4HWFA

Crystal structure of atbag3
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
87
structure length
87
Chain Sequence
b'SASKSISDISFEVDRLAGQVSAFETVINKGGKVEEKSLVNLIEMLMNQLLRLDAIIADGDVKLMRKMQVQRVQKYVEALDLLKVKNS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords BAG family molecular chaperone regulator 3
publication title Structural insight into plant programmed cell death mediated by BAG proteins in Arabidopsis thaliana.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Apoptosis
total genus 37
structure length 87
sequence length 87
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02179 BAG BAG domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.120 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 BAG domain 4hwfA00
5AQTB 5AQPB 4HWCA 5AQNB 2D9DA 5AQLB 1HX1B 3A8YC 3FZFB 3LDQB 5AQHB 5AQKB 5AQQB 1T7SA 5AQRB 1I6ZA 4HWFA 5AQIB 3M3ZB 5AQFB 1UGOA 5AQJB 1UK5A 5AQMB 3FZLB 4HWDA 5AQVB 3FZHB 1M7KA 3FZMB 3FZKB 5AQSB 1M62A 4HWHA 4HWIB 5AQUB 5AQOB 5AQGB
chains in the Genus database with same CATH superfamily
2X68A 1N32T 4UXNB 2WBLA 2KINB 2XQ3A 3LBXA 2VVSA 2CCQA 2X66A 4AQGA 4U7YA 3C4ZA 5CB4E 2VQET 2LKGA 3MJXA 5JDGA 1NWMX 2XM1A 4O4JE 5LCYA 2BKPA 2D9DA 4I43B 1XZYA 2BS4A 3OVUA 3PUWF 4LF4T 4CQIA 2BVMA 2OV9A 2HHHT 3QC9A 2M6BA 1YKEB 4XAXB 2CWYA 2EHOA 3LK3B 3O1JA 4X66T 4AISA 4NXMT 2WS3A 3ZYLA 4IDQA 3MXZA 5FMNA 2JQQA 5HYAA 3Q2MA 2K48A 3JADA 4HWHA 3JAEA 4HWIB 2CEAA 4BJNA 5C3JA 3RQWA 1KF6A 3ONLC 5HXEA 2BBHA 4DR2T 2UUBT 5F8PA 3UU8A 2VK9A 3N9NA 2V5DA 4LMKA 2X9HA 2D0TA 3GWHA 2I59A 2ODVA 3N9MA 4HFBA 2RPAA 4NPPA 2FJBA 4G2AA 2XASB 1JNZA 5L47A 5FY7A 2LSGA 4GYRA 5L3FB 3VKHA 2X0YA 2BBJA 2QYWA 1HF8A 3Q5EA 1QUUA 2X0HA 2V7LA 4O4IE 2YEVC 5J2UE 3UU3A 3LBXB 2X67A 2V7IA 4X20E 2PFVA 2CBJA 4ISTA 3ZMUB 2ZM6T 1SUMB 4X1YE 3LSVA 4H9QC 3TLTA 5DQWA 5HWYA 1IZNB 5JDFA 2XHEB 5HAXA 3BQKA 2LSKA 2UXBT 3OYZA 3LK2B 2BG9C 3KV9A 5LMUT 4EXTA 5BMVE 4FJOA 4DUZT 4H9NC 4HFVA 3FZKB 5J1GA 5KDMC 1KNRA 4XBFB 4DV0T 1LKXA 2EHOB 3ETVA 4TWDA 3LG7A 1E1HB 3K3QC 1J5WA 4JI4T 3NKZA 3PUSA 1U4QA 2WAUA 5DJQC 5FYMA 2UU9T 3ONJA 2NTYA 2V8SV 3UFGA 4IT4A 2IAKA 3FBLA 2PBIA 1NENA 2WZIA 1MNDA 4EYYR 1MMAA 1Z8UA 3AE4A 1U5PA 3NZQA 4PK4A 4X1KE 2N1GA 5LOVE 5C2TA 4AI6A 4WYVA 4B3MT 5JDNA 2AE9A 2E9XB 3ZJ1A 5TAOA 2IMLA 2NW9A 4Z91A 3ANWA 4P0BA 4JI1T 4AKIA 3AE7A 2X9YA 4CI2B 2KT9A 4KHPT 2EHOC 2VKDA 5HEHA 4CI1B 3WAKA 2V7JA 5AQPB 2Y8DA 2BVLA 2X9WA 2PJQA 2XQ7A 1W0BA 2DL1A 3KVAA 4EB6E 2LSYA 1I6ZA 3PU3A 3I9WA 1OEDB 2XZEA 3UUXB 3SWHA 3RQUA 3KBTA 2IW5B 4CXYA 2XTLA 2CLYC 2HPLA 4OYKA 1CUNA 2Y6XA 2A72A 4EEBA 2XAQB 3CIRA 3BQLA 3SFDA 3G06A 4UVBB 2CBIA 1I94T 3J7Yq 3B13A 4QX8B 5EK2A 5AQNB 4YFSA 4IE4A 3HI2A 4O8SA 4ASKA 2NOXA 4A98A 1DU2A 1MIWA 2WDQA 5AQFB 1MNEA 2H89A 3JAFA 2XQ4A 4GYSA 2KLQA 1LVFA 2VVNA 2WSSV 1B7TA 4EZHA 5ABHA 5HXHA 3ZC1A 3OKQA 4AQFA 3ESLA 4GOUA 5EZYE 2Q9QA 2DNXA 2WDVA 4YT0A 3KBUA 4HFIA 3AA7B 3I9YA 3L8RA 3JC6C 2XY8B 2KNDA 2BKNA 4JI7T 4YJ3E 2YDSA 3EHZA 2XAGB 4X1IE 4U33A 4ILBA 3UTKA 4U31A 3UU6A 2W61A 3O1IA 3PUAA 4TN7B 4MFRA 5H6QB 4UV8B 3RF1A 4ZS3A 4UEMA 5AQOB 3PUYF 1BR2A 2DCFA 1SHZC 4ZI3C 1NAFA 1XMQT 5AQHB 3VRBA 5DQVA 2CRBA 4A97A 4HFEA 4U2YA 3R6NA 1YKHB 2LEHA 4OX9T 3A7MA 4QHOA 3I0OA 3MZKB 3AEBA 2YN6A 2P9BA 2KWHA 3RGLA 4HE8A 2JPFA 2JRKA 4JUYA 4HKAA 2MYSA 3CMLA 5FXVA 3M3ZB 2V1DB 3DTOA 5FL0A 3KFWX 3HKEE 2L3LA 2CXDA 5ETWA 4EGWA 4HFCA 3LK42 3AA1B 4H9RC 4IE5A 3QOFA 3RKOA 5HEGA 5HCMA 3T8OA 5LHHB 4ZEYA 2I0MA 1XWMA 2LM9A 2FJAA 2WY2A 3PU8A 4PAGA 5CFBA 5AQLB 5A1LA 4WBOA 4HFDA 1VCSA 4TNVA 2N9DA 2Q9QB 1T7SA 4DV4T 4LMLA 3AEDA 3RLFF 2XQ6A 3C51A 4HWDA 4PW8A 4DUYT 3SFEA 3NRXA 5JR9A 5AQUB 2LKHA 3LJCA 2VL0A 3AEAA 4ZOLE 1XMOT 1KNPA 2I6HA 4YTMA 4DV3T 2WQYA 3KV6A 1WR6A 4B3RT 1GQEA 3AE8A 4OYJA 1MMGA 3KINB 2CWOA 4YSZA 3P4WA 2BG9A 2Z6EA 3ZCIA 4PK5A 5LB7B 4TZ4C 3HKDE 3P7IA 1VRBA 3UUMA 4MBQA 2MOZA 2VL8A 1D0XA 3FXDB 5LGTB 3B5MA 3L09A 4TX5A 2QRXA 1W09A 2LSJA 4JI2T 1Y64B 1KEYA 2W2UA 3AA0B 3RYHE 1FMVA 3UQ4A 5FY1A 3ZC0A 1HG5A 2J4GA 3RYFE 3E0ZA 3N2KE 3SRZA 1WCRA 2JJ9A 4UIGA 2LSIA 3EVYA 4ZI2D 2W0GA 5LGNB 1Z0PA 1ZHCA 3A5XA 4O2BE 3F31A 1Y01A 2NWBA 3UUBA 3N9PA 1HFAA 3ZMSB 2DLRA 2D5UA 4A56A 5HWXA 2W62A 3AE5A 4U3CA 3ZT5A 4LF9T 5JR9B 1FIOA 5JREA 4LF6T 1UCUA 4N78D 5LG3A 4ZXLA 4GKJT 3PJAJ 1S35A 2V7KA 3K3OA 4DMWA 5AQIB 2K3WA 3AEGA 2IIUA 5HXCA 3UUNA 4DBRA 4QXBB 2JIWA 2IDOB 1WLXA 4PJNA 2BG9B 2CHOA 4U74A 2WMOA 3CQXC 3UU5A 3EUHA 1X9BA 3ZN0B 3PUZF 3TLSA 2XQYA 3R84B 3VHLA 2UXNB 3F57A 3VU7H 5JH7E 4KBMB 3IA3A 4LFAT 4B3ST 4CXWA 4YSXA 2VB6A 4QKNA 2NW8A 2XQ8A 3PDYA 3PUQA 2WCAA 4I50E 3NZPA 5LGUB 3CK6A 5JR9C 2OLTA 2NP9A 4V1Av 4I0UA 2ZLYA 4O2AE 3CPZA 3GMIA 3K3NA 4EYUA 3N9QA 2RP4A 2KWIB 2VWAA 4GKKT 3VRAA 4AKHA 3B57A 3H37A 1WFDA 3NWIA 2CHNA 1IBMT 5AQSB 4IE6A 5KXJA 1X79A 4QWNB 2BG9E 4F8HA 3IF8B 5CGMA 2IHR1 4ZZCA 3N5LA 1G73A 1KFYA 2CMRA 2B1EA 1WR0A 4GK0E 4IL9A 4L9IA 4PJLA 3AEEA 3UQ7A 4G63A 4COFA 5ABFA 1CHUA 3OTOT 2OA5A 3H3MA 2XAFB 1VOMA 4O4LE 4OFZA 2NW7A 2UXDT 2NTXA 4KX6A 5LHIB 2J1DG 2L9QA 3L3PA 2CE7A 2CLYB 2YKSA 2BZBA 1JNRA 3C98B 4IE7A 4PJMA 4UVCB 5ABGA 3FHNA 2YK0A 3BK9A 1YQ3A 4DBQA 2CPTA 3PUXF 4QXCB 4X62T 3RH3A 3E22E 2C5KT 4LMJA 5L4HA 1QSDA 5HXRA 2UUAT 2BS2A 3FZHB 5JTGA 2WM9A 4Z8XA 1ZKEA 3CQCB 3JCFA 2YU2A 4TWFA 3C4XA 3I1AA 4X65T 5FP3A 4DV5T 3ZYKA 4AQYT 2UUCT 1IBLT 5F5WA 3H3AA 1HCIA 4OHFA 2QVAA 3TLUA 3FXEB 2WZHA 3PURA 5JDMA 5JDHA 1H7CA 1OXZA 4DV1T 3O9XA 3ZCJA 2UXCT 2LLYA 4HTEA 5L2LA 2PTFA 5FVKA 1LVKA 2YDRA 1MIVA 4UV9B 4Z90A 1HNWT 5JDLA 1WYCA 2YINA 1MMDA 3C50A 3O4XE 2K9AA 4C90A 3NRYA 2F4VT 2EHOD 1D1AA 5J0ZA 2H3RA 3L39A 4KI0F 3CWZB 4YLHA 4WZXA 4PJJA 4HN9A 5LBQB 3CVRA 3MKDA 4OK0A 3ANWB 4J2CA 3RIAA 5H6RB 5JRCA 4ISSA 4YHJA 2XSAA 3TKLB 4DR3T 4EOZB 2YU1A 3E08A 5L3EB 3VR9A 1AJ3A 2E9XD 1SA0E 4CXXA 3ZN1B 1W9RA 2A9UA 2C5IT 4GIWA 5ABEA 3N2GE 3RC8A 3C64A 3TLWA 3FBZA 3ABVA 5LA6E 4AKLA 4O4HE 3IBPA 2GK9A 2XM2A 1SE7A 2V5CA 3PTRB 1YXRA 3Q5XA 5FKYA 1ZV4X 4HFHA 1XNRT 3K8PC 5IUXA 4DV6T 1M62A 4ZHQE 4AKGA 2V26A 5AQGB 1HR0T 2KSRA 3CQGB 3LFMA 1YD8G 5KX5E 3EDUA 3EABA 1BR0A 2LOPA 5L3BB 3AE9A 5CA1E 4PFPA 1T8BA 5JDQA 4DNDA 1BR4A 2W66A 2JQKA 4QH1A 3Q5DA 2LHRA 3ZLIA 2HN2A 3RYIE 2C5JA 1XDPA 4E7ZA 4IHJE 2QGSA 1ZP0A 2MAWA 2MTQA 1XDOA 2W67A 2BKOA 4KP3C 4DV2T 2XQ9A 5FXXA 5LYJE 3FB2A 2LJLA 3HL6A 5AFUL 5JRCB 5M4YA 1D0ZA 3AB3B 3NBXX 3FZFB 3K1SA 2XSBA 3N2OA 1G8XA 3RIUC 1FJGT 3ZYMA 3P4RA 3ZJ2A 4ZI2C 3DP7A 5AQTB 1FMWA 4HEAA 1KNZA 2N2NA 4DR5T 4TWHA 4IDOA 4JI3T 4YJ2E 4X5TA 2H7VC 2WB5A 1V9DA 4E7SA 3AAEB 3I0QA 1J5ET 2V6XA 2JQHA 1OWAA 3QUJA 2W4XA 3P4QA 3MA9A 1R8IA 4ZI7E 4JI5T 1N33T 1UX5A 4H63H 2VURA 2K5BB 4XZCA 2E5LT 2DHRA 4PFOA 3UFEA 4JI6T 4DIDB 5AQRB 4JEHB 1NEKA 2VKOA 3F2EA 1HNZT 3MK7C 1UUSA 2D0UA 3UT5E 4P0AA 4K0KT 2M67A 2J62A 3P8CD 3AE6A 3ZMVB 4LFBT 5FL1A 3ZMTB 5IWAT 3W15B 2ZMAA 2AXDS 2D2SA 1E2AA 4EV6A 4F6RC 1HTJF 3ZMZB 5KMGP 4CN1A 5L4EA 4ADZA 4EZ4A 2VQFT 3PE0A 4EAHA 2WWVA 3ZKRA 2HN1A 4PK6A 5BR8T 2Q9QD 4CN4A 2XJ7A 1L0VA 3GA8A 5CA0E 4CZZB 4ANJA 1O3XA 4MLKA 4LF5T 4X64T 3Q5WA 3AVRA 3OJAA 2R6GF 2IC9A 1WRDA 2ES0A 3ZSSA 4I4TE 4L0RA 3RIFA 3RKGA 1LRZA 2JMKA 2BDEA 4KHZF 1VCTA 4ILCA 5FVLA 2JQ9A 5LNKA 3RI5A 2M6IA 4DV7T 3IHRA 5FNVE 3UULA 2KMFA 2VASA 4TV8E 3PUGA 4YTPA 5JQGE 1HG2A 2E9XA 2KZ7B 3S4UA 4AXPA 5IYZE 3ZEFB 5FXZA 5ADXL 2H7OA 4Q25A 3PUVF 4JI0T 4NUUA 5GONE 4ILUA 3SS1A 4IDNA 1MMNA 4WW0A 2CA5A 4HGAA 4YHHT 4DR1T 2FUPA 1EZ3A 3RPUA 1T98A 1OEDA 1US7B 1E7PA 1UGOA 4ZZBA 5L3GB 1ZEEA 3BQIA 4FI5A 4IIJE 5LJNA 1BR1A 3CKDA 4ERRA 3T1YT 2CM0A 2X9XA 4UR9A 3OPCA 2C0SA 2LM2A 2PG8A 2W63A 1FEWA 1UURA 2WWUA 3RX6A 5F3JA 2HH7A 4JBWF 2YDQA 2VKJA 4YSYA 5FY0A 2ODUA 3J9X1 2HPJA 4QX7B 2A3DA 2X0LB 2SPCA 4U72A 3AE3A 3V5SA 1D0YA 3AAAB 3N9OA 3P50A 3RRCA 4QH4A 3PJAA 4PNIA 4JYAT 4DO0A 2CXLA 3EDVA 1HS7A 4DMVA 4LFCT 1HX8A 4C91A 1UX4A 3CX8B 4DVDA 2E2AA 2ZM8A 2L8KA 5C8YE 3WAJA 4U2ZA 1KK7A 4GK5E 3RRWA 2KXPB 4DR4T 3U3IA 3ZPOA 3OYXA 2V6YA 2X51A 4ILAA 4LF7T 3HKBE 4MALA 3KV5A 3IEEA 3FZLB 4IE0A 1IJ5A 1M7KA 5HEUA 5HCJA 3D0TA 3VKGA 3SOLA 4AKRB 4CN6A 5LJMA 4IGUA 2ACXA 4KUMB 4P09A 4CI3B 5DABA 5EK3A 3AVSA 3ZT6A 2ZM0A 4M1PA 4L5GA 2LHNA 4H9PC 5AQKB 4MHCA 4UF0A 2FJEA 2XPKA 2LT3A 2B76A 2IUBA 2G0UA 2LE8A 4DR6T 4B6XA 1HNXT 4KMCA 2XQAA 3FZMB 4NIQA 2FJDA 3ETUA 3NVOA 2LRKA 1S94A 3RIUA 3AEFA 3U78A 2E9XC 5FXWA 4JLEA 1UK5A 3PV0F 4IDZA 5AQMB 5JVDE 1IJ6A 3ZSTA 5ABFB 3O1HA 4IREA 2RA1A 2XUEA 3Q9DA 2NR4A 2WMNA 3GN5A 3RC3A 3UU4A 1D1CA 2Y48B 5LG4A 5LXTE 3HA4A 3RYCE 3P4SA 1OEDC 3P4PA 5LHGB 4P1NA 3AE1A 1OEDE 4JV5T 5AQJB 4JEUB 4QXHB 1N34T 5EK4A 4I55E 5HEJA 2V6YB 2CXFA 2UXXB 4HWCA 2A2FX 2YOEA 3ONXA 3A8YC 4JI8T 5AQQB 4U7IA 4IL4A 4ZS2A 4NXNT 4BJMA 3QB5A 2MBGA 1XNQT 2H88A 1N36T 3AECA 3QK6A 3HKCE 2ACZA 3AAIA 3CX7B 3AXJA 2IC6A 3RHWA 2WU5A 2WU2A 2XAHB 1MIYA 4UF0B 1QLBA 3AA6B 3MACA 5E0OA 2K24A 4K0UA 3QNUA 3ZT7A 5CJ5A 2ZM2A 1D1BA 5HXSA 3JC6D 1YW0A 1IBKT 2WDRA 4H63V 2LOSA 4HWFA 2VKHA 3TLVA 2XQ5A 2V7MA 2DWGA 5AQVB 1ZOYA 2LRLA 2WP9A 3KVBA 3OBVE 4EIWA 3N9LA 4WNKA 4WBNE 4B3TT 1HX1B 5LP6E 3GN5B 4TV9E 3QB5K 4ZI3D 4TUYE 5L3DB 2XAJB 5HEOA 4UVAB 4UELA 1WYBA 4AIUA 3T1HT 3VR8A 2E8IA 5LMNT 3LDQB 4YXDA 4A5XA 2QA7A 3WI3A 3KDSE 3DJBA 2FBWA 4TNWA 4H9SE 4BAYB 1T72A 4H9OC 4YY3T 5LBMA 1YQ4A 4IDPA 3V5UA 5L3CB 3CX6B 4DR7T 3M65A 4BA9A 2MPKA 3X1DA 3HR0A 3C4WA 5J2TE 2J47A 2E5VA 3AXJB 3KV4A 1J1JA 4EEDA 1W0AA 2W00A 2BS3A 3EAMA 3EI0A 4LF8T 2JMHA 3AE2A 4YTNA 2DWKA 1IAPA 2DI4A 4NUVA 4AQFC 5IHYA 2Q9QC 4QH5A
chains in the Genus database with same CATH topology
5AQTB 5AQPB 4HWCA 5AQNB 2D9DA 5AQLB 1HX1B 3A8YC 3FZFB 3LDQB 5AQHB 5AQKB 5AQQB 1T7SA 5AQRB 1I6ZA 4HWFA 5AQIB 3M3ZB 5AQFB 1UGOA 5AQJB 1UK5A 5AQMB 3FZLB 4HWDA 5AQVB 3FZHB 1M7KA 3FZMB 3FZKB 5AQSB 1M62A 4HWHA 4HWIB 5AQUB 5AQOB 5AQGB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AQT B;  5AQP B;  4HWC A;  5AQN B;  2D9D A;  5AQL B;  1HX1 B;  3A8Y C;  3FZF B;  3LDQ B;  5AQH B;  5AQK B;  5AQQ B;  1T7S A;  5AQR B;  1I6Z A;  4HWF A;  5AQI B;  3M3Z B;  5AQF B;  1UGO A;  5AQJ B;  1UK5 A;  5AQM B;  3FZL B;  4HWD A;  5AQV B;  3FZH B;  1M7K A;  3FZM B;  3FZK B;  5AQS B;  1M62 A;  4HWH A;  4HWI B;  5AQU B;  5AQO B;  5AQG B; 
#chains in the Genus database with same CATH topology
 2X68 A;  1N32 T;  4UXN B;  2WBL A;  2KIN B;  2XQ3 A;  3LBX A;  2VVS A;  2CCQ A;  2X66 A;  4AQG A;  4U7Y A;  3C4Z A;  5CB4 E;  2VQE T;  2LKG A;  3MJX A;  5JDG A;  1NWM X;  2XM1 A;  4O4J E;  5LCY A;  2BKP A;  2D9D A;  4I43 B;  1XZY A;  2BS4 A;  3OVU A;  3PUW F;  4LF4 T;  4CQI A;  2BVM A;  2OV9 A;  2HHH T;  3QC9 A;  2M6B A;  1YKE B;  4XAX B;  2CWY A;  2EHO A;  3LK3 B;  3O1J A;  4X66 T;  4AIS A;  4NXM T;  2WS3 A;  3ZYL A;  4IDQ A;  3MXZ A;  5FMN A;  2JQQ A;  5HYA A;  3Q2M A;  2K48 A;  3JAD A;  4HWH A;  3JAE A;  4HWI B;  2CEA A;  4BJN A;  5C3J A;  3RQW A;  1KF6 A;  3ONL C;  5HXE A;  2BBH A;  4DR2 T;  2UUB T;  5F8P A;  3UU8 A;  2VK9 A;  3N9N A;  2V5D A;  4LMK A;  2X9H A;  2D0T A;  3GWH A;  2I59 A;  2ODV A;  3N9M A;  4HFB A;  2RPA A;  4NPP A;  2FJB A;  4G2A A;  2XAS B;  1JNZ A;  5L47 A;  5FY7 A;  2LSG A;  4GYR A;  5L3F B;  3VKH A;  2X0Y A;  2BBJ A;  2QYW A;  1HF8 A;  3Q5E A;  1QUU A;  2X0H A;  2V7L A;  4O4I E;  2YEV C;  5J2U E;  3UU3 A;  3LBX B;  2X67 A;  2V7I A;  4X20 E;  2PFV A;  2CBJ A;  4IST A;  3ZMU B;  2ZM6 T;  1SUM B;  4X1Y E;  3LSV A;  4H9Q C;  3TLT A;  5DQW A;  5HWY A;  1IZN B;  5JDF A;  2XHE B;  5HAX A;  3BQK A;  2LSK A;  2UXB T;  3OYZ A;  3LK2 B;  2BG9 C;  3KV9 A;  5LMU T;  4EXT A;  5BMV E;  4FJO A;  4DUZ T;  4H9N C;  4HFV A;  3FZK B;  5J1G A;  5KDM C;  1KNR A;  4XBF B;  4DV0 T;  1LKX A;  2EHO B;  3ETV A;  4TWD A;  3LG7 A;  1E1H B;  3K3Q C;  1J5W A;  4JI4 T;  3NKZ A;  3PUS A;  1U4Q A;  2WAU A;  5DJQ C;  5FYM A;  2UU9 T;  3ONJ A;  2NTY A;  2V8S V;  3UFG A;  4IT4 A;  2IAK A;  3FBL A;  2PBI A;  1NEN A;  2WZI A;  1MND A;  4EYY R;  1MMA A;  1Z8U A;  3AE4 A;  1U5P A;  3NZQ A;  4PK4 A;  4X1K E;  2N1G A;  5LOV E;  5C2T A;  4AI6 A;  4WYV A;  4B3M T;  5JDN A;  2AE9 A;  2E9X B;  3ZJ1 A;  5TAO A;  2IML A;  2NW9 A;  4Z91 A;  3ANW A;  4P0B A;  4JI1 T;  4AKI A;  3AE7 A;  2X9Y A;  4CI2 B;  2KT9 A;  4KHP T;  2EHO C;  2VKD A;  5HEH A;  4CI1 B;  3WAK A;  2V7J A;  5AQP B;  2Y8D A;  2BVL A;  2X9W A;  2PJQ A;  2XQ7 A;  1W0B A;  2DL1 A;  3KVA A;  4EB6 E;  2LSY A;  1I6Z A;  3PU3 A;  3I9W A;  1OED B;  2XZE A;  3UUX B;  3SWH A;  3RQU A;  3KBT A;  2IW5 B;  4CXY A;  2XTL A;  2CLY C;  2HPL A;  4OYK A;  1CUN A;  2Y6X A;  2A72 A;  4EEB A;  2XAQ B;  3CIR A;  3BQL A;  3SFD A;  3G06 A;  4UVB B;  2CBI A;  1I94 T;  3J7Y q;  3B13 A;  4QX8 B;  5EK2 A;  5AQN B;  4YFS A;  4IE4 A;  3HI2 A;  4O8S A;  4ASK A;  2NOX A;  4A98 A;  1DU2 A;  1MIW A;  2WDQ A;  5AQF B;  1MNE A;  2H89 A;  3JAF A;  2XQ4 A;  4GYS A;  2KLQ A;  1LVF A;  2VVN A;  2WSS V;  1B7T A;  4EZH A;  5ABH A;  5HXH A;  3ZC1 A;  3OKQ A;  4AQF A;  3ESL A;  4GOU A;  5EZY E;  2Q9Q A;  2DNX A;  2WDV A;  4YT0 A;  3KBU A;  4HFI A;  3AA7 B;  3I9Y A;  3L8R A;  3JC6 C;  2XY8 B;  2KND A;  2BKN A;  4JI7 T;  4YJ3 E;  2YDS A;  3EHZ A;  2XAG B;  4X1I E;  4U33 A;  4ILB A;  3UTK A;  4U31 A;  3UU6 A;  2W61 A;  3O1I A;  3PUA A;  4TN7 B;  4MFR A;  5H6Q B;  4UV8 B;  3RF1 A;  4ZS3 A;  4UEM A;  5AQO B;  3PUY F;  1BR2 A;  2DCF A;  1SHZ C;  4ZI3 C;  1NAF A;  1XMQ T;  5AQH B;  3VRB A;  5DQV A;  2CRB A;  4A97 A;  4HFE A;  4U2Y A;  3R6N A;  1YKH B;  2LEH A;  4OX9 T;  3A7M A;  4QHO A;  3I0O A;  3MZK B;  3AEB A;  2YN6 A;  2P9B A;  2KWH A;  3RGL A;  4HE8 A;  2JPF A;  2JRK A;  4JUY A;  4HKA A;  2MYS A;  3CML A;  5FXV A;  3M3Z B;  2V1D B;  3DTO A;  5FL0 A;  3KFW X;  3HKE E;  2L3L A;  2CXD A;  5ETW A;  4EGW A;  4HFC A;  3LK4 2;  3AA1 B;  4H9R C;  4IE5 A;  3QOF A;  3RKO A;  5HEG A;  5HCM A;  3T8O A;  5LHH B;  4ZEY A;  2I0M A;  1XWM A;  2LM9 A;  2FJA A;  2WY2 A;  3PU8 A;  4PAG A;  5CFB A;  5AQL B;  5A1L A;  4WBO A;  4HFD A;  1VCS A;  4TNV A;  2N9D A;  2Q9Q B;  1T7S A;  4DV4 T;  4LML A;  3AED A;  3RLF F;  2XQ6 A;  3C51 A;  4HWD A;  4PW8 A;  4DUY T;  3SFE A;  3NRX A;  5JR9 A;  5AQU B;  2LKH A;  3LJC A;  2VL0 A;  3AEA A;  4ZOL E;  1XMO T;  1KNP A;  2I6H A;  4YTM A;  4DV3 T;  2WQY A;  3KV6 A;  1WR6 A;  4B3R T;  1GQE A;  3AE8 A;  4OYJ A;  1MMG A;  3KIN B;  2CWO A;  4YSZ A;  3P4W A;  2BG9 A;  2Z6E A;  3ZCI A;  4PK5 A;  5LB7 B;  4TZ4 C;  3HKD E;  3P7I A;  1VRB A;  3UUM A;  4MBQ A;  2MOZ A;  2VL8 A;  1D0X A;  3FXD B;  5LGT B;  3B5M A;  3L09 A;  4TX5 A;  2QRX A;  1W09 A;  2LSJ A;  4JI2 T;  1Y64 B;  1KEY A;  2W2U A;  3AA0 B;  3RYH E;  1FMV A;  3UQ4 A;  5FY1 A;  3ZC0 A;  1HG5 A;  2J4G A;  3RYF E;  3E0Z A;  3N2K E;  3SRZ A;  1WCR A;  2JJ9 A;  4UIG A;  2LSI A;  3EVY A;  4ZI2 D;  2W0G A;  5LGN B;  1Z0P A;  1ZHC A;  3A5X A;  4O2B E;  3F31 A;  1Y01 A;  2NWB A;  3UUB A;  3N9P A;  1HFA A;  3ZMS B;  2DLR A;  2D5U A;  4A56 A;  5HWX A;  2W62 A;  3AE5 A;  4U3C A;  3ZT5 A;  4LF9 T;  5JR9 B;  1FIO A;  5JRE A;  4LF6 T;  1UCU A;  4N78 D;  5LG3 A;  4ZXL A;  4GKJ T;  3PJA J;  1S35 A;  2V7K A;  3K3O A;  4DMW A;  5AQI B;  2K3W A;  3AEG A;  2IIU A;  5HXC A;  3UUN A;  4DBR A;  4QXB B;  2JIW A;  2IDO B;  1WLX A;  4PJN A;  2BG9 B;  2CHO A;  4U74 A;  2WMO A;  3CQX C;  3UU5 A;  3EUH A;  1X9B A;  3ZN0 B;  3PUZ F;  3TLS A;  2XQY A;  3R84 B;  3VHL A;  2UXN B;  3F57 A;  3VU7 H;  5JH7 E;  4KBM B;  3IA3 A;  4LFA T;  4B3S T;  4CXW A;  4YSX A;  2VB6 A;  4QKN A;  2NW8 A;  2XQ8 A;  3PDY A;  3PUQ A;  2WCA A;  4I50 E;  3NZP A;  5LGU B;  3CK6 A;  5JR9 C;  2OLT A;  2NP9 A;  4V1A v;  4I0U A;  2ZLY A;  4O2A E;  3CPZ A;  3GMI A;  3K3N A;  4EYU A;  3N9Q A;  2RP4 A;  2KWI B;  2VWA A;  4GKK T;  3VRA A;  4AKH A;  3B57 A;  3H37 A;  1WFD A;  3NWI A;  2CHN A;  1IBM T;  5AQS B;  4IE6 A;  5KXJ A;  1X79 A;  4QWN B;  2BG9 E;  4F8H A;  3IF8 B;  5CGM A;  2IHR 1;  4ZZC A;  3N5L A;  1G73 A;  1KFY A;  2CMR A;  2B1E A;  1WR0 A;  4GK0 E;  4IL9 A;  4L9I A;  4PJL A;  3AEE A;  3UQ7 A;  4G63 A;  4COF A;  5ABF A;  1CHU A;  3OTO T;  2OA5 A;  3H3M A;  2XAF B;  1VOM A;  4O4L E;  4OFZ A;  2NW7 A;  2UXD T;  2NTX A;  4KX6 A;  5LHI B;  2J1D G;  2L9Q A;  3L3P A;  2CE7 A;  2CLY B;  2YKS A;  2BZB A;  1JNR A;  3C98 B;  4IE7 A;  4PJM A;  4UVC B;  5ABG A;  3FHN A;  2YK0 A;  3BK9 A;  1YQ3 A;  4DBQ A;  2CPT A;  3PUX F;  4QXC B;  4X62 T;  3RH3 A;  3E22 E;  2C5K T;  4LMJ A;  5L4H A;  1QSD A;  5HXR A;  2UUA T;  2BS2 A;  3FZH B;  5JTG A;  2WM9 A;  4Z8X A;  1ZKE A;  3CQC B;  3JCF A;  2YU2 A;  4TWF A;  3C4X A;  3I1A A;  4X65 T;  5FP3 A;  4DV5 T;  3ZYK A;  4AQY T;  2UUC T;  1IBL T;  5F5W A;  3H3A A;  1HCI A;  4OHF A;  2QVA A;  3TLU A;  3FXE B;  2WZH A;  3PUR A;  5JDM A;  5JDH A;  1H7C A;  1OXZ A;  4DV1 T;  3O9X A;  3ZCJ A;  2UXC T;  2LLY A;  4HTE A;  5L2L A;  2PTF A;  5FVK A;  1LVK A;  2YDR A;  1MIV A;  4UV9 B;  4Z90 A;  1HNW T;  5JDL A;  1WYC A;  2YIN A;  1MMD A;  3C50 A;  3O4X E;  2K9A A;  4C90 A;  3NRY A;  2F4V T;  2EHO D;  1D1A A;  5J0Z A;  2H3R A;  3L39 A;  4KI0 F;  3CWZ B;  4YLH A;  4WZX A;  4PJJ A;  4HN9 A;  5LBQ B;  3CVR A;  3MKD A;  4OK0 A;  3ANW B;  4J2C A;  3RIA A;  5H6R B;  5JRC A;  4ISS A;  4YHJ A;  2XSA A;  3TKL B;  4DR3 T;  4EOZ B;  2YU1 A;  3E08 A;  5L3E B;  3VR9 A;  1AJ3 A;  2E9X D;  1SA0 E;  4CXX A;  3ZN1 B;  1W9R A;  2A9U A;  2C5I T;  4GIW A;  5ABE A;  3N2G E;  3RC8 A;  3C64 A;  3TLW A;  3FBZ A;  3ABV A;  5LA6 E;  4AKL A;  4O4H E;  3IBP A;  2GK9 A;  2XM2 A;  1SE7 A;  2V5C A;  3PTR B;  1YXR A;  3Q5X A;  5FKY A;  1ZV4 X;  4HFH A;  1XNR T;  3K8P C;  5IUX A;  4DV6 T;  1M62 A;  4ZHQ E;  4AKG A;  2V26 A;  5AQG B;  1HR0 T;  2KSR A;  3CQG B;  3LFM A;  1YD8 G;  5KX5 E;  3EDU A;  3EAB A;  1BR0 A;  2LOP A;  5L3B B;  3AE9 A;  5CA1 E;  4PFP A;  1T8B A;  5JDQ A;  4DND A;  1BR4 A;  2W66 A;  2JQK A;  4QH1 A;  3Q5D A;  2LHR A;  3ZLI A;  2HN2 A;  3RYI E;  2C5J A;  1XDP A;  4E7Z A;  4IHJ E;  2QGS A;  1ZP0 A;  2MAW A;  2MTQ A;  1XDO A;  2W67 A;  2BKO A;  4KP3 C;  4DV2 T;  2XQ9 A;  5FXX A;  5LYJ E;  3FB2 A;  2LJL A;  3HL6 A;  5AFU L;  5JRC B;  5M4Y A;  1D0Z A;  3AB3 B;  3NBX X;  3FZF B;  3K1S A;  2XSB A;  3N2O A;  1G8X A;  3RIU C;  1FJG T;  3ZYM A;  3P4R A;  3ZJ2 A;  4ZI2 C;  3DP7 A;  5AQT B;  1FMW A;  4HEA A;  1KNZ A;  2N2N A;  4DR5 T;  4TWH A;  4IDO A;  4JI3 T;  4YJ2 E;  4X5T A;  2H7V C;  2WB5 A;  1V9D A;  4E7S A;  3AAE B;  3I0Q A;  1J5E T;  2V6X A;  2JQH A;  1OWA A;  3QUJ A;  2W4X A;  3P4Q A;  3MA9 A;  1R8I A;  4ZI7 E;  4JI5 T;  1N33 T;  1UX5 A;  4H63 H;  2VUR A;  2K5B B;  4XZC A;  2E5L T;  2DHR A;  4PFO A;  3UFE A;  4JI6 T;  4DID B;  5AQR B;  4JEH B;  1NEK A;  2VKO A;  3F2E A;  1HNZ T;  3MK7 C;  1UUS A;  2D0U A;  3UT5 E;  4P0A A;  4K0K T;  2M67 A;  2J62 A;  3P8C D;  3AE6 A;  3ZMV B;  4LFB T;  5FL1 A;  3ZMT B;  5IWA T;  3W15 B;  2ZMA A;  2AXD S;  2D2S A;  1E2A A;  4EV6 A;  4F6R C;  1HTJ F;  3ZMZ B;  5KMG P;  4CN1 A;  5L4E A;  4ADZ A;  4EZ4 A;  2VQF T;  3PE0 A;  4EAH A;  2WWV A;  3ZKR A;  2HN1 A;  4PK6 A;  5BR8 T;  2Q9Q D;  4CN4 A;  2XJ7 A;  1L0V A;  3GA8 A;  5CA0 E;  4CZZ B;  4ANJ A;  1O3X A;  4MLK A;  4LF5 T;  4X64 T;  3Q5W A;  3AVR A;  3OJA A;  2R6G F;  2IC9 A;  1WRD A;  2ES0 A;  3ZSS A;  4I4T E;  4L0R A;  3RIF A;  3RKG A;  1LRZ A;  2JMK A;  2BDE A;  4KHZ F;  1VCT A;  4ILC A;  5FVL A;  2JQ9 A;  5LNK A;  3RI5 A;  2M6I A;  4DV7 T;  3IHR A;  5FNV E;  3UUL A;  2KMF A;  2VAS A;  4TV8 E;  3PUG A;  4YTP A;  5JQG E;  1HG2 A;  2E9X A;  2KZ7 B;  3S4U A;  4AXP A;  5IYZ E;  3ZEF B;  5FXZ A;  5ADX L;  2H7O A;  4Q25 A;  3PUV F;  4JI0 T;  4NUU A;  5GON E;  4ILU A;  3SS1 A;  4IDN A;  1MMN A;  4WW0 A;  2CA5 A;  4HGA A;  4YHH T;  4DR1 T;  2FUP A;  1EZ3 A;  3RPU A;  1T98 A;  1OED A;  1US7 B;  1E7P A;  1UGO A;  4ZZB A;  5L3G B;  1ZEE A;  3BQI A;  4FI5 A;  4IIJ E;  5LJN A;  1BR1 A;  3CKD A;  4ERR A;  3T1Y T;  2CM0 A;  2X9X A;  4UR9 A;  3OPC A;  2C0S A;  2LM2 A;  2PG8 A;  2W63 A;  1FEW A;  1UUR A;  2WWU A;  3RX6 A;  5F3J A;  2HH7 A;  4JBW F;  2YDQ A;  2VKJ A;  4YSY A;  5FY0 A;  2ODU A;  3J9X 1;  2HPJ A;  4QX7 B;  2A3D A;  2X0L B;  2SPC A;  4U72 A;  3AE3 A;  3V5S A;  1D0Y A;  3AAA B;  3N9O A;  3P50 A;  3RRC A;  4QH4 A;  3PJA A;  4PNI A;  4JYA T;  4DO0 A;  2CXL A;  3EDV A;  1HS7 A;  4DMV A;  4LFC T;  1HX8 A;  4C91 A;  1UX4 A;  3CX8 B;  4DVD A;  2E2A A;  2ZM8 A;  2L8K A;  5C8Y E;  3WAJ A;  4U2Z A;  1KK7 A;  4GK5 E;  3RRW A;  2KXP B;  4DR4 T;  3U3I A;  3ZPO A;  3OYX A;  2V6Y A;  2X51 A;  4ILA A;  4LF7 T;  3HKB E;  4MAL A;  3KV5 A;  3IEE A;  3FZL B;  4IE0 A;  1IJ5 A;  1M7K A;  5HEU A;  5HCJ A;  3D0T A;  3VKG A;  3SOL A;  4AKR B;  4CN6 A;  5LJM A;  4IGU A;  2ACX A;  4KUM B;  4P09 A;  4CI3 B;  5DAB A;  5EK3 A;  3AVS A;  3ZT6 A;  2ZM0 A;  4M1P A;  4L5G A;  2LHN A;  4H9P C;  5AQK B;  4MHC A;  4UF0 A;  2FJE A;  2XPK A;  2LT3 A;  2B76 A;  2IUB A;  2G0U A;  2LE8 A;  4DR6 T;  4B6X A;  1HNX T;  4KMC A;  2XQA A;  3FZM B;  4NIQ A;  2FJD A;  3ETU A;  3NVO A;  2LRK A;  1S94 A;  3RIU A;  3AEF A;  3U78 A;  2E9X C;  5FXW A;  4JLE A;  1UK5 A;  3PV0 F;  4IDZ A;  5AQM B;  5JVD E;  1IJ6 A;  3ZST A;  5ABF B;  3O1H A;  4IRE A;  2RA1 A;  2XUE A;  3Q9D A;  2NR4 A;  2WMN A;  3GN5 A;  3RC3 A;  3UU4 A;  1D1C A;  2Y48 B;  5LG4 A;  5LXT E;  3HA4 A;  3RYC E;  3P4S A;  1OED C;  3P4P A;  5LHG B;  4P1N A;  3AE1 A;  1OED E;  4JV5 T;  5AQJ B;  4JEU B;  4QXH B;  1N34 T;  5EK4 A;  4I55 E;  5HEJ A;  2V6Y B;  2CXF A;  2UXX B;  4HWC A;  2A2F X;  2YOE A;  3ONX A;  3A8Y C;  4JI8 T;  5AQQ B;  4U7I A;  4IL4 A;  4ZS2 A;  4NXN T;  4BJM A;  3QB5 A;  2MBG A;  1XNQ T;  2H88 A;  1N36 T;  3AEC A;  3QK6 A;  3HKC E;  2ACZ A;  3AAI A;  3CX7 B;  3AXJ A;  2IC6 A;  3RHW A;  2WU5 A;  2WU2 A;  2XAH B;  1MIY A;  4UF0 B;  1QLB A;  3AA6 B;  3MAC A;  5E0O A;  2K24 A;  4K0U A;  3QNU A;  3ZT7 A;  5CJ5 A;  2ZM2 A;  1D1B A;  5HXS A;  3JC6 D;  1YW0 A;  1IBK T;  2WDR A;  4H63 V;  2LOS A;  4HWF A;  2VKH A;  3TLV A;  2XQ5 A;  2V7M A;  2DWG A;  5AQV B;  1ZOY A;  2LRL A;  2WP9 A;  3KVB A;  3OBV E;  4EIW A;  3N9L A;  4WNK A;  4WBN E;  4B3T T;  1HX1 B;  5LP6 E;  3GN5 B;  4TV9 E;  3QB5 K;  4ZI3 D;  4TUY E;  5L3D B;  2XAJ B;  5HEO A;  4UVA B;  4UEL A;  1WYB A;  4AIU A;  3T1H T;  3VR8 A;  2E8I A;  5LMN T;  3LDQ B;  4YXD A;  4A5X A;  2QA7 A;  3WI3 A;  3KDS E;  3DJB A;  2FBW A;  4TNW A;  4H9S E;  4BAY B;  1T72 A;  4H9O C;  4YY3 T;  5LBM A;  1YQ4 A;  4IDP A;  3V5U A;  5L3C B;  3CX6 B;  4DR7 T;  3M65 A;  4BA9 A;  2MPK A;  3X1D A;  3HR0 A;  3C4W A;  5J2T E;  2J47 A;  2E5V A;  3AXJ B;  3KV4 A;  1J1J A;  4EED A;  1W0A A;  2W00 A;  2BS3 A;  3EAM A;  3EI0 A;  4LF8 T;  2JMH A;  3AE2 A;  4YTN A;  2DWK A;  1IAP A;  2DI4 A;  4NUV A;  4AQF C;  5IHY A;  2Q9Q C;  4QH5 A; 
#chains in the Genus database with same CATH homology
 5AQT B;  5AQP B;  4HWC A;  5AQN B;  2D9D A;  5AQL B;  1HX1 B;  3A8Y C;  3FZF B;  3LDQ B;  5AQH B;  5AQK B;  5AQQ B;  1T7S A;  5AQR B;  1I6Z A;  4HWF A;  5AQI B;  3M3Z B;  5AQF B;  1UGO A;  5AQJ B;  1UK5 A;  5AQM B;  3FZL B;  4HWD A;  5AQV B;  3FZH B;  1M7K A;  3FZM B;  3FZK B;  5AQS B;  1M62 A;  4HWH A;  4HWI B;  5AQU B;  5AQO B;  5AQG B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...