4HWFA

Crystal structure of atbag3
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
87
structure length
87
Chain Sequence
SASKSISDISFEVDRLAGQVSAFETVINKGGKVEEKSLVNLIEMLMNQLLRLDAIIADGDVKLMRKMQVQRVQKYVEALDLLKVKNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural insight into plant programmed cell death mediated by BAG proteins in Arabidopsis thaliana.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Apoptosis
molecule keywords BAG family molecular chaperone regulator 3
total genus 37
structure length 87
sequence length 87
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02179 BAG BAG domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.120 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 BAG domain 4hwfA00
3LDQB 4HWDA 3M3ZB 1UK5A 5AQKB 5AQRB 4HWFA 3FZHB 3A8YC 5AQPB 5AQGB 5AQTB 5AQFB 2D9DA 3FZFB 5AQOB 1HX1B 3FZMB 5AQQB 1M7KA 5AQHB 1UGOA 5AQSB 3FZKB 5AQIB 5AQLB 5AQMB 5AQNB 1M62A 5AQUB 5AQVB 1T7SA 4HWCA 3FZLB 1I6ZA 5AQJB 4HWHA 4HWIB
chains in the Genus database with same CATH superfamily
1IJ6A 2YU1A 3RIFA 2X67A 5HEHA 4F8HA 2WWUA 4QHOA 3ZMVB 2A72A 2X9XA 1YW0A 5L3FB 3L09A 2K3WA 2LM2A 3LG7A 4QH4A 4QX8B 5LHHB 5LXTE 1FEWA 2PJQA 2W63A 2XQ4A 4KHZF 3VR8A 3ANWA 5C3JA 3PUYF 5AQFB 2WZHA 3AEAA 1EZ3A 3C51A 3GWHA 4MBQA 4GKKT 3LFMA 2LJLA 1G73A 2V7KA 2MBGA 1MMGA 1SE7A 5ABHA 4C90A 2DNXA 3M65A 4HKAA 2K24A 4AQGA 4YSYA 4OYJA 2DL1A 1MNDA 2FBWA 5HEJA 5LMUT 2GK9A 2VASA 3VHLA 2ZM6T 3RHWA 4JI5T 5L3BB 3ONXA 2BG9E 4XZCA 2HHHT 2MOZA 3DP7A 2C5KT 3H3MA 2YDRA 3RC3A 3H37A 3U78A 4AQYT 4TWDA 5J2UE 5FY1A 1HX8A 3C50A 5LG3A 2V7MA 3AAIA 2WSSV 3A8YC 3CX7B 3DJBA 4B6XA 2RP4A 4EOZB 5HWXA 3FBZA 4F6RC 3P50A 4DMVA 3ZLIA 3RQUA 3RIUA 2YEVC 3FZFB 2LKHA 3RPUA 1VOMA 4HFHA 2X66A 3E22E 5JRCA 1X79A 4KP3C 3HKBE 5ETWA 1HG2A 5A1LA 1UGOA 1ZKEA 2WZIA 3AA0B 3AB3B 1IBLT 4QKNA 5HEUA 5AQIB 4KUMB 4LFCT 2UXDT 1D1AA 1ZEEA 4I43B 2CHNA 3SWHA 3UQ4A 4UVAB 4DR1T 1N34T 2E2AA 1YQ4A 4I55E 2V7IA 2PFVA 2A9UA 4NUUA 4YT0A 4UIGA 2UU9T 4GYSA 2BG9B 4MFRA 3K8PC 4PFPA 1U4QA 3TLUA 2XAHB 4TN7B 2VL0A 1KNPA 2VKOA 3UU8A 4EGWA 1XNQT 5JTGA 4YTPA 2XM1A 1HF8A 3AE9A 4KI0F 4DV5T 3P8CD 3R6NA 4A97A 4LFAT 4TNVA 4UELA 4IIJE 4OYKA 3AXJA 4AISA 2BKNA 3ZCIA 1N32T 1IJ5A 5DJQC 3OBVE 2HPJA 5CFBA 2E5VA 2LHNA 4J2CA 2NW9A 4H9PC 1HX1B 4BJNA 1UX4A 2CLYB 4ZZCA 4B3MT 4DV1T 3FBLA 4YHHT 4WZXA 4ZXLA 1LRZA 3AE1A 2JQKA 3CK6A 2WU5A 3OYZA 4L5GA 3RKGA 3ZYLA 4AQFC 3P4WA 3Q5XA 5F8PA 4HFCA 1HNZT 3UUXB 3Q2MA 3Q5WA 4Z91A 3P4PA 1W09A 5HXCA 3UUMA 3WAKA 5L4EA 1J5WA 4HTEA 4PJLA 2C5JA 4U74A 2W4XA 4GK5E 2M67A 2XM2A 3RLFF 4DV3T 4U7YA 3GN5A 4UV9B 4IT4A 3LDQB 1NAFA 2CM0A 3QK6A 4QH5A 3F31A 4P0BA 3RI5A 1O3XA 4QWNB 3ZMZB 2VL8A 3UU3A 2F4VT 4YSXA 5IHYA 2H89A 4ISTA 2XAFB 1LVFA 3I1AA 4ZI2C 4ILAA 3EUHA 4EV6A 4LF5T 4MALA 2I6HA 2Q9QA 4AKRB 2LOSA 3KINB 5LOVE 4C91A 5EZYE 2UXBT 2NTXA 3AE5A 2IUBA 3RQWA 2QA7A 1WR0A 3PUWF 2WY2A 3O1JA 4V1Av 1US7B 1OEDC 2K9AA 2LSYA 4QH1A 2NW7A 2VWAA 3ZPOA 5JH7E 4TZ4C 2EHOA 4ASKA 3IF8B 3K3NA 2NWBA 2CBJA 2DWKA 3RH3A 2BKPA 4BJMA 4EEDA 3SFEA 1J5ET 4EYUA 1KK7A 2NTYA 2W61A 2YINA 2BDEA 3N9MA 3OKQA 2D5UA 5H6QB 5TAOA 3UU4A 3IBPA 2Y6XA 3NWIA 4U3CA 2Y8DA 3AE6A 4U2ZA 5GONE 5FYMA 2LM9A 2OV9A 3ZT5A 3H3AA 1UK5A 2BVMA 3OJAA 5AQRB 1VCSA 2FJDA 3NBXX 2W00A 4X62T 4AIUA 2ZLYA 4IE7A 4DV7T 1HNWT 3AA7B 3VKGA 3AE4A 3RYIE 2MTQA 4PK6A 4Z90A 4MLKA 5IYZE 4YY3T 3NZQA 2EHOD 2SPCA 4KX6A 1MIWA 2XQ3A 3AE8A 3N2OA 3ZC0A 1J1JA 4B3RT 1R8IA 3ZMTB 3VRBA 3LBXB 4PNIA 3T1YT 5AQHB 2LRLA 3QNUA 5IWAT 4ZOLE 3GMIA 3PUSA 2PTFA 3EAMA 3F57A 3I9WA 1HTJF 2XQ8A 3NKZA 3O1IA 4CI2B 4H9OC 3T8OA 1T7SA 1E2AA 4ILBA 1BR2A 3JC6D 1I6ZA 1ZV4X 3LJCA 4JUYA 2VVSA 3ABVA 4DV0T 3C98B 2L3LA 5BMVE 3KV4A 2QVAA 4IREA 3QUJA 5J1GA 5JDLA 2NP9A 1OEDE 2IMLA 2V6YA 4ILUA 5FL1A 3PUAA 2W62A 4HFBA 3ESLA 3AEGA 2XSAA 2YKSA 4X66T 3EI0A 4JEHB 2BG9A 5JVDE 3PTRB 2V7LA 1FJGT 3VKHA 1Y64B 3BQKA 4IE6A 3NRXA 2W0GA 2X0LB 3QB5A 3EHZA 2WMNA 3I0QA 5FKYA 3VU7H 5KMGP 2IAKA 1D0XA 2WDQA 4TV8E 5KX5E 4WNKA 3KFWX 4P09A 5KDMC 3V5SA 1UX5A 4QXCB 2CXLA 4HFVA 4KBMB 3S4UA 3K3QC 2CWOA 2OLTA 4O8SA 3D0TA 2CEAA 3GN5B 2XSBA 3W15B 2D0UA 2V26A 4CN4A 2JQQA 4DIDB 5CJ5A 5KXJA 5LJNA 4A98A 4KHPT 1HNXT 1YKEB 4QX7B 2VKDA 4X1YE 2XPKA 4ISSA 2YOEA 1CHUA 2NOXA 4I4TE 2EHOB 2XZEA 3JADA 4IE5A 3HI2A 4PK4A 3RF1A 2E8IA 4ANJA 3BQIA 4HWDA 4JI3T 3AEDA 5HXRA 3AA1B 3ANWB 3MZKB 2WWVA 3ZSTA 1WFDA 4NUVA 5FXXA 1YD8G 2IC6A 3SS1A 3ZT6A 4DVDA 2WQYA 4UR9A 4I0UA 2BS4A 5FMNA 1BR4A 3PV0F 5FP3A 1XMQT 2CBIA 3P7IA 2LRKA 3L8RA 2YK0A 4X5TA 2J4GA 1JNZA 2M6BA 2NW8A 3IA3A 5HWYA 4WW0A 3RIAA 4UXNB 2C0SA 1M7KA 1X9BA 5J0ZA 2LEHA 5C8YE 4XAXB 2X9YA 1VRBA 2D0TA 5J2TE 3AEEA 1FIOA 1MMAA 3EABA 3CPZA 3AEFA 4DBRA 2Z6EA 2VKHA 3I9YA 3U3IA 4LF6T 4HGAA 1NEKA 2HN1A 4CXXA 2J1DG 3HL6A 5HYAA 2BVLA 3C4XA 3QOFA 4JI7T 4WYVA 3AEBA 5LG4A 3PUQA 4CN6A 1B7TA 5ABFB 2VQFT 1LKXA 3MA9A 5JDMA 2W2UA 3V5UA 4ZI3D 1W0AA 3LBXA 4YLHA 5HXEA 4DR6T 3PURA 2E9XB 3TLWA 5ABFA 3LSVA 3ZT7A 5JDNA 2KT9A 4AI6A 2D9DA 5CGMA 4HE8A 3IEEA 2FJBA 5L4HA 3RC8A 1D0YA 2E9XA 1QUUA 1QSDA 4PFOA 3UU5A 4CXYA 3OTOT 5F3JA 3ZSSA 3NZPA 2XAGB 5AQMB 4X65T 2IDOB 4ZHQE 4FI5A 5LBMA 4AKLA 1D0ZA 2X0YA 4K0KT 3PJAJ 4IE0A 4JI1T 4AXPA 3B13A 3LK3B 1E7PA 3MJXA 2A2FX 2L8KA 2XQ6A 3A7MA 3B5MA 2YDQA 3PUVF 4U33A 4M1PA 3RYCE 4U72A 3UT5E 3AE2A 4KMCA 4DUZT 2E9XD 4DV4T 4P0AA 4Q25A 3AVSA 1XMOT 3EVYA 5L3CB 2JQ9A 3ZJ1A 4A5XA 5IUXA 3KBTA 1W9RA 2BS2A 1KNZA 3KV5A 3ONJA 1OEDA 2QGSA 2I0MA 3BQLA 4JBWF 2YU2A 4DR7T 3GA8A 4ADZA 4EIWA 5CA0E 5AQQB 3MKDA 4H9NC 3CIRA 4EEBA 5L3EB 2MAWA 1UURA 2H3RA 1NWMX 2FJAA 2JMKA 2LSKA 2V6XA 1CUNA 2V1DB 2W67A 2XQ5A 3OVUA 3FZLB 4HWCA 3UU6A 4EXTA 2J62A 3CVRA 4HN9A 3AE7A 3KV6A 4AQFA 2KNDA 2V5DA 3JC6C 4HFDA 4O4JE 2C5IT 4YHJA 2WB5A 4YXDA 5AFUL 3CWZB 3TLVA 1ZOYA 1D1CA 2V7JA 1IZNB 2K5BB 5L3DB 3L39A 4GOUA 3TLSA 3HKDE 3C4WA 5C2TA 5JR9A 3N9OA 2CPTA 5HCMA 4DR3T 1E1HB 2J47A 2JMHA 3ETUA 2FUPA 4G2AA 4OK0A 3LK2B 4UVBB 5HAXA 4IGUA 4QXHB 3AAAB 3ZC1A 2QYWA 2VVNA 5EK3A 4CXWA 5FXVA 1BR1A 4ZI7E 1YKHB 4GYRA 3CQXC 4BAYB 5ADXL 5LYJE 2OA5A 2ZM8A 2CXDA 2H7OA 4COFA 2B1EA 4ZS2A 5AQNB 2FJEA 4ILCA 3KV9A 2MYSA 5EK4A 3UFGA 3UUBA 2YDSA 4UF0A 2KZ7B 3RYHE 2CCQA 2LLYA 5JDFA 4U2YA 3HA4A 5JDQA 3B57A 4H63H 1HFAA 1UUSA 2ZMAA 4PJMA 4DR5T 2MPKA 2WMOA 3QB5K 2CXFA 2KSRA 2R6GF 3AXJB 3CX8B 2BKOA 3UUNA 4EYYR 2YN6A 4GKJT 2IC9A 1OXZA 2K48A 2XHEB 3JCFA 1N33T 3J9X1 4TWHA 5FXZA 4JEUB 4N78D 4YTMA 4YJ3E 2XQ7A 4I50E 5AQPB 3O4XE 3PUZF 3N9QA 2ES0A 1LVKA 3T1HT 5M4YA 2L9QA 1WR6A 2WDRA 4Z8XA 2UXNB 3PE0A 4ZS3A 2KWHA 3MACA 3X1DA 2AXDS 3E08A 2V5CA 3O9XA 3ZN1B 3HKEE 5FNVE 5L47A 2JPFA 2DLRA 2PBIA 3EDUA 3UQ7A 4O4HE 5DQVA 1OEDB 2XQAA 2X9HA 1MIYA 3P4SA 2B76A 4O2BE 4O2AE 3ZYMA 5AQVB 3UFEA 3UTKA 2ZM0A 2LOPA 2WU2A 3Q9DA 4NPPA 4DV2T 2DHRA 2KINB 2LHRA 2CRBA 2V6YB 4UV8B 3AAEB 4IDOA 4YJ2E 2H7VC 2V8SV 1IBKT 3CX6B 1SHZC 4IHJE 3MK7C 3OYXA 4CI3B 2ODVA 4LMLA 4JI6T 5LHIB 4B3TT 4H9SE 3RIUC 1IAPA 2WP9A 1N36T 3NVOA 4DO0A 5HXSA 3MXZA 3NRYA 2KWIB 5LP6E 5AQTB 2CHOA 3N2GE 2LSJA 5JDHA 3BK9A 2XY8B 4DR2T 5DABA 4JI4T 2UXXB 5AQOB 3FZMB 3CKDA 4TUYE 4IDNA 5LA6E 3RGLA 3VR9A 4OX9T 1SA0E 4ZZBA 4LF8T 3KVAA 3TLTA 2UUBT 2ZM2A 1H7CA 3CQGB 1MNEA 3DTOA 4NIQA 4ZI3C 3ZMUB 4U7IA 5F5WA 3ZEFB 2BBJA 2X68A 3PDYA 5LJMA 5EK2A 4P1NA 3FXEB 4HWIB 4O4IE 3ZJ2A 3J7Yq 4IDQA 3L3PA 2G0UA 3ONLC 2CLYC 3PUGA 4X1IE 3SFDA 3UULA 1DU2A 1KF6A 4A56A 2VURA 3KVBA 3PU8A 2UUAT 2WM9A 4IL4A 4PJJA 4JYAT 3WI3A 3N9PA 2LKGA 2VB6A 2IW5B 1ZHCA 2KXPB 4LFBT 5JDGA 4CQIA 3ZN0B 5JRCB 1MIVA 1YQ3A 3E0ZA 2Y48B 4X64T 4IDPA 5AQGB 1W0BA 1OWAA 1WCRA 3N9NA 4DUYT 1S94A 3KDSE 4MHCA 5E0OA 2X0HA 2CMRA 2CE7A 3ZKRA 3R84B 5LGUB 5LCYA 4JI2T 4EAHA 4TX5A 1UCUA 1AJ3A 4EB6E 4E7SA 1WYBA 2BS3A 2HN2A 4L9IA 5FY7A 2N2NA 3JAFA 3EDVA 4DNDA 2Q9QD 5LHGB 5AQUB 2AE9A 5FY0A 3QC9A 1MMNA 3ZYKA 5LGNB 2PG8A 4IE4A 3RKOA 4QXBB 3RX6A 1IBMT 1T8BA 3AECA 2KLQA 1MMDA 1ZP0A 4TWFA 2IHR1 2WDVA 5HEOA 4PJNA 5LB7B 4GIWA 1V9DA 3O1HA 4JLEA 2Q9QC 4NXNT 2BZBA 4YTNA 4IDZA 2ODUA 3CQCB 5AQKB 2UUCT 3FZHB 4FJOA 1U5PA 5L3GB 3RYFE 2XQYA 1KFYA 2X9WA 2JRKA 1VCTA 2CWYA 2KMFA 3HR0A 4YFSA 4WBOA 4GK0E 1BR0A 1Z8UA 3C64A 4L0RA 2HH7A 2EHOC 2XJ7A 4AKHA 1HG5A 4AKIA 4JI8T 3A5XA 1KNRA 2JQHA 3FHNA 3JAEA 2NR4A 3CMLA 2Q9QB 4IL9A 4BA9A 5AQSB 3FZKB 1XZYA 4H63V 5DQWA 5AQLB 3SOLA 4ZEYA 4DBQA 4ERRA 2N9DA 1Z0PA 1I94T 5ABGA 2H88A 1XNRT 2DI4A 2LSGA 2WBLA 2E9XC 3C4ZA 3FXDB 3N5LA 5H6RB 5LBQB 4AKGA 4HWHA 1HR0T 4LF7T 2BBHA 3VRAA 4JV5T 2UXCT 3WAJA 3AA6B 5HEGA 4PAGA 2I59A 2ACZA 2A3DA 3M3ZB 3N9LA 2RA1A 2HPLA 5FL0A 4H9QC 4B3ST 3LK42 2XAJB 5HXHA 3PUXF 5FVLA 3PJAA 4CI1B 4H9RC 3K3OA 2WAUA 2LSIA 3I0OA 4HEAA 2E5LT 2W66A 2CA5A 5HCJA 5L2LA 2QRXA 4UF0B 1XWMA 4U31A 4UVCB 4CZZB 4JI0T 3HKCE 4PW8A 4TNWA 3F2EA 1S35A 1GQEA 1M62A 2XUEA 4CN1A 3G06A 4DV6T 2RPAA 4UEMA 4DMWA 3P4QA 4X20E 2M6IA 4YSZA 3K1SA 2XQ9A 4HFIA 5AQJB 3RRWA 5LNKA 4X1KE 2BG9C 3ETVA 2VKJA 3Q5EA 3RRCA 1SUMB 5JR9B 4EZHA 1FMVA 2XTLA 3AVRA 1XDPA 4K0UA 1YXRA 5FVKA 4ZI2D 2X51A 1HS7A 1HCIA 4HWFA 1T72A 1L0VA 3AE3A 1WRDA 5FXWA 3ZMSB 3Q5DA 5LMNT 1D1BA 1FMWA 2IIUA 5JQGE 2JJ9A 1JNRA 4HFEA 1T98A 2VQET 3FB2A 2JIWA 2D2SA 2VK9A 3PU3A 4G63A 4PK5A 3TKLB 4E7ZA 2WCAA 5BR8T 2ACXA 4DR4T 3KBUA 2XASB 2LT3A 1QLBA 2LE8A 4EZ4A 1NENA 5JREA 3N2KE 4WBNE 3OPCA 5JR9C 5CA1E 4NXMT 2P9BA 4O4LE 3SRZA 1KEYA 2XAQB 1XDOA 4OFZA 4LF4T 4XBFB 4LF9T 1WLXA 1WYCA 3IHRA 3ZCJA 4LMJA 4LMKA 4OHFA 5CB4E 2WS3A 2DCFA 1Y01A 2N1GA 3P4RA 5LGTB 5ABEA 4TV9E 1G8XA 2DWGA
chains in the Genus database with same CATH topology
3LDQB 4HWDA 3M3ZB 1UK5A 5AQKB 5AQRB 4HWFA 3FZHB 3A8YC 5AQPB 5AQGB 5AQTB 5AQFB 2D9DA 3FZFB 5AQOB 1HX1B 3FZMB 5AQQB 1M7KA 5AQHB 1UGOA 5AQSB 3FZKB 5AQIB 5AQLB 5AQMB 5AQNB 1M62A 5AQUB 5AQVB 1T7SA 4HWCA 3FZLB 1I6ZA 5AQJB 4HWHA 4HWIB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LDQ B;  4HWD A;  3M3Z B;  1UK5 A;  5AQK B;  5AQR B;  4HWF A;  3FZH B;  3A8Y C;  5AQP B;  5AQG B;  5AQT B;  5AQF B;  2D9D A;  3FZF B;  5AQO B;  1HX1 B;  3FZM B;  5AQQ B;  1M7K A;  5AQH B;  1UGO A;  5AQS B;  3FZK B;  5AQI B;  5AQL B;  5AQM B;  5AQN B;  1M62 A;  5AQU B;  5AQV B;  1T7S A;  4HWC A;  3FZL B;  1I6Z A;  5AQJ B;  4HWH A;  4HWI B; 
#chains in the Genus database with same CATH topology
 1IJ6 A;  2YU1 A;  3RIF A;  2X67 A;  5HEH A;  4F8H A;  2WWU A;  4QHO A;  3ZMV B;  2A72 A;  2X9X A;  1YW0 A;  5L3F B;  3L09 A;  2K3W A;  2LM2 A;  3LG7 A;  4QH4 A;  4QX8 B;  5LHH B;  5LXT E;  1FEW A;  2PJQ A;  2W63 A;  2XQ4 A;  4KHZ F;  3VR8 A;  3ANW A;  5C3J A;  3PUY F;  5AQF B;  2WZH A;  3AEA A;  1EZ3 A;  3C51 A;  3GWH A;  4MBQ A;  4GKK T;  3LFM A;  2LJL A;  1G73 A;  2V7K A;  2MBG A;  1MMG A;  1SE7 A;  5ABH A;  4C90 A;  2DNX A;  3M65 A;  4HKA A;  2K24 A;  4AQG A;  4YSY A;  4OYJ A;  2DL1 A;  1MND A;  2FBW A;  5HEJ A;  5LMU T;  2GK9 A;  2VAS A;  3VHL A;  2ZM6 T;  3RHW A;  4JI5 T;  5L3B B;  3ONX A;  2BG9 E;  4XZC A;  2HHH T;  2MOZ A;  3DP7 A;  2C5K T;  3H3M A;  2YDR A;  3RC3 A;  3H37 A;  3U78 A;  4AQY T;  4TWD A;  5J2U E;  5FY1 A;  1HX8 A;  3C50 A;  5LG3 A;  2V7M A;  3AAI A;  2WSS V;  3A8Y C;  3CX7 B;  3DJB A;  4B6X A;  2RP4 A;  4EOZ B;  5HWX A;  3FBZ A;  4F6R C;  3P50 A;  4DMV A;  3ZLI A;  3RQU A;  3RIU A;  2YEV C;  3FZF B;  2LKH A;  3RPU A;  1VOM A;  4HFH A;  2X66 A;  3E22 E;  5JRC A;  1X79 A;  4KP3 C;  3HKB E;  5ETW A;  1HG2 A;  5A1L A;  1UGO A;  1ZKE A;  2WZI A;  3AA0 B;  3AB3 B;  1IBL T;  4QKN A;  5HEU A;  5AQI B;  4KUM B;  4LFC T;  2UXD T;  1D1A A;  1ZEE A;  4I43 B;  2CHN A;  3SWH A;  3UQ4 A;  4UVA B;  4DR1 T;  1N34 T;  2E2A A;  1YQ4 A;  4I55 E;  2V7I A;  2PFV A;  2A9U A;  4NUU A;  4YT0 A;  4UIG A;  2UU9 T;  4GYS A;  2BG9 B;  4MFR A;  3K8P C;  4PFP A;  1U4Q A;  3TLU A;  2XAH B;  4TN7 B;  2VL0 A;  1KNP A;  2VKO A;  3UU8 A;  4EGW A;  1XNQ T;  5JTG A;  4YTP A;  2XM1 A;  1HF8 A;  3AE9 A;  4KI0 F;  4DV5 T;  3P8C D;  3R6N A;  4A97 A;  4LFA T;  4TNV A;  4UEL A;  4IIJ E;  4OYK A;  3AXJ A;  4AIS A;  2BKN A;  3ZCI A;  1N32 T;  1IJ5 A;  5DJQ C;  3OBV E;  2HPJ A;  5CFB A;  2E5V A;  2LHN A;  4J2C A;  2NW9 A;  4H9P C;  1HX1 B;  4BJN A;  1UX4 A;  2CLY B;  4ZZC A;  4B3M T;  4DV1 T;  3FBL A;  4YHH T;  4WZX A;  4ZXL A;  1LRZ A;  3AE1 A;  2JQK A;  3CK6 A;  2WU5 A;  3OYZ A;  4L5G A;  3RKG A;  3ZYL A;  4AQF C;  3P4W A;  3Q5X A;  5F8P A;  4HFC A;  1HNZ T;  3UUX B;  3Q2M A;  3Q5W A;  4Z91 A;  3P4P A;  1W09 A;  5HXC A;  3UUM A;  3WAK A;  5L4E A;  1J5W A;  4HTE A;  4PJL A;  2C5J A;  4U74 A;  2W4X A;  4GK5 E;  2M67 A;  2XM2 A;  3RLF F;  4DV3 T;  4U7Y A;  3GN5 A;  4UV9 B;  4IT4 A;  3LDQ B;  1NAF A;  2CM0 A;  3QK6 A;  4QH5 A;  3F31 A;  4P0B A;  3RI5 A;  1O3X A;  4QWN B;  3ZMZ B;  2VL8 A;  3UU3 A;  2F4V T;  4YSX A;  5IHY A;  2H89 A;  4IST A;  2XAF B;  1LVF A;  3I1A A;  4ZI2 C;  4ILA A;  3EUH A;  4EV6 A;  4LF5 T;  4MAL A;  2I6H A;  2Q9Q A;  4AKR B;  2LOS A;  3KIN B;  5LOV E;  4C91 A;  5EZY E;  2UXB T;  2NTX A;  3AE5 A;  2IUB A;  3RQW A;  2QA7 A;  1WR0 A;  3PUW F;  2WY2 A;  3O1J A;  4V1A v;  1US7 B;  1OED C;  2K9A A;  2LSY A;  4QH1 A;  2NW7 A;  2VWA A;  3ZPO A;  5JH7 E;  4TZ4 C;  2EHO A;  4ASK A;  3IF8 B;  3K3N A;  2NWB A;  2CBJ A;  2DWK A;  3RH3 A;  2BKP A;  4BJM A;  4EED A;  3SFE A;  1J5E T;  4EYU A;  1KK7 A;  2NTY A;  2W61 A;  2YIN A;  2BDE A;  3N9M A;  3OKQ A;  2D5U A;  5H6Q B;  5TAO A;  3UU4 A;  3IBP A;  2Y6X A;  3NWI A;  4U3C A;  2Y8D A;  3AE6 A;  4U2Z A;  5GON E;  5FYM A;  2LM9 A;  2OV9 A;  3ZT5 A;  3H3A A;  1UK5 A;  2BVM A;  3OJA A;  5AQR B;  1VCS A;  2FJD A;  3NBX X;  2W00 A;  4X62 T;  4AIU A;  2ZLY A;  4IE7 A;  4DV7 T;  1HNW T;  3AA7 B;  3VKG A;  3AE4 A;  3RYI E;  2MTQ A;  4PK6 A;  4Z90 A;  4MLK A;  5IYZ E;  4YY3 T;  3NZQ A;  2EHO D;  2SPC A;  4KX6 A;  1MIW A;  2XQ3 A;  3AE8 A;  3N2O A;  3ZC0 A;  1J1J A;  4B3R T;  1R8I A;  3ZMT B;  3VRB A;  3LBX B;  4PNI A;  3T1Y T;  5AQH B;  2LRL A;  3QNU A;  5IWA T;  4ZOL E;  3GMI A;  3PUS A;  2PTF A;  3EAM A;  3F57 A;  3I9W A;  1HTJ F;  2XQ8 A;  3NKZ A;  3O1I A;  4CI2 B;  4H9O C;  3T8O A;  1T7S A;  1E2A A;  4ILB A;  1BR2 A;  3JC6 D;  1I6Z A;  1ZV4 X;  3LJC A;  4JUY A;  2VVS A;  3ABV A;  4DV0 T;  3C98 B;  2L3L A;  5BMV E;  3KV4 A;  2QVA A;  4IRE A;  3QUJ A;  5J1G A;  5JDL A;  2NP9 A;  1OED E;  2IML A;  2V6Y A;  4ILU A;  5FL1 A;  3PUA A;  2W62 A;  4HFB A;  3ESL A;  3AEG A;  2XSA A;  2YKS A;  4X66 T;  3EI0 A;  4JEH B;  2BG9 A;  5JVD E;  3PTR B;  2V7L A;  1FJG T;  3VKH A;  1Y64 B;  3BQK A;  4IE6 A;  3NRX A;  2W0G A;  2X0L B;  3QB5 A;  3EHZ A;  2WMN A;  3I0Q A;  5FKY A;  3VU7 H;  5KMG P;  2IAK A;  1D0X A;  2WDQ A;  4TV8 E;  5KX5 E;  4WNK A;  3KFW X;  4P09 A;  5KDM C;  3V5S A;  1UX5 A;  4QXC B;  2CXL A;  4HFV A;  4KBM B;  3S4U A;  3K3Q C;  2CWO A;  2OLT A;  4O8S A;  3D0T A;  2CEA A;  3GN5 B;  2XSB A;  3W15 B;  2D0U A;  2V26 A;  4CN4 A;  2JQQ A;  4DID B;  5CJ5 A;  5KXJ A;  5LJN A;  4A98 A;  4KHP T;  1HNX T;  1YKE B;  4QX7 B;  2VKD A;  4X1Y E;  2XPK A;  4ISS A;  2YOE A;  1CHU A;  2NOX A;  4I4T E;  2EHO B;  2XZE A;  3JAD A;  4IE5 A;  3HI2 A;  4PK4 A;  3RF1 A;  2E8I A;  4ANJ A;  3BQI A;  4HWD A;  4JI3 T;  3AED A;  5HXR A;  3AA1 B;  3ANW B;  3MZK B;  2WWV A;  3ZST A;  1WFD A;  4NUV A;  5FXX A;  1YD8 G;  2IC6 A;  3SS1 A;  3ZT6 A;  4DVD A;  2WQY A;  4UR9 A;  4I0U A;  2BS4 A;  5FMN A;  1BR4 A;  3PV0 F;  5FP3 A;  1XMQ T;  2CBI A;  3P7I A;  2LRK A;  3L8R A;  2YK0 A;  4X5T A;  2J4G A;  1JNZ A;  2M6B A;  2NW8 A;  3IA3 A;  5HWY A;  4WW0 A;  3RIA A;  4UXN B;  2C0S A;  1M7K A;  1X9B A;  5J0Z A;  2LEH A;  5C8Y E;  4XAX B;  2X9Y A;  1VRB A;  2D0T A;  5J2T E;  3AEE A;  1FIO A;  1MMA A;  3EAB A;  3CPZ A;  3AEF A;  4DBR A;  2Z6E A;  2VKH A;  3I9Y A;  3U3I A;  4LF6 T;  4HGA A;  1NEK A;  2HN1 A;  4CXX A;  2J1D G;  3HL6 A;  5HYA A;  2BVL A;  3C4X A;  3QOF A;  4JI7 T;  4WYV A;  3AEB A;  5LG4 A;  3PUQ A;  4CN6 A;  1B7T A;  5ABF B;  2VQF T;  1LKX A;  3MA9 A;  5JDM A;  2W2U A;  3V5U A;  4ZI3 D;  1W0A A;  3LBX A;  4YLH A;  5HXE A;  4DR6 T;  3PUR A;  2E9X B;  3TLW A;  5ABF A;  3LSV A;  3ZT7 A;  5JDN A;  2KT9 A;  4AI6 A;  2D9D A;  5CGM A;  4HE8 A;  3IEE A;  2FJB A;  5L4H A;  3RC8 A;  1D0Y A;  2E9X A;  1QUU A;  1QSD A;  4PFO A;  3UU5 A;  4CXY A;  3OTO T;  5F3J A;  3ZSS A;  3NZP A;  2XAG B;  5AQM B;  4X65 T;  2IDO B;  4ZHQ E;  4FI5 A;  5LBM A;  4AKL A;  1D0Z A;  2X0Y A;  4K0K T;  3PJA J;  4IE0 A;  4JI1 T;  4AXP A;  3B13 A;  3LK3 B;  1E7P A;  3MJX A;  2A2F X;  2L8K A;  2XQ6 A;  3A7M A;  3B5M A;  2YDQ A;  3PUV F;  4U33 A;  4M1P A;  3RYC E;  4U72 A;  3UT5 E;  3AE2 A;  4KMC A;  4DUZ T;  2E9X D;  4DV4 T;  4P0A A;  4Q25 A;  3AVS A;  1XMO T;  3EVY A;  5L3C B;  2JQ9 A;  3ZJ1 A;  4A5X A;  5IUX A;  3KBT A;  1W9R A;  2BS2 A;  1KNZ A;  3KV5 A;  3ONJ A;  1OED A;  2QGS A;  2I0M A;  3BQL A;  4JBW F;  2YU2 A;  4DR7 T;  3GA8 A;  4ADZ A;  4EIW A;  5CA0 E;  5AQQ B;  3MKD A;  4H9N C;  3CIR A;  4EEB A;  5L3E B;  2MAW A;  1UUR A;  2H3R A;  1NWM X;  2FJA A;  2JMK A;  2LSK A;  2V6X A;  1CUN A;  2V1D B;  2W67 A;  2XQ5 A;  3OVU A;  3FZL B;  4HWC A;  3UU6 A;  4EXT A;  2J62 A;  3CVR A;  4HN9 A;  3AE7 A;  3KV6 A;  4AQF A;  2KND A;  2V5D A;  3JC6 C;  4HFD A;  4O4J E;  2C5I T;  4YHJ A;  2WB5 A;  4YXD A;  5AFU L;  3CWZ B;  3TLV A;  1ZOY A;  1D1C A;  2V7J A;  1IZN B;  2K5B B;  5L3D B;  3L39 A;  4GOU A;  3TLS A;  3HKD E;  3C4W A;  5C2T A;  5JR9 A;  3N9O A;  2CPT A;  5HCM A;  4DR3 T;  1E1H B;  2J47 A;  2JMH A;  3ETU A;  2FUP A;  4G2A A;  4OK0 A;  3LK2 B;  4UVB B;  5HAX A;  4IGU A;  4QXH B;  3AAA B;  3ZC1 A;  2QYW A;  2VVN A;  5EK3 A;  4CXW A;  5FXV A;  1BR1 A;  4ZI7 E;  1YKH B;  4GYR A;  3CQX C;  4BAY B;  5ADX L;  5LYJ E;  2OA5 A;  2ZM8 A;  2CXD A;  2H7O A;  4COF A;  2B1E A;  4ZS2 A;  5AQN B;  2FJE A;  4ILC A;  3KV9 A;  2MYS A;  5EK4 A;  3UFG A;  3UUB A;  2YDS A;  4UF0 A;  2KZ7 B;  3RYH E;  2CCQ A;  2LLY A;  5JDF A;  4U2Y A;  3HA4 A;  5JDQ A;  3B57 A;  4H63 H;  1HFA A;  1UUS A;  2ZMA A;  4PJM A;  4DR5 T;  2MPK A;  2WMO A;  3QB5 K;  2CXF A;  2KSR A;  2R6G F;  3AXJ B;  3CX8 B;  2BKO A;  3UUN A;  4EYY R;  2YN6 A;  4GKJ T;  2IC9 A;  1OXZ A;  2K48 A;  2XHE B;  3JCF A;  1N33 T;  3J9X 1;  4TWH A;  5FXZ A;  4JEU B;  4N78 D;  4YTM A;  4YJ3 E;  2XQ7 A;  4I50 E;  5AQP B;  3O4X E;  3PUZ F;  3N9Q A;  2ES0 A;  1LVK A;  3T1H T;  5M4Y A;  2L9Q A;  1WR6 A;  2WDR A;  4Z8X A;  2UXN B;  3PE0 A;  4ZS3 A;  2KWH A;  3MAC A;  3X1D A;  2AXD S;  3E08 A;  2V5C A;  3O9X A;  3ZN1 B;  3HKE E;  5FNV E;  5L47 A;  2JPF A;  2DLR A;  2PBI A;  3EDU A;  3UQ7 A;  4O4H E;  5DQV A;  1OED B;  2XQA A;  2X9H A;  1MIY A;  3P4S A;  2B76 A;  4O2B E;  4O2A E;  3ZYM A;  5AQV B;  3UFE A;  3UTK A;  2ZM0 A;  2LOP A;  2WU2 A;  3Q9D A;  4NPP A;  4DV2 T;  2DHR A;  2KIN B;  2LHR A;  2CRB A;  2V6Y B;  4UV8 B;  3AAE B;  4IDO A;  4YJ2 E;  2H7V C;  2V8S V;  1IBK T;  3CX6 B;  1SHZ C;  4IHJ E;  3MK7 C;  3OYX A;  4CI3 B;  2ODV A;  4LML A;  4JI6 T;  5LHI B;  4B3T T;  4H9S E;  3RIU C;  1IAP A;  2WP9 A;  1N36 T;  3NVO A;  4DO0 A;  5HXS A;  3MXZ A;  3NRY A;  2KWI B;  5LP6 E;  5AQT B;  2CHO A;  3N2G E;  2LSJ A;  5JDH A;  3BK9 A;  2XY8 B;  4DR2 T;  5DAB A;  4JI4 T;  2UXX B;  5AQO B;  3FZM B;  3CKD A;  4TUY E;  4IDN A;  5LA6 E;  3RGL A;  3VR9 A;  4OX9 T;  1SA0 E;  4ZZB A;  4LF8 T;  3KVA A;  3TLT A;  2UUB T;  2ZM2 A;  1H7C A;  3CQG B;  1MNE A;  3DTO A;  4NIQ A;  4ZI3 C;  3ZMU B;  4U7I A;  5F5W A;  3ZEF B;  2BBJ A;  2X68 A;  3PDY A;  5LJM A;  5EK2 A;  4P1N A;  3FXE B;  4HWI B;  4O4I E;  3ZJ2 A;  3J7Y q;  4IDQ A;  3L3P A;  2G0U A;  3ONL C;  2CLY C;  3PUG A;  4X1I E;  3SFD A;  3UUL A;  1DU2 A;  1KF6 A;  4A56 A;  2VUR A;  3KVB A;  3PU8 A;  2UUA T;  2WM9 A;  4IL4 A;  4PJJ A;  4JYA T;  3WI3 A;  3N9P A;  2LKG A;  2VB6 A;  2IW5 B;  1ZHC A;  2KXP B;  4LFB T;  5JDG A;  4CQI A;  3ZN0 B;  5JRC B;  1MIV A;  1YQ3 A;  3E0Z A;  2Y48 B;  4X64 T;  4IDP A;  5AQG B;  1W0B A;  1OWA A;  1WCR A;  3N9N A;  4DUY T;  1S94 A;  3KDS E;  4MHC A;  5E0O A;  2X0H A;  2CMR A;  2CE7 A;  3ZKR A;  3R84 B;  5LGU B;  5LCY A;  4JI2 T;  4EAH A;  4TX5 A;  1UCU A;  1AJ3 A;  4EB6 E;  4E7S A;  1WYB A;  2BS3 A;  2HN2 A;  4L9I A;  5FY7 A;  2N2N A;  3JAF A;  3EDV A;  4DND A;  2Q9Q D;  5LHG B;  5AQU B;  2AE9 A;  5FY0 A;  3QC9 A;  1MMN A;  3ZYK A;  5LGN B;  2PG8 A;  4IE4 A;  3RKO A;  4QXB B;  3RX6 A;  1IBM T;  1T8B A;  3AEC A;  2KLQ A;  1MMD A;  1ZP0 A;  4TWF A;  2IHR 1;  2WDV A;  5HEO A;  4PJN A;  5LB7 B;  4GIW A;  1V9D A;  3O1H A;  4JLE A;  2Q9Q C;  4NXN T;  2BZB A;  4YTN A;  4IDZ A;  2ODU A;  3CQC B;  5AQK B;  2UUC T;  3FZH B;  4FJO A;  1U5P A;  5L3G B;  3RYF E;  2XQY A;  1KFY A;  2X9W A;  2JRK A;  1VCT A;  2CWY A;  2KMF A;  3HR0 A;  4YFS A;  4WBO A;  4GK0 E;  1BR0 A;  1Z8U A;  3C64 A;  4L0R A;  2HH7 A;  2EHO C;  2XJ7 A;  4AKH A;  1HG5 A;  4AKI A;  4JI8 T;  3A5X A;  1KNR A;  2JQH A;  3FHN A;  3JAE A;  2NR4 A;  3CML A;  2Q9Q B;  4IL9 A;  4BA9 A;  5AQS B;  3FZK B;  1XZY A;  4H63 V;  5DQW A;  5AQL B;  3SOL A;  4ZEY A;  4DBQ A;  4ERR A;  2N9D A;  1Z0P A;  1I94 T;  5ABG A;  2H88 A;  1XNR T;  2DI4 A;  2LSG A;  2WBL A;  2E9X C;  3C4Z A;  3FXD B;  3N5L A;  5H6R B;  5LBQ B;  4AKG A;  4HWH A;  1HR0 T;  4LF7 T;  2BBH A;  3VRA A;  4JV5 T;  2UXC T;  3WAJ A;  3AA6 B;  5HEG A;  4PAG A;  2I59 A;  2ACZ A;  2A3D A;  3M3Z B;  3N9L A;  2RA1 A;  2HPL A;  5FL0 A;  4H9Q C;  4B3S T;  3LK4 2;  2XAJ B;  5HXH A;  3PUX F;  5FVL A;  3PJA A;  4CI1 B;  4H9R C;  3K3O A;  2WAU A;  2LSI A;  3I0O A;  4HEA A;  2E5L T;  2W66 A;  2CA5 A;  5HCJ A;  5L2L A;  2QRX A;  4UF0 B;  1XWM A;  4U31 A;  4UVC B;  4CZZ B;  4JI0 T;  3HKC E;  4PW8 A;  4TNW A;  3F2E A;  1S35 A;  1GQE A;  1M62 A;  2XUE A;  4CN1 A;  3G06 A;  4DV6 T;  2RPA A;  4UEM A;  4DMW A;  3P4Q A;  4X20 E;  2M6I A;  4YSZ A;  3K1S A;  2XQ9 A;  4HFI A;  5AQJ B;  3RRW A;  5LNK A;  4X1K E;  2BG9 C;  3ETV A;  2VKJ A;  3Q5E A;  3RRC A;  1SUM B;  5JR9 B;  4EZH A;  1FMV A;  2XTL A;  3AVR A;  1XDP A;  4K0U A;  1YXR A;  5FVK A;  4ZI2 D;  2X51 A;  1HS7 A;  1HCI A;  4HWF A;  1T72 A;  1L0V A;  3AE3 A;  1WRD A;  5FXW A;  3ZMS B;  3Q5D A;  5LMN T;  1D1B A;  1FMW A;  2IIU A;  5JQG E;  2JJ9 A;  1JNR A;  4HFE A;  1T98 A;  2VQE T;  3FB2 A;  2JIW A;  2D2S A;  2VK9 A;  3PU3 A;  4G63 A;  4PK5 A;  3TKL B;  4E7Z A;  2WCA A;  5BR8 T;  2ACX A;  4DR4 T;  3KBU A;  2XAS B;  2LT3 A;  1QLB A;  2LE8 A;  4EZ4 A;  1NEN A;  5JRE A;  3N2K E;  4WBN E;  3OPC A;  5JR9 C;  5CA1 E;  4NXM T;  2P9B A;  4O4L E;  3SRZ A;  1KEY A;  2XAQ B;  1XDO A;  4OFZ A;  4LF4 T;  4XBF B;  4LF9 T;  1WLX A;  1WYC A;  3IHR A;  3ZCJ A;  4LMJ A;  4LMK A;  4OHF A;  5CB4 E;  2WS3 A;  2DCF A;  1Y01 A;  2N1G A;  3P4R A;  5LGT B;  5ABE A;  4TV9 E;  1G8X A;  2DWG A; 
#chains in the Genus database with same CATH homology
 3LDQ B;  4HWD A;  3M3Z B;  1UK5 A;  5AQK B;  5AQR B;  4HWF A;  3FZH B;  3A8Y C;  5AQP B;  5AQG B;  5AQT B;  5AQF B;  2D9D A;  3FZF B;  5AQO B;  1HX1 B;  3FZM B;  5AQQ B;  1M7K A;  5AQH B;  1UGO A;  5AQS B;  3FZK B;  5AQI B;  5AQL B;  5AQM B;  5AQN B;  1M62 A;  5AQU B;  5AQV B;  1T7S A;  4HWC A;  3FZL B;  1I6Z A;  5AQJ B;  4HWH A;  4HWI B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...