4HWFA

Crystal structure of atbag3
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
87
structure length
87
Chain Sequence
SASKSISDISFEVDRLAGQVSAFETVINKGGKVEEKSLVNLIEMLMNQLLRLDAIIADGDVKLMRKMQVQRVQKYVEALDLLKVKNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural insight into plant programmed cell death mediated by BAG proteins in Arabidopsis thaliana.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Apoptosis
molecule keywords BAG family molecular chaperone regulator 3
total genus 37
structure length 87
sequence length 87
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02179 BAG BAG domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.120 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 BAG domain 4hwfA00
5AQVB 5AQTB 5AQOB 5AQLB 1UK5A 3FZMB 4HWFA 5AQHB 5AQIB 4HWHA 5AQRB 1M62A 5AQGB 5AQFB 5AQKB 5AQQB 3M3ZB 1I6ZA 4HWIB 1T7SA 1HX1B 1M7KA 3A8YC 3LDQB 4HWDA 5AQUB 3FZLB 5AQPB 3FZFB 4HWCA 1UGOA 3FZHB 2D9DA 3FZKB 5AQJB 5AQSB 5AQMB 5AQNB
chains in the Genus database with same CATH superfamily
4YT0A 2XM2A 5FVKA 3O4XE 5AQLB 2YEVC 3RX6A 3U78A 2MOZA 2BS3A 3PUZF 1HTJF 3AAAB 1D1CA 3ESLA 4DV6T 3A5XA 2X0YA 1YKEB 3PUVF 2KWHA 2H89A 2HPJA 4ILUA 2VKJA 4L5GA 3N2GE 5J1GA 2CEAA 4ZZCA 2XZEA 3HI2A 3AE9A 4PJJA 4JI3T 1NEKA 2JMHA 3P4SA 3ONJA 3C4XA 4DR4T 3CX7B 3LDQB 5F8PA 2QYWA 4CI1B 3ZN1B 4PJMA 2H7OA 2CMRA 1W09A 2R6GF 1MMDA 3V5UA 3QB5K 1W9RA 4QWNB 2PJQA 1FMWA 2QGSA 3H3MA 3PU8A 2X68A 2YU1A 1JNZA 2AE9A 4O4LE 3L8RA 3ZPOA 4IDQA 1IBMT 4X64T 2KLQA 4HN9A 1US7B 3AE3A 5AQOB 4U72A 3AEDA 1LRZA 1NWMX 2WZIA 3JAEA 3NKZA 4N78D 2BKNA 2KMFA 5AQHB 4CI2B 2VASA 3T1YT 5ADXL 2UU9T 2UXBT 5AQRB 1T98A 5AQGB 5HXCA 4JV5T 2IMLA 2JQ9A 4OK0A 2J1DG 3LK3B 3CMLA 1HFAA 5LJMA 4GKJT 2CE7A 2BBJA 3AXJB 3F31A 3CX6B 4AQYT 3FBLA 4IE7A 2IUBA 2XQ4A 5FY7A 1MNEA 4TV9E 4DV3T 4DV7T 4X1YE 5C3JA 2L8KA 1D1BA 3HKCE 4UV9B 2W00A 5H6QB 2V6YA 5HWXA 5KXJA 3S4UA 2VURA 3HKDE 4ZXLA 4COFA 2WCAA 1I6ZA 1HX8A 3GWHA 2XQ6A 3ZN0B 2UUAT 5LHHB 3AEBA 1T72A 5AQVB 2LOSA 3AA7B 4X1KE 1Y64B 2DLRA 2LSYA 3ZT5A 2IAKA 2JQKA 2CA5A 2B1EA 2I6HA 2G0UA 5EK3A 2NW7A 4U7YA 5HCMA 4PFOA 1ZKEA 2X0HA 1NAFA 3SFDA 4ZZBA 3T1HT 5L4EA 2UXDT 3RI5A 1BR4A 4TZ4C 3PJAA 1T7SA 4AXPA 2C5KT 2N2NA 2PTFA 1R8IA 2P9BA 2XQ8A 1HR0T 1KK7A 5FXXA 3ZMUB 2OLTA 3RC3A 5DQVA 3RKOA 4EIWA 3N2OA 2EHOB 4ZHQE 4H63V 3PDYA 3PV0F 4YLHA 4G2AA 3UU6A 2HHHT 4GK5E 2K48A 5HEOA 4UIGA 4LF4T 5JDNA 3PUQA 4KHPT 3UUXB 3PTRB 3UQ4A 3RYFE 3KBTA 4NIQA 4ZI3C 3N9PA 2OA5A 3KINB 4JBWF 4OYKA 3ZYKA 4EYYR 5LGNB 4JI7T 2XQ9A 2NTYA 3AA6B 2XM1A 2Y48B 3BQIA 2JRKA 5LBMA 4QX8B 5FY1A 3NWIA 2WBLA 5LNKA 5J0ZA 5FXWA 2A3DA 2JMKA 4K0KT 3D0TA 1HCIA 2ODVA 2W2UA 1KEYA 4U31A 5FVLA 4DR6T 3NVOA 3RIFA 2E9XD 3AEGA 2VL0A 2JQQA 3ZJ2A 3UU5A 1KNPA 1MIWA 4HFVA 3ZLIA 4DUYT 4YY3T 4CXYA 5EK2A 4FI5A 2K9AA 2UXCT 5GONE 2WU5A 1E2AA 1IAPA 1UGOA 3P4QA 1IBLT 4LFBT 2WDRA 4UELA 5C8YE 2CHNA 4EGWA 4Z8XA 2LKGA 2ZMAA 4HEAA 3RQUA 1QLBA 4ZS3A 2CPTA 3MKDA 4XBFB 2GK9A 3RRCA 4DR2T 3RIAA 2KINB 4GOUA 4P1NA 5F3JA 4TV8E 4NXNT 3NRYA 3UULA 2WSSV 1UK5A 4IGUA 4ILBA 3I9WA 2VQFT 2BVMA 4P0BA 3NZPA 2BG9C 3PE0A 4AKIA 5HEUA 2IC9A 2NTXA 1V9DA 4O2BE 2BVLA 2FJAA 3QNUA 4DNDA 2JPFA 4B3TT 5FNVE 3VR9A 1HNXT 2MBGA 4IL4A 4QHOA 2WS3A 2BG9E 4HWIB 4MLKA 4O4JE 5LYJE 4HFBA 1HX1B 2W63A 3KV4A 3E08A 2A72A 4L9IA 3UTKA 1H7CA 4YTNA 3AE8A 1J1JA 3MA9A 2D0UA 3FXEB 4IREA 4MHCA 1IJ5A 2FUPA 3K1SA 2QRXA 3BK9A 4EXTA 4PK4A 4U2YA 3E0ZA 5ABHA 2KSRA 1KFYA 3B13A 5AQSB 4IDPA 2BS2A 3ZT6A 4YFSA 2VL8A 5CGMA 4GYSA 2K24A 1OEDE 3C4ZA 2SPCA 5AQTB 3L3PA 2L3LA 3AEEA 3GN5A 1KNZA 4NUUA 4QX7B 5LHGB 1QSDA 3UUBA 1SHZC 2XSAA 3P4RA 4TWDA 3EDUA 4JEHB 4G63A 4E7SA 2OV9A 3WAJA 4DR3T 4P09A 4QXBB 4P0AA 4JUYA 2Y6XA 3IF8B 3RYIE 5JVDE 3LBXB 5HYAA 2XQYA 3FXDB 2V7KA 4QKNA 4CQIA 2VQET 5JH7E 4AKHA 1M7KA 1ZOYA 5ABEA 3MXZA 1E7PA 3AE1A 3MJXA 3K3QC 2MAWA 5LG4A 3OTOT 3RYCE 3PUAA 1MIYA 2D2SA 3K3OA 4A97A 3BQKA 3N9LA 4H9NC 4ZOLE 1SE7A 2W66A 3HA4A 3G06A 3K8PC 3W15B 4AKGA 1NENA 2HPLA 4U3CA 4BJNA 1X79A 2CRBA 4B3MT 5L3EB 3UT5E 4QH4A 5JR9A 2Q9QD 3DJBA 2DI4A 2LM2A 3ONLC 5JTGA 1OXZA 2LHNA 3LJCA 3QOFA 4HFEA 3UU3A 5L3GB 5JRCA 4HTEA 1YXRA 3VKGA 4GIWA 1CUNA 1HG2A 2X0LB 2QA7A 3RIUC 1XDOA 1Y01A 4HWHA 4C91A 4CN1A 3CQCB 1S94A 4KUMB 2ODUA 2K5BB 1HF8A 2Q9QB 3E22E 4TNVA 2DL1A 2VKHA 2YDRA 4YSZA 4DV2T 4A98A 2KWIB 2XY8B 4JI8T 3MACA 3I9YA 4CXWA 3RKGA 3I1AA 2YN6A 1XWMA 2BBHA 4QXHB 5M4YA 3QB5A 3ZYMA 4ZI7E 2ES0A 5LBQB 2WWVA 3J9X1 4ZEYA 2CXFA 3N2KE 3FHNA 2IHR1 2ZM2A 3L39A 5JDMA 3RHWA 3UUMA 1FJGT 5CA1E 3EDVA 5FL0A 3T8OA 4EOZB 1XMQT 3KVAA 5JR9B 4I50E 3ZSTA 2RPAA 2X9HA 1KNRA 1MMNA 3F57A 4LF8T 1LVFA 3FZMB 2NWBA 4U33A 4PJLA 3SFEA 3B5MA 4DR5T 2PBIA 4Q25A 2FJBA 4KX6A 4H9SE 5BR8T 4CZZB 5AQFB 5DABA 3J7Yq 2X9XA 2EHOC 4AIUA 4UF0A 3H3AA 3PUXF 1YD8G 2XSBA 4PK6A 3ZCIA 4EZ4A 5FY0A 1N34T 5L3FB 1X9BA 2UUCT 4LFAT 4YXDA 5LA6E 5HEJA 4YJ3E 2CLYC 1YQ3A 2LE8A 2XTLA 3EABA 3EI0A 3JAFA 3OBVE 2W61A 4ILAA 2I0MA 1OEDB 2E9XC 4EV6A 1FMVA 3ZMSB 3ZC1A 3AE6A 4FJOA 2L9QA 2V8SV 5HXSA 2E5LT 1N32T 2DNXA 3EUHA 4UV8B 3IBPA 3JADA 3PUGA 5LB7B 3UFGA 4DR1T 5LXTE 2RA1A 1WYBA 2BDEA 4IE4A 5A1LA 4GYRA 3TLWA 2E8IA 2JQHA 3I0QA 2KZ7B 2M6BA 3JC6C 4X5TA 3ZEFB 5HXEA 4IDZA 1LKXA 4U74A 3AE2A 2WY2A 3IEEA 1M62A 1U5PA 1N33T 3QK6A 4O4HE 3ONXA 1WFDA 2Q9QA 2ACXA 2DCFA 2PFVA 4JI5T 4PK5A 3N9NA 4O2AE 4JI2T 5LMUT 5HXHA 1ZV4X 2EHOD 5HWYA 2XPKA 5FL1A 2MPKA 4PFPA 5HAXA 3LK2B 2VKOA 4ADZA 4MALA 3LK42 3P8CD 1W0AA 3C4WA 4ZS2A 2NW9A 2LHRA 4DBRA 3VHLA 5LCYA 2NP9A 3HR0A 2V5DA 2W4XA 1XZYA 3KDSE 4I0UA 3HL6A 3FZKB 4X20E 3BQLA 4CXXA 4ERRA 5J2UE 1HNZT 3ZYLA 4HGAA 2XAJB 3OVUA 3MK7C 1UCUA 4GK0E 4ISTA 3CK6A 3CKDA 4PAGA 4TWHA 5CB4E 3VRBA 2X9WA 3CWZB 4ILCA 3AE7A 5HCJA 1LVKA 3TLVA 4AI6A 4B6XA 2D5UA 4O4IE 1KF6A 4Z91A 2ZM6T 4HWFA 2XAQB 5LGUB 1OEDC 2E9XB 3CQXC 3UU4A 3VR8A 3AVRA 3VKHA 3RIUA 1Z0PA 3EVYA 2K3WA 2N1GA 2C5JA 3M3ZB 2WDQA 3TLSA 4OFZA 3LG7A 4JEUB 4MBQA 5JR9C 3ZCJA 4DUZT 3CIRA 5FP3A 1FIOA 2VK9A 2V7JA 2LJLA 3AEFA 2IW5B 4PJNA 3EAMA 2XAFB 2ACZA 3HKBE 1D0YA 1SUMB 2IDOB 2WM9A 4HFCA 5ABFA 4DIDB 2BG9A 2BS4A 4PNIA 3RF1A 3ZJ1A 2B76A 4IE0A 4LF7T 4AKRB 1HS7A 4AQFA 1IJ6A 4BA9A 4BJMA 2WQYA 2MYSA 4YHHT 4IE5A 1I94T 1FEWA 2LRKA 4EEDA 3JC6D 2W62A 2CBIA 2WMNA 2YDSA 3R84B 4IT4A 1QUUA 1WR0A 5TAOA 4JI0T 4YSYA 2XQ3A 2F4VT 4TN7B 3FB2A 2BKOA 3C64A 2W67A 3VRAA 3N9OA 4QXCB 4B3ST 1MMAA 3PUYF 5EK4A 4IIJE 5FXVA 4DVDA 3Q2MA 2HN2A 3RQWA 4UXNB 3RLFF 3UUNA 3DP7A 4NUVA 4IDOA 3OJAA 4M1PA 4AKLA 2H7VC 2VKDA 4DR7T 4C90A 3C50A 4ZI3D 2VVNA 3RYHE 4UVBB 4HWCA 2LKHA 4XZCA 4HFHA 5KX5E 3AE4A 5LGTB 1WYCA 1YKHB 2CM0A 2WWUA 3LBXA 4H9OC 4DV1T 4JI1T 4TNWA 4X65T 4B3RT 3FBZA 4QH5A 1T8BA 1UUSA 2WP9A 3AAIA 3ZMVB 4DMVA 4NPPA 4H9PC 4QH1A 3AE5A 3SOLA 2V26A 3Q5XA 4OHFA 1BR0A 4XAXB 4A5XA 4CN4A 3L09A 5HEHA 2JIWA 2MTQA 4ISSA 3UFEA 2V6YB 5AQIB 3NRXA 5EZYE 1L0VA 2ZM0A 4H9RC 5AFUL 4WW0A 1WR6A 5JREA 2IC6A 2LSGA 4E7ZA 4F6RC 3ANWA 2BG9B 1XDPA 4PW8A 2X51A 5HEGA 2CWYA 1IBKT 3PUSA 4HWDA 5H6RB 1VCSA 1ZHCA 3C98B 4WYVA 4ASKA 2A2FX 3FZFB 3N5LA 2BKPA 2XQAA 3OKQA 3ABVA 3QC9A 4HFIA 3RPUA 1WRDA 1G73A 1VOMA 2DWKA 2YK0A 1SA0E 4LMJA 1DU2A 2NR4A 2NOXA 3UQ7A 3TKLB 5IWAT 2J4GA 4KP3C 4WBOA 5CJ5A 5C2TA 1D1AA 1U4QA 1XNRT 3O1JA 3P4WA 2LSKA 4YTMA 5JDHA 3PUWF 4EB6E 1ZEEA 4LF5T 5E0OA 3CVRA 4AQFC 2V1DB 2CCQA 2V7IA 2ZM8A 2H88A 2Z6EA 3N9QA 3NBXX 2XQ5A 3Q9DA 4X1IE 3SS1A 3KV5A 4JI4T 1BR1A 4LF9T 3ZT7A 3P7IA 2XHEB 2V7LA 3C51A 3R6NA 5JQGE 2CLYB 3KBUA 5AQQB 3ZMTB 4YJ2E 2CXDA 5HXRA 3P50A 2VWAA 2LEHA 5JDGA 3B57A 2FJEA 1Z8UA 3MZKB 1D0XA 4K0UA 3ZC0A 4I4TE 2XUEA 5IUXA 5L3CB 5JRCB 2WDVA 3N9MA 5FKYA 5ETWA 3SWHA 2WAUA 2C5IT 5L4HA 2CBJA 3QUJA 3TLUA 3CPZA 4X62T 4X66T 4JI6T 1AJ3A 5F5WA 3SRZA 5LG3A 4I55E 3EHZA 5CA0E 3KVBA 5L47A 2ZLYA 3WAKA 5KMGP 5LHIB 4LF6T 2YU2A 2H3RA 2W0GA 2WMOA 2X66A 4CN6A 4TUYE 3ANWB 3ETUA 1EZ3A 2LRLA 3CQGB 3PU3A 2NW8A 5IYZE 1OWAA 2LOPA 5LOVE 3PURA 4ZI2C 3AB3B 4IHJE 1B7TA 2V6XA 4AQGA 2WZHA 5IHYA 1W0BA 3PJAJ 2XJ7A 4AISA 2HH7A 2KT9A 4IL9A 3KV6A 4JLEA 1G8XA 4I43B 4DMWA 3M65A 3TLTA 2VVSA 1J5ET 4UR9A 4KMCA 2J47A 2M67A 1D0ZA 1CHUA 2AXDS 1WCRA 2FBWA 2LLYA 2XAHB 2YKSA 1GQEA 4HFDA 4J2CA 5FXZA 3Q5WA 3Q5DA 5JDFA 2LSIA 1XMOT 5LMNT 2Q9QC 3GMIA 5J2TE 3FZHB 3O1HA 5ABGA 3AVSA 2UUBT 1HG5A 2V7MA 4UVCB 4HKAA 5AQJB 3X1DA 4KBMB 3OPCA 1VCTA 4UF0B 3RGLA 4H9QC 3WI3A 2KXPB 2LT3A 2XQ7A 2QVAA 4BAYB 4YSXA 3ZSSA 2LSJA 5FMNA 3ZKRA 4YTPA 4H63H 1XNQT 4EYUA 4GKKT 4DV0T 3AA0B 3A7MA 3ETVA 2E2AA 2YOEA 3OYZA 4TWFA 4ANJA 2YINA 3RRWA 3H37A 1J5WA 1OEDA 2YDQA 4DO0A 2I59A 5L3BB 2CXLA 3CX8B 3RC8A 3AEAA 2XAGB 1E1HB 4KI0F 2KNDA 4LMKA 1VRBA 1MMGA 4Z90A 2DWGA 3O1IA 5ABFB 5JDLA 3DTOA 4NXMT 3AAEB 1YQ4A 2V5CA 3JCFA 4OYJA 4OX9T 3IA3A 3FZLB 2PG8A 4LMLA 2M6IA 4CI3B 2EHOA 5L2LA 3AA1B 4LFCT 3P4PA 2D0TA 4KHZF 3U3IA 2XASB 4DV4T 2BZBA 2RP4A 2UXNB 2X9YA 4MFRA 4JYAT 4YHJA 2VB6A 3O9XA 1UURA 3IHRA 3I0OA 4A56A 1S35A 2UXXB 4WNKA 5LJNA 3V5SA 2Y8DA 4IE6A 5L3DB 4ZI2D 4WBNE 3LFMA 1O3XA 1UX5A 3HKEE 5FYMA 5LP6E 3UU8A 3GN5B 5CFBA 1YW0A 2LM9A 3VU7H 1BR2A 2N9DA 2WU2A 2WB5A 3KV9A 2E5VA 4L0RA 4EAHA 4UVAB 5BMVE 1ZP0A 2A9UA 3AECA 5DJQC 5DQWA 3ZMZB 4EZHA 5AQKB 4DBQA 1N36T 3NZQA 4WZXA 2IIUA 1MNDA 2CWOA 2J62A 2HN1A 3AXJA 4U7IA 1HNWT 4F8HA 3A8YC 4IDNA 5AQUB 4HE8A 5KDMC 5AQPB 3K3NA 1JNRA 2DHRA 2FJDA 2X67A 4V1Av 2E9XA 2D9DA 3LSVA 5JDQA 4TX5A 4EEBA 4DV5T 1WLXA 3OYXA 2C0SA 2JJ9A 3KFWX 4U2ZA 1UX4A 4UEMA 2CHOA 3Q5EA 5AQMB 1IZNB 5AQNB 4O8SA 1MIVA 3RH3A 3F2EA 3GA8A
chains in the Genus database with same CATH topology
5AQVB 5AQTB 5AQOB 5AQLB 1UK5A 3FZMB 4HWFA 5AQHB 5AQIB 4HWHA 5AQRB 1M62A 5AQGB 5AQFB 5AQKB 5AQQB 3M3ZB 1I6ZA 4HWIB 1T7SA 1HX1B 1M7KA 3A8YC 3LDQB 4HWDA 5AQUB 3FZLB 5AQPB 3FZFB 4HWCA 1UGOA 3FZHB 2D9DA 3FZKB 5AQJB 5AQSB 5AQMB 5AQNB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AQV B;  5AQT B;  5AQO B;  5AQL B;  1UK5 A;  3FZM B;  4HWF A;  5AQH B;  5AQI B;  4HWH A;  5AQR B;  1M62 A;  5AQG B;  5AQF B;  5AQK B;  5AQQ B;  3M3Z B;  1I6Z A;  4HWI B;  1T7S A;  1HX1 B;  1M7K A;  3A8Y C;  3LDQ B;  4HWD A;  5AQU B;  3FZL B;  5AQP B;  3FZF B;  4HWC A;  1UGO A;  3FZH B;  2D9D A;  3FZK B;  5AQJ B;  5AQS B;  5AQM B;  5AQN B; 
#chains in the Genus database with same CATH topology
 4YT0 A;  2XM2 A;  5FVK A;  3O4X E;  5AQL B;  2YEV C;  3RX6 A;  3U78 A;  2MOZ A;  2BS3 A;  3PUZ F;  1HTJ F;  3AAA B;  1D1C A;  3ESL A;  4DV6 T;  3A5X A;  2X0Y A;  1YKE B;  3PUV F;  2KWH A;  2H89 A;  2HPJ A;  4ILU A;  2VKJ A;  4L5G A;  3N2G E;  5J1G A;  2CEA A;  4ZZC A;  2XZE A;  3HI2 A;  3AE9 A;  4PJJ A;  4JI3 T;  1NEK A;  2JMH A;  3P4S A;  3ONJ A;  3C4X A;  4DR4 T;  3CX7 B;  3LDQ B;  5F8P A;  2QYW A;  4CI1 B;  3ZN1 B;  4PJM A;  2H7O A;  2CMR A;  1W09 A;  2R6G F;  1MMD A;  3V5U A;  3QB5 K;  1W9R A;  4QWN B;  2PJQ A;  1FMW A;  2QGS A;  3H3M A;  3PU8 A;  2X68 A;  2YU1 A;  1JNZ A;  2AE9 A;  4O4L E;  3L8R A;  3ZPO A;  4IDQ A;  1IBM T;  4X64 T;  2KLQ A;  4HN9 A;  1US7 B;  3AE3 A;  5AQO B;  4U72 A;  3AED A;  1LRZ A;  1NWM X;  2WZI A;  3JAE A;  3NKZ A;  4N78 D;  2BKN A;  2KMF A;  5AQH B;  4CI2 B;  2VAS A;  3T1Y T;  5ADX L;  2UU9 T;  2UXB T;  5AQR B;  1T98 A;  5AQG B;  5HXC A;  4JV5 T;  2IML A;  2JQ9 A;  4OK0 A;  2J1D G;  3LK3 B;  3CML A;  1HFA A;  5LJM A;  4GKJ T;  2CE7 A;  2BBJ A;  3AXJ B;  3F31 A;  3CX6 B;  4AQY T;  3FBL A;  4IE7 A;  2IUB A;  2XQ4 A;  5FY7 A;  1MNE A;  4TV9 E;  4DV3 T;  4DV7 T;  4X1Y E;  5C3J A;  2L8K A;  1D1B A;  3HKC E;  4UV9 B;  2W00 A;  5H6Q B;  2V6Y A;  5HWX A;  5KXJ A;  3S4U A;  2VUR A;  3HKD E;  4ZXL A;  4COF A;  2WCA A;  1I6Z A;  1HX8 A;  3GWH A;  2XQ6 A;  3ZN0 B;  2UUA T;  5LHH B;  3AEB A;  1T72 A;  5AQV B;  2LOS A;  3AA7 B;  4X1K E;  1Y64 B;  2DLR A;  2LSY A;  3ZT5 A;  2IAK A;  2JQK A;  2CA5 A;  2B1E A;  2I6H A;  2G0U A;  5EK3 A;  2NW7 A;  4U7Y A;  5HCM A;  4PFO A;  1ZKE A;  2X0H A;  1NAF A;  3SFD A;  4ZZB A;  3T1H T;  5L4E A;  2UXD T;  3RI5 A;  1BR4 A;  4TZ4 C;  3PJA A;  1T7S A;  4AXP A;  2C5K T;  2N2N A;  2PTF A;  1R8I A;  2P9B A;  2XQ8 A;  1HR0 T;  1KK7 A;  5FXX A;  3ZMU B;  2OLT A;  3RC3 A;  5DQV A;  3RKO A;  4EIW A;  3N2O A;  2EHO B;  4ZHQ E;  4H63 V;  3PDY A;  3PV0 F;  4YLH A;  4G2A A;  3UU6 A;  2HHH T;  4GK5 E;  2K48 A;  5HEO A;  4UIG A;  4LF4 T;  5JDN A;  3PUQ A;  4KHP T;  3UUX B;  3PTR B;  3UQ4 A;  3RYF E;  3KBT A;  4NIQ A;  4ZI3 C;  3N9P A;  2OA5 A;  3KIN B;  4JBW F;  4OYK A;  3ZYK A;  4EYY R;  5LGN B;  4JI7 T;  2XQ9 A;  2NTY A;  3AA6 B;  2XM1 A;  2Y48 B;  3BQI A;  2JRK A;  5LBM A;  4QX8 B;  5FY1 A;  3NWI A;  2WBL A;  5LNK A;  5J0Z A;  5FXW A;  2A3D A;  2JMK A;  4K0K T;  3D0T A;  1HCI A;  2ODV A;  2W2U A;  1KEY A;  4U31 A;  5FVL A;  4DR6 T;  3NVO A;  3RIF A;  2E9X D;  3AEG A;  2VL0 A;  2JQQ A;  3ZJ2 A;  3UU5 A;  1KNP A;  1MIW A;  4HFV A;  3ZLI A;  4DUY T;  4YY3 T;  4CXY A;  5EK2 A;  4FI5 A;  2K9A A;  2UXC T;  5GON E;  2WU5 A;  1E2A A;  1IAP A;  1UGO A;  3P4Q A;  1IBL T;  4LFB T;  2WDR A;  4UEL A;  5C8Y E;  2CHN A;  4EGW A;  4Z8X A;  2LKG A;  2ZMA A;  4HEA A;  3RQU A;  1QLB A;  4ZS3 A;  2CPT A;  3MKD A;  4XBF B;  2GK9 A;  3RRC A;  4DR2 T;  3RIA A;  2KIN B;  4GOU A;  4P1N A;  5F3J A;  4TV8 E;  4NXN T;  3NRY A;  3UUL A;  2WSS V;  1UK5 A;  4IGU A;  4ILB A;  3I9W A;  2VQF T;  2BVM A;  4P0B A;  3NZP A;  2BG9 C;  3PE0 A;  4AKI A;  5HEU A;  2IC9 A;  2NTX A;  1V9D A;  4O2B E;  2BVL A;  2FJA A;  3QNU A;  4DND A;  2JPF A;  4B3T T;  5FNV E;  3VR9 A;  1HNX T;  2MBG A;  4IL4 A;  4QHO A;  2WS3 A;  2BG9 E;  4HWI B;  4MLK A;  4O4J E;  5LYJ E;  4HFB A;  1HX1 B;  2W63 A;  3KV4 A;  3E08 A;  2A72 A;  4L9I A;  3UTK A;  1H7C A;  4YTN A;  3AE8 A;  1J1J A;  3MA9 A;  2D0U A;  3FXE B;  4IRE A;  4MHC A;  1IJ5 A;  2FUP A;  3K1S A;  2QRX A;  3BK9 A;  4EXT A;  4PK4 A;  4U2Y A;  3E0Z A;  5ABH A;  2KSR A;  1KFY A;  3B13 A;  5AQS B;  4IDP A;  2BS2 A;  3ZT6 A;  4YFS A;  2VL8 A;  5CGM A;  4GYS A;  2K24 A;  1OED E;  3C4Z A;  2SPC A;  5AQT B;  3L3P A;  2L3L A;  3AEE A;  3GN5 A;  1KNZ A;  4NUU A;  4QX7 B;  5LHG B;  1QSD A;  3UUB A;  1SHZ C;  2XSA A;  3P4R A;  4TWD A;  3EDU A;  4JEH B;  4G63 A;  4E7S A;  2OV9 A;  3WAJ A;  4DR3 T;  4P09 A;  4QXB B;  4P0A A;  4JUY A;  2Y6X A;  3IF8 B;  3RYI E;  5JVD E;  3LBX B;  5HYA A;  2XQY A;  3FXD B;  2V7K A;  4QKN A;  4CQI A;  2VQE T;  5JH7 E;  4AKH A;  1M7K A;  1ZOY A;  5ABE A;  3MXZ A;  1E7P A;  3AE1 A;  3MJX A;  3K3Q C;  2MAW A;  5LG4 A;  3OTO T;  3RYC E;  3PUA A;  1MIY A;  2D2S A;  3K3O A;  4A97 A;  3BQK A;  3N9L A;  4H9N C;  4ZOL E;  1SE7 A;  2W66 A;  3HA4 A;  3G06 A;  3K8P C;  3W15 B;  4AKG A;  1NEN A;  2HPL A;  4U3C A;  4BJN A;  1X79 A;  2CRB A;  4B3M T;  5L3E B;  3UT5 E;  4QH4 A;  5JR9 A;  2Q9Q D;  3DJB A;  2DI4 A;  2LM2 A;  3ONL C;  5JTG A;  1OXZ A;  2LHN A;  3LJC A;  3QOF A;  4HFE A;  3UU3 A;  5L3G B;  5JRC A;  4HTE A;  1YXR A;  3VKG A;  4GIW A;  1CUN A;  1HG2 A;  2X0L B;  2QA7 A;  3RIU C;  1XDO A;  1Y01 A;  4HWH A;  4C91 A;  4CN1 A;  3CQC B;  1S94 A;  4KUM B;  2ODU A;  2K5B B;  1HF8 A;  2Q9Q B;  3E22 E;  4TNV A;  2DL1 A;  2VKH A;  2YDR A;  4YSZ A;  4DV2 T;  4A98 A;  2KWI B;  2XY8 B;  4JI8 T;  3MAC A;  3I9Y A;  4CXW A;  3RKG A;  3I1A A;  2YN6 A;  1XWM A;  2BBH A;  4QXH B;  5M4Y A;  3QB5 A;  3ZYM A;  4ZI7 E;  2ES0 A;  5LBQ B;  2WWV A;  3J9X 1;  4ZEY A;  2CXF A;  3N2K E;  3FHN A;  2IHR 1;  2ZM2 A;  3L39 A;  5JDM A;  3RHW A;  3UUM A;  1FJG T;  5CA1 E;  3EDV A;  5FL0 A;  3T8O A;  4EOZ B;  1XMQ T;  3KVA A;  5JR9 B;  4I50 E;  3ZST A;  2RPA A;  2X9H A;  1KNR A;  1MMN A;  3F57 A;  4LF8 T;  1LVF A;  3FZM B;  2NWB A;  4U33 A;  4PJL A;  3SFE A;  3B5M A;  4DR5 T;  2PBI A;  4Q25 A;  2FJB A;  4KX6 A;  4H9S E;  5BR8 T;  4CZZ B;  5AQF B;  5DAB A;  3J7Y q;  2X9X A;  2EHO C;  4AIU A;  4UF0 A;  3H3A A;  3PUX F;  1YD8 G;  2XSB A;  4PK6 A;  3ZCI A;  4EZ4 A;  5FY0 A;  1N34 T;  5L3F B;  1X9B A;  2UUC T;  4LFA T;  4YXD A;  5LA6 E;  5HEJ A;  4YJ3 E;  2CLY C;  1YQ3 A;  2LE8 A;  2XTL A;  3EAB A;  3EI0 A;  3JAF A;  3OBV E;  2W61 A;  4ILA A;  2I0M A;  1OED B;  2E9X C;  4EV6 A;  1FMV A;  3ZMS B;  3ZC1 A;  3AE6 A;  4FJO A;  2L9Q A;  2V8S V;  5HXS A;  2E5L T;  1N32 T;  2DNX A;  3EUH A;  4UV8 B;  3IBP A;  3JAD A;  3PUG A;  5LB7 B;  3UFG A;  4DR1 T;  5LXT E;  2RA1 A;  1WYB A;  2BDE A;  4IE4 A;  5A1L A;  4GYR A;  3TLW A;  2E8I A;  2JQH A;  3I0Q A;  2KZ7 B;  2M6B A;  3JC6 C;  4X5T A;  3ZEF B;  5HXE A;  4IDZ A;  1LKX A;  4U74 A;  3AE2 A;  2WY2 A;  3IEE A;  1M62 A;  1U5P A;  1N33 T;  3QK6 A;  4O4H E;  3ONX A;  1WFD A;  2Q9Q A;  2ACX A;  2DCF A;  2PFV A;  4JI5 T;  4PK5 A;  3N9N A;  4O2A E;  4JI2 T;  5LMU T;  5HXH A;  1ZV4 X;  2EHO D;  5HWY A;  2XPK A;  5FL1 A;  2MPK A;  4PFP A;  5HAX A;  3LK2 B;  2VKO A;  4ADZ A;  4MAL A;  3LK4 2;  3P8C D;  1W0A A;  3C4W A;  4ZS2 A;  2NW9 A;  2LHR A;  4DBR A;  3VHL A;  5LCY A;  2NP9 A;  3HR0 A;  2V5D A;  2W4X A;  1XZY A;  3KDS E;  4I0U A;  3HL6 A;  3FZK B;  4X20 E;  3BQL A;  4CXX A;  4ERR A;  5J2U E;  1HNZ T;  3ZYL A;  4HGA A;  2XAJ B;  3OVU A;  3MK7 C;  1UCU A;  4GK0 E;  4IST A;  3CK6 A;  3CKD A;  4PAG A;  4TWH A;  5CB4 E;  3VRB A;  2X9W A;  3CWZ B;  4ILC A;  3AE7 A;  5HCJ A;  1LVK A;  3TLV A;  4AI6 A;  4B6X A;  2D5U A;  4O4I E;  1KF6 A;  4Z91 A;  2ZM6 T;  4HWF A;  2XAQ B;  5LGU B;  1OED C;  2E9X B;  3CQX C;  3UU4 A;  3VR8 A;  3AVR A;  3VKH A;  3RIU A;  1Z0P A;  3EVY A;  2K3W A;  2N1G A;  2C5J A;  3M3Z B;  2WDQ A;  3TLS A;  4OFZ A;  3LG7 A;  4JEU B;  4MBQ A;  5JR9 C;  3ZCJ A;  4DUZ T;  3CIR A;  5FP3 A;  1FIO A;  2VK9 A;  2V7J A;  2LJL A;  3AEF A;  2IW5 B;  4PJN A;  3EAM A;  2XAF B;  2ACZ A;  3HKB E;  1D0Y A;  1SUM B;  2IDO B;  2WM9 A;  4HFC A;  5ABF A;  4DID B;  2BG9 A;  2BS4 A;  4PNI A;  3RF1 A;  3ZJ1 A;  2B76 A;  4IE0 A;  4LF7 T;  4AKR B;  1HS7 A;  4AQF A;  1IJ6 A;  4BA9 A;  4BJM A;  2WQY A;  2MYS A;  4YHH T;  4IE5 A;  1I94 T;  1FEW A;  2LRK A;  4EED A;  3JC6 D;  2W62 A;  2CBI A;  2WMN A;  2YDS A;  3R84 B;  4IT4 A;  1QUU A;  1WR0 A;  5TAO A;  4JI0 T;  4YSY A;  2XQ3 A;  2F4V T;  4TN7 B;  3FB2 A;  2BKO A;  3C64 A;  2W67 A;  3VRA A;  3N9O A;  4QXC B;  4B3S T;  1MMA A;  3PUY F;  5EK4 A;  4IIJ E;  5FXV A;  4DVD A;  3Q2M A;  2HN2 A;  3RQW A;  4UXN B;  3RLF F;  3UUN A;  3DP7 A;  4NUV A;  4IDO A;  3OJA A;  4M1P A;  4AKL A;  2H7V C;  2VKD A;  4DR7 T;  4C90 A;  3C50 A;  4ZI3 D;  2VVN A;  3RYH E;  4UVB B;  4HWC A;  2LKH A;  4XZC A;  4HFH A;  5KX5 E;  3AE4 A;  5LGT B;  1WYC A;  1YKH B;  2CM0 A;  2WWU A;  3LBX A;  4H9O C;  4DV1 T;  4JI1 T;  4TNW A;  4X65 T;  4B3R T;  3FBZ A;  4QH5 A;  1T8B A;  1UUS A;  2WP9 A;  3AAI A;  3ZMV B;  4DMV A;  4NPP A;  4H9P C;  4QH1 A;  3AE5 A;  3SOL A;  2V26 A;  3Q5X A;  4OHF A;  1BR0 A;  4XAX B;  4A5X A;  4CN4 A;  3L09 A;  5HEH A;  2JIW A;  2MTQ A;  4ISS A;  3UFE A;  2V6Y B;  5AQI B;  3NRX A;  5EZY E;  1L0V A;  2ZM0 A;  4H9R C;  5AFU L;  4WW0 A;  1WR6 A;  5JRE A;  2IC6 A;  2LSG A;  4E7Z A;  4F6R C;  3ANW A;  2BG9 B;  1XDP A;  4PW8 A;  2X51 A;  5HEG A;  2CWY A;  1IBK T;  3PUS A;  4HWD A;  5H6R B;  1VCS A;  1ZHC A;  3C98 B;  4WYV A;  4ASK A;  2A2F X;  3FZF B;  3N5L A;  2BKP A;  2XQA A;  3OKQ A;  3ABV A;  3QC9 A;  4HFI A;  3RPU A;  1WRD A;  1G73 A;  1VOM A;  2DWK A;  2YK0 A;  1SA0 E;  4LMJ A;  1DU2 A;  2NR4 A;  2NOX A;  3UQ7 A;  3TKL B;  5IWA T;  2J4G A;  4KP3 C;  4WBO A;  5CJ5 A;  5C2T A;  1D1A A;  1U4Q A;  1XNR T;  3O1J A;  3P4W A;  2LSK A;  4YTM A;  5JDH A;  3PUW F;  4EB6 E;  1ZEE A;  4LF5 T;  5E0O A;  3CVR A;  4AQF C;  2V1D B;  2CCQ A;  2V7I A;  2ZM8 A;  2H88 A;  2Z6E A;  3N9Q A;  3NBX X;  2XQ5 A;  3Q9D A;  4X1I E;  3SS1 A;  3KV5 A;  4JI4 T;  1BR1 A;  4LF9 T;  3ZT7 A;  3P7I A;  2XHE B;  2V7L A;  3C51 A;  3R6N A;  5JQG E;  2CLY B;  3KBU A;  5AQQ B;  3ZMT B;  4YJ2 E;  2CXD A;  5HXR A;  3P50 A;  2VWA A;  2LEH A;  5JDG A;  3B57 A;  2FJE A;  1Z8U A;  3MZK B;  1D0X A;  4K0U A;  3ZC0 A;  4I4T E;  2XUE A;  5IUX A;  5L3C B;  5JRC B;  2WDV A;  3N9M A;  5FKY A;  5ETW A;  3SWH A;  2WAU A;  2C5I T;  5L4H A;  2CBJ A;  3QUJ A;  3TLU A;  3CPZ A;  4X62 T;  4X66 T;  4JI6 T;  1AJ3 A;  5F5W A;  3SRZ A;  5LG3 A;  4I55 E;  3EHZ A;  5CA0 E;  3KVB A;  5L47 A;  2ZLY A;  3WAK A;  5KMG P;  5LHI B;  4LF6 T;  2YU2 A;  2H3R A;  2W0G A;  2WMO A;  2X66 A;  4CN6 A;  4TUY E;  3ANW B;  3ETU A;  1EZ3 A;  2LRL A;  3CQG B;  3PU3 A;  2NW8 A;  5IYZ E;  1OWA A;  2LOP A;  5LOV E;  3PUR A;  4ZI2 C;  3AB3 B;  4IHJ E;  1B7T A;  2V6X A;  4AQG A;  2WZH A;  5IHY A;  1W0B A;  3PJA J;  2XJ7 A;  4AIS A;  2HH7 A;  2KT9 A;  4IL9 A;  3KV6 A;  4JLE A;  1G8X A;  4I43 B;  4DMW A;  3M65 A;  3TLT A;  2VVS A;  1J5E T;  4UR9 A;  4KMC A;  2J47 A;  2M67 A;  1D0Z A;  1CHU A;  2AXD S;  1WCR A;  2FBW A;  2LLY A;  2XAH B;  2YKS A;  1GQE A;  4HFD A;  4J2C A;  5FXZ A;  3Q5W A;  3Q5D A;  5JDF A;  2LSI A;  1XMO T;  5LMN T;  2Q9Q C;  3GMI A;  5J2T E;  3FZH B;  3O1H A;  5ABG A;  3AVS A;  2UUB T;  1HG5 A;  2V7M A;  4UVC B;  4HKA A;  5AQJ B;  3X1D A;  4KBM B;  3OPC A;  1VCT A;  4UF0 B;  3RGL A;  4H9Q C;  3WI3 A;  2KXP B;  2LT3 A;  2XQ7 A;  2QVA A;  4BAY B;  4YSX A;  3ZSS A;  2LSJ A;  5FMN A;  3ZKR A;  4YTP A;  4H63 H;  1XNQ T;  4EYU A;  4GKK T;  4DV0 T;  3AA0 B;  3A7M A;  3ETV A;  2E2A A;  2YOE A;  3OYZ A;  4TWF A;  4ANJ A;  2YIN A;  3RRW A;  3H37 A;  1J5W A;  1OED A;  2YDQ A;  4DO0 A;  2I59 A;  5L3B B;  2CXL A;  3CX8 B;  3RC8 A;  3AEA A;  2XAG B;  1E1H B;  4KI0 F;  2KND A;  4LMK A;  1VRB A;  1MMG A;  4Z90 A;  2DWG A;  3O1I A;  5ABF B;  5JDL A;  3DTO A;  4NXM T;  3AAE B;  1YQ4 A;  2V5C A;  3JCF A;  4OYJ A;  4OX9 T;  3IA3 A;  3FZL B;  2PG8 A;  4LML A;  2M6I A;  4CI3 B;  2EHO A;  5L2L A;  3AA1 B;  4LFC T;  3P4P A;  2D0T A;  4KHZ F;  3U3I A;  2XAS B;  4DV4 T;  2BZB A;  2RP4 A;  2UXN B;  2X9Y A;  4MFR A;  4JYA T;  4YHJ A;  2VB6 A;  3O9X A;  1UUR A;  3IHR A;  3I0O A;  4A56 A;  1S35 A;  2UXX B;  4WNK A;  5LJN A;  3V5S A;  2Y8D A;  4IE6 A;  5L3D B;  4ZI2 D;  4WBN E;  3LFM A;  1O3X A;  1UX5 A;  3HKE E;  5FYM A;  5LP6 E;  3UU8 A;  3GN5 B;  5CFB A;  1YW0 A;  2LM9 A;  3VU7 H;  1BR2 A;  2N9D A;  2WU2 A;  2WB5 A;  3KV9 A;  2E5V A;  4L0R A;  4EAH A;  4UVA B;  5BMV E;  1ZP0 A;  2A9U A;  3AEC A;  5DJQ C;  5DQW A;  3ZMZ B;  4EZH A;  5AQK B;  4DBQ A;  1N36 T;  3NZQ A;  4WZX A;  2IIU A;  1MND A;  2CWO A;  2J62 A;  2HN1 A;  3AXJ A;  4U7I A;  1HNW T;  4F8H A;  3A8Y C;  4IDN A;  5AQU B;  4HE8 A;  5KDM C;  5AQP B;  3K3N A;  1JNR A;  2DHR A;  2FJD A;  2X67 A;  4V1A v;  2E9X A;  2D9D A;  3LSV A;  5JDQ A;  4TX5 A;  4EEB A;  4DV5 T;  1WLX A;  3OYX A;  2C0S A;  2JJ9 A;  3KFW X;  4U2Z A;  1UX4 A;  4UEM A;  2CHO A;  3Q5E A;  5AQM B;  1IZN B;  5AQN B;  4O8S A;  1MIV A;  3RH3 A;  3F2E A;  3GA8 A; 
#chains in the Genus database with same CATH homology
 5AQV B;  5AQT B;  5AQO B;  5AQL B;  1UK5 A;  3FZM B;  4HWF A;  5AQH B;  5AQI B;  4HWH A;  5AQR B;  1M62 A;  5AQG B;  5AQF B;  5AQK B;  5AQQ B;  3M3Z B;  1I6Z A;  4HWI B;  1T7S A;  1HX1 B;  1M7K A;  3A8Y C;  3LDQ B;  4HWD A;  5AQU B;  3FZL B;  5AQP B;  3FZF B;  4HWC A;  1UGO A;  3FZH B;  2D9D A;  3FZK B;  5AQJ B;  5AQS B;  5AQM B;  5AQN B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...