4HWFA

Crystal structure of atbag3
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
87
structure length
87
Chain Sequence
SASKSISDISFEVDRLAGQVSAFETVINKGGKVEEKSLVNLIEMLMNQLLRLDAIIADGDVKLMRKMQVQRVQKYVEALDLLKVKNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords BAG family molecular chaperone regulator 3
publication title Structural insight into plant programmed cell death mediated by BAG proteins in Arabidopsis thaliana.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Apoptosis
total genus 37
structure length 87
sequence length 87
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02179 BAG BAG domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.120 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 BAG domain 4hwfA00
4HWCA 4HWIB 5AQOB 2D9DA 3FZLB 5AQVB 5AQMB 5AQTB 1UGOA 5AQGB 3M3ZB 3FZMB 5AQUB 5AQPB 1T7SA 4HWFA 5AQSB 5AQHB 5AQRB 3FZHB 5AQQB 3FZFB 5AQNB 3FZKB 5AQJB 5AQLB 5AQFB 3LDQB 1I6ZA 1M7KA 1UK5A 5AQKB 1HX1B 3A8YC 4HWDA 4HWHA 5AQIB 1M62A
chains in the Genus database with same CATH superfamily
2XAQB 2VVSA 4UVBB 4P1NA 4O4JE 3O1HA 2V7KA 3ZC0A 3IA3A 2KNDA 2QA7A 1OEDB 3CVRA 4LF5T 4P0BA 1AJ3A 3M65A 2NR4A 4TWDA 3RIUA 2XHEB 2UUBT 1KFYA 2VWAA 2IW5B 3ZKRA 2WMNA 4UELA 3PU3A 2CBIA 3RYCE 3NWIA 4AI6A 4UXNB 1MNDA 4V1Av 4OX9T 3EDUA 1H7CA 5HXCA 2CPTA 3T1YT 4HWFA 4LMLA 3V5UA 4XZCA 4BJMA 4QH4A 1I6ZA 3T1HT 4OYJA 4CXWA 1YXRA 2DI4A 4HN9A 1MIYA 4DV2T 3RIAA 5IYZE 5LHIB 1UGOA 3FXDB 4YTMA 2X0LB 1CUNA 2E9XB 4YHJA 1HG5A 2A2FX 3UFGA 1XZYA 1XMOT 1XNRT 2WQYA 3RLFF 4JI2T 4XAXB 4LF6T 3WI3A 4IDZA 4DMWA 2RA1A 3P8CD 3H3MA 1HF8A 3E08A 3B57A 5HEGA 3JCFA 4HWDA 4EIWA 4ZZCA 2IC9A 1D1AA 2L8KA 2FBWA 4YY3T 2V26A 3AEGA 1B7TA 3MJXA 4JLEA 5AQRB 4WW0A 4JV5T 5LNKA 5CGMA 4NUVA 5AQJB 2VASA 3CQGB 3LDQB 4XBFB 1QUUA 2ZM0A 1KK7A 4AKIA 4JBWF 2BS2A 2CRBA 2C0SA 4FJOA 2E9XD 3P4WA 5L3EB 4O4LE 4EOZB 3EAMA 5AQPB 4H63H 3NVOA 3SS1A 3NZPA 4EV6A 2UXXB 1W09A 4DR7T 5AQKB 2I59A 2VKHA 4IL9A 4E7SA 3HKEE 4QXBB 3FZLB 1KF6A 1UUSA 2YINA 3HR0A 3ONJA 4CN4A 3RYIE 2LSKA 2MAWA 5H6RB 3ONLC 3GN5B 4B3RT 4UVCB 4BJNA 2X9XA 1J5ET 1T72A 5HCJA 4TN7B 5AQIB 5JDLA 4CN6A 4JEUB 5LHGB 4DR1T 5JH7E 2XPKA 1CHUA 1HG2A 3TLWA 5LGUB 4A98A 2X0YA 5AQNB 1VRBA 4TV8E 5HAXA 3FBLA 4I4TE 3VHLA 3R6NA 1FMWA 3AE7A 4JI6T 2BVLA 2RP4A 2LOSA 2X9YA 3PTRB 5J0ZA 3UU6A 5HWXA 1U5PA 2UUCT 5LHHB 4EGWA 2CCQA 4DV3T 4NIQA 5JDHA 2C5KT 2WDQA 2Y8DA 3PURA 4HFCA 4ZS2A 2CBJA 2X68A 4L5GA 5KMGP 2YU2A 5AQOB 1Z8UA 3Q5XA 3VKGA 2ODUA 2OLTA 2XQ4A 1W0BA 4YHHT 4OFZA 3ZSSA 2KSRA 3LJCA 3QUJA 3HKBE 2CHOA 4X62T 5FXXA 4IDOA 4A5XA 4AKRB 2ES0A 1FMVA 3ZSTA 1SUMB 4PFOA 3FZKB 3C98B 1IAPA 2Q9QA 4U7YA 2XM1A 1BR1A 3PUVF 4IE4A 2NTYA 5BR8T 3Q5WA 2W61A 3FZHB 4B3TT 4NUUA 3C51A 3C50A 2V7JA 3PJAA 3TLVA 2VVNA 4YLHA 3CKDA 1DU2A 2V5DA 2JPFA 3EHZA 3KBUA 3AVRA 3ZMVB 3QB5K 1R8IA 3Q9DA 3ZYMA 2AE9A 2NWBA 4HTEA 3PJAJ 1S35A 2LJLA 3JC6C 4EZHA 5LGTB 2EHOC 1UX4A 3RKOA 2XAGB 4GK5E 5LMNT 2J47A 2X67A 2J62A 4AKGA 3K8PC 2W2UA 4M1PA 4UF0A 2HPJA 4IE5A 2ODVA 4IT4A 2XQ3A 4Q25A 4TZ4C 5AQLB 2B1EA 5JR9B 2LM2A 2EHOA 2ZM8A 1IBLT 2JMHA 2W67A 5FXVA 5LJNA 2LRLA 2V6XA 3PUGA 3MXZA 2IDOB 2VKDA 3QB5A 5AQSB 4ASKA 4DO0A 5EK4A 5HYAA 1ZOYA 3AEFA 3RF1A 2BBJA 4DNDA 5EK3A 3EI0A 5GONE 1BR4A 3ZLIA 5AQGB 3RC3A 4ZI3D 2KINB 4QHOA 4GYSA 1Z0PA 4DR2T 5JTGA 1L0VA 1VCSA 3KDSE 5AFUL 2LM9A 5FY0A 3RQUA 3AE1A 2DHRA 1O3XA 3U3IA 1D1CA 4NXMT 1QSDA 4U74A 5F8PA 3RHWA 4K0KT 2VL8A 3OKQA 2Z6EA 4LF8T 1D0XA 5AQFB 2H3RA 3C64A 3MK7C 3UUMA 3ZJ1A 4WBOA 1IJ5A 5LMUT 4HWIB 4I55E 4PNIA 5IHYA 2BKNA 2FUPA 3E0ZA 4HEAA 3IHRA 3N9NA 2I6HA 2NW7A 3LG7A 2R6GF 3DJBA 5HXEA 4CQIA 3PDYA 2D0TA 4CN1A 4ISSA 3ANWA 3P4QA 3C4XA 1HNXT 3UT5E 4JI0T 3CWZB 2CLYC 1FEWA 3AEDA 2WAUA 4H9OC 4Z8XA 3PUWF 1IZNB 4Z91A 3OVUA 4CZZB 2B76A 3ZC1A 2JMKA 3R84B 3D0TA 2E5LT 3OTOT 5JDFA 2KWHA 3VRBA 5LB7B 3PUQA 2NW9A 3ZYKA 3AXJB 2YDQA 2FJDA 5HEHA 1KNPA 3AA7B 5ABFA 3P50A 2BVMA 3LFMA 4TNWA 4E7ZA 3LK42 2CA5A 4CI2B 5CFBA 5JDMA 3AAIA 5FY7A 1JNZA 2ZMAA 2IAKA 3RIFA 4AQFA 2MTQA 1BR0A 3ABVA 3N5LA 1S94A 1XWMA 5ABGA 1SHZC 3UQ7A 2E2AA 3AA0B 2OV9A 5FL0A 5J2TE 4FI5A 4AQGA 4L0RA 5ETWA 4O2BE 4F6RC 3VR8A 4DBRA 2XQ6A 2W00A 4PK5A 1X9BA 5EZYE 2D2SA 4PJJA 3I9WA 2KMFA 3O1IA 2WY2A 2LEHA 2PG8A 2M6IA 1D0YA 2W0GA 4EXTA 1M7KA 1ZHCA 4MFRA 3P4SA 2BG9C 2JQKA 4EZ4A 5A1LA 3VU7H 2XAJB 5HCMA 2AXDS 3WAJA 3HI2A 4PJNA 3HL6A 4O4HE 4ZHQE 3OYZA 2V7LA 2JIWA 4EYYR 2K9AA 2W63A 4KX6A 5HEOA 4BA9A 2BG9A 3J7Yq 3FBZA 3S4UA 1YKHB 4KUMB 5C3JA 2Y48B 5E0OA 2BG9E 1KEYA 1OEDC 4TV9E 4X20E 2P9BA 1WLXA 3RRWA 2YDRA 4P09A 3AE6A 2JQHA 4DIDB 3UTKA 5FXWA 2L9QA 1HCIA 2XQ8A 5JRCB 2DL1A 2CXFA 1MIWA 3GMIA 3AAEB 2MYSA 4UV8B 2KT9A 2WZIA 1XDPA 1OEDA 3HKCE 2DLRA 1OWAA 2KWIB 2MBGA 2HHHT 2V7MA 3RGLA 5LXTE 3SRZA 3RC8A 4PJMA 1YD8G 1OEDE 2KZ7B 1T7SA 1UX5A 2XY8B 2CWYA 4IIJE 5LG3A 1IJ6A 4EAHA 4MHCA 3AE4A 2H7OA 2VKJA 3EDVA 4MLKA 1HX1B 4JYAT 3OYXA 4JI5T 2V1DB 1HR0T 4UV9B 3K3NA 4LF7T 4IDNA 3Q2MA 1LKXA 3CX7B 2Q9QB 2G0UA 4IDPA 3UU8A 2XQYA 4WYVA 3IEEA 1OXZA 1WR6A 2E9XC 2XASB 3MACA 3BQLA 4DV4T 4HGAA 2X9HA 5IUXA 4X1KE 1SE7A 3TLTA 5ADXL 3UU5A 5C8YE 2CE7A 1ZP0A 2WDRA 3QNUA 2H7VC 2V6YA 4IGUA 3RI5A 4ISTA 4YTNA 4EEBA 5F5WA 3PU8A 3EABA 1MNEA 3NZQA 2JQ9A 3ZMZB 2K24A 3PUYF 3AEEA 3N2GE 3ZYLA 4KP3C 3MKDA 3B13A 4O8SA 3ZMSB 4G2AA 4GYRA 4ZOLE 4A56A 3AAAB 4DBQA 2QRXA 3FZFB 2MOZA 2N9DA 4DUZT 4PK6A 2LSYA 4AXPA 4AIUA 3BK9A 5CA1E 1XNQT 4HWCA 3MA9A 1XMQT 2WCAA 2Q9QD 5F3JA 4ERRA 2J1DG 3OPCA 4ZXLA 3RKGA 3ZJ2A 4AQYT 3DTOA 2JQQA 4N78D 4COFA 4ZEYA 1NEKA 1FIOA 3A8YC 3QC9A 1E7PA 5DABA 5LG4A 3CK6A 2E8IA 3ETVA 2QGSA 4X65T 2WWUA 4U7IA 3NKZA 3CQXC 1WYCA 5EK2A 4C90A 2X9WA 2SPCA 4IE0A 3PUSA 4LFBT 4O4IE 4YXDA 3V5SA 2YKSA 4U2YA 1NWMX 5L3BB 2XQAA 3AE9A 3N9MA 5AQHB 1IBKT 3LBXA 3GN5A 2WMOA 4MBQA 4YJ2E 4HFDA 3KV6A 3IBPA 4IE6A 2BKPA 2K3WA 4HFBA 5CA0E 1MMGA 1N32T 3RYHE 4EB6E 3Q5EA 4KMCA 2C5IT 4U31A 4I50E 3PUXF 2ZM6T 1UK5A 2A3DA 4AKHA 2PTFA 4JUYA 2K48A 2PJQA 3W15B 5FKYA 3C4WA 2E5VA 4EYUA 3E22E 2RPAA 4QX7B 3O9XA 3ANWB 4BAYB 3AB3B 4QKNA 4ZI2D 3N2OA 1MMNA 3PUZF 5AQTB 2A72A 3G06A 5JDNA 4PFPA 1J1JA 4QWNB 2NOXA 2UU9T 5FMNA 2LHNA 5LBQB 4IREA 5L3FB 3QK6A 3K1SA 3L3PA 1LVFA 1IBMT 1YW0A 1BR2A 3FZMB 2WU2A 3HA4A 2ZLYA 5DQVA 3CQCB 2W4XA 2VB6A 2WBLA 1ZV4X 4C91A 5L3GB 2LOPA 1YQ3A 3CPZA 1QLBA 3KV4A 3PE0A 5AQQB 3BQKA 1YKEB 3PV0F 4HWHA 2UXNB 5LYJE 5HXSA 2DWKA 4UEMA 4GK0E 1N34T 3AE8A 3KVBA 2L3LA 3N2KE 4ZI3C 2LT3A 5AQUB 5M4YA 4I43B 1WYBA 3T8OA 3K3QC 2XSBA 2XAHB 5JREA 4YFSA 4DR4T 4PW8A 3OJAA 1SA0E 3A5XA 3LK3B 2YOEA 2ZM2A 2VURA 4JI8T 3LK2B 2LHRA 4HFHA 4EEDA 4B6XA 3J9X1 3RRCA 3CX8B 2XQ7A 4DV5T 4F8HA 2LE8A 5L2LA 4WBNE 2GK9A 2XUEA 4G63A 4IL4A 2IHR1 3UU3A 3FHNA 1XDOA 5FXZA 3FXEB 3ZMUB 2I0MA 2KLQA 4KBMB 1GQEA 2UXDT 3PUAA 3UFEA 3N9OA 4J2CA 2CXLA 4U3CA 3RX6A 1D1BA 2FJEA 2JRKA 2PBIA 1WR0A 4DV0T 4UIGA 4KHPT 2W62A 3ESLA 3N9LA 2YDSA 3RIUC 4YTPA 3RYFE 3ZN1B 1UCUA 3QOFA 4U33A 1ZKEA 2KXPB 4GKJT 2XJ7A 5L4HA 2UXBT 5L3CB 3VKHA 4IHJE 3ZN0B 5KXJA 2CMRA 3ZMTB 4L9IA 3AA1B 5FVLA 2WDVA 2V7IA 4DMVA 4JI1T 4HFVA 4DV6T 4JI7T 2V8SV 2WU5A 3KV5A 5LP6E 3SFEA 2Y6XA 1Y01A 4ZZBA 5CJ5A 3EVYA 2XQ5A 1D0ZA 5LCYA 2BS4A 2VQET 4K0UA 2LSGA 3A7MA 3TKLB 1N33T 2UUAT 4UVAB 2HH7A 3Q5DA 5L3DB 3TLUA 4P0AA 4GIWA 4DV1T 4HFEA 5FY1A 2V6YB 2FJAA 5LGNB 3UU4A 2IC6A 2PFVA 4YSZA 3AVSA 4OHFA 1YQ4A 4LFCT 3AXJA 1UURA 3AEBA 1LRZA 5AQVB 5LBMA 1KNZA 3HKDE 5HEUA 5FYMA 3KBTA 2DNXA 2VKOA 4KHZF 3LSVA 5KX5E 2LRKA 3DP7A 3AE3A 3L8RA 1J5WA 4HKAA 4H9SE 2X66A 4ILUA 3B5MA 2H88A 1FJGT 2W66A 2YK0A 1KNRA 2XZEA 2CXDA 2BDEA 3KVAA 1E1HB 2YEVC 5LJMA 3ZPOA 1G8XA 3N9PA 4DR5T 1MIVA 2YN6A 4TNVA 4LMJA 1HX8A 3ONXA 2X51A 2D9DA 3JAEA 5J1GA 3C4ZA 3O1JA 2LKHA 2WB5A 2WSSV 2LLYA 4GOUA 3UUBA 2NP9A 4X1IE 4WZXA 1NENA 4TUYE 2IIUA 3LBXB 5AQMB 3ZT7A 3AE2A 5LA6E 2NTXA 3JADA 4LF9T 4PK4A 4X64T 2CWOA 4TX5A 2QVAA 1E2AA 4QXHB 1VCTA 2H89A 4OYKA 5IWAT 4QX8B 2E9XA 5FP3A 3U78A 4UR9A 4YSYA 2WWVA 2LSIA 2CM0A 3M3ZB 3SFDA 3NRXA 3P7IA 4ILBA 5LOVE 3H3AA 4ILCA 1N36T 4CI1B 4A97A 4HE8A 4UF0B 5J2UE 4H9QC 5FNVE 4PJLA 3P4PA 2DCFA 2WP9A 4DV7T 4H9PC 3L09A 3L39A 4H9RC 4YSXA 5JRCA 4YT0A 2EHOB 1WCRA 2CEAA 4LFAT 4NXNT 3KFWX 1NAFA 2OA5A 4GKKT 4CXYA 3SWHA 1WFDA 1V9DA 4CI3B 2FJBA 2NW8A 3ZT6A 4QH1A 4Z90A 2D5UA 1EZ3A 2Q9QC 3MZKB 3BQIA 2ACXA 2XTLA 4X5TA 4H9NC 3ZCIA 3IF8B 3N9QA 5HXHA 1HTJF 4PAGA 2JJ9A 5BMVE 5JVDE 2M67A 2HN1A 4AISA 3ZCJA 3JC6D 2EHOD 2WM9A 2V5CA 1HNWT 4IE7A 2BBHA 1HFAA 1WRDA 1W9RA 4LF4T 2DWGA 4X1YE 3EUHA 3CMLA 2WZHA 3UQ4A 4MALA 4I0UA 5ABEA 3JAFA 4B3MT 2ACZA 1MMAA 3ZEFB 4HFIA 4ILAA 4NPPA 3FB2A 3K3OA 3NBXX 3NRYA 4B3ST 2M6BA 4DVDA 3RQWA 4CXXA 4X66T 2VL0A 4YJ3E 2LKGA 3F57A 1T8BA 1Y64B 4LMKA 4KI0F 2BKOA 4AKLA 2CLYB 3AA6B 2XSAA 1HNZT 5CB4E 4QH5A 4TWFA 2J4GA 3KINB 5FL1A 3UUNA 5ABFB 1LVKA 4ZI2C 3TLSA 1HS7A 2HPLA 2LSJA 5JDQA 4DR6T 2X0HA 2BZBA 3I1AA 3GWHA 3UULA 4WNKA 5HWYA 2XAFB 4DUYT 1T98A 5HEJA 3P4RA 4ANJA 2UXCT 4H63V 3RPUA 2XQ9A 1M62A 1G73A 3OBVE 3H37A 3AE5A 5JDGA 4ZS3A 1I94T 2N1GA 1MMDA 4ZI7E 3X1DA 3CIRA 4OK0A 2IUBA 4JI3T 5DJQC 2XM2A 2D0UA 2K5BB 5JR9C 4ADZA 1ZEEA 5KDMC 4DR3T 2WS3A 4JEHB 1US7B 3GA8A 4QXCB 1JNRA 3KV9A 4IDQA 1VOMA 3ETUA 2VK9A 5ABHA 3I9YA 3VR9A 5DQWA 2QYWA 5JR9A 3I0OA 5HXRA 5TAOA 3I0QA 5JQGE 3F31A 3VRAA 5L47A 2YU1A 2A9UA 2HN2A 2CHNA 2BG9B 3O4XE 3AEAA 4U2ZA 1X79A 4O2AE 3F2EA 3AECA 5H6QB 3ZT5A 2VQFT 2BS3A 2F4VT 1W0AA 1U4QA 3WAKA 2IMLA 4JI4T 4U72A 4AQFC 5L4EA 4TWHA 3CX6B 3SOLA 5C2TA 3UUXB 2MPKA 2N2NA 2C5JA 5FVKA 3RH3A
chains in the Genus database with same CATH topology
4HWCA 4HWIB 5AQOB 2D9DA 3FZLB 5AQVB 5AQMB 5AQTB 1UGOA 5AQGB 3M3ZB 3FZMB 5AQUB 5AQPB 1T7SA 4HWFA 5AQSB 5AQHB 5AQRB 3FZHB 5AQQB 3FZFB 5AQNB 3FZKB 5AQJB 5AQLB 5AQFB 3LDQB 1I6ZA 1M7KA 1UK5A 5AQKB 1HX1B 3A8YC 4HWDA 4HWHA 5AQIB 1M62A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HWC A;  4HWI B;  5AQO B;  2D9D A;  3FZL B;  5AQV B;  5AQM B;  5AQT B;  1UGO A;  5AQG B;  3M3Z B;  3FZM B;  5AQU B;  5AQP B;  1T7S A;  4HWF A;  5AQS B;  5AQH B;  5AQR B;  3FZH B;  5AQQ B;  3FZF B;  5AQN B;  3FZK B;  5AQJ B;  5AQL B;  5AQF B;  3LDQ B;  1I6Z A;  1M7K A;  1UK5 A;  5AQK B;  1HX1 B;  3A8Y C;  4HWD A;  4HWH A;  5AQI B;  1M62 A; 
#chains in the Genus database with same CATH topology
 2XAQ B;  2VVS A;  4UVB B;  4P1N A;  4O4J E;  3O1H A;  2V7K A;  3ZC0 A;  3IA3 A;  2KND A;  2QA7 A;  1OED B;  3CVR A;  4LF5 T;  4P0B A;  1AJ3 A;  3M65 A;  2NR4 A;  4TWD A;  3RIU A;  2XHE B;  2UUB T;  1KFY A;  2VWA A;  2IW5 B;  3ZKR A;  2WMN A;  4UEL A;  3PU3 A;  2CBI A;  3RYC E;  3NWI A;  4AI6 A;  4UXN B;  1MND A;  4V1A v;  4OX9 T;  3EDU A;  1H7C A;  5HXC A;  2CPT A;  3T1Y T;  4HWF A;  4LML A;  3V5U A;  4XZC A;  4BJM A;  4QH4 A;  1I6Z A;  3T1H T;  4OYJ A;  4CXW A;  1YXR A;  2DI4 A;  4HN9 A;  1MIY A;  4DV2 T;  3RIA A;  5IYZ E;  5LHI B;  1UGO A;  3FXD B;  4YTM A;  2X0L B;  1CUN A;  2E9X B;  4YHJ A;  1HG5 A;  2A2F X;  3UFG A;  1XZY A;  1XMO T;  1XNR T;  2WQY A;  3RLF F;  4JI2 T;  4XAX B;  4LF6 T;  3WI3 A;  4IDZ A;  4DMW A;  2RA1 A;  3P8C D;  3H3M A;  1HF8 A;  3E08 A;  3B57 A;  5HEG A;  3JCF A;  4HWD A;  4EIW A;  4ZZC A;  2IC9 A;  1D1A A;  2L8K A;  2FBW A;  4YY3 T;  2V26 A;  3AEG A;  1B7T A;  3MJX A;  4JLE A;  5AQR B;  4WW0 A;  4JV5 T;  5LNK A;  5CGM A;  4NUV A;  5AQJ B;  2VAS A;  3CQG B;  3LDQ B;  4XBF B;  1QUU A;  2ZM0 A;  1KK7 A;  4AKI A;  4JBW F;  2BS2 A;  2CRB A;  2C0S A;  4FJO A;  2E9X D;  3P4W A;  5L3E B;  4O4L E;  4EOZ B;  3EAM A;  5AQP B;  4H63 H;  3NVO A;  3SS1 A;  3NZP A;  4EV6 A;  2UXX B;  1W09 A;  4DR7 T;  5AQK B;  2I59 A;  2VKH A;  4IL9 A;  4E7S A;  3HKE E;  4QXB B;  3FZL B;  1KF6 A;  1UUS A;  2YIN A;  3HR0 A;  3ONJ A;  4CN4 A;  3RYI E;  2LSK A;  2MAW A;  5H6R B;  3ONL C;  3GN5 B;  4B3R T;  4UVC B;  4BJN A;  2X9X A;  1J5E T;  1T72 A;  5HCJ A;  4TN7 B;  5AQI B;  5JDL A;  4CN6 A;  4JEU B;  5LHG B;  4DR1 T;  5JH7 E;  2XPK A;  1CHU A;  1HG2 A;  3TLW A;  5LGU B;  4A98 A;  2X0Y A;  5AQN B;  1VRB A;  4TV8 E;  5HAX A;  3FBL A;  4I4T E;  3VHL A;  3R6N A;  1FMW A;  3AE7 A;  4JI6 T;  2BVL A;  2RP4 A;  2LOS A;  2X9Y A;  3PTR B;  5J0Z A;  3UU6 A;  5HWX A;  1U5P A;  2UUC T;  5LHH B;  4EGW A;  2CCQ A;  4DV3 T;  4NIQ A;  5JDH A;  2C5K T;  2WDQ A;  2Y8D A;  3PUR A;  4HFC A;  4ZS2 A;  2CBJ A;  2X68 A;  4L5G A;  5KMG P;  2YU2 A;  5AQO B;  1Z8U A;  3Q5X A;  3VKG A;  2ODU A;  2OLT A;  2XQ4 A;  1W0B A;  4YHH T;  4OFZ A;  3ZSS A;  2KSR A;  3LJC A;  3QUJ A;  3HKB E;  2CHO A;  4X62 T;  5FXX A;  4IDO A;  4A5X A;  4AKR B;  2ES0 A;  1FMV A;  3ZST A;  1SUM B;  4PFO A;  3FZK B;  3C98 B;  1IAP A;  2Q9Q A;  4U7Y A;  2XM1 A;  1BR1 A;  3PUV F;  4IE4 A;  2NTY A;  5BR8 T;  3Q5W A;  2W61 A;  3FZH B;  4B3T T;  4NUU A;  3C51 A;  3C50 A;  2V7J A;  3PJA A;  3TLV A;  2VVN A;  4YLH A;  3CKD A;  1DU2 A;  2V5D A;  2JPF A;  3EHZ A;  3KBU A;  3AVR A;  3ZMV B;  3QB5 K;  1R8I A;  3Q9D A;  3ZYM A;  2AE9 A;  2NWB A;  4HTE A;  3PJA J;  1S35 A;  2LJL A;  3JC6 C;  4EZH A;  5LGT B;  2EHO C;  1UX4 A;  3RKO A;  2XAG B;  4GK5 E;  5LMN T;  2J47 A;  2X67 A;  2J62 A;  4AKG A;  3K8P C;  2W2U A;  4M1P A;  4UF0 A;  2HPJ A;  4IE5 A;  2ODV A;  4IT4 A;  2XQ3 A;  4Q25 A;  4TZ4 C;  5AQL B;  2B1E A;  5JR9 B;  2LM2 A;  2EHO A;  2ZM8 A;  1IBL T;  2JMH A;  2W67 A;  5FXV A;  5LJN A;  2LRL A;  2V6X A;  3PUG A;  3MXZ A;  2IDO B;  2VKD A;  3QB5 A;  5AQS B;  4ASK A;  4DO0 A;  5EK4 A;  5HYA A;  1ZOY A;  3AEF A;  3RF1 A;  2BBJ A;  4DND A;  5EK3 A;  3EI0 A;  5GON E;  1BR4 A;  3ZLI A;  5AQG B;  3RC3 A;  4ZI3 D;  2KIN B;  4QHO A;  4GYS A;  1Z0P A;  4DR2 T;  5JTG A;  1L0V A;  1VCS A;  3KDS E;  5AFU L;  2LM9 A;  5FY0 A;  3RQU A;  3AE1 A;  2DHR A;  1O3X A;  3U3I A;  1D1C A;  4NXM T;  1QSD A;  4U74 A;  5F8P A;  3RHW A;  4K0K T;  2VL8 A;  3OKQ A;  2Z6E A;  4LF8 T;  1D0X A;  5AQF B;  2H3R A;  3C64 A;  3MK7 C;  3UUM A;  3ZJ1 A;  4WBO A;  1IJ5 A;  5LMU T;  4HWI B;  4I55 E;  4PNI A;  5IHY A;  2BKN A;  2FUP A;  3E0Z A;  4HEA A;  3IHR A;  3N9N A;  2I6H A;  2NW7 A;  3LG7 A;  2R6G F;  3DJB A;  5HXE A;  4CQI A;  3PDY A;  2D0T A;  4CN1 A;  4ISS A;  3ANW A;  3P4Q A;  3C4X A;  1HNX T;  3UT5 E;  4JI0 T;  3CWZ B;  2CLY C;  1FEW A;  3AED A;  2WAU A;  4H9O C;  4Z8X A;  3PUW F;  1IZN B;  4Z91 A;  3OVU A;  4CZZ B;  2B76 A;  3ZC1 A;  2JMK A;  3R84 B;  3D0T A;  2E5L T;  3OTO T;  5JDF A;  2KWH A;  3VRB A;  5LB7 B;  3PUQ A;  2NW9 A;  3ZYK A;  3AXJ B;  2YDQ A;  2FJD A;  5HEH A;  1KNP A;  3AA7 B;  5ABF A;  3P50 A;  2BVM A;  3LFM A;  4TNW A;  4E7Z A;  3LK4 2;  2CA5 A;  4CI2 B;  5CFB A;  5JDM A;  3AAI A;  5FY7 A;  1JNZ A;  2ZMA A;  2IAK A;  3RIF A;  4AQF A;  2MTQ A;  1BR0 A;  3ABV A;  3N5L A;  1S94 A;  1XWM A;  5ABG A;  1SHZ C;  3UQ7 A;  2E2A A;  3AA0 B;  2OV9 A;  5FL0 A;  5J2T E;  4FI5 A;  4AQG A;  4L0R A;  5ETW A;  4O2B E;  4F6R C;  3VR8 A;  4DBR A;  2XQ6 A;  2W00 A;  4PK5 A;  1X9B A;  5EZY E;  2D2S A;  4PJJ A;  3I9W A;  2KMF A;  3O1I A;  2WY2 A;  2LEH A;  2PG8 A;  2M6I A;  1D0Y A;  2W0G A;  4EXT A;  1M7K A;  1ZHC A;  4MFR A;  3P4S A;  2BG9 C;  2JQK A;  4EZ4 A;  5A1L A;  3VU7 H;  2XAJ B;  5HCM A;  2AXD S;  3WAJ A;  3HI2 A;  4PJN A;  3HL6 A;  4O4H E;  4ZHQ E;  3OYZ A;  2V7L A;  2JIW A;  4EYY R;  2K9A A;  2W63 A;  4KX6 A;  5HEO A;  4BA9 A;  2BG9 A;  3J7Y q;  3FBZ A;  3S4U A;  1YKH B;  4KUM B;  5C3J A;  2Y48 B;  5E0O A;  2BG9 E;  1KEY A;  1OED C;  4TV9 E;  4X20 E;  2P9B A;  1WLX A;  3RRW A;  2YDR A;  4P09 A;  3AE6 A;  2JQH A;  4DID B;  3UTK A;  5FXW A;  2L9Q A;  1HCI A;  2XQ8 A;  5JRC B;  2DL1 A;  2CXF A;  1MIW A;  3GMI A;  3AAE B;  2MYS A;  4UV8 B;  2KT9 A;  2WZI A;  1XDP A;  1OED A;  3HKC E;  2DLR A;  1OWA A;  2KWI B;  2MBG A;  2HHH T;  2V7M A;  3RGL A;  5LXT E;  3SRZ A;  3RC8 A;  4PJM A;  1YD8 G;  1OED E;  2KZ7 B;  1T7S A;  1UX5 A;  2XY8 B;  2CWY A;  4IIJ E;  5LG3 A;  1IJ6 A;  4EAH A;  4MHC A;  3AE4 A;  2H7O A;  2VKJ A;  3EDV A;  4MLK A;  1HX1 B;  4JYA T;  3OYX A;  4JI5 T;  2V1D B;  1HR0 T;  4UV9 B;  3K3N A;  4LF7 T;  4IDN A;  3Q2M A;  1LKX A;  3CX7 B;  2Q9Q B;  2G0U A;  4IDP A;  3UU8 A;  2XQY A;  4WYV A;  3IEE A;  1OXZ A;  1WR6 A;  2E9X C;  2XAS B;  3MAC A;  3BQL A;  4DV4 T;  4HGA A;  2X9H A;  5IUX A;  4X1K E;  1SE7 A;  3TLT A;  5ADX L;  3UU5 A;  5C8Y E;  2CE7 A;  1ZP0 A;  2WDR A;  3QNU A;  2H7V C;  2V6Y A;  4IGU A;  3RI5 A;  4IST A;  4YTN A;  4EEB A;  5F5W A;  3PU8 A;  3EAB A;  1MNE A;  3NZQ A;  2JQ9 A;  3ZMZ B;  2K24 A;  3PUY F;  3AEE A;  3N2G E;  3ZYL A;  4KP3 C;  3MKD A;  3B13 A;  4O8S A;  3ZMS B;  4G2A A;  4GYR A;  4ZOL E;  4A56 A;  3AAA B;  4DBQ A;  2QRX A;  3FZF B;  2MOZ A;  2N9D A;  4DUZ T;  4PK6 A;  2LSY A;  4AXP A;  4AIU A;  3BK9 A;  5CA1 E;  1XNQ T;  4HWC A;  3MA9 A;  1XMQ T;  2WCA A;  2Q9Q D;  5F3J A;  4ERR A;  2J1D G;  3OPC A;  4ZXL A;  3RKG A;  3ZJ2 A;  4AQY T;  3DTO A;  2JQQ A;  4N78 D;  4COF A;  4ZEY A;  1NEK A;  1FIO A;  3A8Y C;  3QC9 A;  1E7P A;  5DAB A;  5LG4 A;  3CK6 A;  2E8I A;  3ETV A;  2QGS A;  4X65 T;  2WWU A;  4U7I A;  3NKZ A;  3CQX C;  1WYC A;  5EK2 A;  4C90 A;  2X9W A;  2SPC A;  4IE0 A;  3PUS A;  4LFB T;  4O4I E;  4YXD A;  3V5S A;  2YKS A;  4U2Y A;  1NWM X;  5L3B B;  2XQA A;  3AE9 A;  3N9M A;  5AQH B;  1IBK T;  3LBX A;  3GN5 A;  2WMO A;  4MBQ A;  4YJ2 E;  4HFD A;  3KV6 A;  3IBP A;  4IE6 A;  2BKP A;  2K3W A;  4HFB A;  5CA0 E;  1MMG A;  1N32 T;  3RYH E;  4EB6 E;  3Q5E A;  4KMC A;  2C5I T;  4U31 A;  4I50 E;  3PUX F;  2ZM6 T;  1UK5 A;  2A3D A;  4AKH A;  2PTF A;  4JUY A;  2K48 A;  2PJQ A;  3W15 B;  5FKY A;  3C4W A;  2E5V A;  4EYU A;  3E22 E;  2RPA A;  4QX7 B;  3O9X A;  3ANW B;  4BAY B;  3AB3 B;  4QKN A;  4ZI2 D;  3N2O A;  1MMN A;  3PUZ F;  5AQT B;  2A72 A;  3G06 A;  5JDN A;  4PFP A;  1J1J A;  4QWN B;  2NOX A;  2UU9 T;  5FMN A;  2LHN A;  5LBQ B;  4IRE A;  5L3F B;  3QK6 A;  3K1S A;  3L3P A;  1LVF A;  1IBM T;  1YW0 A;  1BR2 A;  3FZM B;  2WU2 A;  3HA4 A;  2ZLY A;  5DQV A;  3CQC B;  2W4X A;  2VB6 A;  2WBL A;  1ZV4 X;  4C91 A;  5L3G B;  2LOP A;  1YQ3 A;  3CPZ A;  1QLB A;  3KV4 A;  3PE0 A;  5AQQ B;  3BQK A;  1YKE B;  3PV0 F;  4HWH A;  2UXN B;  5LYJ E;  5HXS A;  2DWK A;  4UEM A;  4GK0 E;  1N34 T;  3AE8 A;  3KVB A;  2L3L A;  3N2K E;  4ZI3 C;  2LT3 A;  5AQU B;  5M4Y A;  4I43 B;  1WYB A;  3T8O A;  3K3Q C;  2XSB A;  2XAH B;  5JRE A;  4YFS A;  4DR4 T;  4PW8 A;  3OJA A;  1SA0 E;  3A5X A;  3LK3 B;  2YOE A;  2ZM2 A;  2VUR A;  4JI8 T;  3LK2 B;  2LHR A;  4HFH A;  4EED A;  4B6X A;  3J9X 1;  3RRC A;  3CX8 B;  2XQ7 A;  4DV5 T;  4F8H A;  2LE8 A;  5L2L A;  4WBN E;  2GK9 A;  2XUE A;  4G63 A;  4IL4 A;  2IHR 1;  3UU3 A;  3FHN A;  1XDO A;  5FXZ A;  3FXE B;  3ZMU B;  2I0M A;  2KLQ A;  4KBM B;  1GQE A;  2UXD T;  3PUA A;  3UFE A;  3N9O A;  4J2C A;  2CXL A;  4U3C A;  3RX6 A;  1D1B A;  2FJE A;  2JRK A;  2PBI A;  1WR0 A;  4DV0 T;  4UIG A;  4KHP T;  2W62 A;  3ESL A;  3N9L A;  2YDS A;  3RIU C;  4YTP A;  3RYF E;  3ZN1 B;  1UCU A;  3QOF A;  4U33 A;  1ZKE A;  2KXP B;  4GKJ T;  2XJ7 A;  5L4H A;  2UXB T;  5L3C B;  3VKH A;  4IHJ E;  3ZN0 B;  5KXJ A;  2CMR A;  3ZMT B;  4L9I A;  3AA1 B;  5FVL A;  2WDV A;  2V7I A;  4DMV A;  4JI1 T;  4HFV A;  4DV6 T;  4JI7 T;  2V8S V;  2WU5 A;  3KV5 A;  5LP6 E;  3SFE A;  2Y6X A;  1Y01 A;  4ZZB A;  5CJ5 A;  3EVY A;  2XQ5 A;  1D0Z A;  5LCY A;  2BS4 A;  2VQE T;  4K0U A;  2LSG A;  3A7M A;  3TKL B;  1N33 T;  2UUA T;  4UVA B;  2HH7 A;  3Q5D A;  5L3D B;  3TLU A;  4P0A A;  4GIW A;  4DV1 T;  4HFE A;  5FY1 A;  2V6Y B;  2FJA A;  5LGN B;  3UU4 A;  2IC6 A;  2PFV A;  4YSZ A;  3AVS A;  4OHF A;  1YQ4 A;  4LFC T;  3AXJ A;  1UUR A;  3AEB A;  1LRZ A;  5AQV B;  5LBM A;  1KNZ A;  3HKD E;  5HEU A;  5FYM A;  3KBT A;  2DNX A;  2VKO A;  4KHZ F;  3LSV A;  5KX5 E;  2LRK A;  3DP7 A;  3AE3 A;  3L8R A;  1J5W A;  4HKA A;  4H9S E;  2X66 A;  4ILU A;  3B5M A;  2H88 A;  1FJG T;  2W66 A;  2YK0 A;  1KNR A;  2XZE A;  2CXD A;  2BDE A;  3KVA A;  1E1H B;  2YEV C;  5LJM A;  3ZPO A;  1G8X A;  3N9P A;  4DR5 T;  1MIV A;  2YN6 A;  4TNV A;  4LMJ A;  1HX8 A;  3ONX A;  2X51 A;  2D9D A;  3JAE A;  5J1G A;  3C4Z A;  3O1J A;  2LKH A;  2WB5 A;  2WSS V;  2LLY A;  4GOU A;  3UUB A;  2NP9 A;  4X1I E;  4WZX A;  1NEN A;  4TUY E;  2IIU A;  3LBX B;  5AQM B;  3ZT7 A;  3AE2 A;  5LA6 E;  2NTX A;  3JAD A;  4LF9 T;  4PK4 A;  4X64 T;  2CWO A;  4TX5 A;  2QVA A;  1E2A A;  4QXH B;  1VCT A;  2H89 A;  4OYK A;  5IWA T;  4QX8 B;  2E9X A;  5FP3 A;  3U78 A;  4UR9 A;  4YSY A;  2WWV A;  2LSI A;  2CM0 A;  3M3Z B;  3SFD A;  3NRX A;  3P7I A;  4ILB A;  5LOV E;  3H3A A;  4ILC A;  1N36 T;  4CI1 B;  4A97 A;  4HE8 A;  4UF0 B;  5J2U E;  4H9Q C;  5FNV E;  4PJL A;  3P4P A;  2DCF A;  2WP9 A;  4DV7 T;  4H9P C;  3L09 A;  3L39 A;  4H9R C;  4YSX A;  5JRC A;  4YT0 A;  2EHO B;  1WCR A;  2CEA A;  4LFA T;  4NXN T;  3KFW X;  1NAF A;  2OA5 A;  4GKK T;  4CXY A;  3SWH A;  1WFD A;  1V9D A;  4CI3 B;  2FJB A;  2NW8 A;  3ZT6 A;  4QH1 A;  4Z90 A;  2D5U A;  1EZ3 A;  2Q9Q C;  3MZK B;  3BQI A;  2ACX A;  2XTL A;  4X5T A;  4H9N C;  3ZCI A;  3IF8 B;  3N9Q A;  5HXH A;  1HTJ F;  4PAG A;  2JJ9 A;  5BMV E;  5JVD E;  2M67 A;  2HN1 A;  4AIS A;  3ZCJ A;  3JC6 D;  2EHO D;  2WM9 A;  2V5C A;  1HNW T;  4IE7 A;  2BBH A;  1HFA A;  1WRD A;  1W9R A;  4LF4 T;  2DWG A;  4X1Y E;  3EUH A;  3CML A;  2WZH A;  3UQ4 A;  4MAL A;  4I0U A;  5ABE A;  3JAF A;  4B3M T;  2ACZ A;  1MMA A;  3ZEF B;  4HFI A;  4ILA A;  4NPP A;  3FB2 A;  3K3O A;  3NBX X;  3NRY A;  4B3S T;  2M6B A;  4DVD A;  3RQW A;  4CXX A;  4X66 T;  2VL0 A;  4YJ3 E;  2LKG A;  3F57 A;  1T8B A;  1Y64 B;  4LMK A;  4KI0 F;  2BKO A;  4AKL A;  2CLY B;  3AA6 B;  2XSA A;  1HNZ T;  5CB4 E;  4QH5 A;  4TWF A;  2J4G A;  3KIN B;  5FL1 A;  3UUN A;  5ABF B;  1LVK A;  4ZI2 C;  3TLS A;  1HS7 A;  2HPL A;  2LSJ A;  5JDQ A;  4DR6 T;  2X0H A;  2BZB A;  3I1A A;  3GWH A;  3UUL A;  4WNK A;  5HWY A;  2XAF B;  4DUY T;  1T98 A;  5HEJ A;  3P4R A;  4ANJ A;  2UXC T;  4H63 V;  3RPU A;  2XQ9 A;  1M62 A;  1G73 A;  3OBV E;  3H37 A;  3AE5 A;  5JDG A;  4ZS3 A;  1I94 T;  2N1G A;  1MMD A;  4ZI7 E;  3X1D A;  3CIR A;  4OK0 A;  2IUB A;  4JI3 T;  5DJQ C;  2XM2 A;  2D0U A;  2K5B B;  5JR9 C;  4ADZ A;  1ZEE A;  5KDM C;  4DR3 T;  2WS3 A;  4JEH B;  1US7 B;  3GA8 A;  4QXC B;  1JNR A;  3KV9 A;  4IDQ A;  1VOM A;  3ETU A;  2VK9 A;  5ABH A;  3I9Y A;  3VR9 A;  5DQW A;  2QYW A;  5JR9 A;  3I0O A;  5HXR A;  5TAO A;  3I0Q A;  5JQG E;  3F31 A;  3VRA A;  5L47 A;  2YU1 A;  2A9U A;  2HN2 A;  2CHN A;  2BG9 B;  3O4X E;  3AEA A;  4U2Z A;  1X79 A;  4O2A E;  3F2E A;  3AEC A;  5H6Q B;  3ZT5 A;  2VQF T;  2BS3 A;  2F4V T;  1W0A A;  1U4Q A;  3WAK A;  2IML A;  4JI4 T;  4U72 A;  4AQF C;  5L4E A;  4TWH A;  3CX6 B;  3SOL A;  5C2T A;  3UUX B;  2MPK A;  2N2N A;  2C5J A;  5FVK A;  3RH3 A; 
#chains in the Genus database with same CATH homology
 4HWC A;  4HWI B;  5AQO B;  2D9D A;  3FZL B;  5AQV B;  5AQM B;  5AQT B;  1UGO A;  5AQG B;  3M3Z B;  3FZM B;  5AQU B;  5AQP B;  1T7S A;  4HWF A;  5AQS B;  5AQH B;  5AQR B;  3FZH B;  5AQQ B;  3FZF B;  5AQN B;  3FZK B;  5AQJ B;  5AQL B;  5AQF B;  3LDQ B;  1I6Z A;  1M7K A;  1UK5 A;  5AQK B;  1HX1 B;  3A8Y C;  4HWD A;  4HWH A;  5AQI B;  1M62 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...