4HWFA

Crystal structure of atbag3
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
87
structure length
87
Chain Sequence
b'SASKSISDISFEVDRLAGQVSAFETVINKGGKVEEKSLVNLIEMLMNQLLRLDAIIADGDVKLMRKMQVQRVQKYVEALDLLKVKNS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords BAG family molecular chaperone regulator 3
publication title Structural insight into plant programmed cell death mediated by BAG proteins in Arabidopsis thaliana.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Apoptosis
total genus 37
structure length 87
sequence length 87
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02179 BAG BAG domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.120 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 BAG domain 4hwfA00
5AQQB 1I6ZA 3M3ZB 5AQMB 1HX1B 5AQUB 5AQIB 5AQLB 3FZKB 3FZFB 5AQGB 5AQNB 1M7KA 4HWHA 5AQKB 5AQRB 5AQHB 5AQVB 3FZLB 4HWCA 5AQOB 4HWIB 5AQTB 2D9DA 5AQFB 3LDQB 3A8YC 5AQSB 4HWFA 3FZHB 1UGOA 1T7SA 5AQJB 3FZMB 1M62A 1UK5A 4HWDA 5AQPB
chains in the Genus database with same CATH superfamily
4JI7T 4KHPT 5LJNA 5AQLB 4KUMB 3ZYLA 3AAAB 3N2KE 4KI0F 4TN7B 5LHHB 3VRBA 4YSYA 4OHFA 2ACXA 4UV8B 2XZEA 4KMCA 4QXHB 2DWKA 4G2AA 4EOZB 2I6HA 2Q9QD 1HNXT 2ES0A 2V6XA 3FHNA 1J5WA 3HKBE 3CKDA 4MLKA 3UU5A 4GKKT 2E5VA 2LSGA 2XQ7A 1D0YA 5HXRA 3N9PA 3RX6A 2WP9A 3ZPOA 4UVBB 4DV7T 3ZMSB 4X64T 5HEHA 1U4QA 4B3MT 3PUQA 4U72A 3DTOA 1YXRA 5AQFB 4GOUA 1IJ6A 3ETVA 2Q9QC 4UF0A 2F4VT 1OEDC 1SE7A 4O2AE 3PUWF 2IC9A 2MBGA 2KNDA 1JNRA 3X1DA 3H3MA 5LMNT 4ILCA 2JPFA 4PFPA 4E7SA 1YQ3A 3IEEA 3KV4A 2UXDT 3FXDB 4MHCA 4KBMB 1IJ5A 3IF8B 1LVKA 5ADXL 4H63H 4C91A 3AEFA 2CHOA 3UQ4A 4ZI2C 3A7MA 4CN6A 1MMAA 2N2NA 2ZM0A 3BQKA 3C4XA 2WZHA 2B76A 2HPJA 2DI4A 3AAEB 2H88A 4IE5A 2BVLA 3LJCA 4CN4A 2I0MA 3UU3A 4ANJA 3RH3A 3RYCE 2X9WA 2EHOB 5JR9C 4JI3T 2VQET 3T1YT 3CPZA 2A3DA 3B57A 3AXJA 4EYUA 1N36T 3C4ZA 4YTMA 2J62A 3ONJA 4CXXA 1Z0PA 3ZMVB 5EZYE 4U2ZA 4JI4T 3RIFA 2KT9A 2V7JA 4BJMA 2VWAA 5C2TA 2D0TA 3UULA 2VKJA 1M7KA 4DR5T 2UUCT 4IE6A 4YXDA 3N9QA 1KNZA 4DIDB 3RC8A 3EI0A 4LF7T 1X79A 2PJQA 4IGUA 3DJBA 4U74A 3PU8A 5FNVE 3NRXA 3QUJA 2V7MA 3E0ZA 5LMUT 2MOZA 4DV1T 2CRBA 2CA5A 1IBKT 4O4LE 4O4JE 4F8HA 4YHHT 5TAOA 4LMKA 3UU4A 4NPPA 4WYVA 3PDYA 2QRXA 4H9OC 5FP3A 1W09A 3JC6D 4OK0A 4TX5A 5J0ZA 3I1AA 3HL6A 3AE3A 3SWHA 1T8BA 2X0LB 2MAWA 2LE8A 3F57A 2HPLA 3LK42 3Q5WA 3UU8A 4U7YA 3VR9A 2BKNA 4ZZCA 1MIWA 3AE5A 4UVCB 2Z6EA 4PFOA 4UF0B 2KLQA 2D9DA 3LBXA 4P0BA 4DV6T 1MNEA 5CA1E 2WB5A 3ZT7A 2NW9A 3WI3A 1M62A 5CGMA 4X20E 2YKSA 3JC6C 3UT5E 2LLYA 2CWOA 2YOEA 2WY2A 4O4IE 4ZEYA 4ILUA 2X66A 3ZMUB 4HFDA 4HFVA 2JMKA 3PUSA 3PUXF 5JDGA 3FZHB 1YW0A 4AKGA 1G8XA 3NBXX 3N9OA 3RF1A 5IWAT 2PTFA 2QYWA 3OVUA 5JDQA 3RQWA 2L9QA 4TNVA 3L09A 1G73A 2ZM2A 2RP4A 3AXJB 2XQYA 2VL0A 1QSDA 4IDOA 2CLYC 2XSAA 5AQVB 2YINA 2HN2A 5F5WA 3Q5XA 5AQSB 2LSYA 3ZCIA 4I50E 1NWMX 2W4XA 2IMLA 2OA5A 1UK5A 4UVAB 3AB3B 2KINB 1E2AA 3MK7C 5KXJA 5L2LA 3UU6A 4ZOLE 2SPCA 4QH5A 3O9XA 4YHJA 2J4GA 4LF9T 3LK3B 2ACZA 4PK4A 4IE4A 2N9DA 4ZS2A 3QNUA 2H3RA 2LEHA 3KV5A 1UX4A 2IC6A 5AQGB 4YY3T 4U7IA 1YKHB 2A72A 5LBQB 3CIRA 1X9BA 2VKOA 4EZHA 1CUNA 3EUHA 5HCJA 5J2UE 4XAXB 2KMFA 3J9X1 3AEEA 1D0XA 1HR0T 1XZYA 1IBLT 2ZM6T 2LM9A 3RHWA 3RIUC 2XQ5A 5HXSA 2UUBT 1VOMA 2D0UA 4A98A 3T1HT 4EGWA 2UU9T 2E8IA 4NXNT 3ZC1A 4QXCB 1XMOT 1V9DA 2BDEA 3K8PC 3ONLC 4DBQA 2XQ4A 3M3ZB 3LBXB 4PJNA 3KVBA 2X9HA 3AE2A 5L4EA 3K3NA 3ZEFB 1WYBA 3L3PA 3J7Yq 4YSXA 3CX6B 2CXDA 2QVAA 4U3CA 3ANWA 2P9BA 4DMWA 3PURA 3P7IA 3V5UA 3H3AA 1Y64B 4GKJT 2BG9A 4QH4A 1UUSA 1S94A 3CX8B 5FXWA 1XMQT 3C4WA 1MIYA 4IIJE 4H9NC 3MJXA 2C5IT 3MKDA 4K0KT 3LG7A 5LA6E 4NXMT 2UXXB 4PJMA 4WZXA 4DV0T 3P50A 4TUYE 2RA1A 1ZKEA 2YDSA 2WS3A 2VASA 3RRCA 5AQOB 3IBPA 3FBLA 3QK6A 5FYMA 2LKHA 4QKNA 3V5SA 5AQRB 2D2SA 4WW0A 5HXHA 5AQMB 4AXPA 1KK7A 4HFIA 1MNDA 4O4HE 2WCAA 3L39A 2E9XD 2IHR1 5IYZE 2IDOB 2Q9QA 4TWHA 3KV9A 4QHOA 2FJEA 2V7KA 1OEDA 5LGNB 3AA0B 2IIUA 4CN1A 1ZV4X 2A9UA 1Z8UA 4IDNA 2Y48B 5LNKA 1OEDE 1ZP0A 4ZXLA 3RKOA 4XBFB 2LRKA 2EHOD 2PG8A 4Z8XA 4DNDA 4UXNB 4AISA 5DQWA 2BVMA 5L3EB 4ZS3A 1WR0A 5M4YA 4CXYA 3VKGA 1BR1A 3ZN1B 2E9XC 3ZSTA 1EZ3A 4H9SE 1H7CA 3CX7B 2ZM8A 1HNZT 5JR9A 2VK9A 4AI6A 3PJAA 1KFYA 3SFDA 1N33T 5CA0E 4P1NA 3SOLA 5AQKB 3RIAA 2DWGA 3ANWB 5HYAA 4AQFC 1W0BA 1MMDA 5ABEA 1FMWA 2BG9B 5LHGB 4X1YE 3HR0A 1OXZA 2XAFB 4PAGA 1QLBA 2Y8DA 3ESLA 2LSIA 1FJGT 2VL8A 2IW5B 2XUEA 3VR8A 4OYJA 4QXBB 3PUAA 1JNZA 2BBHA 2V7IA 3P4RA 2XASB 5LJMA 4WNKA 3FZKB 4Z90A 2NW8A 4I0UA 3ZT5A 2CE7A 4EIWA 3W15B 2ODUA 2M67A 4DVDA 3RYFE 3ZC0A 1UX5A 2FJAA 1GQEA 3AE9A 5LP6E 1US7B 4WBOA 4TNWA 1HTJF 3WAJA 1HG2A 3ZMTB 2E5LT 4AKIA 3MA9A 4P09A 3GWHA 2L3LA 5FY7A 4TV9E 3O1JA 4JI1T 4HWDA 2I59A 3ZT6A 3AE1A 2WDQA 2Q9QB 2FBWA 3ZKRA 2K3WA 4A97A 1OEDB 1FIOA 3TKLB 2ZMAA 2LOPA 2CXFA 3UUXB 5LHIB 1WLXA 5KMGP 4JEUB 4YLHA 4I4TE 2XAJB 5HEJA 4O8SA 4AIUA 3ZLIA 5AFUL 2L8KA 4A5XA 5BR8T 2CM0A 2JJ9A 2XHEB 4H63V 2JIWA 3NWIA 5JQGE 4PK5A 3PTRB 4JYAT 5L47A 4IE0A 4DUYT 4DUZT 3C98B 1O3XA 5AQQB 3ZYMA 4B3RT 4Q25A 1I6ZA 3N2OA 2C5KT 3UFEA 3CVRA 5LB7B 3KDSE 5JR9B 1VCTA 5LCYA 1HG5A 2V26A 4FI5A 4L5GA 2E2AA 4LF6T 1D1CA 1KNRA 4C90A 2MPKA 2XM1A 5FY1A 2DNXA 3AA1B 2LM2A 2K48A 4IDPA 2HH7A 5EK3A 1VCSA 2BZBA 2WZIA 4EB6E 4ZHQE 4EEBA 2CEAA 3CK6A 3I0OA 3ZCJA 4TZ4C 2R6GF 2K5BB 3EAMA 3I9YA 3RGLA 5L3GB 3PUGA 2K24A 5ETWA 4ISSA 3K3OA 2FUPA 3A8YC 2WDRA 3P4WA 2YU1A 3PE0A 2DLRA 2WWVA 2C0SA 1HX8A 4EZ4A 4DV5T 4P0AA 2X68A 2X9YA 4LF5T 2IAKA 1J5ET 2AE9A 2H7OA 1SHZC 3PV0F 4X5TA 3ZJ1A 4DR2T 4COFA 3SRZA 3PU3A 3JAEA 3OPCA 1YQ4A 3RIUA 1HS7A 1NAFA 3EABA 4B6XA 2V8SV 2X0HA 5GONE 5L4HA 1HFAA 4K0UA 5HEUA 2BS4A 1VRBA 2XY8B 3ABVA 2CPTA 2A2FX 4X1KE 4E7ZA 5JRCA 3N9NA 4MBQA 5L3FB 3GN5A 2LSJA 3OKQA 2MYSA 4IDZA 3AEGA 4N78D 4B3ST 4QH1A 4GK5E 4EYYR 2N1GA 5F3JA 3O1IA 4IREA 4OFZA 5LBMA 5J2TE 3S4UA 4AQGA 4DBRA 4LFCT 3E22E 3D0TA 5FL0A 3CWZB 2HHHT 2LJLA 3N9LA 5FXXA 4H9PC 5AQNB 3KINB 1UURA 4DO0A 3Q5DA 2JMHA 1Y01A 5FY0A 3ONXA 2FJDA 2CLYB 4MFRA 5EK2A 1MMNA 4F6RC 4ZZBA 2WAUA 3ZN0B 4KX6A 3C64A 2VKDA 1KEYA 3VRAA 5ABFB 4GYSA 4KHZF 3N9MA 3AA7B 1OWAA 2YK0A 5IUXA 4EAHA 3M65A 1N34T 3OTOT 4EV6A 1AJ3A 5LYJE 3BK9A 2BKOA 3LDQB 3UUNA 4TWDA 3GMIA 2XSBA 3CQXC 2WU5A 4JBWF 3AEBA 2WSSV 2LKGA 3G06A 2KWIB 3SFEA 2C5JA 1SA0E 2XPKA 2PFVA 3BQIA 2X0YA 1D1AA 1XDPA 4DR7T 2E9XA 3EDVA 1XNRT 5FVLA 4NIQA 4HFHA 2CXLA 2J1DG 5C3JA 2KZ7B 3OYXA 5ABGA 2XQ9A 3K1SA 3NRYA 3RPUA 4UR9A 3FZMB 5L3BB 2ODVA 4HTEA 5JRCB 3TLWA 2NR4A 3NZQA 3CQCB 1HX1B 3GN5B 4U33A 2XTLA 1MMGA 1WFDA 3U78A 5H6QB 4AQFA 3R84B 3T8OA 5LGUB 3UQ7A 3P4PA 3VU7H 2X67A 1XDOA 2PBIA 2XJ7A 4NUUA 3HA4A 2BKPA 2IUBA 4YJ2E 4YJ3E 2WDVA 3AVSA 2WBLA 2UUAT 2GK9A 3TLUA 2W00A 1NEKA 4CQIA 1T72A 4PW8A 4CI1B 4UEMA 2WU2A 3UUMA 4MALA 4OX9T 2J47A 5LOVE 4DR4T 1HCIA 2NP9A 3EDUA 5FKYA 3RLFF 5JDHA 4QWNB 3NKZA 1T7SA 2KXPB 1HF8A 4ASKA 3AVRA 3OJAA 2EHOC 1N32T 3TLSA 1L0VA 5LG4A 4LFAT 4Z91A 2JQ9A 3A5XA 3LK2B 1WYCA 3GA8A 5FXVA 2JQHA 2V1DB 2JRKA 2KWHA 4ZI2D 2WMOA 1BR0A 3PUZF 1WCRA 3QB5A 3FBZA 3RRWA 4CI2B 4JLEA 5C8YE 4JEHB 4H9QC 3AE4A 1LRZA 2NWBA 3H37A 2NTYA 2HN1A 3RYHE 3ZYKA 4AQYT 3JAFA 1W9RA 2E9XB 3Q5EA 4HEAA 1YD8G 4PK6A 4G63A 4PJLA 2W62A 5HAXA 1WR6A 1ZEEA 4UELA 2KSRA 2NOXA 5F8PA 5JVDE 2G0UA 1S35A 4LF8T 2W67A 4JUYA 4X1IE 1ZOYA 2BS3A 1BR4A 1KNPA 4DR6T 3AA6B 3ZJ2A 4PJJA 5BMVE 3E08A 3KBUA 3I0QA 1KF6A 1UCUA 4H9RC 2FJBA 5HWXA 4QX7B 2DHRA 3NVOA 4IT4A 5AQJB 5L3DB 3AE8A 4HFBA 2YN6A 4L0RA 3AEAA 3KV6A 1D0ZA 1FEWA 1NENA 2XQ3A 2B1EA 1XWMA 2M6BA 4HE8A 5DQVA 4HN9A 1UGOA 5L3CB 5J1GA 2UXBT 4DR3T 4XZCA 2YDRA 1B7TA 5HEOA 2H7VC 3RI5A 4PNIA 3FXEB 3C51A 3CQGB 3PUVF 4ILAA 4ZI7E 3HKCE 5JDMA 2K9AA 3B13A 2LHRA 3F2EA 4GYRA 5IHYA 5JDNA 2V5DA 3IHRA 3QC9A 2CMRA 3NZPA 5KX5E 3UUBA 3LFMA 3LSVA 3RYIE 2X51A 4DR1T 5CB4E 1D1BA 5ABFA 4YSZA 2V6YA 1FMVA 2XAQB 4DV3T 3P8CD 1J1JA 4IL9A 2DCFA 4LMLA 2YDQA 4HFEA 5A1LA 3WAKA 5FL1A 4BA9A 4ERRA 3U3IA 5FXZA 4LF4T 2XAGB 2NTXA 2VURA 5JDLA 3SS1A 5KDMC 3R6NA 3B5MA 3FZLB 2WQYA 1U5PA 4ZI3D 2CHNA 5E0OA 3JADA 4JI8T 1E1HB 4AKHA 1IZNB 3EHZA 3I9WA 4CZZB 2CCQA 4IE7A 3QOFA 4LMJA 3P4QA 4HFCA 5ABHA 1I94T 1MIVA 2VKHA 4DV4T 5CFBA 4BAYB 3AEDA 4X65T 4HKAA 4ADZA 5LGTB 4YTNA 1HNWT 4ISTA 4BJNA 2VVNA 4JI0T 3AECA 1DU2A 4ZI3C 1E7PA 1W0AA 2RPAA 2QA7A 4IDQA 3ETUA 3UTKA 3KFWX 2Y6XA 3TLTA 4J2CA 3HKDE 4CI3B 3F31A 5JDFA 3FB2A 4EXTA 5DABA 5FVKA 4HWHA 4I43B 5HCMA 3ZSSA 1CHUA 3MXZA 2H89A 2VVSA 3OBVE 3P4SA 2BS2A 5HXCA 4OYKA 3QB5K 4UV9B 1IBMT 5EK4A 3RKGA 2LSKA 2VQFT 1SUMB 5LXTE 4DMVA 5AQHB 4KP3C 3MACA 2W66A 3AE7A 4LFBT 3MZKB 4YFSA 3DP7A 5H6RB 4UIGA 4M1PA 2CBIA 4HGAA 2OLTA 2VB6A 4TV8E 2MTQA 5AQPB 2LRLA 4CXWA 3ZMZB 4IL4A 1R8IA 1IAPA 3OYZA 4GIWA 3HKEE 3Q9DA 2V5CA 2M6IA 5AQTB 5JREA 2XQAA 2XQ6A 1XNQT 4B3TT 4WBNE 2LOSA 2V6YB 2V7LA 3RQUA 2JQQA 2JQKA 3Q2MA 1T98A 2UXNB 1LVFA 2W2UA 5HXEA 3C50A 2W61A 4HWCA 3KVAA 4JI6T 3EVYA 3N5LA 4A56A 3TLVA 4HWFA 2QGSA 4I55E 3BQLA 3N2GE 2CWYA 2CBJA 4X62T 1BR2A 4QX8B 5AQUB 3RC3A 2WWUA 3AAIA 3FZFB 3HI2A 4NUVA 2OV9A 4ILBA 2D5UA 5JH7E 4L9IA 3UFGA 4X66T 2WM9A 2XQ8A 5FMNA 4GK0E 3VKHA 4JI2T 2BG9E 4DV2T 3IA3A 5JTGA 1YKEB 2AXDS 4O2BE 2LHNA 4FJOA 2UXCT 4HWIB 4V1Av 4TWFA 5CJ5A 3O1HA 4AKLA 2NW7A 5HWYA 3CMLA 2YU2A 1QUUA 1WRDA 5LG3A 4EEDA 3O4XE 2EHOA 2X9XA 4YT0A 4IHJE 3VHLA 2LT3A 4YTPA 3JCFA 2XAHB 2XM2A 3PJAJ 4U2YA 4U31A 4JI5T 2WMNA 2W63A 5AQIB 5HEGA 2BBJA 3KBTA 1ZHCA 1LKXA 3K3QC 2BG9C 3PUYF 2W0GA 4AKRB 3AE6A 2YEVC 2ZLYA 4JV5T 3L8RA 2DL1A 5DJQC
chains in the Genus database with same CATH topology
5AQQB 1I6ZA 3M3ZB 5AQMB 1HX1B 5AQUB 5AQIB 5AQLB 3FZKB 3FZFB 5AQGB 5AQNB 1M7KA 4HWHA 5AQKB 5AQRB 5AQHB 5AQVB 3FZLB 4HWCA 5AQOB 4HWIB 5AQTB 2D9DA 5AQFB 3LDQB 3A8YC 5AQSB 4HWFA 3FZHB 1UGOA 1T7SA 5AQJB 3FZMB 1M62A 1UK5A 4HWDA 5AQPB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AQQ B;  1I6Z A;  3M3Z B;  5AQM B;  1HX1 B;  5AQU B;  5AQI B;  5AQL B;  3FZK B;  3FZF B;  5AQG B;  5AQN B;  1M7K A;  4HWH A;  5AQK B;  5AQR B;  5AQH B;  5AQV B;  3FZL B;  4HWC A;  5AQO B;  4HWI B;  5AQT B;  2D9D A;  5AQF B;  3LDQ B;  3A8Y C;  5AQS B;  4HWF A;  3FZH B;  1UGO A;  1T7S A;  5AQJ B;  3FZM B;  1M62 A;  1UK5 A;  4HWD A;  5AQP B; 
#chains in the Genus database with same CATH topology
 4JI7 T;  4KHP T;  5LJN A;  5AQL B;  4KUM B;  3ZYL A;  3AAA B;  3N2K E;  4KI0 F;  4TN7 B;  5LHH B;  3VRB A;  4YSY A;  4OHF A;  2ACX A;  4UV8 B;  2XZE A;  4KMC A;  4QXH B;  2DWK A;  4G2A A;  4EOZ B;  2I6H A;  2Q9Q D;  1HNX T;  2ES0 A;  2V6X A;  3FHN A;  1J5W A;  3HKB E;  3CKD A;  4MLK A;  3UU5 A;  4GKK T;  2E5V A;  2LSG A;  2XQ7 A;  1D0Y A;  5HXR A;  3N9P A;  3RX6 A;  2WP9 A;  3ZPO A;  4UVB B;  4DV7 T;  3ZMS B;  4X64 T;  5HEH A;  1U4Q A;  4B3M T;  3PUQ A;  4U72 A;  3DTO A;  1YXR A;  5AQF B;  4GOU A;  1IJ6 A;  3ETV A;  2Q9Q C;  4UF0 A;  2F4V T;  1OED C;  1SE7 A;  4O2A E;  3PUW F;  2IC9 A;  2MBG A;  2KND A;  1JNR A;  3X1D A;  3H3M A;  5LMN T;  4ILC A;  2JPF A;  4PFP A;  4E7S A;  1YQ3 A;  3IEE A;  3KV4 A;  2UXD T;  3FXD B;  4MHC A;  4KBM B;  1IJ5 A;  3IF8 B;  1LVK A;  5ADX L;  4H63 H;  4C91 A;  3AEF A;  2CHO A;  3UQ4 A;  4ZI2 C;  3A7M A;  4CN6 A;  1MMA A;  2N2N A;  2ZM0 A;  3BQK A;  3C4X A;  2WZH A;  2B76 A;  2HPJ A;  2DI4 A;  3AAE B;  2H88 A;  4IE5 A;  2BVL A;  3LJC A;  4CN4 A;  2I0M A;  3UU3 A;  4ANJ A;  3RH3 A;  3RYC E;  2X9W A;  2EHO B;  5JR9 C;  4JI3 T;  2VQE T;  3T1Y T;  3CPZ A;  2A3D A;  3B57 A;  3AXJ A;  4EYU A;  1N36 T;  3C4Z A;  4YTM A;  2J62 A;  3ONJ A;  4CXX A;  1Z0P A;  3ZMV B;  5EZY E;  4U2Z A;  4JI4 T;  3RIF A;  2KT9 A;  2V7J A;  4BJM A;  2VWA A;  5C2T A;  2D0T A;  3UUL A;  2VKJ A;  1M7K A;  4DR5 T;  2UUC T;  4IE6 A;  4YXD A;  3N9Q A;  1KNZ A;  4DID B;  3RC8 A;  3EI0 A;  4LF7 T;  1X79 A;  2PJQ A;  4IGU A;  3DJB A;  4U74 A;  3PU8 A;  5FNV E;  3NRX A;  3QUJ A;  2V7M A;  3E0Z A;  5LMU T;  2MOZ A;  4DV1 T;  2CRB A;  2CA5 A;  1IBK T;  4O4L E;  4O4J E;  4F8H A;  4YHH T;  5TAO A;  4LMK A;  3UU4 A;  4NPP A;  4WYV A;  3PDY A;  2QRX A;  4H9O C;  5FP3 A;  1W09 A;  3JC6 D;  4OK0 A;  4TX5 A;  5J0Z A;  3I1A A;  3HL6 A;  3AE3 A;  3SWH A;  1T8B A;  2X0L B;  2MAW A;  2LE8 A;  3F57 A;  2HPL A;  3LK4 2;  3Q5W A;  3UU8 A;  4U7Y A;  3VR9 A;  2BKN A;  4ZZC A;  1MIW A;  3AE5 A;  4UVC B;  2Z6E A;  4PFO A;  4UF0 B;  2KLQ A;  2D9D A;  3LBX A;  4P0B A;  4DV6 T;  1MNE A;  5CA1 E;  2WB5 A;  3ZT7 A;  2NW9 A;  3WI3 A;  1M62 A;  5CGM A;  4X20 E;  2YKS A;  3JC6 C;  3UT5 E;  2LLY A;  2CWO A;  2YOE A;  2WY2 A;  4O4I E;  4ZEY A;  4ILU A;  2X66 A;  3ZMU B;  4HFD A;  4HFV A;  2JMK A;  3PUS A;  3PUX F;  5JDG A;  3FZH B;  1YW0 A;  4AKG A;  1G8X A;  3NBX X;  3N9O A;  3RF1 A;  5IWA T;  2PTF A;  2QYW A;  3OVU A;  5JDQ A;  3RQW A;  2L9Q A;  4TNV A;  3L09 A;  1G73 A;  2ZM2 A;  2RP4 A;  3AXJ B;  2XQY A;  2VL0 A;  1QSD A;  4IDO A;  2CLY C;  2XSA A;  5AQV B;  2YIN A;  2HN2 A;  5F5W A;  3Q5X A;  5AQS B;  2LSY A;  3ZCI A;  4I50 E;  1NWM X;  2W4X A;  2IML A;  2OA5 A;  1UK5 A;  4UVA B;  3AB3 B;  2KIN B;  1E2A A;  3MK7 C;  5KXJ A;  5L2L A;  3UU6 A;  4ZOL E;  2SPC A;  4QH5 A;  3O9X A;  4YHJ A;  2J4G A;  4LF9 T;  3LK3 B;  2ACZ A;  4PK4 A;  4IE4 A;  2N9D A;  4ZS2 A;  3QNU A;  2H3R A;  2LEH A;  3KV5 A;  1UX4 A;  2IC6 A;  5AQG B;  4YY3 T;  4U7I A;  1YKH B;  2A72 A;  5LBQ B;  3CIR A;  1X9B A;  2VKO A;  4EZH A;  1CUN A;  3EUH A;  5HCJ A;  5J2U E;  4XAX B;  2KMF A;  3J9X 1;  3AEE A;  1D0X A;  1HR0 T;  1XZY A;  1IBL T;  2ZM6 T;  2LM9 A;  3RHW A;  3RIU C;  2XQ5 A;  5HXS A;  2UUB T;  1VOM A;  2D0U A;  4A98 A;  3T1H T;  4EGW A;  2UU9 T;  2E8I A;  4NXN T;  3ZC1 A;  4QXC B;  1XMO T;  1V9D A;  2BDE A;  3K8P C;  3ONL C;  4DBQ A;  2XQ4 A;  3M3Z B;  3LBX B;  4PJN A;  3KVB A;  2X9H A;  3AE2 A;  5L4E A;  3K3N A;  3ZEF B;  1WYB A;  3L3P A;  3J7Y q;  4YSX A;  3CX6 B;  2CXD A;  2QVA A;  4U3C A;  3ANW A;  2P9B A;  4DMW A;  3PUR A;  3P7I A;  3V5U A;  3H3A A;  1Y64 B;  4GKJ T;  2BG9 A;  4QH4 A;  1UUS A;  1S94 A;  3CX8 B;  5FXW A;  1XMQ T;  3C4W A;  1MIY A;  4IIJ E;  4H9N C;  3MJX A;  2C5I T;  3MKD A;  4K0K T;  3LG7 A;  5LA6 E;  4NXM T;  2UXX B;  4PJM A;  4WZX A;  4DV0 T;  3P50 A;  4TUY E;  2RA1 A;  1ZKE A;  2YDS A;  2WS3 A;  2VAS A;  3RRC A;  5AQO B;  3IBP A;  3FBL A;  3QK6 A;  5FYM A;  2LKH A;  4QKN A;  3V5S A;  5AQR B;  2D2S A;  4WW0 A;  5HXH A;  5AQM B;  4AXP A;  1KK7 A;  4HFI A;  1MND A;  4O4H E;  2WCA A;  3L39 A;  2E9X D;  2IHR 1;  5IYZ E;  2IDO B;  2Q9Q A;  4TWH A;  3KV9 A;  4QHO A;  2FJE A;  2V7K A;  1OED A;  5LGN B;  3AA0 B;  2IIU A;  4CN1 A;  1ZV4 X;  2A9U A;  1Z8U A;  4IDN A;  2Y48 B;  5LNK A;  1OED E;  1ZP0 A;  4ZXL A;  3RKO A;  4XBF B;  2LRK A;  2EHO D;  2PG8 A;  4Z8X A;  4DND A;  4UXN B;  4AIS A;  5DQW A;  2BVM A;  5L3E B;  4ZS3 A;  1WR0 A;  5M4Y A;  4CXY A;  3VKG A;  1BR1 A;  3ZN1 B;  2E9X C;  3ZST A;  1EZ3 A;  4H9S E;  1H7C A;  3CX7 B;  2ZM8 A;  1HNZ T;  5JR9 A;  2VK9 A;  4AI6 A;  3PJA A;  1KFY A;  3SFD A;  1N33 T;  5CA0 E;  4P1N A;  3SOL A;  5AQK B;  3RIA A;  2DWG A;  3ANW B;  5HYA A;  4AQF C;  1W0B A;  1MMD A;  5ABE A;  1FMW A;  2BG9 B;  5LHG B;  4X1Y E;  3HR0 A;  1OXZ A;  2XAF B;  4PAG A;  1QLB A;  2Y8D A;  3ESL A;  2LSI A;  1FJG T;  2VL8 A;  2IW5 B;  2XUE A;  3VR8 A;  4OYJ A;  4QXB B;  3PUA A;  1JNZ A;  2BBH A;  2V7I A;  3P4R A;  2XAS B;  5LJM A;  4WNK A;  3FZK B;  4Z90 A;  2NW8 A;  4I0U A;  3ZT5 A;  2CE7 A;  4EIW A;  3W15 B;  2ODU A;  2M67 A;  4DVD A;  3RYF E;  3ZC0 A;  1UX5 A;  2FJA A;  1GQE A;  3AE9 A;  5LP6 E;  1US7 B;  4WBO A;  4TNW A;  1HTJ F;  3WAJ A;  1HG2 A;  3ZMT B;  2E5L T;  4AKI A;  3MA9 A;  4P09 A;  3GWH A;  2L3L A;  5FY7 A;  4TV9 E;  3O1J A;  4JI1 T;  4HWD A;  2I59 A;  3ZT6 A;  3AE1 A;  2WDQ A;  2Q9Q B;  2FBW A;  3ZKR A;  2K3W A;  4A97 A;  1OED B;  1FIO A;  3TKL B;  2ZMA A;  2LOP A;  2CXF A;  3UUX B;  5LHI B;  1WLX A;  5KMG P;  4JEU B;  4YLH A;  4I4T E;  2XAJ B;  5HEJ A;  4O8S A;  4AIU A;  3ZLI A;  5AFU L;  2L8K A;  4A5X A;  5BR8 T;  2CM0 A;  2JJ9 A;  2XHE B;  4H63 V;  2JIW A;  3NWI A;  5JQG E;  4PK5 A;  3PTR B;  4JYA T;  5L47 A;  4IE0 A;  4DUY T;  4DUZ T;  3C98 B;  1O3X A;  5AQQ B;  3ZYM A;  4B3R T;  4Q25 A;  1I6Z A;  3N2O A;  2C5K T;  3UFE A;  3CVR A;  5LB7 B;  3KDS E;  5JR9 B;  1VCT A;  5LCY A;  1HG5 A;  2V26 A;  4FI5 A;  4L5G A;  2E2A A;  4LF6 T;  1D1C A;  1KNR A;  4C90 A;  2MPK A;  2XM1 A;  5FY1 A;  2DNX A;  3AA1 B;  2LM2 A;  2K48 A;  4IDP A;  2HH7 A;  5EK3 A;  1VCS A;  2BZB A;  2WZI A;  4EB6 E;  4ZHQ E;  4EEB A;  2CEA A;  3CK6 A;  3I0O A;  3ZCJ A;  4TZ4 C;  2R6G F;  2K5B B;  3EAM A;  3I9Y A;  3RGL A;  5L3G B;  3PUG A;  2K24 A;  5ETW A;  4ISS A;  3K3O A;  2FUP A;  3A8Y C;  2WDR A;  3P4W A;  2YU1 A;  3PE0 A;  2DLR A;  2WWV A;  2C0S A;  1HX8 A;  4EZ4 A;  4DV5 T;  4P0A A;  2X68 A;  2X9Y A;  4LF5 T;  2IAK A;  1J5E T;  2AE9 A;  2H7O A;  1SHZ C;  3PV0 F;  4X5T A;  3ZJ1 A;  4DR2 T;  4COF A;  3SRZ A;  3PU3 A;  3JAE A;  3OPC A;  1YQ4 A;  3RIU A;  1HS7 A;  1NAF A;  3EAB A;  4B6X A;  2V8S V;  2X0H A;  5GON E;  5L4H A;  1HFA A;  4K0U A;  5HEU A;  2BS4 A;  1VRB A;  2XY8 B;  3ABV A;  2CPT A;  2A2F X;  4X1K E;  4E7Z A;  5JRC A;  3N9N A;  4MBQ A;  5L3F B;  3GN5 A;  2LSJ A;  3OKQ A;  2MYS A;  4IDZ A;  3AEG A;  4N78 D;  4B3S T;  4QH1 A;  4GK5 E;  4EYY R;  2N1G A;  5F3J A;  3O1I A;  4IRE A;  4OFZ A;  5LBM A;  5J2T E;  3S4U A;  4AQG A;  4DBR A;  4LFC T;  3E22 E;  3D0T A;  5FL0 A;  3CWZ B;  2HHH T;  2LJL A;  3N9L A;  5FXX A;  4H9P C;  5AQN B;  3KIN B;  1UUR A;  4DO0 A;  3Q5D A;  2JMH A;  1Y01 A;  5FY0 A;  3ONX A;  2FJD A;  2CLY B;  4MFR A;  5EK2 A;  1MMN A;  4F6R C;  4ZZB A;  2WAU A;  3ZN0 B;  4KX6 A;  3C64 A;  2VKD A;  1KEY A;  3VRA A;  5ABF B;  4GYS A;  4KHZ F;  3N9M A;  3AA7 B;  1OWA A;  2YK0 A;  5IUX A;  4EAH A;  3M65 A;  1N34 T;  3OTO T;  4EV6 A;  1AJ3 A;  5LYJ E;  3BK9 A;  2BKO A;  3LDQ B;  3UUN A;  4TWD A;  3GMI A;  2XSB A;  3CQX C;  2WU5 A;  4JBW F;  3AEB A;  2WSS V;  2LKG A;  3G06 A;  2KWI B;  3SFE A;  2C5J A;  1SA0 E;  2XPK A;  2PFV A;  3BQI A;  2X0Y A;  1D1A A;  1XDP A;  4DR7 T;  2E9X A;  3EDV A;  1XNR T;  5FVL A;  4NIQ A;  4HFH A;  2CXL A;  2J1D G;  5C3J A;  2KZ7 B;  3OYX A;  5ABG A;  2XQ9 A;  3K1S A;  3NRY A;  3RPU A;  4UR9 A;  3FZM B;  5L3B B;  2ODV A;  4HTE A;  5JRC B;  3TLW A;  2NR4 A;  3NZQ A;  3CQC B;  1HX1 B;  3GN5 B;  4U33 A;  2XTL A;  1MMG A;  1WFD A;  3U78 A;  5H6Q B;  4AQF A;  3R84 B;  3T8O A;  5LGU B;  3UQ7 A;  3P4P A;  3VU7 H;  2X67 A;  1XDO A;  2PBI A;  2XJ7 A;  4NUU A;  3HA4 A;  2BKP A;  2IUB A;  4YJ2 E;  4YJ3 E;  2WDV A;  3AVS A;  2WBL A;  2UUA T;  2GK9 A;  3TLU A;  2W00 A;  1NEK A;  4CQI A;  1T72 A;  4PW8 A;  4CI1 B;  4UEM A;  2WU2 A;  3UUM A;  4MAL A;  4OX9 T;  2J47 A;  5LOV E;  4DR4 T;  1HCI A;  2NP9 A;  3EDU A;  5FKY A;  3RLF F;  5JDH A;  4QWN B;  3NKZ A;  1T7S A;  2KXP B;  1HF8 A;  4ASK A;  3AVR A;  3OJA A;  2EHO C;  1N32 T;  3TLS A;  1L0V A;  5LG4 A;  4LFA T;  4Z91 A;  2JQ9 A;  3A5X A;  3LK2 B;  1WYC A;  3GA8 A;  5FXV A;  2JQH A;  2V1D B;  2JRK A;  2KWH A;  4ZI2 D;  2WMO A;  1BR0 A;  3PUZ F;  1WCR A;  3QB5 A;  3FBZ A;  3RRW A;  4CI2 B;  4JLE A;  5C8Y E;  4JEH B;  4H9Q C;  3AE4 A;  1LRZ A;  2NWB A;  3H37 A;  2NTY A;  2HN1 A;  3RYH E;  3ZYK A;  4AQY T;  3JAF A;  1W9R A;  2E9X B;  3Q5E A;  4HEA A;  1YD8 G;  4PK6 A;  4G63 A;  4PJL A;  2W62 A;  5HAX A;  1WR6 A;  1ZEE A;  4UEL A;  2KSR A;  2NOX A;  5F8P A;  5JVD E;  2G0U A;  1S35 A;  4LF8 T;  2W67 A;  4JUY A;  4X1I E;  1ZOY A;  2BS3 A;  1BR4 A;  1KNP A;  4DR6 T;  3AA6 B;  3ZJ2 A;  4PJJ A;  5BMV E;  3E08 A;  3KBU A;  3I0Q A;  1KF6 A;  1UCU A;  4H9R C;  2FJB A;  5HWX A;  4QX7 B;  2DHR A;  3NVO A;  4IT4 A;  5AQJ B;  5L3D B;  3AE8 A;  4HFB A;  2YN6 A;  4L0R A;  3AEA A;  3KV6 A;  1D0Z A;  1FEW A;  1NEN A;  2XQ3 A;  2B1E A;  1XWM A;  2M6B A;  4HE8 A;  5DQV A;  4HN9 A;  1UGO A;  5L3C B;  5J1G A;  2UXB T;  4DR3 T;  4XZC A;  2YDR A;  1B7T A;  5HEO A;  2H7V C;  3RI5 A;  4PNI A;  3FXE B;  3C51 A;  3CQG B;  3PUV F;  4ILA A;  4ZI7 E;  3HKC E;  5JDM A;  2K9A A;  3B13 A;  2LHR A;  3F2E A;  4GYR A;  5IHY A;  5JDN A;  2V5D A;  3IHR A;  3QC9 A;  2CMR A;  3NZP A;  5KX5 E;  3UUB A;  3LFM A;  3LSV A;  3RYI E;  2X51 A;  4DR1 T;  5CB4 E;  1D1B A;  5ABF A;  4YSZ A;  2V6Y A;  1FMV A;  2XAQ B;  4DV3 T;  3P8C D;  1J1J A;  4IL9 A;  2DCF A;  4LML A;  2YDQ A;  4HFE A;  5A1L A;  3WAK A;  5FL1 A;  4BA9 A;  4ERR A;  3U3I A;  5FXZ A;  4LF4 T;  2XAG B;  2NTX A;  2VUR A;  5JDL A;  3SS1 A;  5KDM C;  3R6N A;  3B5M A;  3FZL B;  2WQY A;  1U5P A;  4ZI3 D;  2CHN A;  5E0O A;  3JAD A;  4JI8 T;  1E1H B;  4AKH A;  1IZN B;  3EHZ A;  3I9W A;  4CZZ B;  2CCQ A;  4IE7 A;  3QOF A;  4LMJ A;  3P4Q A;  4HFC A;  5ABH A;  1I94 T;  1MIV A;  2VKH A;  4DV4 T;  5CFB A;  4BAY B;  3AED A;  4X65 T;  4HKA A;  4ADZ A;  5LGT B;  4YTN A;  1HNW T;  4IST A;  4BJN A;  2VVN A;  4JI0 T;  3AEC A;  1DU2 A;  4ZI3 C;  1E7P A;  1W0A A;  2RPA A;  2QA7 A;  4IDQ A;  3ETU A;  3UTK A;  3KFW X;  2Y6X A;  3TLT A;  4J2C A;  3HKD E;  4CI3 B;  3F31 A;  5JDF A;  3FB2 A;  4EXT A;  5DAB A;  5FVK A;  4HWH A;  4I43 B;  5HCM A;  3ZSS A;  1CHU A;  3MXZ A;  2H89 A;  2VVS A;  3OBV E;  3P4S A;  2BS2 A;  5HXC A;  4OYK A;  3QB5 K;  4UV9 B;  1IBM T;  5EK4 A;  3RKG A;  2LSK A;  2VQF T;  1SUM B;  5LXT E;  4DMV A;  5AQH B;  4KP3 C;  3MAC A;  2W66 A;  3AE7 A;  4LFB T;  3MZK B;  4YFS A;  3DP7 A;  5H6R B;  4UIG A;  4M1P A;  2CBI A;  4HGA A;  2OLT A;  2VB6 A;  4TV8 E;  2MTQ A;  5AQP B;  2LRL A;  4CXW A;  3ZMZ B;  4IL4 A;  1R8I A;  1IAP A;  3OYZ A;  4GIW A;  3HKE E;  3Q9D A;  2V5C A;  2M6I A;  5AQT B;  5JRE A;  2XQA A;  2XQ6 A;  1XNQ T;  4B3T T;  4WBN E;  2LOS A;  2V6Y B;  2V7L A;  3RQU A;  2JQQ A;  2JQK A;  3Q2M A;  1T98 A;  2UXN B;  1LVF A;  2W2U A;  5HXE A;  3C50 A;  2W61 A;  4HWC A;  3KVA A;  4JI6 T;  3EVY A;  3N5L A;  4A56 A;  3TLV A;  4HWF A;  2QGS A;  4I55 E;  3BQL A;  3N2G E;  2CWY A;  2CBJ A;  4X62 T;  1BR2 A;  4QX8 B;  5AQU B;  3RC3 A;  2WWU A;  3AAI A;  3FZF B;  3HI2 A;  4NUV A;  2OV9 A;  4ILB A;  2D5U A;  5JH7 E;  4L9I A;  3UFG A;  4X66 T;  2WM9 A;  2XQ8 A;  5FMN A;  4GK0 E;  3VKH A;  4JI2 T;  2BG9 E;  4DV2 T;  3IA3 A;  5JTG A;  1YKE B;  2AXD S;  4O2B E;  2LHN A;  4FJO A;  2UXC T;  4HWI B;  4V1A v;  4TWF A;  5CJ5 A;  3O1H A;  4AKL A;  2NW7 A;  5HWY A;  3CML A;  2YU2 A;  1QUU A;  1WRD A;  5LG3 A;  4EED A;  3O4X E;  2EHO A;  2X9X A;  4YT0 A;  4IHJ E;  3VHL A;  2LT3 A;  4YTP A;  3JCF A;  2XAH B;  2XM2 A;  3PJA J;  4U2Y A;  4U31 A;  4JI5 T;  2WMN A;  2W63 A;  5AQI B;  5HEG A;  2BBJ A;  3KBT A;  1ZHC A;  1LKX A;  3K3Q C;  2BG9 C;  3PUY F;  2W0G A;  4AKR B;  3AE6 A;  2YEV C;  2ZLY A;  4JV5 T;  3L8R A;  2DL1 A;  5DJQ C; 
#chains in the Genus database with same CATH homology
 5AQQ B;  1I6Z A;  3M3Z B;  5AQM B;  1HX1 B;  5AQU B;  5AQI B;  5AQL B;  3FZK B;  3FZF B;  5AQG B;  5AQN B;  1M7K A;  4HWH A;  5AQK B;  5AQR B;  5AQH B;  5AQV B;  3FZL B;  4HWC A;  5AQO B;  4HWI B;  5AQT B;  2D9D A;  5AQF B;  3LDQ B;  3A8Y C;  5AQS B;  4HWF A;  3FZH B;  1UGO A;  1T7S A;  5AQJ B;  3FZM B;  1M62 A;  1UK5 A;  4HWD A;  5AQP B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...