2LHRA

Solution structure of staphylococcus aureus isdh linker domain
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
78
structure length
78
Chain Sequence
SDDYVDEETYNLQKLLAPYHKAKTLERQVYELEKLQEKLPEKYKAEYKKKLDQTRVELADQVKSAVTEFENVTPTNDQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Staphylococcus aureus Uses a Novel Multidomain Receptor to Break Apart Human Hemoglobin and Steal Its Heme.
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Metal transport
molecule keywords Iron-regulated surface determinant protein H
total genus 21
structure length 78
sequence length 78
ec nomenclature
pdb deposition date 2011-08-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1270 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2lhrA00
2LHRA
chains in the Genus database with same CATH superfamily
5AQVB 1LVFA 4CXYA 1HNWT 4IDPA 1Y01A 2QRXA 5LA6E 3TLTA 5AQFB 5AQNB 3OKQA 3ZMTB 5ABFB 1I6ZA 3VKGA 3VU7H 3KV4A 2WZIA 4KMCA 5HXSA 3PUGA 3FZHB 4AKLA 4TUYE 4J2CA 2SPCA 3RIUC 5LBMA 2V7JA 2UXDT 2NP9A 4QX7B 3AA7B 3I0OA 3QK6A 4HWDA 3P7IA 4QHOA 1WFDA 2BDEA 3K3NA 5EK3A 2QYWA 3ZYKA 1T7SA 3K8PC 2K3WA 3CQGB 3OJAA 3JADA 3PUAA 2XJ7A 4UVAB 4Z91A 4YTPA 5C8YE 2LEHA 3GN5A 2FUPA 2EHOD 1VRBA 2CCQA 3FHNA 2OLTA 2Q9QC 3N2KE 3KBTA 3UUNA 2XM1A 4CI3B 2CWYA 4ERRA 2XPKA 4QH1A 2V7KA 5DJQC 1UCUA 4ZI2C 5JDNA 2UUCT 1T8BA 4UXNB 2LLYA 2YINA 3AEBA 3FZLB 4IE7A 4JI2T 4LF8T 3UUMA 2WMNA 3PDYA 4QXCB 2ODUA 2VKJA 3UU4A 3IBPA 4NXMT 3RC3A 2X9WA 4EYYR 2JQKA 2BKOA 1XDPA 1J5WA 4IE0A 1JNRA 4JV5T 1SHZC 2X68A 4H9OC 2PTFA 4YLHA 5L47A 3ZCJA 2E9XD 3FZKB 1MIYA 2I59A 2KXPB 2XQ9A 5BMVE 2QGSA 4QKNA 2LKGA 3S4UA 3FB2A 4LF6T 3Q5EA 3PUQA 2FJDA 4ZOLE 2VL8A 4ISSA 4CN6A 2BS3A 1Z0PA 4COFA 4JYAT 3RI5A 1D1CA 1UUSA 4OFZA 2DLRA 1YKHB 2W4XA 4DO0A 5LHHB 4PAGA 4OK0A 5L3EB 3CQXC 3LFMA 3BK9A 2PG8A 4JI6T 3HI2A 3U3IA 4ADZA 2BS4A 3ZT7A 4ASKA 3DP7A 1N33T 3CKDA 4IE5A 2EHOC 3EDUA 2D5UA 5AQGB 5HWYA 1N34T 1VCTA 4YJ3E 4HFHA 3TLUA 5LJNA 5LMUT 1KF6A 4CI1B 3MJXA 1NEKA 1XDOA 3E0ZA 4X1IE 2C5KT 3GN5B 3ZJ1A 1OEDA 5FL0A 4YY3T 1J1JA 5CA0E 4DV3T 3NVOA 3QB5A 4H9QC 5CA1E 1XMQT 2HHHT 4TX5A 4QWNB 3O9XA 2WU2A 3HA4A 2XQ8A 3CPZA 4KHZF 2JQHA 1WCRA 4GKJT 2YEVC 4IREA 2UXNB 2JMHA 2FJEA 4Q25A 3J9X1 5ABEA 4X20E 3SOLA 5LP6E 5HXEA 2HPJA 2K24A 5J2TE 3N2OA 2RA1A 5TAOA 2XZEA 4LF9T 1D1AA 2FJBA 2WAUA 2N1GA 3EI0A 2LHNA 3KINB 3P4QA 1S94A 3CQCB 5DQWA 4QH4A 4AKRB 4ZI3D 5HEUA 4DV6T 4DIDB 2V8SV 3X1DA 1MIVA 2DWKA 2CHOA 3N5LA 2V6YB 4YTNA 4AISA 2KT9A 5AQPB 2YN6A 2BS2A 2V7LA 1CHUA 2VL0A 3LBXA 1J5ET 4ZZBA 4E7ZA 2CHNA 3H37A 3MZKB 2C5JA 2DWGA 3AE6A 4KI0F 4C91A 3AA1B 1T72A 5AQIB 2MOZA 4P0BA 3NRXA 2PBIA 3N9OA 3C4XA 3H3AA 4HEAA 2WP9A 4DV0T 3N9NA 2N9DA 3N9PA 4PFPA 1YXRA 3RKOA 1H7CA 2CXFA 2M67A 3LK3B 5JDGA 3KDSE 2I0MA 2NWBA 3L39A 4TNVA 3PUXF 5AFUL 5JRCA 4NUVA 2AXDS 3PJAA 4DV7T 2X67A 3HKCE 5KX5E 5L4EA 2HPLA 3B13A 2FJAA 4LF7T 1MIWA 2VB6A 4DMWA 2VURA 2IUBA 3KBUA 1T98A 5L4HA 4CXXA 1E1HB 4UR9A 3AE4A 4U7YA 3AA6B 1HFAA 3LK2B 2NTYA 4F6RC 1JNZA 2E9XB 4UIGA 2KWIB 2WB5A 2LM2A 4IL9A 2KNDA 3WAJA 4IL4A 4ZS3A 5KMGP 1QLBA 3PV0F 4GK0E 3UULA 4XZCA 2CE7A 3RGLA 3ZKRA 4BA9A 3NZQA 2B76A 4LF4T 4IDZA 2XAGB 3ANWB 4TWDA 2E8IA 2K9AA 1IAPA 2RP4A 2XM2A 4IIJE 4A56A 3ZT5A 2BKPA 3VRBA 5LGTB 4O4LE 1KK7A 4I4TE 4WBOA 2GK9A 2Y6XA 2DNXA 3MA9A 3WI3A 1N32T 1HX1B 3AAIA 4YHHT 1R8IA 3QNUA 4OYKA 4K0UA 5FXVA 4EOZB 4BJNA 1ZKEA 2L8KA 2W61A 3C4WA 3ESLA 3CVRA 4ANJA 1G73A 3F31A 3FXEB 4BAYB 4X64T 4X65T 2WBLA 3ZMUB 2KINB 3UU5A 2Q9QB 3N9QA 3RYFE 3UUBA 2XAJB 4WZXA 4AQGA 2CA5A 3JC6D 3PU8A 1BR0A 5FNVE 4EEDA 1XWMA 4EZ4A 2WDRA 2E5LT 3OYZA 2NTXA 4IDQA 4TNWA 1D0ZA 1MNEA 2CEAA 2X9HA 1D0XA 2YK0A 2UUAT 4DV1T 3O1IA 2ZM6T 5LG3A 2KZ7B 3KV9A 5F5WA 3FXDB 5J2UE 3FBLA 1ZHCA 2A3DA 2XQ3A 3I9WA 5EK4A 2XY8B 1KNPA 4UV8B 5FYMA 1I94T 5FVKA 3IF8B 1YKEB 3LK42 2WY2A 3WAKA 5AQHB 5FVLA 4LFAT 5HEHA 3PURA 2BG9E 3L3PA 3PUZF 1UK5A 4TN7B 1IBKT 5AQJB 4AKGA 2LJLA 3RF1A 3RYCE 3VR8A 5JRCB 5DABA 4AKIA 5JDLA 3EVYA 2C5IT 2XASB 1FJGT 4XAXB 4EV6A 3JAFA 2LOPA 5JQGE 3SFEA 5IUXA 3UT5E 1EZ3A 2JIWA 3IA3A 4IT4A 2LT3A 2ZM8A 2BG9C 3M65A 1IZNB 3LJCA 1QSDA 2H3RA 2CBIA 1OXZA 3AE5A 4QX8B 4OYJA 3RH3A 3C4ZA 3G06A 5ABFA 5FL1A 4B3ST 2VVNA 4UF0B 2E9XA 4GK5E 3SWHA 2BZBA 2HN1A 2X0HA 3RIUA 4AIUA 4JI0T 2LOSA 2JJ9A 2BG9B 3ETVA 3AAAB 2IAKA 3Q2MA 2ZMAA 4KUMB 2XHEB 3E08A 1VCSA 4MLKA 2MYSA 4CI2B 1KNZA 2UXCT 3P4WA 3I9YA 3IEEA 1UX5A 5IHYA 2HN2A 3AA0B 4H9NC 3PJAJ 4IGUA 1L0VA 2LM9A 3ZPOA 3ZSTA 4UV9B 2Q9QA 5IYZE 3FBZA 1YQ4A 3FZFB 1WYBA 5FXWA 2J62A 5JR9B 4HWCA 2XQAA 5LGUB 4P0AA 1G8XA 4AXPA 5JH7E 1LRZA 3HL6A 3LBXB 3UU6A 4AKHA 4FJOA 4DR5T 4E7SA 5JREA 4PK4A 4CXWA 5LOVE 1KFYA 2F4VT 4LMLA 4IE6A 3ZEFB 2YDRA 1HF8A 3GMIA 4CN1A 1U4QA 4K0KT 4DR3T 3UFEA 1S35A 2VKOA 3OBVE 4I43B 2D9DA 3C98B 5HAXA 3PE0A 2E2AA 2LRLA 2WZHA 4KBMB 3LG7A 4DR2T 4KX6A 4H9RC 2YDSA 2VQFT 4V1Av 2IMLA 3CIRA 3RHWA 3SRZA 4EEBA 4HWIB 3VRAA 2K5BB 3F57A 4GOUA 2UXBT 3DTOA 4UELA 2JRKA 5HEOA 4DNDA 3NKZA 1XMOT 2EHOA 5AQRB 4UVBB 3CK6A 3ZYLA 2Q9QD 5JVDE 3KV5A 3AVSA 1MMNA 2DI4A 4L0RA 3AE3A 2A2FX 5GONE 5HXCA 5J1GA 5FMNA 4YXDA 3T8OA 4ZEYA 1D1BA 2QA7A 4JI1T 2YU2A 4H63H 4JI3T 4DV4T 3N2GE 1XZYA 2ACZA 4XBFB 2JPFA 4U33A 3BQKA 3I1AA 4HN9A 4H9SE 4U2ZA 3RIAA 4CN4A 5AQUB 5L3GB 2PJQA 5CFBA 4PNIA 1UX4A 3LSVA 1IJ6A 2XQ5A 3PTRB 2VASA 3V5SA 1KNRA 4YSYA 5LYJE 2J4GA 2FBWA 2V6YA 3NWIA 4JEHB 1BR4A 4NPPA 2JQ9A 4EYUA 1WYCA 2KMFA 1O3XA 5HCJA 2DHRA 2XAQB 4O4JE 4JI4T 3EHZA 4U2YA 2Y48B 3AVRA 3CMLA 4ZS2A 2NW7A 5LBQB 5CGMA 5IWAT 4HFBA 2CLYC 3QUJA 5JDHA 2MPKA 3ZMSB 4YFSA 3RIFA 2V6XA 2YDQA 3ONLC 3OYXA 3AEFA 1WRDA 5AQKB 2BBJA 2HH7A 2QVAA 4UVCB 4G2AA 1M62A 3PU3A 4IDNA 4TZ4C 2LKHA 4ILAA 5H6QB 5LHGB 2RPAA 4MFRA 5FKYA 3TKLB 4YSZA 2C0SA 2VVSA 4JI7T 5JTGA 3O1HA 3JAEA 3O1JA 4ZI3C 5ABGA 1IBMT 4PW8A 1U5PA 3M3ZB 3J7Yq 5FXXA 3ZC1A 2A72A 3PUVF 4YHJA 1NENA 3B5MA 2A9UA 3D0TA 1LVKA 2I6HA 2DCFA 2L9QA 2ODVA 3UTKA 3CX8B 3P4PA 4EIWA 4DUZT 3O4XE 4AQYT 3T1YT 3VR9A 5F8PA 3C64A 4YSXA 5EZYE 4B3RT 1D0YA 2WWUA 2VQET 2IC9A 3AB3B 4M1PA 4PK5A 3UQ7A 5A1LA 2X9XA 2K48A 1BR1A 3EDVA 3IHRA 3K1SA 5DQVA 2MBGA 4HFDA 3T1HT 2H7OA 4N78D 3SFDA 3KVAA 3GA8A 2BBHA 3W15B 4PJNA 5LGNB 1HR0T 4ILBA 4MBQA 5KXJA 2MAWA 1OEDE 5CB4E 3RPUA 1CUNA 3SS1A 3P50A 1OWAA 2W00A 3AXJA 4ILCA 4B3TT 3DJBA 2IHR1 5HEGA 3ZSSA 3BQIA 3L09A 4UF0A 3MXZA 4JUYA 2CXDA 1BR2A 2W2UA 3AEDA 2UUBT 5HXRA 4YJ2E 2V1DB 4OX9T 2VK9A 4GIWA 4H9PC 5FY0A 4YT0A 2LSIA 2BKNA 1NAFA 1SA0E 5JR9A 3UUXB 4EAHA 4KP3C 2IW5B 4FI5A 4DR7T 4LFBT 1AJ3A 3ZT6A 1MNDA 4ZI7E 2KSRA 4QXHB 1ZV4X 1ZP0A 4ISTA 3ZN1B 1MMGA 4O2AE 4X1YE 5L2LA 2PFVA 3CX6B 3P8CD 3MKDA 4A5XA 5CJ5A 3UQ4A 4OHFA 3AE1A 2XQ6A 1WR6A 4L5GA 4P1NA 4NXNT 2BVMA 2V5DA 5LJMA 2E9XC 4DVDA 5M4YA 4AQFA 2LSJA 2M6BA 3AE2A 3TLVA 4HGAA 5EK2A 3QC9A 4DV2T 2UU9T 3NBXX 3AE8A 4AQFC 2WCAA 4TWHA 2DL1A 2JMKA 5JDMA 1E2AA 4L9IA 3AE7A 4LFCT 1YD8G 2KLQA 5FY1A 3ZMZB 5C2TA 1IBLT 1V9DA 4HWHA 2D2SA 1HTJF 1GQEA 3AAEB 5J0ZA 3AEGA 3CWZB 2D0UA 3OVUA 4BJMA 4WBNE 4F8HA 4ZI2D 3A7MA 3BQLA 2BVLA 2CM0A 3MK7C 5AQOB 2MTQA 2LRKA 4PFOA 4DR1T 3EAMA 3QB5K 2KWHA 4MHCA 4WNKA 5HEJA 4B3MT 2CRBA 3C51A 2ES0A 2CPTA 1W0BA 4JEUB 4HTEA 4O4IE 4X5TA 4Z90A 4U72A 5AQLB 1HG5A 4DBQA 1LKXA 2CWOA 4LMKA 4DMVA 3AE9A 3EABA 4HFCA 2W63A 4JI8T 2CLYB 4I50E 3AEEA 2OV9A 1X79A 5L3FB 2AE9A 1FIOA 3LDQB 1VOMA 3HKDE 1MMAA 1E7PA 2D0TA 2L3LA 5AQMB 2UXXB 3JCFA 5E0OA 3OPCA 2V7MA 2XQ4A 2ZM2A 4LF5T 4JI5T 3ABVA 3ZLIA 4C90A 4O4HE 2LE8A 5JDQA 2XSBA 3CX7B 3ETUA 4A97A 2WWVA 4KHPT 4UEMA 3RQWA 2LSKA 3AXJB 3U78A 3I0QA 3KVBA 5LHIB 5KDMC 1W9RA 2H7VC 2X66A 1ZOYA 1HG2A 2B1EA 3ONJA 4B6XA 5ABHA 2WU5A 2YKSA 4I0UA 3R84B 3NZPA 3A8YC 3Q5DA 3ZN0B 2N2NA 3P4SA 4H63V 2WQYA 5HWXA 2W67A 3TLSA 2LHRA 4DR6T 3PUSA 4O2BE 5F3JA 1YQ3A 5HCMA 1SE7A 5AQQB 5ADXL 2VKHA 3ONXA 3UFGA 2X9YA 3N9LA 1X9BA 3K3QC 4DR4T 4P09A 2V26A 3JC6C 2NR4A 2V7IA 4U3CA 4PJMA 1FMVA 2VWAA 1ZEEA 4U7IA 1M7KA 2CBJA 1HNXT 4HE8A 4IDOA 1WR0A 1SUMB 3ZC0A 2EHOB 3MACA 1XNQT 3FZMB 1XNRT 1NWMX 3OTOT 3RRWA 4DUYT 4JBWF 2XQYA 4WW0A 5BR8T 2G0UA 2WDVA 1W0AA 1HNZT 2ACXA 2YOEA 3QOFA 4X62T 2P9BA 2XAFB 4GYSA 4X66T 3VKHA 5LXTE 4ZHQE 1W09A 1DU2A 3KFWX 2H89A 2XTLA 3L8RA 3HKBE 1OEDB 5ETWA 3RLFF 5HYAA 5H6RB 4GYRA 4WYVA 4EGWA 1Y64B 1QUUA 1HCIA 5AQTB 1FMWA 2E5VA 2NW8A 4IE4A 2M6IA 2NW9A 2WM9A 5LB7B 1YW0A 2YU1A 4CZZB 3PUWF 4HFIA 2OA5A 4DV5T 4A98A 3C50A 2NOXA 3F2EA 5LG4A 2IIUA 3V5UA 3H3MA 1FEWA 2IC6A 3NRYA 5FY7A 5JDFA 3RKGA 3RRCA 5LMNT 2W62A 2BG9A 1OEDC 2J1DG 2JQQA 3Q5XA 3ZMVB 3TLWA 4DBRA 4NIQA 4GKKT 2XSAA 4TWFA 4U31A 3ANWA 2W0GA 4AI6A 1MMDA 4EZHA 2ZLYA 3AEAA 3GWHA 2WDQA 4MALA 2IDOB 4PJJA 3ZCIA 5LNKA 2WMOA 1US7B 2WSSV 3AECA 3K3OA 1UURA 1Z8UA 1B7TA 1IJ5A 2XQ7A 4O8SA 5AQSB 3RYHE 4Z8XA 5LCYA 4PK6A 5HXHA 4QXBB 2R6GF 4TV8E 4NUUA 2VKDA 5FXZA 5L3CB 4HFVA 4HKAA 4HFEA 4LMJA 3RC8A 4YTMA 4QH5A 2W66A 1WLXA 4X1KE 3ZYMA 1N36T 2CXLA 3PUYF 3R6NA 2LSYA 4ZXLA 2Z6EA 3EUHA 3UU8A 3VHLA 4JLEA 3ZJ2A 4HWFA 2V5CA 2X0YA 2XAHB 3N9MA 2X51A 3A5XA 3P4RA 3HKEE 4ILUA 4PJLA 4CQIA 4EB6E 4EXTA 2WS3A 2ZM0A 3RYIE 5C3JA 1UGOA 3Q9DA 4I55E 4TV9E 5JR9C 3HR0A 1HS7A 5FP3A 2CMRA 1HX8A 3RX6A 4ZZCA 3Q5WA 2Y8DA 3B57A 3UU3A 2LSGA 3KV6A 2H88A 4G63A 4IHJE 3E22E 3RQUA 5L3DB 2X0LB 1KEYA 4U74A 5L3BB 2J47A 2XUEA
chains in the Genus database with same CATH topology
1LVFA 4CXYA 5JQGE 5LA6E 3VKGA 3OKQA 3ZMTB 3KV4A 4KMCA 5HXSA 3PUGA 4AKLA 4TUYE 4J2CA 2SPCA 5LBMA 2V7JA 2NP9A 4QX7B 3AA7B 3I0OA 3QK6A 3P7IA 4QHOA 2BDEA 3K3NA 5EK3A 3ZYKA 3K8PC 3OJAA 3CQGB 3PUAA 4UVAB 5C8YE 2LEHA 3GN5A 2EHOD 1VRBA 2CCQA 3FHNA 2Q9QC 3N2KE 3KBTA 3UUNA 4CI3B 4ERRA 2CWYA 2V7KA 5DJQC 1UCUA 4ZI2C 5JDNA 4UXNB 2YINA 4IE7A 3UUMA 2WMNA 3PDYA 4QXCB 2ODUA 2VKJA 3IBPA 2X9WA 4EYYR 4IE0A 1SHZC 2X68A 4H9OC 4YLHA 3ZCJA 2E9XD 1MIYA 2I59A 2KXPB 5BMVE 2QGSA 4QKNA 3S4UA 3FB2A 3PUQA 4ZOLE 2VL8A 4ISSA 1Z0PA 1D1CA 4OFZA 2DLRA 1YKHB 4DO0A 5LHHB 4PAGA 4OK0A 5L3EB 3CQXC 3LFMA 3BK9A 2PG8A 3HI2A 3U3IA 4ADZA 4ASKA 3DP7A 3CKDA 4IE5A 2EHOC 3EDUA 2D5UA 5HWYA 5LJNA 4YJ3E 4CI1B 3MJXA 3E0ZA 4X1IE 2C5KT 3GN5B 3ZJ1A 5CA0E 4H9QC 5CA1E 4TX5A 4QWNB 3O9XA 3HA4A 3CPZA 2YEVC 2UXNB 2JMHA 3J9X1 4X20E 3SOLA 5LP6E 5HXEA 2HPJA 2K24A 5J2TE 3N2OA 2RA1A 5TAOA 1D1AA 2WAUA 3KINB 2N1GA 4AKRB 2LHNA 1S94A 3CQCB 5DQWA 4ZI3D 1MIVA 2DWKA 3N5LA 2KT9A 2V7LA 3LBXA 4E7ZA 3H37A 3MZKB 2C5JA 2DWGA 4C91A 3AA1B 2MOZA 4P0BA 3NRXA 2PBIA 3N9OA 3C4XA 3H3AA 4HEAA 3N9NA 2N9DA 3N9PA 4PFPA 3RKOA 1H7CA 2CXFA 2M67A 3LK3B 5JDGA 3KDSE 5AFUL 2NWBA 5LXTE 5JRCA 4NUVA 2X67A 3HKCE 5KX5E 2HPLA 3B13A 1MIWA 2VB6A 4DMWA 3KBUA 1T98A 4CXXA 1E1HB 3AA6B 1HFAA 3LK2B 2NTYA 4F6RC 2E9XB 4UIGA 2KWIB 2KNDA 3WAJA 4ZS3A 5KMGP 4GK0E 3UULA 4XZCA 2CE7A 4BA9A 3NZQA 4IDZA 2XAGB 3ANWB 2E8IA 2K9AA 1IAPA 2RP4A 4IIJE 4A56A 5LGTB 4O4LE 1KK7A 4I4TE 4WBOA 2GK9A 2Y6XA 2DNXA 3MA9A 3WI3A 3AAIA 4OYKA 4K0UA 5FXVA 4EOZB 4BJNA 1ZKEA 2L8KA 2W61A 3C4WA 3ESLA 3CVRA 4ANJA 1G73A 3F31A 3FXEB 4BAYB 2WBLA 3ZMUB 2KINB 2Q9QB 3N9QA 3RYFE 2XAJB 4AQGA 2CA5A 3JC6D 3PU8A 1BR0A 5FNVE 4EZ4A 3OYZA 2NTXA 1D0ZA 1MNEA 2CEAA 2X9HA 1D0XA 2YK0A 3O1IA 2KZ7B 3KV9A 3FXDB 5J2UE 3FBLA 1ZHCA 2A3DA 3I9WA 5FYMA 4UV8B 3IF8B 1YKEB 3LK42 3WAKA 3PURA 3L3PA 4TN7B 4AKGA 2LJLA 3RYCE 5JRCB 5DABA 4AKIA 5JDLA 3EVYA 2C5IT 2XASB 4XAXB 2LOPA 3UT5E 1EZ3A 2LT3A 2ZM8A 3M65A 1IZNB 3LJCA 1QSDA 2H3RA 3RH3A 1OXZA 4QX8B 4OYJA 3C4ZA 4UF0B 2E9XA 4GK5E 3SWHA 2BZBA 2LOSA 2JJ9A 3ETVA 3AAAB 2IAKA 3Q2MA 2ZMAA 4KUMB 2XHEB 3E08A 4MLKA 2MYSA 4CI2B 1KNZA 3I9YA 3IEEA 1UX5A 5IHYA 3AA0B 4H9NC 4IGUA 2LM9A 3ZPOA 4UV9B 2Q9QA 5IYZE 3FBZA 1WYBA 5FXWA 5JR9B 5LGUB 4P0AA 1G8XA 4AXPA 5JH7E 1LRZA 3HL6A 3LBXB 4AKHA 4FJOA 4E7SA 5JREA 4PK4A 4CXWA 5LOVE 4IE6A 3ZEFB 1HF8A 3GMIA 1U4QA 3UFEA 1S35A 2VKOA 3OBVE 4I43B 3C98B 5HAXA 3RC3A 3PE0A 4KBMB 3LG7A 4H9RC 4V1Av 3SRZA 2K5BB 3F57A 4GOUA 3DTOA 4UELA 2JRKA 4DNDA 2EHOA 4UVBB 3ZYLA 2Q9QD 5JVDE 3KV5A 3AVSA 1MMNA 2DI4A 4L0RA 5GONE 2A2FX 5HXCA 5J1GA 5FMNA 3T8OA 1D1BA 2QA7A 2YU2A 4H63H 3N2GE 4XBFB 2JPFA 3BQKA 3I1AA 4HN9A 4H9SE 2PJQA 4PNIA 1UX4A 1IJ6A 3PTRB 3V5SA 2VASA 5LYJE 4JEHB 1BR4A 4EYUA 1WYCA 2KMFA 1O3XA 2DHRA 2XAQB 4O4JE 2Y48B 3AVRA 3CMLA 4ZS2A 2NW7A 5LBQB 2CLYC 3QUJA 5JDHA 3ZMSB 4YFSA 3OYXA 1WRDA 3VU7H 5L3GB 2HH7A 4UVCB 4G2AA 5H6QB 3PU3A 4TZ4C 5LHGB 4MFRA 3TKLB 2C0SA 3O1HA 3O1JA 4ZI3C 4PW8A 1U5PA 3J7Yq 5FXXA 3ZC1A 2A72A 4YHJA 3D0TA 1LVKA 2L9QA 2DCFA 2ODVA 3UTKA 4EIWA 3CX8B 3O4XE 5F8PA 3C64A 5EZYE 1D0YA 2WWUA 2IC9A 3AB3B 4M1PA 4PK5A 5A1LA 2X9XA 2K48A 1BR1A 3EDVA 3IHRA 5DQVA 2MBGA 2H7OA 4N78D 3KVAA 3GA8A 3W15B 4PJNA 5LGNB 4MBQA 5CB4E 3RPUA 1CUNA 3SS1A 1OWAA 2W00A 3DJBA 3BQIA 3L09A 4UF0A 3MXZA 4JUYA 2CXDA 1BR2A 5HXRA 4YJ2E 2V1DB 2VK9A 4GIWA 4H9PC 5FY0A 2LSIA 1NAFA 1SA0E 5JR9A 3UUXB 4EAHA 4KP3C 2IW5B 4FI5A 1AJ3A 1MNDA 4ZI7E 4QXHB 1ZV4X 4ISTA 3ZN1B 5L2LA 1MMGA 4O2AE 4X1YE 2PFVA 3CX6B 3P8CD 3MKDA 4OHFA 4L5GA 1WR6A 2BVMA 5LJMA 2E9XC 4DVDA 5M4YA 4AQFA 2LSJA 5EK2A 4HGAA 3QC9A 3NBXX 4AQFC 2JMKA 5JDMA 4L9IA 1YD8G 2KLQA 5FY1A 3ZMZB 1V9DA 2D2SA 1HTJF 3AAEB 3CWZB 2D0UA 4BJMA 4WBNE 4ZI2D 3BQLA 2BVLA 2CM0A 3MK7C 2MTQA 4PFOA 2KWHA 4MHCA 4WNKA 3C51A 5EK4A 2ES0A 4O4IE 4JEUB 4HTEA 4DBQA 4U72A 1HG5A 1LKXA 2CWOA 4DMVA 2W63A 2CLYB 4I50E 1X79A 5L3FB 1FIOA 1VOMA 3HKDE 1MMAA 2D0TA 2L3LA 2UXXB 5E0OA 2V7MA 2ZM2A 4C90A 3ZLIA 4O4HE 2LE8A 5JDQA 3CX7B 3ETUA 4UEMA 2LSKA 3U78A 3I0QA 3KVBA 5LHIB 5KDMC 2H7VC 2X66A 1HG2A 2B1EA 4B6XA 3R84B 3NZPA 3ZN0B 2N2NA 4H63V 5HWXA 2LHRA 3PUSA 4O2BE 5F3JA 5ADXL 2VKHA 3ONXA 2X9YA 3N9LA 3K3QC 4P09A 2V26A 3JC6C 2V7IA 4PJMA 1FMVA 2VWAA 1ZEEA 4HE8A 3ZC0A 2EHOB 3MACA 1NWMX 3RRWA 2XQYA 4WW0A 2G0UA 2ACXA 2P9BA 2XAFB 4GYSA 3VKHA 4ZHQE 3KFWX 2XTLA 3HKBE 5ETWA 5HYAA 5H6RB 4GYRA 1Y64B 1QUUA 1HCIA 1FMWA 2NW8A 4IE4A 2NW9A 2WM9A 1YW0A 2YU1A 4CZZB 2OA5A 3C50A 2NOXA 3F2EA 5LG4A 3V5UA 1FEWA 2IC6A 3NRYA 5FY7A 5JDFA 3RRCA 2W62A 2JQQA 2J1DG 3Q5XA 3ZMVB 4DBRA 3ANWA 2W0GA 4AI6A 1MMDA 4EZHA 2ZLYA 3GWHA 4MALA 3ZCIA 4PJJA 5LNKA 2WMOA 1US7B 2WSSV 3K3OA 4O8SA 1B7TA 1IJ5A 3RYHE 4Z8XA 5LCYA 4PK6A 5HXHA 4QXBB 4TV8E 4NUUA 2VKDA 5FXZA 5L3CB 4HFVA 4HKAA 3RC8A 1WLXA 4X1KE 3ZYMA 2CXLA 3R6NA 2LSYA 2Z6EA 3EUHA 3VHLA 4JLEA 3ZJ2A 2XAHB 4ILUA 3N9MA 2X51A 3A5XA 4PJLA 3HKEE 4CQIA 4EB6E 4EXTA 2ZM0A 3RYIE 5JR9C 4I55E 3Q9DA 1HS7A 4TV9E 3HR0A 5FP3A 2CMRA 1HX8A 3RX6A 3Q5WA 2Y8DA 3B57A 2LSGA 3KV6A 4G63A 4IHJE 5L3DB 3E22E 5L3BB 2X0LB 4U74A 2XUEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LHR A; 
#chains in the Genus database with same CATH topology
 5AQV B;  1LVF A;  4CXY A;  1HNW T;  4IDP A;  1Y01 A;  2QRX A;  5LA6 E;  3TLT A;  5AQF B;  5AQN B;  3OKQ A;  3ZMT B;  5ABF B;  1I6Z A;  3VKG A;  3VU7 H;  3KV4 A;  2WZI A;  4KMC A;  5HXS A;  3PUG A;  3FZH B;  4AKL A;  4TUY E;  4J2C A;  2SPC A;  3RIU C;  5LBM A;  2V7J A;  2UXD T;  2NP9 A;  4QX7 B;  3AA7 B;  3I0O A;  3QK6 A;  4HWD A;  3P7I A;  4QHO A;  1WFD A;  2BDE A;  3K3N A;  5EK3 A;  2QYW A;  3ZYK A;  1T7S A;  3K8P C;  2K3W A;  3CQG B;  3OJA A;  3JAD A;  3PUA A;  2XJ7 A;  4UVA B;  4Z91 A;  4YTP A;  5C8Y E;  2LEH A;  3GN5 A;  2FUP A;  2EHO D;  1VRB A;  2CCQ A;  3FHN A;  2OLT A;  2Q9Q C;  3N2K E;  3KBT A;  3UUN A;  2XM1 A;  4CI3 B;  2CWY A;  4ERR A;  2XPK A;  4QH1 A;  2V7K A;  5DJQ C;  1UCU A;  4ZI2 C;  5JDN A;  2UUC T;  1T8B A;  4UXN B;  2LLY A;  2YIN A;  3AEB A;  3FZL B;  4IE7 A;  4JI2 T;  4LF8 T;  3UUM A;  2WMN A;  3PDY A;  4QXC B;  2ODU A;  2VKJ A;  3UU4 A;  3IBP A;  4NXM T;  3RC3 A;  2X9W A;  4EYY R;  2JQK A;  2BKO A;  1XDP A;  1J5W A;  4IE0 A;  1JNR A;  4JV5 T;  1SHZ C;  2X68 A;  4H9O C;  2PTF A;  4YLH A;  5L47 A;  3ZCJ A;  2E9X D;  3FZK B;  1MIY A;  2I59 A;  2KXP B;  2XQ9 A;  5BMV E;  2QGS A;  4QKN A;  2LKG A;  3S4U A;  3FB2 A;  4LF6 T;  3Q5E A;  3PUQ A;  2FJD A;  4ZOL E;  2VL8 A;  4ISS A;  4CN6 A;  2BS3 A;  1Z0P A;  4COF A;  4JYA T;  3RI5 A;  1D1C A;  1UUS A;  4OFZ A;  2DLR A;  1YKH B;  2W4X A;  4DO0 A;  5LHH B;  4PAG A;  4OK0 A;  5L3E B;  3CQX C;  3LFM A;  3BK9 A;  2PG8 A;  4JI6 T;  3HI2 A;  3U3I A;  4ADZ A;  2BS4 A;  3ZT7 A;  4ASK A;  3DP7 A;  1N33 T;  3CKD A;  4IE5 A;  2EHO C;  3EDU A;  2D5U A;  5AQG B;  5HWY A;  1N34 T;  1VCT A;  4YJ3 E;  4HFH A;  3TLU A;  5LJN A;  5LMU T;  1KF6 A;  4CI1 B;  3MJX A;  1NEK A;  1XDO A;  3E0Z A;  4X1I E;  2C5K T;  3GN5 B;  3ZJ1 A;  1OED A;  5FL0 A;  4YY3 T;  1J1J A;  5CA0 E;  4DV3 T;  3NVO A;  3QB5 A;  4H9Q C;  5CA1 E;  1XMQ T;  2HHH T;  4TX5 A;  4QWN B;  3O9X A;  2WU2 A;  3HA4 A;  2XQ8 A;  3CPZ A;  4KHZ F;  2JQH A;  1WCR A;  4GKJ T;  2YEV C;  4IRE A;  2UXN B;  2JMH A;  2FJE A;  4Q25 A;  3J9X 1;  5ABE A;  4X20 E;  3SOL A;  5LP6 E;  5HXE A;  2HPJ A;  2K24 A;  5J2T E;  3N2O A;  2RA1 A;  5TAO A;  2XZE A;  4LF9 T;  1D1A A;  2FJB A;  2WAU A;  2N1G A;  3EI0 A;  2LHN A;  3KIN B;  3P4Q A;  1S94 A;  3CQC B;  5DQW A;  4QH4 A;  4AKR B;  4ZI3 D;  5HEU A;  4DV6 T;  4DID B;  2V8S V;  3X1D A;  1MIV A;  2DWK A;  2CHO A;  3N5L A;  2V6Y B;  4YTN A;  4AIS A;  2KT9 A;  5AQP B;  2YN6 A;  2BS2 A;  2V7L A;  1CHU A;  2VL0 A;  3LBX A;  1J5E T;  4ZZB A;  4E7Z A;  2CHN A;  3H37 A;  3MZK B;  2C5J A;  2DWG A;  3AE6 A;  4KI0 F;  4C91 A;  3AA1 B;  1T72 A;  5AQI B;  2MOZ A;  4P0B A;  3NRX A;  2PBI A;  3N9O A;  3C4X A;  3H3A A;  4HEA A;  2WP9 A;  4DV0 T;  3N9N A;  2N9D A;  3N9P A;  4PFP A;  1YXR A;  3RKO A;  1H7C A;  2CXF A;  2M67 A;  3LK3 B;  5JDG A;  3KDS E;  2I0M A;  2NWB A;  3L39 A;  4TNV A;  3PUX F;  5AFU L;  5JRC A;  4NUV A;  2AXD S;  3PJA A;  4DV7 T;  2X67 A;  3HKC E;  5KX5 E;  5L4E A;  2HPL A;  3B13 A;  2FJA A;  4LF7 T;  1MIW A;  2VB6 A;  4DMW A;  2VUR A;  2IUB A;  3KBU A;  1T98 A;  5L4H A;  4CXX A;  1E1H B;  4UR9 A;  3AE4 A;  4U7Y A;  3AA6 B;  1HFA A;  3LK2 B;  2NTY A;  4F6R C;  1JNZ A;  2E9X B;  4UIG A;  2KWI B;  2WB5 A;  2LM2 A;  4IL9 A;  2KND A;  3WAJ A;  4IL4 A;  4ZS3 A;  5KMG P;  1QLB A;  3PV0 F;  4GK0 E;  3UUL A;  4XZC A;  2CE7 A;  3RGL A;  3ZKR A;  4BA9 A;  3NZQ A;  2B76 A;  4LF4 T;  4IDZ A;  2XAG B;  3ANW B;  4TWD A;  2E8I A;  2K9A A;  1IAP A;  2RP4 A;  2XM2 A;  4IIJ E;  4A56 A;  3ZT5 A;  2BKP A;  3VRB A;  5LGT B;  4O4L E;  1KK7 A;  4I4T E;  4WBO A;  2GK9 A;  2Y6X A;  2DNX A;  3MA9 A;  3WI3 A;  1N32 T;  1HX1 B;  3AAI A;  4YHH T;  1R8I A;  3QNU A;  4OYK A;  4K0U A;  5FXV A;  4EOZ B;  4BJN A;  1ZKE A;  2L8K A;  2W61 A;  3C4W A;  3ESL A;  3CVR A;  4ANJ A;  1G73 A;  3F31 A;  3FXE B;  4BAY B;  4X64 T;  4X65 T;  2WBL A;  3ZMU B;  2KIN B;  3UU5 A;  2Q9Q B;  3N9Q A;  3RYF E;  3UUB A;  2XAJ B;  4WZX A;  4AQG A;  2CA5 A;  3JC6 D;  3PU8 A;  1BR0 A;  5FNV E;  4EED A;  1XWM A;  4EZ4 A;  2WDR A;  2E5L T;  3OYZ A;  2NTX A;  4IDQ A;  4TNW A;  1D0Z A;  1MNE A;  2CEA A;  2X9H A;  1D0X A;  2YK0 A;  2UUA T;  4DV1 T;  3O1I A;  2ZM6 T;  5LG3 A;  2KZ7 B;  3KV9 A;  5F5W A;  3FXD B;  5J2U E;  3FBL A;  1ZHC A;  2A3D A;  2XQ3 A;  3I9W A;  5EK4 A;  2XY8 B;  1KNP A;  4UV8 B;  5FYM A;  1I94 T;  5FVK A;  3IF8 B;  1YKE B;  3LK4 2;  2WY2 A;  3WAK A;  5AQH B;  5FVL A;  4LFA T;  5HEH A;  3PUR A;  2BG9 E;  3L3P A;  3PUZ F;  1UK5 A;  4TN7 B;  1IBK T;  5AQJ B;  4AKG A;  2LJL A;  3RF1 A;  3RYC E;  3VR8 A;  5JRC B;  5DAB A;  4AKI A;  5JDL A;  3EVY A;  2C5I T;  2XAS B;  1FJG T;  4XAX B;  4EV6 A;  3JAF A;  2LOP A;  5JQG E;  3SFE A;  5IUX A;  3UT5 E;  1EZ3 A;  2JIW A;  3IA3 A;  4IT4 A;  2LT3 A;  2ZM8 A;  2BG9 C;  3M65 A;  1IZN B;  3LJC A;  1QSD A;  2H3R A;  2CBI A;  1OXZ A;  3AE5 A;  4QX8 B;  4OYJ A;  3RH3 A;  3C4Z A;  3G06 A;  5ABF A;  5FL1 A;  4B3S T;  2VVN A;  4UF0 B;  2E9X A;  4GK5 E;  3SWH A;  2BZB A;  2HN1 A;  2X0H A;  3RIU A;  4AIU A;  4JI0 T;  2LOS A;  2JJ9 A;  2BG9 B;  3ETV A;  3AAA B;  2IAK A;  3Q2M A;  2ZMA A;  4KUM B;  2XHE B;  3E08 A;  1VCS A;  4MLK A;  2MYS A;  4CI2 B;  1KNZ A;  2UXC T;  3P4W A;  3I9Y A;  3IEE A;  1UX5 A;  5IHY A;  2HN2 A;  3AA0 B;  4H9N C;  3PJA J;  4IGU A;  1L0V A;  2LM9 A;  3ZPO A;  3ZST A;  4UV9 B;  2Q9Q A;  5IYZ E;  3FBZ A;  1YQ4 A;  3FZF B;  1WYB A;  5FXW A;  2J62 A;  5JR9 B;  4HWC A;  2XQA A;  5LGU B;  4P0A A;  1G8X A;  4AXP A;  5JH7 E;  1LRZ A;  3HL6 A;  3LBX B;  3UU6 A;  4AKH A;  4FJO A;  4DR5 T;  4E7S A;  5JRE A;  4PK4 A;  4CXW A;  5LOV E;  1KFY A;  2F4V T;  4LML A;  4IE6 A;  3ZEF B;  2YDR A;  1HF8 A;  3GMI A;  4CN1 A;  1U4Q A;  4K0K T;  4DR3 T;  3UFE A;  1S35 A;  2VKO A;  3OBV E;  4I43 B;  2D9D A;  3C98 B;  5HAX A;  3PE0 A;  2E2A A;  2LRL A;  2WZH A;  4KBM B;  3LG7 A;  4DR2 T;  4KX6 A;  4H9R C;  2YDS A;  2VQF T;  4V1A v;  2IML A;  3CIR A;  3RHW A;  3SRZ A;  4EEB A;  4HWI B;  3VRA A;  2K5B B;  3F57 A;  4GOU A;  2UXB T;  3DTO A;  4UEL A;  2JRK A;  5HEO A;  4DND A;  3NKZ A;  1XMO T;  2EHO A;  5AQR B;  4UVB B;  3CK6 A;  3ZYL A;  2Q9Q D;  5JVD E;  3KV5 A;  3AVS A;  1MMN A;  2DI4 A;  4L0R A;  3AE3 A;  2A2F X;  5GON E;  5HXC A;  5J1G A;  5FMN A;  4YXD A;  3T8O A;  4ZEY A;  1D1B A;  2QA7 A;  4JI1 T;  2YU2 A;  4H63 H;  4JI3 T;  4DV4 T;  3N2G E;  1XZY A;  2ACZ A;  4XBF B;  2JPF A;  4U33 A;  3BQK A;  3I1A A;  4HN9 A;  4H9S E;  4U2Z A;  3RIA A;  4CN4 A;  5AQU B;  5L3G B;  2PJQ A;  5CFB A;  4PNI A;  1UX4 A;  3LSV A;  1IJ6 A;  2XQ5 A;  3PTR B;  2VAS A;  3V5S A;  1KNR A;  4YSY A;  5LYJ E;  2J4G A;  2FBW A;  2V6Y A;  3NWI A;  4JEH B;  1BR4 A;  4NPP A;  2JQ9 A;  4EYU A;  1WYC A;  2KMF A;  1O3X A;  5HCJ A;  2DHR A;  2XAQ B;  4O4J E;  4JI4 T;  3EHZ A;  4U2Y A;  2Y48 B;  3AVR A;  3CML A;  4ZS2 A;  2NW7 A;  5LBQ B;  5CGM A;  5IWA T;  4HFB A;  2CLY C;  3QUJ A;  5JDH A;  2MPK A;  3ZMS B;  4YFS A;  3RIF A;  2V6X A;  2YDQ A;  3ONL C;  3OYX A;  3AEF A;  1WRD A;  5AQK B;  2BBJ A;  2HH7 A;  2QVA A;  4UVC B;  4G2A A;  1M62 A;  3PU3 A;  4IDN A;  4TZ4 C;  2LKH A;  4ILA A;  5H6Q B;  5LHG B;  2RPA A;  4MFR A;  5FKY A;  3TKL B;  4YSZ A;  2C0S A;  2VVS A;  4JI7 T;  5JTG A;  3O1H A;  3JAE A;  3O1J A;  4ZI3 C;  5ABG A;  1IBM T;  4PW8 A;  1U5P A;  3M3Z B;  3J7Y q;  5FXX A;  3ZC1 A;  2A72 A;  3PUV F;  4YHJ A;  1NEN A;  3B5M A;  2A9U A;  3D0T A;  1LVK A;  2I6H A;  2DCF A;  2L9Q A;  2ODV A;  3UTK A;  3CX8 B;  3P4P A;  4EIW A;  4DUZ T;  3O4X E;  4AQY T;  3T1Y T;  3VR9 A;  5F8P A;  3C64 A;  4YSX A;  5EZY E;  4B3R T;  1D0Y A;  2WWU A;  2VQE T;  2IC9 A;  3AB3 B;  4M1P A;  4PK5 A;  3UQ7 A;  5A1L A;  2X9X A;  2K48 A;  1BR1 A;  3EDV A;  3IHR A;  3K1S A;  5DQV A;  2MBG A;  4HFD A;  3T1H T;  2H7O A;  4N78 D;  3SFD A;  3KVA A;  3GA8 A;  2BBH A;  3W15 B;  4PJN A;  5LGN B;  1HR0 T;  4ILB A;  4MBQ A;  5KXJ A;  2MAW A;  1OED E;  5CB4 E;  3RPU A;  1CUN A;  3SS1 A;  3P50 A;  1OWA A;  2W00 A;  3AXJ A;  4ILC A;  4B3T T;  3DJB A;  2IHR 1;  5HEG A;  3ZSS A;  3BQI A;  3L09 A;  4UF0 A;  3MXZ A;  4JUY A;  2CXD A;  1BR2 A;  2W2U A;  3AED A;  2UUB T;  5HXR A;  4YJ2 E;  2V1D B;  4OX9 T;  2VK9 A;  4GIW A;  4H9P C;  5FY0 A;  4YT0 A;  2LSI A;  2BKN A;  1NAF A;  1SA0 E;  5JR9 A;  3UUX B;  4EAH A;  4KP3 C;  2IW5 B;  4FI5 A;  4DR7 T;  4LFB T;  1AJ3 A;  3ZT6 A;  1MND A;  4ZI7 E;  2KSR A;  4QXH B;  1ZV4 X;  1ZP0 A;  4IST A;  3ZN1 B;  1MMG A;  4O2A E;  4X1Y E;  5L2L A;  2PFV A;  3CX6 B;  3P8C D;  3MKD A;  4A5X A;  5CJ5 A;  3UQ4 A;  4OHF A;  3AE1 A;  2XQ6 A;  1WR6 A;  4L5G A;  4P1N A;  4NXN T;  2BVM A;  2V5D A;  5LJM A;  2E9X C;  4DVD A;  5M4Y A;  4AQF A;  2LSJ A;  2M6B A;  3AE2 A;  3TLV A;  4HGA A;  5EK2 A;  3QC9 A;  4DV2 T;  2UU9 T;  3NBX X;  3AE8 A;  4AQF C;  2WCA A;  4TWH A;  2DL1 A;  2JMK A;  5JDM A;  1E2A A;  4L9I A;  3AE7 A;  4LFC T;  1YD8 G;  2KLQ A;  5FY1 A;  3ZMZ B;  5C2T A;  1IBL T;  1V9D A;  4HWH A;  2D2S A;  1HTJ F;  1GQE A;  3AAE B;  5J0Z A;  3AEG A;  3CWZ B;  2D0U A;  3OVU A;  4BJM A;  4WBN E;  4F8H A;  4ZI2 D;  3A7M A;  3BQL A;  2BVL A;  2CM0 A;  3MK7 C;  5AQO B;  2MTQ A;  2LRK A;  4PFO A;  4DR1 T;  3EAM A;  3QB5 K;  2KWH A;  4MHC A;  4WNK A;  5HEJ A;  4B3M T;  2CRB A;  3C51 A;  2ES0 A;  2CPT A;  1W0B A;  4JEU B;  4HTE A;  4O4I E;  4X5T A;  4Z90 A;  4U72 A;  5AQL B;  1HG5 A;  4DBQ A;  1LKX A;  2CWO A;  4LMK A;  4DMV A;  3AE9 A;  3EAB A;  4HFC A;  2W63 A;  4JI8 T;  2CLY B;  4I50 E;  3AEE A;  2OV9 A;  1X79 A;  5L3F B;  2AE9 A;  1FIO A;  3LDQ B;  1VOM A;  3HKD E;  1MMA A;  1E7P A;  2D0T A;  2L3L A;  5AQM B;  2UXX B;  3JCF A;  5E0O A;  3OPC A;  2V7M A;  2XQ4 A;  2ZM2 A;  4LF5 T;  4JI5 T;  3ABV A;  3ZLI A;  4C90 A;  4O4H E;  2LE8 A;  5JDQ A;  2XSB A;  3CX7 B;  3ETU A;  4A97 A;  2WWV A;  4KHP T;  4UEM A;  3RQW A;  2LSK A;  3AXJ B;  3U78 A;  3I0Q A;  3KVB A;  5LHI B;  5KDM C;  1W9R A;  2H7V C;  2X66 A;  1ZOY A;  1HG2 A;  2B1E A;  3ONJ A;  4B6X A;  5ABH A;  2WU5 A;  2YKS A;  4I0U A;  3R84 B;  3NZP A;  3A8Y C;  3Q5D A;  3ZN0 B;  2N2N A;  3P4S A;  4H63 V;  2WQY A;  5HWX A;  2W67 A;  3TLS A;  2LHR A;  4DR6 T;  3PUS A;  4O2B E;  5F3J A;  1YQ3 A;  5HCM A;  1SE7 A;  5AQQ B;  5ADX L;  2VKH A;  3ONX A;  3UFG A;  2X9Y A;  3N9L A;  1X9B A;  3K3Q C;  4DR4 T;  4P09 A;  2V26 A;  3JC6 C;  2NR4 A;  2V7I A;  4U3C A;  4PJM A;  1FMV A;  2VWA A;  1ZEE A;  4U7I A;  1M7K A;  2CBJ A;  1HNX T;  4HE8 A;  4IDO A;  1WR0 A;  1SUM B;  3ZC0 A;  2EHO B;  3MAC A;  1XNQ T;  3FZM B;  1XNR T;  1NWM X;  3OTO T;  3RRW A;  4DUY T;  4JBW F;  2XQY A;  4WW0 A;  5BR8 T;  2G0U A;  2WDV A;  1W0A A;  1HNZ T;  2ACX A;  2YOE A;  3QOF A;  4X62 T;  2P9B A;  2XAF B;  4GYS A;  4X66 T;  3VKH A;  5LXT E;  4ZHQ E;  1W09 A;  1DU2 A;  3KFW X;  2H89 A;  2XTL A;  3L8R A;  3HKB E;  1OED B;  5ETW A;  3RLF F;  5HYA A;  5H6R B;  4GYR A;  4WYV A;  4EGW A;  1Y64 B;  1QUU A;  1HCI A;  5AQT B;  1FMW A;  2E5V A;  2NW8 A;  4IE4 A;  2M6I A;  2NW9 A;  2WM9 A;  5LB7 B;  1YW0 A;  2YU1 A;  4CZZ B;  3PUW F;  4HFI A;  2OA5 A;  4DV5 T;  4A98 A;  3C50 A;  2NOX A;  3F2E A;  5LG4 A;  2IIU A;  3V5U A;  3H3M A;  1FEW A;  2IC6 A;  3NRY A;  5FY7 A;  5JDF A;  3RKG A;  3RRC A;  5LMN T;  2W62 A;  2BG9 A;  1OED C;  2J1D G;  2JQQ A;  3Q5X A;  3ZMV B;  3TLW A;  4DBR A;  4NIQ A;  4GKK T;  2XSA A;  4TWF A;  4U31 A;  3ANW A;  2W0G A;  4AI6 A;  1MMD A;  4EZH A;  2ZLY A;  3AEA A;  3GWH A;  2WDQ A;  4MAL A;  2IDO B;  4PJJ A;  3ZCI A;  5LNK A;  2WMO A;  1US7 B;  2WSS V;  3AEC A;  3K3O A;  1UUR A;  1Z8U A;  1B7T A;  1IJ5 A;  2XQ7 A;  4O8S A;  5AQS B;  3RYH E;  4Z8X A;  5LCY A;  4PK6 A;  5HXH A;  4QXB B;  2R6G F;  4TV8 E;  4NUU A;  2VKD A;  5FXZ A;  5L3C B;  4HFV A;  4HKA A;  4HFE A;  4LMJ A;  3RC8 A;  4YTM A;  4QH5 A;  2W66 A;  1WLX A;  4X1K E;  3ZYM A;  1N36 T;  2CXL A;  3PUY F;  3R6N A;  2LSY A;  4ZXL A;  2Z6E A;  3EUH A;  3UU8 A;  3VHL A;  4JLE A;  3ZJ2 A;  4HWF A;  2V5C A;  2X0Y A;  2XAH B;  3N9M A;  2X51 A;  3A5X A;  3P4R A;  3HKE E;  4ILU A;  4PJL A;  4CQI A;  4EB6 E;  4EXT A;  2WS3 A;  2ZM0 A;  3RYI E;  5C3J A;  1UGO A;  3Q9D A;  4I55 E;  4TV9 E;  5JR9 C;  3HR0 A;  1HS7 A;  5FP3 A;  2CMR A;  1HX8 A;  3RX6 A;  4ZZC A;  3Q5W A;  2Y8D A;  3B57 A;  3UU3 A;  2LSG A;  3KV6 A;  2H88 A;  4G63 A;  4IHJ E;  3E22 E;  3RQU A;  5L3D B;  2X0L B;  1KEY A;  4U74 A;  5L3B B;  2J47 A;  2XUE A; 
#chains in the Genus database with same CATH homology
 1LVF A;  4CXY A;  5JQG E;  5LA6 E;  3VKG A;  3OKQ A;  3ZMT B;  3KV4 A;  4KMC A;  5HXS A;  3PUG A;  4AKL A;  4TUY E;  4J2C A;  2SPC A;  5LBM A;  2V7J A;  2NP9 A;  4QX7 B;  3AA7 B;  3I0O A;  3QK6 A;  3P7I A;  4QHO A;  2BDE A;  3K3N A;  5EK3 A;  3ZYK A;  3K8P C;  3OJA A;  3CQG B;  3PUA A;  4UVA B;  5C8Y E;  2LEH A;  3GN5 A;  2EHO D;  1VRB A;  2CCQ A;  3FHN A;  2Q9Q C;  3N2K E;  3KBT A;  3UUN A;  4CI3 B;  4ERR A;  2CWY A;  2V7K A;  5DJQ C;  1UCU A;  4ZI2 C;  5JDN A;  4UXN B;  2YIN A;  4IE7 A;  3UUM A;  2WMN A;  3PDY A;  4QXC B;  2ODU A;  2VKJ A;  3IBP A;  2X9W A;  4EYY R;  4IE0 A;  1SHZ C;  2X68 A;  4H9O C;  4YLH A;  3ZCJ A;  2E9X D;  1MIY A;  2I59 A;  2KXP B;  5BMV E;  2QGS A;  4QKN A;  3S4U A;  3FB2 A;  3PUQ A;  4ZOL E;  2VL8 A;  4ISS A;  1Z0P A;  1D1C A;  4OFZ A;  2DLR A;  1YKH B;  4DO0 A;  5LHH B;  4PAG A;  4OK0 A;  5L3E B;  3CQX C;  3LFM A;  3BK9 A;  2PG8 A;  3HI2 A;  3U3I A;  4ADZ A;  4ASK A;  3DP7 A;  3CKD A;  4IE5 A;  2EHO C;  3EDU A;  2D5U A;  5HWY A;  5LJN A;  4YJ3 E;  4CI1 B;  3MJX A;  3E0Z A;  4X1I E;  2C5K T;  3GN5 B;  3ZJ1 A;  5CA0 E;  4H9Q C;  5CA1 E;  4TX5 A;  4QWN B;  3O9X A;  3HA4 A;  3CPZ A;  2YEV C;  2UXN B;  2JMH A;  3J9X 1;  4X20 E;  3SOL A;  5LP6 E;  5HXE A;  2HPJ A;  2K24 A;  5J2T E;  3N2O A;  2RA1 A;  5TAO A;  1D1A A;  2WAU A;  3KIN B;  2N1G A;  4AKR B;  2LHN A;  1S94 A;  3CQC B;  5DQW A;  4ZI3 D;  1MIV A;  2DWK A;  3N5L A;  2KT9 A;  2V7L A;  3LBX A;  4E7Z A;  3H37 A;  3MZK B;  2C5J A;  2DWG A;  4C91 A;  3AA1 B;  2MOZ A;  4P0B A;  3NRX A;  2PBI A;  3N9O A;  3C4X A;  3H3A A;  4HEA A;  3N9N A;  2N9D A;  3N9P A;  4PFP A;  3RKO A;  1H7C A;  2CXF A;  2M67 A;  3LK3 B;  5JDG A;  3KDS E;  5AFU L;  2NWB A;  5LXT E;  5JRC A;  4NUV A;  2X67 A;  3HKC E;  5KX5 E;  2HPL A;  3B13 A;  1MIW A;  2VB6 A;  4DMW A;  3KBU A;  1T98 A;  4CXX A;  1E1H B;  3AA6 B;  1HFA A;  3LK2 B;  2NTY A;  4F6R C;  2E9X B;  4UIG A;  2KWI B;  2KND A;  3WAJ A;  4ZS3 A;  5KMG P;  4GK0 E;  3UUL A;  4XZC A;  2CE7 A;  4BA9 A;  3NZQ A;  4IDZ A;  2XAG B;  3ANW B;  2E8I A;  2K9A A;  1IAP A;  2RP4 A;  4IIJ E;  4A56 A;  5LGT B;  4O4L E;  1KK7 A;  4I4T E;  4WBO A;  2GK9 A;  2Y6X A;  2DNX A;  3MA9 A;  3WI3 A;  3AAI A;  4OYK A;  4K0U A;  5FXV A;  4EOZ B;  4BJN A;  1ZKE A;  2L8K A;  2W61 A;  3C4W A;  3ESL A;  3CVR A;  4ANJ A;  1G73 A;  3F31 A;  3FXE B;  4BAY B;  2WBL A;  3ZMU B;  2KIN B;  2Q9Q B;  3N9Q A;  3RYF E;  2XAJ B;  4AQG A;  2CA5 A;  3JC6 D;  3PU8 A;  1BR0 A;  5FNV E;  4EZ4 A;  3OYZ A;  2NTX A;  1D0Z A;  1MNE A;  2CEA A;  2X9H A;  1D0X A;  2YK0 A;  3O1I A;  2KZ7 B;  3KV9 A;  3FXD B;  5J2U E;  3FBL A;  1ZHC A;  2A3D A;  3I9W A;  5FYM A;  4UV8 B;  3IF8 B;  1YKE B;  3LK4 2;  3WAK A;  3PUR A;  3L3P A;  4TN7 B;  4AKG A;  2LJL A;  3RYC E;  5JRC B;  5DAB A;  4AKI A;  5JDL A;  3EVY A;  2C5I T;  2XAS B;  4XAX B;  2LOP A;  3UT5 E;  1EZ3 A;  2LT3 A;  2ZM8 A;  3M65 A;  1IZN B;  3LJC A;  1QSD A;  2H3R A;  3RH3 A;  1OXZ A;  4QX8 B;  4OYJ A;  3C4Z A;  4UF0 B;  2E9X A;  4GK5 E;  3SWH A;  2BZB A;  2LOS A;  2JJ9 A;  3ETV A;  3AAA B;  2IAK A;  3Q2M A;  2ZMA A;  4KUM B;  2XHE B;  3E08 A;  4MLK A;  2MYS A;  4CI2 B;  1KNZ A;  3I9Y A;  3IEE A;  1UX5 A;  5IHY A;  3AA0 B;  4H9N C;  4IGU A;  2LM9 A;  3ZPO A;  4UV9 B;  2Q9Q A;  5IYZ E;  3FBZ A;  1WYB A;  5FXW A;  5JR9 B;  5LGU B;  4P0A A;  1G8X A;  4AXP A;  5JH7 E;  1LRZ A;  3HL6 A;  3LBX B;  4AKH A;  4FJO A;  4E7S A;  5JRE A;  4PK4 A;  4CXW A;  5LOV E;  4IE6 A;  3ZEF B;  1HF8 A;  3GMI A;  1U4Q A;  3UFE A;  1S35 A;  2VKO A;  3OBV E;  4I43 B;  3C98 B;  5HAX A;  3RC3 A;  3PE0 A;  4KBM B;  3LG7 A;  4H9R C;  4V1A v;  3SRZ A;  2K5B B;  3F57 A;  4GOU A;  3DTO A;  4UEL A;  2JRK A;  4DND A;  2EHO A;  4UVB B;  3ZYL A;  2Q9Q D;  5JVD E;  3KV5 A;  3AVS A;  1MMN A;  2DI4 A;  4L0R A;  5GON E;  2A2F X;  5HXC A;  5J1G A;  5FMN A;  3T8O A;  1D1B A;  2QA7 A;  2YU2 A;  4H63 H;  3N2G E;  4XBF B;  2JPF A;  3BQK A;  3I1A A;  4HN9 A;  4H9S E;  2PJQ A;  4PNI A;  1UX4 A;  1IJ6 A;  3PTR B;  3V5S A;  2VAS A;  5LYJ E;  4JEH B;  1BR4 A;  4EYU A;  1WYC A;  2KMF A;  1O3X A;  2DHR A;  2XAQ B;  4O4J E;  2Y48 B;  3AVR A;  3CML A;  4ZS2 A;  2NW7 A;  5LBQ B;  2CLY C;  3QUJ A;  5JDH A;  3ZMS B;  4YFS A;  3OYX A;  1WRD A;  3VU7 H;  5L3G B;  2HH7 A;  4UVC B;  4G2A A;  5H6Q B;  3PU3 A;  4TZ4 C;  5LHG B;  4MFR A;  3TKL B;  2C0S A;  3O1H A;  3O1J A;  4ZI3 C;  4PW8 A;  1U5P A;  3J7Y q;  5FXX A;  3ZC1 A;  2A72 A;  4YHJ A;  3D0T A;  1LVK A;  2L9Q A;  2DCF A;  2ODV A;  3UTK A;  4EIW A;  3CX8 B;  3O4X E;  5F8P A;  3C64 A;  5EZY E;  1D0Y A;  2WWU A;  2IC9 A;  3AB3 B;  4M1P A;  4PK5 A;  5A1L A;  2X9X A;  2K48 A;  1BR1 A;  3EDV A;  3IHR A;  5DQV A;  2MBG A;  2H7O A;  4N78 D;  3KVA A;  3GA8 A;  3W15 B;  4PJN A;  5LGN B;  4MBQ A;  5CB4 E;  3RPU A;  1CUN A;  3SS1 A;  1OWA A;  2W00 A;  3DJB A;  3BQI A;  3L09 A;  4UF0 A;  3MXZ A;  4JUY A;  2CXD A;  1BR2 A;  5HXR A;  4YJ2 E;  2V1D B;  2VK9 A;  4GIW A;  4H9P C;  5FY0 A;  2LSI A;  1NAF A;  1SA0 E;  5JR9 A;  3UUX B;  4EAH A;  4KP3 C;  2IW5 B;  4FI5 A;  1AJ3 A;  1MND A;  4ZI7 E;  4QXH B;  1ZV4 X;  4IST A;  3ZN1 B;  5L2L A;  1MMG A;  4O2A E;  4X1Y E;  2PFV A;  3CX6 B;  3P8C D;  3MKD A;  4OHF A;  4L5G A;  1WR6 A;  2BVM A;  5LJM A;  2E9X C;  4DVD A;  5M4Y A;  4AQF A;  2LSJ A;  5EK2 A;  4HGA A;  3QC9 A;  3NBX X;  4AQF C;  2JMK A;  5JDM A;  4L9I A;  1YD8 G;  2KLQ A;  5FY1 A;  3ZMZ B;  1V9D A;  2D2S A;  1HTJ F;  3AAE B;  3CWZ B;  2D0U A;  4BJM A;  4WBN E;  4ZI2 D;  3BQL A;  2BVL A;  2CM0 A;  3MK7 C;  2MTQ A;  4PFO A;  2KWH A;  4MHC A;  4WNK A;  3C51 A;  5EK4 A;  2ES0 A;  4O4I E;  4JEU B;  4HTE A;  4DBQ A;  4U72 A;  1HG5 A;  1LKX A;  2CWO A;  4DMV A;  2W63 A;  2CLY B;  4I50 E;  1X79 A;  5L3F B;  1FIO A;  1VOM A;  3HKD E;  1MMA A;  2D0T A;  2L3L A;  2UXX B;  5E0O A;  2V7M A;  2ZM2 A;  4C90 A;  3ZLI A;  4O4H E;  2LE8 A;  5JDQ A;  3CX7 B;  3ETU A;  4UEM A;  2LSK A;  3U78 A;  3I0Q A;  3KVB A;  5LHI B;  5KDM C;  2H7V C;  2X66 A;  1HG2 A;  2B1E A;  4B6X A;  3R84 B;  3NZP A;  3ZN0 B;  2N2N A;  4H63 V;  5HWX A;  2LHR A;  3PUS A;  4O2B E;  5F3J A;  5ADX L;  2VKH A;  3ONX A;  2X9Y A;  3N9L A;  3K3Q C;  4P09 A;  2V26 A;  3JC6 C;  2V7I A;  4PJM A;  1FMV A;  2VWA A;  1ZEE A;  4HE8 A;  3ZC0 A;  2EHO B;  3MAC A;  1NWM X;  3RRW A;  2XQY A;  4WW0 A;  2G0U A;  2ACX A;  2P9B A;  2XAF B;  4GYS A;  3VKH A;  4ZHQ E;  3KFW X;  2XTL A;  3HKB E;  5ETW A;  5HYA A;  5H6R B;  4GYR A;  1Y64 B;  1QUU A;  1HCI A;  1FMW A;  2NW8 A;  4IE4 A;  2NW9 A;  2WM9 A;  1YW0 A;  2YU1 A;  4CZZ B;  2OA5 A;  3C50 A;  2NOX A;  3F2E A;  5LG4 A;  3V5U A;  1FEW A;  2IC6 A;  3NRY A;  5FY7 A;  5JDF A;  3RRC A;  2W62 A;  2JQQ A;  2J1D G;  3Q5X A;  3ZMV B;  4DBR A;  3ANW A;  2W0G A;  4AI6 A;  1MMD A;  4EZH A;  2ZLY A;  3GWH A;  4MAL A;  3ZCI A;  4PJJ A;  5LNK A;  2WMO A;  1US7 B;  2WSS V;  3K3O A;  4O8S A;  1B7T A;  1IJ5 A;  3RYH E;  4Z8X A;  5LCY A;  4PK6 A;  5HXH A;  4QXB B;  4TV8 E;  4NUU A;  2VKD A;  5FXZ A;  5L3C B;  4HFV A;  4HKA A;  3RC8 A;  1WLX A;  4X1K E;  3ZYM A;  2CXL A;  3R6N A;  2LSY A;  2Z6E A;  3EUH A;  3VHL A;  4JLE A;  3ZJ2 A;  2XAH B;  4ILU A;  3N9M A;  2X51 A;  3A5X A;  4PJL A;  3HKE E;  4CQI A;  4EB6 E;  4EXT A;  2ZM0 A;  3RYI E;  5JR9 C;  4I55 E;  3Q9D A;  1HS7 A;  4TV9 E;  3HR0 A;  5FP3 A;  2CMR A;  1HX8 A;  3RX6 A;  3Q5W A;  2Y8D A;  3B57 A;  2LSG A;  3KV6 A;  4G63 A;  4IHJ E;  5L3D B;  3E22 E;  5L3B B;  2X0L B;  4U74 A;  2XUE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...