5G A;  4U31 A;  2CEA A;  2X0Y A;  2NWB A;  4HEA A;  2QYW A;  3KDS E;  2BS3 A;  3O9X A;  1MMN A;  2KXP B;  4H9O C;  1MMD A;  5AQP B;  4HWF A;  2VQF T;  5IYZ E;  4O2A E;  2D2S A;  4DV2 T;  5HWY A;  3CKD A;  3UU8 A;  4K0U A;  2DWG A;  1D1C A;  3K3O A;  4V1A v;  3LK3 B;  2CLY C;  4WZX A;  2BG9 A;  1L0V A;  4G2A A;  2C5K T;  5JDG A;  4H9Q C;  2CPT A;  4EB6 E;  3O1J A;  2VB6 A;  2EHO B;  1N34 T;  4X1I E;  4M1P A;  2IC6 A;  3UUL A;  4JI7 T;  4CXX A;  4I0U A;  2YN6 A;  1U4Q A;  3U78 A;  5CA1 E;  4U3C A;  4B3R T;  2K48 A;  1LKX A;  1HNZ T;  2JQH A;  1KF6 A;  3TLT A;  2CM0 A;  1KNP A;  4HFV A;  3SFE A;  5HCM A;  2WDQ A;  2ZMA A;  3JCF A;  4WYV A;  5JDF A;  3RHW A;  2LE8 A;  3AED A;  5JQG E;  2KSR A;  5LOV E;  4PFP A;  3RQW A;  4CI1 B;  4ERR A;  1FIO A;  2ACX A;  5LBQ B;  2YDQ A;  4Z91 A;  4GYR A;  4BAY B;  1MIW A;  3EHZ A;  2XHE B;  2SPC A;  4HWI B;  2FUP A;  2N2N A;  1NWM X;  1W0A A;  4PK4 A;  1FJG T;  3FZK B;  3RIF A;  3CPZ A;  5LMN T;  4H9S E;  2XM2 A;  2WU5 A;  4HKA A;  4TWF A;  2W62 A;  3ANW A;  4YXD A;  2W0G A;  3CX6 B;  3GWH A;  2WS3 A;  2XQ8 A;  3O4X E;  3WAJ A;  4PFO A;  3PUR A;  3ZYM A;  5LGN B;  1NEN A;  4AQG A;  3AE6 A;  4ISS A;  2V6Y B;  3AE2 A;  3AEG A;  5LHH B;  2YU2 A;  4JBW F;  2XAJ B;  4HFE A;  3SWH A;  4Z8X A;  1MMA A;  4NIQ A;  5DQV A;  2BBH A;  4OYK A;  1KEY A;  4KP3 C;  4DBQ A;  3RKO A;  1HCI A;  3M3Z B;  4LF8 T;  3UUN A;  4GOU A;  2LSJ A;  4DV0 T;  4X65 T;  2CBJ A;  3JC6 C;  4U74 A;  3AA0 B;  4LML A;  3PV0 F;  5FXW A;  3N9O A;  2ZLY A;  1D1A A;  2M6I A;  4A5X A;  1SE7 A;  2CXL A;  1ZP0 A;  3CQC B;  3FXD B;  2Y48 B;  3EAM A;  4UEL A;  4UR9 A;  3Q5E A;  5BMV E;  4PJJ A;  4JI5 T;  2XQA A;  4IDP A;  2JQK A;  1IJ5 A;  4O4J E;  1S35 A;  4H9P C;  1OED C;  2KMF A;  3PUA A;  1X79 A;  5FVK A;  2LT3 A;  3L09 A;  2X9H A;  3CQG B;  5AQL B;  3M65 A;  2UXB T;  4IST A;  4AQF C;  4H63 H;  3QNU A;  4PJL A;  4KX6 A;  1KNZ A;  3FB2 A;  1VRB A;  2NR4 A;  2W00 A;  4X1K E;  2X66 A;  3RRW A;  3N9P A;  2IML A;  1XMO T;  4DV1 T;  4HFH A;  2UUB T;  2Y8D A;  4A97 A;  5FL0 A;  2H88 A;  4GKK T;  3ZJ1 A;  2X0L B;  2CWY A;  2JRK A;  4QH1 A;  1XNR T;  2V26 A;  3GN5 A;  3Q5W A;  3CX7 B;  4LMJ A;  4TV9 E;  4LF4 T;  2VKJ A;  5JH7 E;  2J1D G;  1W09 A;  2EHO D;  3ONL C;  4HFC A;  1MIV A;  3RF1 A;  3KVA A;  5AQG B;  3RIU C;  4IT4 A;  5LGT B;  2BG9 B;  2LSI A;  2BKP A;  4ZS3 A;  2D9D A;  4TUY E;  5EZY E;  2Q9Q D;  2E5L T;  1XNQ T;  3O1H A;  4AIU A;  1IBK T;  4TWH A;  1WCR A;  3HL6 A;  4DID B;  2W66 A;  3PUG A;  4A98 A;  1J5E T;  2V7I A;  4CN6 A;  2VKD A;  3I9W A;  4QWN B;  2PTF A;  2C5I T;  3WI3 A;  2YDR A;  3NBX X;  1KNR A;  2C0S A;  4J2C A;  2WDR A;  2D5U A;  2ODU A;  5HXR A;  3TKL B;  3P50 A;  4COF A;  3MAC A;  4UF0 A;  2WAU A;  1E1H B;  2E9X B;  1MIY A;  3K1S A;  3VU7 H;  4UV8 B;  3VR8 A;  3G06 A;  2X67 A;  3F57 A;  5HXC A;  2BG9 E;  3T1Y T;  4FJO A;  4DR4 T;  2XPK A;  2YOE A;  4ZZC A;  3W15 B;  1WRD A;  1G8X A;  4KUM B;  4PK6 A;  4U7Y A;  1YXR A;  3ZST A;  2BKO A;  1YKH B;  5L3B B;  2W67 A;  2OA5 A;  4MFR A;  3N5L A;  3AE1 A;  2BBJ A;  2A2F X;  2I0M A;  1EZ3 A;  4DR2 T;  4ILA A;  5JRC A;  4QX7 B;  4YLH A;  4IGU A;  4JV5 T;  2DCF A;  2DHR A;  4PNI A;  3KFW X;  4X5T A;  3D0T A;  3F2E A;  1Z8U A;  3ZC0 A;  2E5V A;  2V7K A;  4TV8 E;  1JNZ A;  4MLK A;  3HA4 A;  4DVD A;  3AE3 A;  3AAI A;  4LF6 T;  5HEG A;  3V5S A;  2JQ9 A;  2WSS V;  4TX5 A;  5CGM A;  1W9R A;  1OED A;  4PW8 A;  3HI2 A;  4WBO A;  4AQF A;  3KBU A;  4ILC A;  4YJ3 E;  4AIS A;  2KZ7 B;  5FNV E;  2LKH A;  2M67 A;  5JDL A;  5JRE A;  1UCU A;  5KX5 E;  4NXM T;  3QUJ A;  5AQQ B;  1QLB A;  3ZMS B;  4ZHQ E;  3ZSS A;  3A7M A;  5ABG A;  5JDH A;  3ZMU B;  5AFU L;  3UUX B;  1G73 A;  1IBL T;  1VOM A;  2WZH A;  2ES0 A;  4JEU B;  3EUH A;  3LJC A;  3HKC E;  2GK9 A;  4H63 V;  3AEE A;  2G0U A;  1BR4 A;  1D0Z A;  5HXS A;  2UXC T;  3RRC A;  4ZS2 A;  2UU9 T;  2UUA T;  4Z90 A;  5JR9 A;  5A1L A;  4YSX A;  4HE8 A;  1M62 A;  4DND A;  4CXW A;  2NW9 A;  2ZM2 A;  4H9N C;  5HEO A;  3ZLI A;  2KIN B;  5M4Y A;  3QK6 A;  1YW0 A;  2VVS A;  3AA6 B;  4JI3 T;  4YY3 T;  3MK7 C;  3X1D A;  5AQT B;  2OV9 A;  3UTK A;  4IE5 A;  4GKJ T;  4I55 E;  3IBP A;  2I59 A;  4NPP A;  3GMI A;  4IDQ A;  3MJX A;  3P4W A;  1UK5 A;  3ZT6 A;  4CQI A;  3VRB A;  5L3C B;  3NRY A;  3H3A A;  4GK5 E;  2FJD A;  4DV7 T;  2JMK A;  1GQE A;  1H7C A;  2WBL A;  2D0T A;  2YU1 A;  3KV6 A;  4X64 T;  3EVY A;  2BS4 A;  3ZC1 A;  5HXE A;  4LF7 T;  3AXJ A;  4IRE A;  3RQU A;  5L3E B;  2WP9 A;  2VAS A;  1WYC A;  2CHO A;  3CQX C;  2XM1 A;  2UXX B;  3L39 A;  4HWH A;  1J5W A;  3AE8 A;  4O2B E;  3OYZ A;  4DR1 T;  2MYS A;  4DR5 T;  2W63 A;  5LHG B;  2A9U A;  5AQO B;  4AKI A;  3K8P C;  1HX8 A;  2EHO C;  5LBM A;  1W0B A;  3C64 A;  4IL4 A;  5HWX A;  4YTM A;  2ZM6 T;  3N9Q A;  1YD8 G;  4ZXL A;  3C4W A;  5LHI B;  2XJ7 A;  1MND A;  4F6R C;  4YTP A;  2E9X D;  4WNK A;  3RYC E;  4IL9 A;  4QH5 A;  2J4G A;  2LJL A;  2Q9Q C;  1U5P A;  2V1D B;  2VVN A;  4QXH B;  5KXJ A;  2CBI A;  4YSZ A;  4O4H E;  4AKG A;  2JMH A;  3HKB E;  4DUY T;  1KK7 A;  4CI2 B;  2X9W A;  5ADX L;  3Q2M A;  2QRX A;  3HR0 A;  4L0R A;  3QOF A;  2B76 A;  3P8C D;  4OFZ A;  4UF0 B;  5BR8 T;  5EK4 A;  1ZV4 X;  3N9N A;  4ZEY A;  3FZH B;  4TNW A;  3RC8 A;  2KND A;  4DUZ T;  3VR9 A;  3UU6 A;  1WYB A;  3N2K E;  2JQQ A;  2BS2 A;  4I43 B;  4HFD A;  2LKG A;  3E0Z A;  2XQ7 A;  3P4Q A;  3AE9 A;  2XSB A;  3H37 A;  4U72 A;  4PJM A;  3GA8 A;  3TLU A;  3ZT5 A;  1T8B A;  1E7P A;  3AEA A;  2LM2 A;  1ZEE A;  1SA0 E;  4EGW A;  2IAK A;  3J7Y q;  3KV4 A;  3O1I A;  3PJA A;  5F5W A;  3RI5 A;  3PUZ F;  4JEH B;  3E08 A;  1JNR A;  5LYJ E;  5L3D B;  2LSY A;  1CUN A;  2IC9 A;  3PTR B;  4EAH A;  2B1E A;  4JI2 T;  4TNV A; 
#chains in the Genus database with same CATH homology
 4U33 A;  2DL1 A;  4WZX A;  2XZE A;  2CRB A;  4U2Y A;  5FVK A;  4U3C A;  2W2U A;  2A9U A;  5CJ5 A;  2JQ9 A;  2V6Y B;  4CN1 A;  1WCR A;  1WR0 A;  2WWV A;  2CPT A;  5CGM A;  2WY2 A;  2K3W A;  4U7Y A;  3ZT7 A;  4ZEY A;  3ZST A;  2V6Y A;  3ZT6 A;  2LRK A;  3EAB A;  4A5X A;  4IT4 A;  2JQH A;  2RPA A;  2JQK A;  4U2Z A;  1WFD A;  4U31 A;  4CN6 A;  3K1S A;  3ZSS A;  3ZT5 A;  4CN4 A;  5FVL A;  4P1N A;  2V6X A;  5LB7 B;  2MPK A;  4U7I A;  2LRL A;  4NIQ A;  1YXR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...