4HWFA

Crystal structure of atbag3
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
87
structure length
87
Chain Sequence
SASKSISDISFEVDRLAGQVSAFETVINKGGKVEEKSLVNLIEMLMNQLLRLDAIIADGDVKLMRKMQVQRVQKYVEALDLLKVKNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Apoptosis
molecule keywords BAG family molecular chaperone regulator 3
publication title Structural insight into plant programmed cell death mediated by BAG proteins in Arabidopsis thaliana.
pubmed doi rcsb
source organism Arabidopsis thaliana
total genus 37
structure length 87
sequence length 87
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02179 BAG BAG domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.120 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 BAG domain 4hwfA00
1I6ZA 5AQHB 5AQNB 1UGOA 3FZLB 1M7KA 5AQUB 5AQOB 5AQTB 5AQVB 3FZMB 5AQIB 5AQMB 4HWHA 3FZHB 3LDQB 4HWDA 5AQPB 5AQSB 5AQQB 3FZFB 1T7SA 1UK5A 4HWFA 5AQGB 5AQFB 1HX1B 5AQKB 5AQRB 3FZKB 2D9DA 5AQLB 3M3ZB 4HWIB 3A8YC 1M62A 5AQJB 4HWCA
chains in the Genus database with same CATH superfamily
3C98B 3AAEB 1W0AA 4O4LE 3ZT7A 4U2YA 3LBXA 4ILUA 3AA6B 4UIGA 4ZI3C 3KV9A 2VL8A 2Z6EA 4AQFC 5LXTE 5F5WA 4NPPA 3M3ZB 2J47A 5LP6E 3CX8B 4LF6T 4I4TE 2VVSA 5AQIB 2X67A 2LOSA 1XNQT 5AQSB 1UK5A 4YJ3E 4F8HA 3PE0A 5LHIB 3B57A 5GONE 5HWXA 4H9OC 5C2TA 2WDRA 4HE8A 3O9XA 4XZCA 1MIVA 1MNDA 3AEAA 3PDYA 5L3GB 3L8RA 1CUNA 3AE2A 3O4XE 4GKKT 1J5WA 4LF9T 4YSZA 4EYUA 1XDPA 3UFEA 1I94T 1WR6A 1KF6A 1WCRA 2K5BB 1BR4A 2YDQA 4TWHA 2XQ8A 2LSGA 3ANWB 1D0YA 3RGLA 4WBOA 4CQIA 2JRKA 4L0RA 1W9RA 5FKYA 3CX6B 5FYMA 2K3WA 2VASA 4DV0T 2N2NA 1FMVA 3GN5A 1ZV4X 1MMGA 2XQ7A 4Q25A 3ZCJA 4F6RC 1SE7A 1IBKT 3HR0A 2BZBA 2WCAA 4LMKA 5IUXA 2VB6A 5HXSA 4O2BE 4OX9T 2UUCT 3N2GE 2OA5A 1ZHCA 1BR0A 3WI3A 3AVSA 1LKXA 4EIWA 3KINB 5ABGA 2WWVA 2MPKA 4C91A 3IBPA 2BS4A 2NTYA 4HFHA 5L3BB 4DR3T 3HA4A 3RIUC 2BBJA 4XBFB 5L3FB 4FI5A 4ZI2D 4PFPA 2MAWA 1YQ3A 1KFYA 3QB5A 2XQ3A 4JEHB 3AE4A 4TWDA 2XM2A 1HFAA 1ZKEA 2V26A 4KX6A 2JMKA 3UQ7A 5LYJE 4B6XA 3JC6D 3X1DA 1BR2A 2L9QA 2QRXA 4X5TA 4KP3C 4BAYB 4AQGA 2J1DG 1HTJF 3MK7C 3ZMTB 4UF0A 2W2UA 2E9XC 5CGMA 2V5DA 4PJLA 2LHRA 2DWGA 3Q5WA 1KEYA 3MACA 4CZZB 3RC8A 4NUVA 2BKNA 4P1NA 3P50A 3VKHA 4AIUA 2ZM8A 1MIWA 4ZZBA 4QX8B 4Z90A 2Q9QA 4U74A 3ZLIA 1AJ3A 3CPZA 2XPKA 5AQUB 5JRCB 2WDVA 2DCFA 5HEUA 3UT5E 2FJBA 4YXDA 2QA7A 4U33A 1HF8A 4HTEA 3ZKRA 1HCIA 5LCYA 2CBIA 5HAXA 4NIQA 3LK2B 5LGNB 3UUMA 2ZMAA 3H3MA 3C51A 3C50A 3ZN0B 3ZC0A 2NP9A 2C5KT 4TV9E 2UU9T 4TN7B 4DIDB 1HG2A 3CKDA 3RYCE 2CA5A 4B3TT 3ZT5A 5AQRB 5DQWA 4ILCA 3E0ZA 4H9QC 2BKPA 4EEBA 2WMOA 3HI2A 1EZ3A 2LLYA 4DV7T 4HWDA 4DV4T 4JI0T 3AA0B 1WRDA 3KV5A 1HX1B 3UUXB 2EHOA 4HKAA 5HCMA 2X9HA 5TAOA 4CXXA 3I1AA 4FJOA 4AKGA 3N9LA 4GK5E 2KNDA 4YFSA 5FXXA 2DNXA 2LSYA 3NWIA 3JADA 3NBXX 4KMCA 2QYWA 3Q2MA 2JIWA 3RYHE 1OEDB 3DTOA 3ZJ2A 2NW9A 4XAXB 2LT3A 2X9YA 2YKSA 4OFZA 3U3IA 5JTGA 2LKHA 5AQNB 3W15B 5ABHA 5KX5E 4I43B 4YY3T 4DBRA 2JQQA 2LOPA 3F57A 3NRXA 1HNXT 3P4SA 2E9XB 1I6ZA 4IE6A 4U31A 1VOMA 2HN2A 3UU5A 2IC9A 4QXBB 2CLYC 2H7VC 3RRWA 4O4HE 3FZMB 1T98A 4IDOA 1FIOA 3UFGA 5IWAT 5L47A 2KINB 2X9XA 3SWHA 4ASKA 5AFUL 1YD8G 5HEOA 5CFBA 5AQTB 3RI5A 3MKDA 3PURA 2ZM2A 5HXEA 4X66T 2IUBA 5AQKB 2A72A 5ABFB 1IJ5A 5IHYA 2YDRA 3V5SA 4HWCA 3I0QA 5HEHA 3AXJB 4IDNA 4U2ZA 3B5MA 3AA7B 2XQ4A 2YU2A 3TLVA 2UXCT 3LBXB 5F3JA 1X9BA 2XAJB 2JMHA 2I0MA 3RKGA 3AVRA 4LFCT 3LFMA 3EUHA 1M62A 4A97A 5HXHA 5EZYE 4EZ4A 3ZYLA 5M4YA 5C3JA 4DV6T 2WB5A 4PNIA 2LM2A 4IE4A 2X0LB 5J1GA 2VWAA 1SHZC 4CN4A 4ERRA 4B3ST 3QK6A 4BJMA 1IBMT 5BR8T 3LJCA 4IREA 2W63A 3VRAA 4CXWA 1KNRA 3HKCE 3N9MA 2E5VA 2BG9E 2AE9A 3AAIA 1YKEB 4PK5A 3RKOA 2Q9QC 2X9WA 4HFCA 4TNWA 3JAFA 3U78A 2LHNA 4ADZA 5KMGP 2M67A 1BR1A 1ZP0A 2CRBA 3GN5B 5JREA 4OK0A 2CLYB 2X0YA 3OPCA 2E8IA 3OBVE 1HR0T 4JI7T 3N5LA 3FB2A 2W00A 3QNUA 4HWHA 5L2LA 1L0VA 4IDPA 3ZMZB 3O1JA 3FXDB 2RPAA 5HXRA 2XZEA 1MMAA 2K9AA 5J2TE 2M6BA 1NEKA 3RQUA 4A5XA 4MALA 1IBLT 3TLUA 4L5GA 2VVNA 5C8YE 5LA6E 3UU6A 2BDEA 2FJEA 2EHOC 4EB6E 1U5PA 1XNRT 4K0KT 3PUSA 3RHWA 3CVRA 3LK42 4IGUA 4I55E 5JR9A 2D9DA 3RIFA 1G8XA 2XY8B 2B76A 5EK3A 4GK0E 4ZS2A 4HN9A 4HGAA 3RIAA 2W4XA 2H89A 5JDFA 4OYKA 1MIYA 2KWIB 2RA1A 3VHLA 3L09A 4PW8A 1XDOA 5LB7B 2DI4A 2H88A 4IDQA 4PJJA 3N9NA 3V5UA 5E0OA 2YOEA 5KXJA 5HCJA 1D1BA 1R8IA 2W66A 3DJBA 4EEDA 1N34T 4UF0B 2IW5B 2LEHA 5FY1A 2HPLA 4H9NC 4IHJE 4PJNA 3MA9A 1D1CA 2V7KA 4KUMB 3RRCA 2V5CA 2XJ7A 1KNPA 4LF4T 2HPJA 1WYBA 3C4ZA 4DO0A 5ETWA 5F8PA 5LBMA 4LMLA 2DLRA 3F31A 3H3AA 1T72A 2WS3A 4I50E 5HYAA 3OTOT 4COFA 5ABEA 4H63V 1HNZT 5LGTB 2Q9QB 4JV5T 3KVBA 2W62A 3A5XA 4YTNA 5H6QB 4ZI2C 5L3CB 4YT0A 3SFEA 5LNKA 3ETUA 4H9PC 4ILBA 2LSJA 2NR4A 2FJAA 5EK4A 2ODVA 3AE7A 1U4QA 3PUGA 2ACZA 2XAQB 3OKQA 5IYZE 3JC6C 3M65A 3F2EA 2ZM0A 2YN6A 4CI1B 3RPUA 3IEEA 1HX8A 4EAHA 4DR7T 4CI3B 3RLFF 5LJNA 4IE0A 2VKDA 2VQET 3FZKB 5AQLB 2DWKA 1HG5A 3UU8A 3IF8B 3K1SA 4PJMA 1IJ6A 2N9DA 2KZ7B 1XMQT 2X0HA 4JLEA 3ZSSA 5LBQB 4ILAA 1S94A 2D2SA 3PJAJ 3C64A 5HEJA 2EHOB 5KDMC 4Z91A 4DNDA 3AE9A 1YKHB 3ZYMA 1JNRA 2CHNA 2XQ5A 2X66A 4A98A 2WSSV 4AXPA 5FXWA 2XQ6A 3N9OA 3AE1A 2UUAT 1H7CA 1KNZA 2CBJA 2WQYA 5FY0A 2XQ9A 1Y64B 2D0UA 3G06A 3P4WA 3D0TA 3PTRB 4JI2T 3J7Yq 2ES0A 4DV1T 4EZHA 5JVDE 3OYXA 3AEEA 1FEWA 2IHR1 4U3CA 4NXNT 4DR5T 3Q5DA 1T8BA 1UURA 2Y8DA 4MFRA 4TWFA 4ISTA 4QWNB 2C5IT 2XAFB 3EDUA 2HH7A 3BQLA 2UXDT 3NZQA 3J9X1 3Q5XA 4HFIA 4HWIB 4IL4A 2YEVC 2JQHA 3TLTA 1Z8UA 2BVMA 4O8SA 3FZLB 1W09A 2BBHA 2JPFA 5FXVA 4P09A 4E7SA 4ZEYA 2VK9A 5JDQA 4X62T 3N9QA 3PUYF 1YXRA 2DL1A 5DQVA 4LF7T 2G0UA 2WWUA 1VCTA 4OYJA 5LMUT 3CK6A 3C4XA 4TZ4C 5JR9C 2F4VT 2ZM6T 3FZHB 4EV6A 3NZPA 2XASB 3ZC1A 3AEBA 1T7SA 1WYCA 1UUSA 2AXDS 3E08A 3HL6A 3EI0A 3ABVA 3OJAA 3L39A 4WW0A 5LOVE 1FMWA 3BQIA 4V1Av 5AQMB 2CXFA 1MMDA 3LSVA 2FUPA 5BMVE 1G73A 4GYSA 2KWHA 3ESLA 4QHOA 2KSRA 3CX7B 4LF8T 3R84B 3FXEB 2LKGA 2UXXB 4X1IE 4G63A 4MBQA 2P9BA 2WM9A 5FNVE 1X79A 1JNZA 4CN6A 3TLWA 3LK3B 4ZZCA 3CWZB 4QXCB 2BG9A 2XUEA 4H9RC 4C90A 2WMNA 4U7YA 3EABA 2WU2A 2IIUA 2D0TA 1D0ZA 2VKHA 5JQGE 4DUZT 3PU8A 2A2FX 3MJXA 4WBNE 3Q5EA 2XSBA 1WR0A 3EHZA 3RC3A 1US7B 2RP4A 2KXPB 5LGUB 3FZFB 1NWMX 1WLXA 5JDHA 4KI0F 4YJ2E 4HFVA 3SRZA 5LG3A 2LE8A 1V9DA 1LVKA 2WZHA 2V6YA 1N36T 4QH4A 4QH5A 5CA0E 5J2UE 3LG7A 3PV0F 2DHRA 5L4HA 2I59A 2UUBT 3EAMA 3ZSTA 4ZI7E 2WY2A 2WDQA 4JI5T 2CCQA 3AE3A 4LFAT 4AISA 4QKNA 4JEUB 1SUMB 1IZNB 2PG8A 4DR1T 5HWYA 3VKGA 5AQGB 2JQKA 5JR9B 5AQJB 4MLKA 2VQFT 4AKHA 3I9YA 1M7KA 3N9PA 4UV9B 3S4UA 2YDSA 3NVOA 3P8CD 2CM0A 3T1YT 2V1DB 3VR8A 4DVDA 3VU7H 2N1GA 2CE7A 3SFDA 4CI2B 2W67A 3H37A 4IT4A 5L4EA 3ZMSB 3T1HT 5LG4A 2VURA 3AXJA 3UUNA 3C4WA 2KMFA 4LF5T 1XMOT 5FMNA 2PJQA 2CXDA 3ONJA 2KT9A 2A9UA 3LDQB 3FBZA 2XTLA 3WAKA 2JJ9A 1ZEEA 3PUVF 2Y48B 2Q9QD 2CMRA 2WAUA 3SS1A 3JAEA 4U72A 2PBIA 4B3RT 2I6HA 4AKRB 4JBWF 1OEDE 1YQ4A 3RH3A 4ZI3D 2XM1A 4DUYT 2PFVA 1CHUA 4WYVA 3BK9A 4QH1A 2KLQA 4YTMA 4WNKA 3UU4A 1J5ET 4ANJA 2WZIA 2BS3A 3K3OA 2H7OA 4B3MT 2YU1A 2FJDA 5DJQC 3FHNA 3VR9A 1ZOYA 4Z8XA 2IMLA 3UQ4A 1VRBA 3KV4A 2PTFA 4X20E 5LMNT 3ZCIA 4X1KE 5FL0A 3B13A 3ETVA 3P7IA 2ACXA 3P4QA 4DV2T 3AEFA 3GWHA 2EHOD 4PAGA 1DU2A 4PK4A 2IAKA 2V8SV 2NTXA 4IE7A 3GA8A 5L3DB 4GOUA 4IE5A 3K3QC 2CWOA 3R6NA 3CQCB 4DBQA 4LFBT 4JUYA 3P4PA 5L3EB 3ZMUB 1WFDA 2E2AA 4N78D 1UGOA 5AQOB 2ZLYA 2WU5A 4BA9A 2MYSA 2BG9C 4UEMA 2W0GA 2CPTA 4IIJE 1Z0PA 2MBGA 4M1PA 3L3PA 3QB5K 1D0XA 4JI3T 4GYRA 2YK0A 1E2AA 3PU3A 4DR4T 2H3RA 3EDVA 4KBMB 1UX4A 3A7MA 3AAAB 3GMIA 3AE6A 2K24A 3SOLA 5FL1A 3ZN1B 5AQFB 3ZEFB 3UU3A 3PUAA 3NRYA 1N32T 3AEGA 2YINA 4DV3T 4EGWA 2VL0A 2XQAA 3KV6A 3N2KE 4EYYR 2CWYA 4EXTA 4GIWA 2V7JA 2XSAA 4I0UA 4P0BA 4A56A 4E7ZA 4TUYE 2IC6A 2LRLA 3EVYA 4NXMT 1YW0A 1OEDC 4YLHA 4ZS3A 3ANWA 1NAFA 5LJMA 5JDMA 2HHHT 4IL9A 4H63H 4H9SE 2NW8A 3HKEE 1E7PA 3KFWX 2LSKA 5HXCA 1SA0E 4ZXLA 3P4RA 3RQWA 4JI4T 3CIRA 4AKIA 3AE5A 1MMNA 2L8KA 2L3LA 3PJAA 2C0SA 4CN1A 4EOZB 2LSIA 3MXZA 1N33T 5CJ5A 3KBUA 2CXLA 3A8YC 2E9XD 1KK7A 3RF1A 4YSXA 3OVUA 2W61A 4UR9A 2XAGB 3ZYKA 2SPCA 2VKJA 3RYFE 2JQ9A 3PUWF 4LMJA 4TV8E 2UXBT 5HEGA 4X1YE 5H6RB 4QX7B 3IHRA 2IDOB 1LVFA 3IA3A 4DMVA 5AQPB 2J4GA 1HS7A 4YTPA 1VCSA 3O1HA 2K48A 1OWAA 3CQGB 4GKJT 2BG9B 4HFDA 4O2AE 1IAPA 5AQHB 3UULA 2J62A 4AQFA 3MZKB 1HNWT 4UVCB 3PUZF 1MNEA 2ODUA 3CMLA 1QUUA 3QUJA 2V7IA 4HEAA 3O1IA 3ONLC 1XZYA 2QVAA 4YHJA 2V7MA 5FP3A 2LRKA 3PUQA 3ZT6A 5EK2A 4JI6T 2NW7A 2MOZA 2LJLA 3NKZA 2UXNB 3KBTA 2XQYA 3AB3B 1O3XA 1FJGT 1UCUA 4ZOLE 3HKDE 2MTQA 3ONXA 3AE8A 2V6XA 1OXZA 4UVBB 1E1HB 3WAJA 4AI6A 2V6YB 1Y01A 3RYIE 5A1LA 5CB4E 5FXZA 4TNVA 4X64T 4JI8T 5JRCA 4HWFA 3DP7A 4UXNB 2M6IA 4YSYA 4O4JE 4DR2T 2WP9A 4HFBA 4HFEA 2LM9A 4IDZA 5J0ZA 3KVAA 4MHCA 3K8PC 2A3DA 2VKOA 5DABA 4O4IE 3ZJ1A 4DMWA 4WZXA 2XAHB 3UUBA 3CQXC 2NWBA 4AQYT 1S35A 4UV8B 2NOXA 1B7TA 3ZPOA 4ZHQE 4CXYA 4X65T 2B1EA 2BS2A 4PK6A 3K3NA 5FVKA 5LHGB 2OV9A 1NENA 3KDSE 1D1AA 1LRZA 3UTKA 5FY7A 3QC9A 4JI1T 3HKBE 2D5UA 1QLBA 3TLSA 3RIUA 3OYZA 4DV5T 2Y6XA 2R6GF 1J1JA 4YHHT 4TX5A 5AQVB 3AA1B 3AECA 3PUXF 4BJNA 5AQQB 4U7IA 5ADXL 2CHOA 4JYAT 2E5LT 1OEDA 2XHEB 3I0OA 3QOFA 2X51A 3VRBA 1W0BA 4K0UA 2BKOA 4KHZF 4J2CA 3AEDA 2X68A 3E22E 1GQEA 2OLTA 3TKLB 5LHHB 5CA1E 2E9XA 5JH7E 3Q9DA 1UX5A 3RX6A 4DR6T 2WBLA 4ISSA 3JCFA 4OHFA 4UVAB 4G2AA 2FBWA 4QXHB 4KHPT 1QSDA 2HN1A 2C5JA 4UELA 2V7LA 3FBLA 5JDNA 3ZMVB 4P0AA 3BQKA 3I9WA 5FVLA 3T8OA 3N2OA 2CEAA 2QGSA 4NUUA 2GK9A 1XWMA 4L9IA 5JDLA 4PFOA 5ABFA 5JDGA 2BVLA 4AKLA
chains in the Genus database with same CATH topology
1I6ZA 5AQHB 5AQNB 1UGOA 3FZLB 1M7KA 5AQUB 5AQOB 5AQTB 5AQVB 3FZMB 5AQIB 5AQMB 4HWHA 3FZHB 3LDQB 4HWDA 5AQPB 5AQSB 5AQQB 3FZFB 1T7SA 1UK5A 4HWFA 5AQGB 5AQFB 1HX1B 5AQKB 5AQRB 3FZKB 2D9DA 5AQLB 3M3ZB 4HWIB 3A8YC 1M62A 5AQJB 4HWCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I6Z A;  5AQH B;  5AQN B;  1UGO A;  3FZL B;  1M7K A;  5AQU B;  5AQO B;  5AQT B;  5AQV B;  3FZM B;  5AQI B;  5AQM B;  4HWH A;  3FZH B;  3LDQ B;  4HWD A;  5AQP B;  5AQS B;  5AQQ B;  3FZF B;  1T7S A;  1UK5 A;  4HWF A;  5AQG B;  5AQF B;  1HX1 B;  5AQK B;  5AQR B;  3FZK B;  2D9D A;  5AQL B;  3M3Z B;  4HWI B;  3A8Y C;  1M62 A;  5AQJ B;  4HWC A; 
#chains in the Genus database with same CATH topology
 3C98 B;  3AAE B;  1W0A A;  4O4L E;  3ZT7 A;  4U2Y A;  3LBX A;  4ILU A;  3AA6 B;  4UIG A;  4ZI3 C;  3KV9 A;  2VL8 A;  2Z6E A;  4AQF C;  5LXT E;  5F5W A;  4NPP A;  3M3Z B;  2J47 A;  5LP6 E;  3CX8 B;  4LF6 T;  4I4T E;  2VVS A;  5AQI B;  2X67 A;  2LOS A;  1XNQ T;  5AQS B;  1UK5 A;  4YJ3 E;  4F8H A;  3PE0 A;  5LHI B;  3B57 A;  5GON E;  5HWX A;  4H9O C;  5C2T A;  2WDR A;  4HE8 A;  3O9X A;  4XZC A;  1MIV A;  1MND A;  3AEA A;  3PDY A;  5L3G B;  3L8R A;  1CUN A;  3AE2 A;  3O4X E;  4GKK T;  1J5W A;  4LF9 T;  4YSZ A;  4EYU A;  1XDP A;  3UFE A;  1I94 T;  1WR6 A;  1KF6 A;  1WCR A;  2K5B B;  1BR4 A;  2YDQ A;  4TWH A;  2XQ8 A;  2LSG A;  3ANW B;  1D0Y A;  3RGL A;  4WBO A;  4CQI A;  2JRK A;  4L0R A;  1W9R A;  5FKY A;  3CX6 B;  5FYM A;  2K3W A;  2VAS A;  4DV0 T;  2N2N A;  1FMV A;  3GN5 A;  1ZV4 X;  1MMG A;  2XQ7 A;  4Q25 A;  3ZCJ A;  4F6R C;  1SE7 A;  1IBK T;  3HR0 A;  2BZB A;  2WCA A;  4LMK A;  5IUX A;  2VB6 A;  5HXS A;  4O2B E;  4OX9 T;  2UUC T;  3N2G E;  2OA5 A;  1ZHC A;  1BR0 A;  3WI3 A;  3AVS A;  1LKX A;  4EIW A;  3KIN B;  5ABG A;  2WWV A;  2MPK A;  4C91 A;  3IBP A;  2BS4 A;  2NTY A;  4HFH A;  5L3B B;  4DR3 T;  3HA4 A;  3RIU C;  2BBJ A;  4XBF B;  5L3F B;  4FI5 A;  4ZI2 D;  4PFP A;  2MAW A;  1YQ3 A;  1KFY A;  3QB5 A;  2XQ3 A;  4JEH B;  3AE4 A;  4TWD A;  2XM2 A;  1HFA A;  1ZKE A;  2V26 A;  4KX6 A;  2JMK A;  3UQ7 A;  5LYJ E;  4B6X A;  3JC6 D;  3X1D A;  1BR2 A;  2L9Q A;  2QRX A;  4X5T A;  4KP3 C;  4BAY B;  4AQG A;  2J1D G;  1HTJ F;  3MK7 C;  3ZMT B;  4UF0 A;  2W2U A;  2E9X C;  5CGM A;  2V5D A;  4PJL A;  2LHR A;  2DWG A;  3Q5W A;  1KEY A;  3MAC A;  4CZZ B;  3RC8 A;  4NUV A;  2BKN A;  4P1N A;  3P50 A;  3VKH A;  4AIU A;  2ZM8 A;  1MIW A;  4ZZB A;  4QX8 B;  4Z90 A;  2Q9Q A;  4U74 A;  3ZLI A;  1AJ3 A;  3CPZ A;  2XPK A;  5AQU B;  5JRC B;  2WDV A;  2DCF A;  5HEU A;  3UT5 E;  2FJB A;  4YXD A;  2QA7 A;  4U33 A;  1HF8 A;  4HTE A;  3ZKR A;  1HCI A;  5LCY A;  2CBI A;  5HAX A;  4NIQ A;  3LK2 B;  5LGN B;  3UUM A;  2ZMA A;  3H3M A;  3C51 A;  3C50 A;  3ZN0 B;  3ZC0 A;  2NP9 A;  2C5K T;  4TV9 E;  2UU9 T;  4TN7 B;  4DID B;  1HG2 A;  3CKD A;  3RYC E;  2CA5 A;  4B3T T;  3ZT5 A;  5AQR B;  5DQW A;  4ILC A;  3E0Z A;  4H9Q C;  2BKP A;  4EEB A;  2WMO A;  3HI2 A;  1EZ3 A;  2LLY A;  4DV7 T;  4HWD A;  4DV4 T;  4JI0 T;  3AA0 B;  1WRD A;  3KV5 A;  1HX1 B;  3UUX B;  2EHO A;  4HKA A;  5HCM A;  2X9H A;  5TAO A;  4CXX A;  3I1A A;  4FJO A;  4AKG A;  3N9L A;  4GK5 E;  2KND A;  4YFS A;  5FXX A;  2DNX A;  2LSY A;  3NWI A;  3JAD A;  3NBX X;  4KMC A;  2QYW A;  3Q2M A;  2JIW A;  3RYH E;  1OED B;  3DTO A;  3ZJ2 A;  2NW9 A;  4XAX B;  2LT3 A;  2X9Y A;  2YKS A;  4OFZ A;  3U3I A;  5JTG A;  2LKH A;  5AQN B;  3W15 B;  5ABH A;  5KX5 E;  4I43 B;  4YY3 T;  4DBR A;  2JQQ A;  2LOP A;  3F57 A;  3NRX A;  1HNX T;  3P4S A;  2E9X B;  1I6Z A;  4IE6 A;  4U31 A;  1VOM A;  2HN2 A;  3UU5 A;  2IC9 A;  4QXB B;  2CLY C;  2H7V C;  3RRW A;  4O4H E;  3FZM B;  1T98 A;  4IDO A;  1FIO A;  3UFG A;  5IWA T;  5L47 A;  2KIN B;  2X9X A;  3SWH A;  4ASK A;  5AFU L;  1YD8 G;  5HEO A;  5CFB A;  5AQT B;  3RI5 A;  3MKD A;  3PUR A;  2ZM2 A;  5HXE A;  4X66 T;  2IUB A;  5AQK B;  2A72 A;  5ABF B;  1IJ5 A;  5IHY A;  2YDR A;  3V5S A;  4HWC A;  3I0Q A;  5HEH A;  3AXJ B;  4IDN A;  4U2Z A;  3B5M A;  3AA7 B;  2XQ4 A;  2YU2 A;  3TLV A;  2UXC T;  3LBX B;  5F3J A;  1X9B A;  2XAJ B;  2JMH A;  2I0M A;  3RKG A;  3AVR A;  4LFC T;  3LFM A;  3EUH A;  1M62 A;  4A97 A;  5HXH A;  5EZY E;  4EZ4 A;  3ZYL A;  5M4Y A;  5C3J A;  4DV6 T;  2WB5 A;  4PNI A;  2LM2 A;  4IE4 A;  2X0L B;  5J1G A;  2VWA A;  1SHZ C;  4CN4 A;  4ERR A;  4B3S T;  3QK6 A;  4BJM A;  1IBM T;  5BR8 T;  3LJC A;  4IRE A;  2W63 A;  3VRA A;  4CXW A;  1KNR A;  3HKC E;  3N9M A;  2E5V A;  2BG9 E;  2AE9 A;  3AAI A;  1YKE B;  4PK5 A;  3RKO A;  2Q9Q C;  2X9W A;  4HFC A;  4TNW A;  3JAF A;  3U78 A;  2LHN A;  4ADZ A;  5KMG P;  2M67 A;  1BR1 A;  1ZP0 A;  2CRB A;  3GN5 B;  5JRE A;  4OK0 A;  2CLY B;  2X0Y A;  3OPC A;  2E8I A;  3OBV E;  1HR0 T;  4JI7 T;  3N5L A;  3FB2 A;  2W00 A;  3QNU A;  4HWH A;  5L2L A;  1L0V A;  4IDP A;  3ZMZ B;  3O1J A;  3FXD B;  2RPA A;  5HXR A;  2XZE A;  1MMA A;  2K9A A;  5J2T E;  2M6B A;  1NEK A;  3RQU A;  4A5X A;  4MAL A;  1IBL T;  3TLU A;  4L5G A;  2VVN A;  5C8Y E;  5LA6 E;  3UU6 A;  2BDE A;  2FJE A;  2EHO C;  4EB6 E;  1U5P A;  1XNR T;  4K0K T;  3PUS A;  3RHW A;  3CVR A;  3LK4 2;  4IGU A;  4I55 E;  5JR9 A;  2D9D A;  3RIF A;  1G8X A;  2XY8 B;  2B76 A;  5EK3 A;  4GK0 E;  4ZS2 A;  4HN9 A;  4HGA A;  3RIA A;  2W4X A;  2H89 A;  5JDF A;  4OYK A;  1MIY A;  2KWI B;  2RA1 A;  3VHL A;  3L09 A;  4PW8 A;  1XDO A;  5LB7 B;  2DI4 A;  2H88 A;  4IDQ A;  4PJJ A;  3N9N A;  3V5U A;  5E0O A;  2YOE A;  5KXJ A;  5HCJ A;  1D1B A;  1R8I A;  2W66 A;  3DJB A;  4EED A;  1N34 T;  4UF0 B;  2IW5 B;  2LEH A;  5FY1 A;  2HPL A;  4H9N C;  4IHJ E;  4PJN A;  3MA9 A;  1D1C A;  2V7K A;  4KUM B;  3RRC A;  2V5C A;  2XJ7 A;  1KNP A;  4LF4 T;  2HPJ A;  1WYB A;  3C4Z A;  4DO0 A;  5ETW A;  5F8P A;  5LBM A;  4LML A;  2DLR A;  3F31 A;  3H3A A;  1T72 A;  2WS3 A;  4I50 E;  5HYA A;  3OTO T;  4COF A;  5ABE A;  4H63 V;  1HNZ T;  5LGT B;  2Q9Q B;  4JV5 T;  3KVB A;  2W62 A;  3A5X A;  4YTN A;  5H6Q B;  4ZI2 C;  5L3C B;  4YT0 A;  3SFE A;  5LNK A;  3ETU A;  4H9P C;  4ILB A;  2LSJ A;  2NR4 A;  2FJA A;  5EK4 A;  2ODV A;  3AE7 A;  1U4Q A;  3PUG A;  2ACZ A;  2XAQ B;  3OKQ A;  5IYZ E;  3JC6 C;  3M65 A;  3F2E A;  2ZM0 A;  2YN6 A;  4CI1 B;  3RPU A;  3IEE A;  1HX8 A;  4EAH A;  4DR7 T;  4CI3 B;  3RLF F;  5LJN A;  4IE0 A;  2VKD A;  2VQE T;  3FZK B;  5AQL B;  2DWK A;  1HG5 A;  3UU8 A;  3IF8 B;  3K1S A;  4PJM A;  1IJ6 A;  2N9D A;  2KZ7 B;  1XMQ T;  2X0H A;  4JLE A;  3ZSS A;  5LBQ B;  4ILA A;  1S94 A;  2D2S A;  3PJA J;  3C64 A;  5HEJ A;  2EHO B;  5KDM C;  4Z91 A;  4DND A;  3AE9 A;  1YKH B;  3ZYM A;  1JNR A;  2CHN A;  2XQ5 A;  2X66 A;  4A98 A;  2WSS V;  4AXP A;  5FXW A;  2XQ6 A;  3N9O A;  3AE1 A;  2UUA T;  1H7C A;  1KNZ A;  2CBJ A;  2WQY A;  5FY0 A;  2XQ9 A;  1Y64 B;  2D0U A;  3G06 A;  3P4W A;  3D0T A;  3PTR B;  4JI2 T;  3J7Y q;  2ES0 A;  4DV1 T;  4EZH A;  5JVD E;  3OYX A;  3AEE A;  1FEW A;  2IHR 1;  4U3C A;  4NXN T;  4DR5 T;  3Q5D A;  1T8B A;  1UUR A;  2Y8D A;  4MFR A;  4TWF A;  4IST A;  4QWN B;  2C5I T;  2XAF B;  3EDU A;  2HH7 A;  3BQL A;  2UXD T;  3NZQ A;  3J9X 1;  3Q5X A;  4HFI A;  4HWI B;  4IL4 A;  2YEV C;  2JQH A;  3TLT A;  1Z8U A;  2BVM A;  4O8S A;  3FZL B;  1W09 A;  2BBH A;  2JPF A;  5FXV A;  4P09 A;  4E7S A;  4ZEY A;  2VK9 A;  5JDQ A;  4X62 T;  3N9Q A;  3PUY F;  1YXR A;  2DL1 A;  5DQV A;  4LF7 T;  2G0U A;  2WWU A;  1VCT A;  4OYJ A;  5LMU T;  3CK6 A;  3C4X A;  4TZ4 C;  5JR9 C;  2F4V T;  2ZM6 T;  3FZH B;  4EV6 A;  3NZP A;  2XAS B;  3ZC1 A;  3AEB A;  1T7S A;  1WYC A;  1UUS A;  2AXD S;  3E08 A;  3HL6 A;  3EI0 A;  3ABV A;  3OJA A;  3L39 A;  4WW0 A;  5LOV E;  1FMW A;  3BQI A;  4V1A v;  5AQM B;  2CXF A;  1MMD A;  3LSV A;  2FUP A;  5BMV E;  1G73 A;  4GYS A;  2KWH A;  3ESL A;  4QHO A;  2KSR A;  3CX7 B;  4LF8 T;  3R84 B;  3FXE B;  2LKG A;  2UXX B;  4X1I E;  4G63 A;  4MBQ A;  2P9B A;  2WM9 A;  5FNV E;  1X79 A;  1JNZ A;  4CN6 A;  3TLW A;  3LK3 B;  4ZZC A;  3CWZ B;  4QXC B;  2BG9 A;  2XUE A;  4H9R C;  4C90 A;  2WMN A;  4U7Y A;  3EAB A;  2WU2 A;  2IIU A;  2D0T A;  1D0Z A;  2VKH A;  5JQG E;  4DUZ T;  3PU8 A;  2A2F X;  3MJX A;  4WBN E;  3Q5E A;  2XSB A;  1WR0 A;  3EHZ A;  3RC3 A;  1US7 B;  2RP4 A;  2KXP B;  5LGU B;  3FZF B;  1NWM X;  1WLX A;  5JDH A;  4KI0 F;  4YJ2 E;  4HFV A;  3SRZ A;  5LG3 A;  2LE8 A;  1V9D A;  1LVK A;  2WZH A;  2V6Y A;  1N36 T;  4QH4 A;  4QH5 A;  5CA0 E;  5J2U E;  3LG7 A;  3PV0 F;  2DHR A;  5L4H A;  2I59 A;  2UUB T;  3EAM A;  3ZST A;  4ZI7 E;  2WY2 A;  2WDQ A;  4JI5 T;  2CCQ A;  3AE3 A;  4LFA T;  4AIS A;  4QKN A;  4JEU B;  1SUM B;  1IZN B;  2PG8 A;  4DR1 T;  5HWY A;  3VKG A;  5AQG B;  2JQK A;  5JR9 B;  5AQJ B;  4MLK A;  2VQF T;  4AKH A;  3I9Y A;  1M7K A;  3N9P A;  4UV9 B;  3S4U A;  2YDS A;  3NVO A;  3P8C D;  2CM0 A;  3T1Y T;  2V1D B;  3VR8 A;  4DVD A;  3VU7 H;  2N1G A;  2CE7 A;  3SFD A;  4CI2 B;  2W67 A;  3H37 A;  4IT4 A;  5L4E A;  3ZMS B;  3T1H T;  5LG4 A;  2VUR A;  3AXJ A;  3UUN A;  3C4W A;  2KMF A;  4LF5 T;  1XMO T;  5FMN A;  2PJQ A;  2CXD A;  3ONJ A;  2KT9 A;  2A9U A;  3LDQ B;  3FBZ A;  2XTL A;  3WAK A;  2JJ9 A;  1ZEE A;  3PUV F;  2Y48 B;  2Q9Q D;  2CMR A;  2WAU A;  3SS1 A;  3JAE A;  4U72 A;  2PBI A;  4B3R T;  2I6H A;  4AKR B;  4JBW F;  1OED E;  1YQ4 A;  3RH3 A;  4ZI3 D;  2XM1 A;  4DUY T;  2PFV A;  1CHU A;  4WYV A;  3BK9 A;  4QH1 A;  2KLQ A;  4YTM A;  4WNK A;  3UU4 A;  1J5E T;  4ANJ A;  2WZI A;  2BS3 A;  3K3O A;  2H7O A;  4B3M T;  2YU1 A;  2FJD A;  5DJQ C;  3FHN A;  3VR9 A;  1ZOY A;  4Z8X A;  2IML A;  3UQ4 A;  1VRB A;  3KV4 A;  2PTF A;  4X20 E;  5LMN T;  3ZCI A;  4X1K E;  5FL0 A;  3B13 A;  3ETV A;  3P7I A;  2ACX A;  3P4Q A;  4DV2 T;  3AEF A;  3GWH A;  2EHO D;  4PAG A;  1DU2 A;  4PK4 A;  2IAK A;  2V8S V;  2NTX A;  4IE7 A;  3GA8 A;  5L3D B;  4GOU A;  4IE5 A;  3K3Q C;  2CWO A;  3R6N A;  3CQC B;  4DBQ A;  4LFB T;  4JUY A;  3P4P A;  5L3E B;  3ZMU B;  1WFD A;  2E2A A;  4N78 D;  1UGO A;  5AQO B;  2ZLY A;  2WU5 A;  4BA9 A;  2MYS A;  2BG9 C;  4UEM A;  2W0G A;  2CPT A;  4IIJ E;  1Z0P A;  2MBG A;  4M1P A;  3L3P A;  3QB5 K;  1D0X A;  4JI3 T;  4GYR A;  2YK0 A;  1E2A A;  3PU3 A;  4DR4 T;  2H3R A;  3EDV A;  4KBM B;  1UX4 A;  3A7M A;  3AAA B;  3GMI A;  3AE6 A;  2K24 A;  3SOL A;  5FL1 A;  3ZN1 B;  5AQF B;  3ZEF B;  3UU3 A;  3PUA A;  3NRY A;  1N32 T;  3AEG A;  2YIN A;  4DV3 T;  4EGW A;  2VL0 A;  2XQA A;  3KV6 A;  3N2K E;  4EYY R;  2CWY A;  4EXT A;  4GIW A;  2V7J A;  2XSA A;  4I0U A;  4P0B A;  4A56 A;  4E7Z A;  4TUY E;  2IC6 A;  2LRL A;  3EVY A;  4NXM T;  1YW0 A;  1OED C;  4YLH A;  4ZS3 A;  3ANW A;  1NAF A;  5LJM A;  5JDM A;  2HHH T;  4IL9 A;  4H63 H;  4H9S E;  2NW8 A;  3HKE E;  1E7P A;  3KFW X;  2LSK A;  5HXC A;  1SA0 E;  4ZXL A;  3P4R A;  3RQW A;  4JI4 T;  3CIR A;  4AKI A;  3AE5 A;  1MMN A;  2L8K A;  2L3L A;  3PJA A;  2C0S A;  4CN1 A;  4EOZ B;  2LSI A;  3MXZ A;  1N33 T;  5CJ5 A;  3KBU A;  2CXL A;  3A8Y C;  2E9X D;  1KK7 A;  3RF1 A;  4YSX A;  3OVU A;  2W61 A;  4UR9 A;  2XAG B;  3ZYK A;  2SPC A;  2VKJ A;  3RYF E;  2JQ9 A;  3PUW F;  4LMJ A;  4TV8 E;  2UXB T;  5HEG A;  4X1Y E;  5H6R B;  4QX7 B;  3IHR A;  2IDO B;  1LVF A;  3IA3 A;  4DMV A;  5AQP B;  2J4G A;  1HS7 A;  4YTP A;  1VCS A;  3O1H A;  2K48 A;  1OWA A;  3CQG B;  4GKJ T;  2BG9 B;  4HFD A;  4O2A E;  1IAP A;  5AQH B;  3UUL A;  2J62 A;  4AQF A;  3MZK B;  1HNW T;  4UVC B;  3PUZ F;  1MNE A;  2ODU A;  3CML A;  1QUU A;  3QUJ A;  2V7I A;  4HEA A;  3O1I A;  3ONL C;  1XZY A;  2QVA A;  4YHJ A;  2V7M A;  5FP3 A;  2LRK A;  3PUQ A;  3ZT6 A;  5EK2 A;  4JI6 T;  2NW7 A;  2MOZ A;  2LJL A;  3NKZ A;  2UXN B;  3KBT A;  2XQY A;  3AB3 B;  1O3X A;  1FJG T;  1UCU A;  4ZOL E;  3HKD E;  2MTQ A;  3ONX A;  3AE8 A;  2V6X A;  1OXZ A;  4UVB B;  1E1H B;  3WAJ A;  4AI6 A;  2V6Y B;  1Y01 A;  3RYI E;  5A1L A;  5CB4 E;  5FXZ A;  4TNV A;  4X64 T;  4JI8 T;  5JRC A;  4HWF A;  3DP7 A;  4UXN B;  2M6I A;  4YSY A;  4O4J E;  4DR2 T;  2WP9 A;  4HFB A;  4HFE A;  2LM9 A;  4IDZ A;  5J0Z A;  3KVA A;  4MHC A;  3K8P C;  2A3D A;  2VKO A;  5DAB A;  4O4I E;  3ZJ1 A;  4DMW A;  4WZX A;  2XAH B;  3UUB A;  3CQX C;  2NWB A;  4AQY T;  1S35 A;  4UV8 B;  2NOX A;  1B7T A;  3ZPO A;  4ZHQ E;  4CXY A;  4X65 T;  2B1E A;  2BS2 A;  4PK6 A;  3K3N A;  5FVK A;  5LHG B;  2OV9 A;  1NEN A;  3KDS E;  1D1A A;  1LRZ A;  3UTK A;  5FY7 A;  3QC9 A;  4JI1 T;  3HKB E;  2D5U A;  1QLB A;  3TLS A;  3RIU A;  3OYZ A;  4DV5 T;  2Y6X A;  2R6G F;  1J1J A;  4YHH T;  4TX5 A;  5AQV B;  3AA1 B;  3AEC A;  3PUX F;  4BJN A;  5AQQ B;  4U7I A;  5ADX L;  2CHO A;  4JYA T;  2E5L T;  1OED A;  2XHE B;  3I0O A;  3QOF A;  2X51 A;  3VRB A;  1W0B A;  4K0U A;  2BKO A;  4KHZ F;  4J2C A;  3AED A;  2X68 A;  3E22 E;  1GQE A;  2OLT A;  3TKL B;  5LHH B;  5CA1 E;  2E9X A;  5JH7 E;  3Q9D A;  1UX5 A;  3RX6 A;  4DR6 T;  2WBL A;  4ISS A;  3JCF A;  4OHF A;  4UVA B;  4G2A A;  2FBW A;  4QXH B;  4KHP T;  1QSD A;  2HN1 A;  2C5J A;  4UEL A;  2V7L A;  3FBL A;  5JDN A;  3ZMV B;  4P0A A;  3BQK A;  3I9W A;  5FVL A;  3T8O A;  3N2O A;  2CEA A;  2QGS A;  4NUU A;  2GK9 A;  1XWM A;  4L9I A;  5JDL A;  4PFO A;  5ABF A;  5JDG A;  2BVL A;  4AKL A; 
#chains in the Genus database with same CATH homology
 1I6Z A;  5AQH B;  5AQN B;  1UGO A;  3FZL B;  1M7K A;  5AQU B;  5AQO B;  5AQT B;  5AQV B;  3FZM B;  5AQI B;  5AQM B;  4HWH A;  3FZH B;  3LDQ B;  4HWD A;  5AQP B;  5AQS B;  5AQQ B;  3FZF B;  1T7S A;  1UK5 A;  4HWF A;  5AQG B;  5AQF B;  1HX1 B;  5AQK B;  5AQR B;  3FZK B;  2D9D A;  5AQL B;  3M3Z B;  4HWI B;  3A8Y C;  1M62 A;  5AQJ B;  4HWC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...