2LHRA

Solution structure of staphylococcus aureus isdh linker domain
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
78
structure length
78
Chain Sequence
SDDYVDEETYNLQKLLAPYHKAKTLERQVYELEKLQEKLPEKYKAEYKKKLDQTRVELADQVKSAVTEFENVTPTNDQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Iron-regulated surface determinant protein H
publication title Staphylococcus aureus Uses a Novel Multidomain Receptor to Break Apart Human Hemoglobin and Steal Its Heme.
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Metal transport
total genus 21
structure length 78
sequence length 78
ec nomenclature
pdb deposition date 2011-08-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1270 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2lhrA00
2LHRA
chains in the Genus database with same CATH superfamily
4DV1T 3PUVF 3PURA 3FZKB 2JQKA 3FHNA 3LDQB 3AE2A 4WZXA 4CQIA 4JI1T 3JAFA 4H9SE 3ZJ1A 3N5LA 4A98A 3E08A 1WR0A 1KNPA 2X51A 1AJ3A 5HEOA 2FJEA 4YTPA 2A2FX 4IHJE 2A72A 4NIQA 1HCIA 3PUQA 3RIUC 5L3EB 3UUNA 1WYBA 4IE6A 3L3PA 2VKOA 1XWMA 1MNDA 1MIYA 3GN5A 3TLVA 4HFCA 4QH5A 2Q9QC 5DJQC 5DQVA 2W62A 4HFVA 1N33T 4DR6T 3JC6C 4HFIA 2BS4A 3ZC1A 4CXXA 1OEDE 3C51A 2LLYA 4IDQA 3UFGA 4XAXB 1VRBA 2WDQA 5JQGE 4B3TT 4GK0E 5LOVE 4OX9T 3KVAA 3CMLA 4U7YA 4QX7B 3AB3B 1WCRA 2V7KA 2BG9C 3FBLA 3UULA 5LNKA 2CHNA 4TV8E 3AEBA 1J1JA 2CBIA 1BR1A 2CLYC 4HFDA 2YDQA 4DO0A 4UXNB 4PJNA 4F8HA 4UV8B 5L2LA 2HN1A 2LT3A 1VOMA 4MFRA 3C50A 3UFEA 2CCQA 2B76A 4U74A 4GKJT 5LJMA 1O3XA 1ZEEA 3UT5E 4EZ4A 3V5UA 5JVDE 5AQPB 3CX6B 4OHFA 4WBOA 2LRLA 1WFDA 4YXDA 2D0UA 3MA9A 1CHUA 3ABVA 4QH4A 2CE7A 1SE7A 4HWHA 2Q9QB 4KX6A 2ACXA 2BKNA 2NW9A 4GOUA 1JNZA 1IJ5A 2C5JA 4JI7T 2E5VA 3KDSE 5F3JA 5HEGA 2FJBA 2JQ9A 4IGUA 2JRKA 3PUYF 2L8KA 5HCMA 3K1SA 3B57A 2DWKA 2X9XA 3IBPA 4A5XA 3KVBA 5KMGP 5J1GA 3P8CD 4DBRA 3O4XE 4Z8XA 3AEEA 2VQFT 2BG9B 4OFZA 4XZCA 2E9XD 2WMNA 2CLYB 5FVLA 2RPAA 4DBQA 3B13A 4P1NA 2XQ3A 2Y48B 4UR9A 5LG4A 3ZMTB 4TN7B 5L47A 4YFSA 2WWVA 1CUNA 5ABGA 5JDLA 2KWHA 4CZZB 1M7KA 4IIJE 2VKJA 3PJAA 4JV5T 2LKGA 3QNUA 2DHRA 3BQLA 3LG7A 5L3FB 3RQUA 3NVOA 5AQHB 4DV7T 4PJJA 5AQMB 3ZLIA 4ZI7E 2BKPA 2CMRA 1T7SA 4JUYA 4NXMT 2ZLYA 2HHHT 2JMKA 2YKSA 4JI2T 2XM1A 3I9YA 2V8SV 3RYIE 4UELA 4ZI3D 5KDMC 5L3DB 4ASKA 4AQFC 2W66A 5LGUB 5IHYA 4WBNE 2V7MA 1KK7A 1WR6A 2XPKA 4DR7T 3OTOT 2WB5A 3P50A 4IDNA 4CI1B 2I6HA 3GMIA 3AA0B 1G73A 3P4QA 4H9QC 3KV4A 5LHHB 5LHGB 1SHZC 3EVYA 3KV5A 3KBTA 2WM9A 4KBMB 2QRXA 3K3NA 2L9QA 2X9WA 1IBLT 1QSDA 2DNXA 2WBLA 3UU5A 1IAPA 4LF7T 1OEDC 2X0LB 4Z90A 4DV6T 3M3ZB 5FYMA 2J47A 4CN1A 4PFPA 2NOXA 2CXFA 5HEJA 3OKQA 1UUSA 2WU2A 4AQGA 3LJCA 3CVRA 3KBUA 3ETUA 2VURA 3AE3A 2E5LT 5AQFB 1ZOYA 3X1DA 2BKOA 3EUHA 2XAHB 2KSRA 3O1IA 5L3GB 3T1YT 2HPLA 4QH1A 3IA3A 3SS1A 4ISTA 3MZKB 4Z91A 3HL6A 4DV3T 4DV0T 4B6XA 3UTKA 4YSZA 3NBXX 5JDFA 3O1JA 3UUBA 3OJAA 2XHEB 3L39A 4AKRB 2XAGB 2CPTA 3LK42 4ANJA 3GWHA 1HNZT 3L09A 2CXLA 4U2YA 4LF5T 2XZEA 5C3JA 4TWDA 2FUPA 2WDRA 4A97A 3QK6A 3LBXB 1ZKEA 3NRXA 2LSJA 3PV0F 1VCTA 3IEEA 4IL9A 4KMCA 2D9DA 1US7B 4M1PA 4I43B 5FXXA 1OEDB 3LFMA 2UU9T 3I9WA 3Q5EA 2CM0A 2V6YA 1HR0T 1OWAA 2YK0A 3WAKA 4DR3T 5FY1A 4AQYT 5AQGB 4AIUA 4L9IA 3AXJA 3CX8B 3CWZB 3J7Yq 5A1LA 4YHHT 2WDVA 2FBWA 3K8PC 3PU8A 2J1DG 4EB6E 4YJ2E 3TKLB 5FMNA 1VCSA 2L3LA 3EAMA 2Z6EA 1T8BA 4TWFA 1LKXA 3RF1A 5C8YE 2AXDS 3PUGA 3ZN1B 3CPZA 2QYWA 1YKHB 5EK3A 2HN2A 1KF6A 3RI5A 3BQKA 2OV9A 3RIFA 3RPUA 4EEBA 5FY7A 3PDYA 2LRKA 5FL1A 4AKLA 5BMVE 5JDMA 5AQSB 4NXNT 5L3CB 3PE0A 3HKEE 2W63A 2J4GA 1V9DA 3V5SA 4BAYB 3EABA 4H9RC 4HE8A 2DCFA 1BR2A 5JRCB 2SPCA 5AQIB 4DR1T 3EDUA 3TLWA 1Y64B 2E9XC 3L8RA 1YQ3A 3VR8A 1BR4A 2YINA 3UU4A 3N9QA 1T72A 3RIAA 1J5WA 3CQGB 1D0ZA 4PK5A 4AXPA 2QA7A 4DV2T 4L0RA 5ABEA 3C64A 2WWUA 2D0TA 3F31A 2V5DA 5DQWA 2CA5A 3KINB 2VKHA 2NW7A 4GYSA 1ZHCA 1XZYA 2LOSA 3RHWA 2CHOA 2F4VT 2VKDA 2BDEA 2MOZA 5CJ5A 2V7IA 3HKCE 2E8IA 3VRBA 2MAWA 2MYSA 5LGNB 4ZI3C 4LMKA 2Y8DA 1ZP0A 2PTFA 5EZYE 2C5KT 1FJGT 2CEAA 3A8YC 3Q5WA 2EHOD 2H7OA 1MMAA 4WYVA 1UK5A 1XMOT 1YW0A 1KNRA 5KXJA 3ZN0B 2X0HA 1HX1B 4EEDA 5JR9C 2VASA 4ZZCA 4X1KE 2PJQA 4DVDA 2YDSA 4HKAA 3F2EA 2H89A 2JMHA 4H63H 4ZI2D 3E22E 2LSKA 1E2AA 4U72A 1KNZA 2ES0A 3BK9A 3HKBE 4U3CA 3NKZA 3SOLA 3O9XA 4ZS3A 3ZMZB 3FXEB 4KHZF 4LF9T 2XQ5A 4O4IE 3OBVE 2E9XB 1FEWA 3ONXA 5M4YA 2E2AA 2WY2A 4ILUA 2FJAA 1G8XA 5FXZA 5AQQB 5AQRB 3VR9A 5LHIB 4IE5A 2M6BA 2IW5B 4X66T 2XSBA 4X5TA 2X68A 5H6RB 3LSVA 5FP3A 4PJLA 3EI0A 3RIUA 3UU6A 1WRDA 5H6QB 4OYJA 2CWYA 4CXYA 4P0AA 3PUXF 5AQLB 1W9RA 3ZC0A 4AKGA 3R84B 3PUWF 4IDOA 3AE5A 4NUUA 1MIVA 4QKNA 3K3QC 3U78A 2J62A 1HG5A 2Q9QA 1XDPA 4H9OC 1D1CA 1I94T 4HEAA 3OYXA 1DU2A 2MBGA 4MLKA 2XQYA 2NW8A 1NENA 4YLHA 3FXDB 2YU1A 4U2ZA 2C0SA 3KV9A 3TLSA 4MHCA 2LKHA 3U3IA 4O4LE 5JR9B 3PJAJ 4LMLA 3MJXA 3JAEA 1WLXA 3I1AA 2KINB 3E0ZA 4TV9E 4O8SA 4XBFB 4HFHA 4FI5A 4QWNB 4TNWA 2VVNA 2BG9A 3VU7H 2P9BA 4CI2B 3DTOA 3NWIA 3H3MA 1WYCA 4YJ3E 1W0AA 5EK4A 4CN6A 1YQ4A 2V1DB 4AKHA 5J2UE 1W0BA 3KV6A 1UX4A 3PUAA 2JQHA 2PG8A 3TLTA 1HF8A 1M62A 3K3OA 4PK6A 2DL1A 4TUYE 5LA6E 3Q5DA 4F6RC 2JPFA 1NAFA 4IDZA 3QB5A 3OPCA 2IMLA 5ADXL 3RKGA 1UX5A 2YEVC 2OA5A 1FMVA 4PNIA 5IWAT 1KEYA 2HH7A 4L5GA 4IDPA 1MMNA 1N34T 3W15B 4PW8A 2H7VC 3ZKRA 1MNEA 3N9OA 3RC3A 4CXWA 4B3ST 2IC9A 1BR0A 5JDHA 3QB5K 3QUJA 3P4PA 1LVKA 3AEAA 4UF0B 5AQNB 1JNRA 2IIUA 4EOZB 3ZMVB 3AA1B 5L3BB 3CQXC 3UU3A 1HS7A 2LSGA 5FXVA 4C91A 1FMWA 2H88A 3ETVA 4X1YE 5J2TE 3AEGA 5LG3A 4EYYR 3RYCE 4DR2T 2VQET 2BS2A 5ETWA 2BBHA 2W00A 3AE7A 4IE4A 1HNXT 3FBZA 2K5BB 4K0KT 4I55E 3AE8A 3WI3A 2XM2A 2WZHA 3RH3A 4DUZT 3P7IA 1U5PA 4JBWF 4UIGA 5DABA 1UGOA 3N2OA 1XDOA 4E7SA 2IHR1 4P09A 4JI4T 1X9BA 3CX7B 4DMVA 1SA0E 3GA8A 4UVAB 4ZS2A 4GKKT 3QC9A 3ANWB 2RA1A 4YTNA 3AECA 1HTJF 4I50E 4YY3T 2N9DA 4DUYT 2EHOC 2KLQA 4K0UA 2VL0A 2W2UA 3ZT7A 5ABFB 3PU3A 2I0MA 4GYRA 3SFEA 4AQFA 3N9NA 2M67A 4BJMA 4ZI2C 3RLFF 4HWCA 4X1IE 1IJ6A 2KT9A 5IUXA 2W4XA 3AE6A 3A7MA 1Z8UA 2X0YA 5LYJE 3LBXA 3H3AA 1NEKA 5TAOA 2YOEA 2XQ6A 4P0BA 2WMOA 4NPPA 4YTMA 4CI3B 1OXZA 2X66A 1OEDA 4UVBB 3CK6A 4OYKA 4EYUA 4ZOLE 5JDQA 1IBMT 5HEHA 3T1HT 4HWDA 4J2CA 3PUZF 4GIWA 3ZCIA 5LBMA 2NP9A 2JJ9A 4WW0A 4X20E 2YDRA 3AA7B 2FJDA 1UURA 2WSSV 3MK7C 2ODVA 4EV6A 2UXBT 3SWHA 4WNKA 4BJNA 3VKHA 2K3WA 4NUVA 4YHJA 2ZMAA 1S35A 3Q5XA 3RRCA 3ZT6A 2DWGA 2LSIA 4QX8B 2UUBT 2XAFB 2M6IA 3RYFE 2C5IT 1H7CA 5CA0E 5LP6E 4HWIB 2KNDA 4KI0F 4E7ZA 4IE0A 3N9LA 3DP7A 2EHOB 2UXNB 4HGAA 4JEUB 5CA1E 4CN4A 4IL4A 4HTEA 5ABHA 5JH7E 4LFAT 2WP9A 2CWOA 5JTGA 2X67A 4KHPT 5CB4E 2NR4A 2BVMA 4U31A 5HCJA 5JRCA 2LE8A 4I4TE 3RKOA 3EHZA 3CQCB 3PTRB 4COFA 2ZM6T 1D1AA 4LF6T 3CIRA 1R8IA 4LFCT 1KFYA 2VK9A 3F57A 1YD8G 5AQTB 2XQ4A 1E1HB 2XASB 4JYAT 4N78D 3RYHE 4B3MT 4JI3T 2K9AA 3SRZA 3ZMSB 4U7IA 1FIOA 4X64T 2WAUA 2VB6A 2IDOB 5E0OA 3IHRA 3N2KE 3ESLA 3ZSTA 3ZCJA 5AQJB 4LMJA 1J5ET 2NTYA 4OK0A 2XQ8A 2D2SA 4HFBA 4HN9A 2IUBA 3FZMB 2XY8B 4KUMB 2K48A 1Z0PA 3GN5B 2LOPA 2G0UA 1X79A 4DR4T 3H37A 2K24A 1S94A 4FJOA 5AQVB 3UU8A 2LHNA 3ZPOA 4H63V 1T98A 2DI4A 4DMWA 5LB7B 5LJNA 3AVSA 3FZFB 4ILBA 2NWBA 5FL0A 1XMQT 4EZHA 3MXZA 4ADZA 1NWMX 5HYAA 2ZM2A 4PAGA 3JADA 1B7TA 2E9XA 5HXRA 5LMNT 2XAQB 2VL8A 5GONE 3ZEFB 2DLRA 3SFDA 3P4SA 3QOFA 2LM2A 2N2NA 1HG2A 3T8OA 2CXDA 2ODUA 4PK4A 4AKIA 5CFBA 2N1GA 5IYZE 3EDVA 3LK2B 2LJLA 3I0OA 3B5MA 2MTQA 3UQ7A 5HXHA 3NZPA 5KX5E 3UQ4A 3ONLC 3VRAA 3ZSSA 2HPJA 3VKGA 2QVAA 1Y01A 3O1HA 2IAKA 2LM9A 2XJ7A 5JR9A 4HFEA 2PFVA 3P4RA 3BQIA 2PBIA 5LBQB 3G06A 4ZEYA 4DNDA 3ZT5A 5FXWA 1SUMB 4DV5T 3N2GE 4G2AA 1LRZA 3DJBA 3AAAB 5HAXA 1GQEA 3LK3B 2A9UA 5LGTB 1IZNB 4ZHQE 3Q2MA 1L0VA 4EIWA 4JI5T 3ZJ2A 4QXHB 2XUEA 2W67A 4B3RT 2RP4A 1QUUA 5AQOB 2B1EA 1LVFA 4JLEA 5AQUB 3IF8B 5FKYA 2KXPB 4UEMA 5AFUL 3S4UA 5LXTE 4EGWA 2W61A 2BS3A 5AQKB 2X9HA 3CKDA 1YKEB 1UCUA 2NTXA 3ZYLA 3FZLB 3TLUA 3AE1A 4H9PC 5FNVE 1QLBA 3NRYA 4UF0A 2Q9QD 3AEDA 2UXCT 4IREA 3HA4A 3RRWA 4QXBB 3UUMA 1D1BA 3JC6D 2AE9A 1EZ3A 4UV9B 2JQQA 4UVCB 4TNVA 1W09A 4X62T 2WCAA 2OLTA 2XQAA 4PJMA 2WZIA 2A3DA 5C2TA 2V5CA 2VWAA 4JI8T 1I6ZA 4MBQA 3AVRA 2V7JA 3C4ZA 5EK2A 3JCFA 4QHOA 4X65T 4IE7A 2UXDT 4O2BE 4IT4A 4I0UA 2V6XA 2LEHA 3P4WA 2UXXB 3AA6B 2ZM8A 4ISSA 4QXCB 2IC6A 3AEFA 5HXCA 3FB2A 3RGLA 3M65A 3ANWA 4TWHA 3RX6A 4DIDB 5L4EA 2LSYA 4ILAA 3AAEB 2VVSA 2CBJA 5ABFA 4TX5A 2BZBA 2KMFA 4DV4T 3KFWX 2XQ9A 3RC8A 3ONJA 2WQYA 4O2AE 2ACZA 2I59A 4O4HE 2BG9E 3HI2A 5FVKA 1U4QA 3Q9DA 5HEUA 3MACA 2JIWA 3AE4A 3ZMUB 4JI6T 3D0TA 5HXEA 3C4WA 5JREA 5HXSA 2XSAA 4H9NC 2GK9A 2V26A 3ZYMA 4ZZBA 5F8PA 4LFBT 4ILCA 2X9YA 2QGSA 4HWFA 3R6NA 2BBJA 1MMDA 4LF4T 1HX8A 3WAJA 3OYZA 3HR0A 1E7PA 5L4HA 3ZYKA 4YT0A 1D0YA 3A5XA 4DR5T 5JDGA 1N32T 1D0XA 4AI6A 2ZM0A 4EAHA 4YSYA 2KWIB 5JDNA 3FZHB 5CGMA 4V1Av 4KP3C 3OVUA 2V6YB 3J9X1 1MMGA 4GK5E 2WS3A 4BA9A 2YN6A 3UUXB 3AXJB 2V7LA 2D5UA 4A56A 4AISA 2R6GF 4ERRA 5F5WA 3C4XA 2W0GA 4Q25A 2EHOA 3I0QA 2CRBA 5BR8T 4JEHB 3N9MA 2XTLA 5HWXA 1ZV4X 4YSXA 4TZ4C 2UUCT 2LHRA 4C90A 4ZXLA 1XNRT 5LCYA 2XQ7A 1N36T 3HKDE 1MIWA 2KZ7B 2XAJB 5J0ZA 5HWYA 1IBKT 4MALA 1HFAA 1XNQT 1HNWT 3RQWA 4O4JE 2MPKA 4PFOA 5LMUT 4U33A 2WU5A 3NZQA 3PUSA 3N9PA 3MKDA 2BVLA 2Y6XA 4JI0T 3AAIA 3AE9A 4LF8T 2UUAT 5FY0A 1YXRA 3C98B 4EXTA 2H3RA 4G63A 2YU2A 3VHLA
chains in the Genus database with same CATH topology
3EDVA 3PURA 4CXWA 3LK2B 3FHNA 2IC9A 2LJLA 1BR0A 5JDHA 3I0OA 3QUJA 3QK6A 2MTQA 4CQIA 4H9SE 1LVKA 3N5LA 3ZJ1A 3LBXB 5HXHA 1ZKEA 3NZPA 5KX5E 3E08A 3NRXA 4UF0B 2X51A 2LSJA 4EOZB 3ZMVB 1AJ3A 3AA1B 3IEEA 5L3BB 4KMCA 3CQXC 2HPJA 1HS7A 1US7B 2A2FX 4M1PA 3VKGA 4I43B 5FXXA 2LSGA 5FXVA 4IHJE 2A72A 3O1HA 3LFMA 3I9WA 1HCIA 2IAKA 2LM9A 3PUQA 4C91A 5L3EB 2CM0A 3UUNA 1FMWA 5JR9A 1OWAA 1WYBA 4IE6A 2YK0A 3WAKA 3L3PA 5FY1A 2VKOA 3ETVA 4X1YE 1MNDA 5J2TE 1MIYA 3GN5A 4L9IA 2PFVA 3CX8B 4EYYR 3CWZB 3RYCE 3J7Yq 5A1LA 5ETWA 2Q9QC 2W00A 3BQIA 5DJQC 2PBIA 3K8PC 5DQVA 5LBQB 3PU8A 2W62A 4IE4A 2J1DG 3FBZA 2K5BB 4HFVA 4EB6E 4YJ2E 3TKLB 5FMNA 4I55E 3JC6C 4DNDA 3ZC1A 5FXWA 2L3LA 4CXXA 2Z6EA 3C51A 3WI3A 3N2GE 3RH3A 1LKXA 4G2AA 1LRZA 3DJBA 5C8YE 3P7IA 1U5PA 3AAAB 4XAXB 3PUGA 5HAXA 3LK3B 5LGTB 4UIGA 3ZN1B 3CPZA 1IZNB 5DABA 3N2OA 4E7SA 1VRBA 1YKHB 5EK3A 4P09A 4ZHQE 3Q2MA 4EIWA 3BQKA 3CX7B 3ZJ2A 4DMVA 4QXHB 3RPUA 5JQGE 1SA0E 2XUEA 4GK0E 3GA8A 5LOVE 3KVAA 4UVAB 4ZS2A 3PDYA 5FY7A 3QC9A 3CMLA 3ANWB 2RA1A 2RP4A 1QUUA 4QX7B 2B1EA 3AB3B 1LVFA 4JLEA 4AKLA 2V7KA 5BMVE 3FBLA 3IF8B 3UULA 5JDMA 1HTJF 4I50E 5L3CB 2N9DA 5LNKA 2EHOC 4TV8E 2KLQA 3PE0A 4K0UA 2KXPB 1BR1A 3HKEE 2CLYC 2W63A 4UEMA 3PU3A 5AFUL 3S4UA 5LXTE 4GYRA 1V9DA 3V5SA 2W61A 4BAYB 4DO0A 4H9RC 4HE8A 4UXNB 4AQFA 3N9NA 2M67A 4PJNA 2DCFA 4BJMA 4ZI2C 1BR2A 2X9HA 2SPCA 5JRCB 3CKDA 4X1IE 3EDUA 1IJ6A 4UV8B 1Y64B 1YKEB 2KT9A 2E9XC 5L2LA 1UCUA 2NTXA 2LT3A 1VOMA 3ZYLA 4MFRA 3C50A 1BR4A 2YINA 3UFEA 5LYJE 4H9PC 5FNVE 3N9QA 2CCQA 4U74A 3LBXA 3NRYA 3H3AA 3CQGB 1D0ZA 1O3XA 1ZEEA 4UF0A 5TAOA 3UT5E 4PK5A 4EZ4A 5LJMA 3V5UA 2Q9QD 5JVDE 4AXPA 4P0BA 3CX6B 4OHFA 2QA7A 2WMOA 3HA4A 4WBOA 4CI3B 3RRWA 4QXBB 1OXZA 2D0UA 3MA9A 1D1BA 3JC6D 4L0RA 3UUMA 3C64A 2WWUA 2D0TA 2X66A 3F31A 1EZ3A 5DQWA 4UVBB 2CA5A 3KINB 4OYKA 4EYUA 4UV9B 2JQQA 4UVCB 2CE7A 2VKHA 2NW7A 2Q9QB 4GYSA 2ACXA 2NW9A 4ZOLE 5JDQA 4GOUA 1ZHCA 1IJ5A 2C5JA 2LOSA 4J2CA 4GIWA 3ZCIA 5LBMA 2VKDA 2BDEA 2NP9A 2JJ9A 2MOZA 4WW0A 4PJMA 4X20E 2A3DA 3AA7B 3KDSE 2V7IA 2WSSV 3MK7C 5F3JA 3HKCE 2E8IA 2VWAA 2ODVA 4MBQA 2MYSA 3AVRA 2V7JA 5LGNB 3SWHA 4WNKA 4BJNA 4ZI3C 2Y8DA 3VKHA 4NUVA 4IGUA 3C4ZA 2JRKA 5EK2A 2L8KA 4YHJA 2ZMAA 5EZYE 2C5KT 4QHOA 1S35A 2CEAA 4IE7A 3B57A 2DWKA 2X9XA 3Q5WA 3Q5XA 4O2BE 2EHOD 2H7OA 1MMAA 3RRCA 3IBPA 2DWGA 3KVBA 1YW0A 2LSIA 4QX8B 2LEHA 2XAFB 3ZN0B 3RYFE 5JR9C 2C5IT 1H7CA 5CA0E 2UXXB 2VASA 5J1GA 3AA6B 3P8CD 2PJQA 4X1KE 4DBRA 4DVDA 5KMGP 2KNDA 5LP6E 3O4XE 4Z8XA 2ZM8A 4ISSA 4HKAA 3F2EA 4QXCB 2IC6A 2JMHA 4H63H 4OFZA 4ZI2D 3E22E 4E7ZA 2LSKA 4IE0A 3N9LA 5HXCA 3DP7A 2EHOB 3FB2A 2UXNB 4XZCA 2E9XD 2WMNA 4U72A 2ES0A 3BK9A 3HKBE 4HGAA 4JEUB 2CLYB 1KNZA 3M65A 4DBQA 3ANWA 3B13A 5CA1E 3RX6A 3SOLA 3O9XA 4HTEA 2Y48B 4ZS3A 3ZMZB 5LG4A 3ZMTB 2LSYA 4TN7B 3FXEB 4YFSA 5JH7E 1CUNA 3AAEB 2CWOA 4O4IE 3OBVE 2X67A 5CB4E 5JDLA 2E9XB 2KWHA 4CZZB 1FEWA 2BVMA 4IIJE 4TX5A 2BZBA 2KMFA 3ONXA 5M4YA 2VKJA 3KFWX 4ILUA 3RC8A 1G8XA 5FXZA 4O2AE 2I59A 4O4HE 3HI2A 2DHRA 5JRCA 3BQLA 3LG7A 5LHIB 5L3FB 1U4QA 2LE8A 3Q9DA 3MACA 4I4TE 4IE5A 3RKOA 3CQCB 3PTRB 4PJJA 3ZMUB 2IW5B 3D0TA 3ZLIA 5HXEA 3C4WA 4ZI7E 2CMRA 5JREA 2X68A 5HXSA 5H6RB 4H9NC 1D1AA 2GK9A 4JUYA 5FP3A 2V26A 2ZLYA 3ZYMA 4PJLA 2VK9A 3F57A 1YD8G 1WRDA 2JMKA 4OYJA 5H6QB 1E1HB 2CWYA 4CXYA 4P0AA 3ZC0A 3I9YA 2XASB 4AKGA 5F8PA 4N78D 2X9YA 3RYHE 3RYIE 2QGSA 3R84B 3R6NA 2K9AA 3SRZA 4UELA 4ZI3D 3ZMSB 4NUUA 5KDMC 1MIVA 5L3DB 4QKNA 1FIOA 1MMDA 4ASKA 3K3QC 3U78A 4AQFC 5LGUB 2WAUA 1HX8A 5IHYA 3WAJA 1HG5A 2Q9QA 4WBNE 2V7MA 2VB6A 4H9OC 3OYZA 5E0OA 3HR0A 1D1CA 3IHRA 3ZYKA 3VHLA 3N2KE 1D0YA 1KK7A 3A5XA 1WR6A 4HEAA 3OYXA 5JDGA 3ESLA 2MBGA 1D0XA 4MLKA 4AI6A 2XQYA 2NW8A 3ZCJA 2ZM0A 4CI1B 3GMIA 4YLHA 3AA0B 4EAHA 3FXDB 1G73A 2KWIB 2YU1A 5JDNA 2C0SA 4H9QC 3KV4A 3KV9A 2NTYA 5LHHB 5LHGB 1SHZC 3EVYA 3KV5A 4MHCA 4OK0A 3KBTA 4KP3C 4V1Av 3U3IA 2D2SA 2WM9A 4HN9A 4KBMB 4O4LE 3J9X1 3K3NA 2L9QA 5JR9B 1MMGA 4GK5E 4KUMB 2K48A 2X9WA 4BA9A 1QSDA 2DNXA 2WBLA 1Z0PA 3UUXB 3MJXA 1IAPA 3GN5B 1WLXA 3I1AA 2KINB 2V7LA 2LOPA 2X0LB 2G0UA 3E0ZA 4TV9E 1X79A 2D5UA 5FYMA 3H37A 4A56A 2K24A 1S94A 4FJOA 2LHNA 4O8SA 4PFPA 3ZPOA 4XBFB 4H63V 2NOXA 4ERRA 2CXFA 3OKQA 4FI5A 1T98A 4QWNB 2DI4A 3C4XA 4AQGA 3LJCA 3CVRA 3VU7H 2W0GA 3KBUA 2EHOA 2P9BA 3ETUA 3I0QA 4CI2B 3DTOA 4JEHB 4DMWA 3N9MA 1WYCA 2XTLA 4YJ3E 5LJNA 5EK4A 5HWXA 2V1DB 3EUHA 1ZV4X 2XAHB 3AVSA 5J2UE 4AKHA 4TZ4C 2LHRA 2NWBA 3O1IA 4EZHA 5L3GB 3KV6A 4C90A 3MXZA 4ADZA 1NWMX 1UX4A 2HPLA 3PUAA 2PG8A 5HYAA 2ZM2A 1HF8A 3K3OA 4PK6A 5LCYA 4PAGA 3SS1A 4ISTA 1B7TA 2E9XA 3HKDE 1MIWA 2KZ7B 5HXRA 2XAJB 3MZKB 4TUYE 5LA6E 5HWYA 2XAQB 2VL8A 3HL6A 4F6RC 2JPFA 4MALA 1HFAA 1NAFA 5GONE 3ZEFB 4IDZA 4O4JE 4PFOA 2DLRA 4B6XA 3UTKA 5ADXL 3NZQA 1UX5A 2YEVC 2OA5A 1FMVA 2N2NA 3PUSA 4PNIA 1HG2A 3N9PA 3T8OA 3NBXX 3MKDA 5JDFA 2BVLA 2CXDA 3O1JA 2HH7A 2Y6XA 4L5GA 3AAIA 3OJAA 2ODUA 2XHEB 4AKRB 4PK4A 2XAGB 1MMNA 3LK42 4AKIA 3W15B 4ANJA 3GWHA 5FY0A 3C98B 4PW8A 2H7VC 1MNEA 4EXTA 2H3RA 3L09A 4G63A 3N9OA 3RC3A 2N1GA 2YU2A 5IYZE 2CXLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LHR A; 
#chains in the Genus database with same CATH topology
 4DV1 T;  3PUV F;  3PUR A;  3FZK B;  2JQK A;  3FHN A;  3LDQ B;  3AE2 A;  4WZX A;  4CQI A;  4JI1 T;  3JAF A;  4H9S E;  3ZJ1 A;  3N5L A;  4A98 A;  3E08 A;  1WR0 A;  1KNP A;  2X51 A;  1AJ3 A;  5HEO A;  2FJE A;  4YTP A;  2A2F X;  4IHJ E;  2A72 A;  4NIQ A;  1HCI A;  3PUQ A;  3RIU C;  5L3E B;  3UUN A;  1WYB A;  4IE6 A;  3L3P A;  2VKO A;  1XWM A;  1MND A;  1MIY A;  3GN5 A;  3TLV A;  4HFC A;  4QH5 A;  2Q9Q C;  5DJQ C;  5DQV A;  2W62 A;  4HFV A;  1N33 T;  4DR6 T;  3JC6 C;  4HFI A;  2BS4 A;  3ZC1 A;  4CXX A;  1OED E;  3C51 A;  2LLY A;  4IDQ A;  3UFG A;  4XAX B;  1VRB A;  2WDQ A;  5JQG E;  4B3T T;  4GK0 E;  5LOV E;  4OX9 T;  3KVA A;  3CML A;  4U7Y A;  4QX7 B;  3AB3 B;  1WCR A;  2V7K A;  2BG9 C;  3FBL A;  3UUL A;  5LNK A;  2CHN A;  4TV8 E;  3AEB A;  1J1J A;  2CBI A;  1BR1 A;  2CLY C;  4HFD A;  2YDQ A;  4DO0 A;  4UXN B;  4PJN A;  4F8H A;  4UV8 B;  5L2L A;  2HN1 A;  2LT3 A;  1VOM A;  4MFR A;  3C50 A;  3UFE A;  2CCQ A;  2B76 A;  4U74 A;  4GKJ T;  5LJM A;  1O3X A;  1ZEE A;  3UT5 E;  4EZ4 A;  3V5U A;  5JVD E;  5AQP B;  3CX6 B;  4OHF A;  4WBO A;  2LRL A;  1WFD A;  4YXD A;  2D0U A;  3MA9 A;  1CHU A;  3ABV A;  4QH4 A;  2CE7 A;  1SE7 A;  4HWH A;  2Q9Q B;  4KX6 A;  2ACX A;  2BKN A;  2NW9 A;  4GOU A;  1JNZ A;  1IJ5 A;  2C5J A;  4JI7 T;  2E5V A;  3KDS E;  5F3J A;  5HEG A;  2FJB A;  2JQ9 A;  4IGU A;  2JRK A;  3PUY F;  2L8K A;  5HCM A;  3K1S A;  3B57 A;  2DWK A;  2X9X A;  3IBP A;  4A5X A;  3KVB A;  5KMG P;  5J1G A;  3P8C D;  4DBR A;  3O4X E;  4Z8X A;  3AEE A;  2VQF T;  2BG9 B;  4OFZ A;  4XZC A;  2E9X D;  2WMN A;  2CLY B;  5FVL A;  2RPA A;  4DBQ A;  3B13 A;  4P1N A;  2XQ3 A;  2Y48 B;  4UR9 A;  5LG4 A;  3ZMT B;  4TN7 B;  5L47 A;  4YFS A;  2WWV A;  1CUN A;  5ABG A;  5JDL A;  2KWH A;  4CZZ B;  1M7K A;  4IIJ E;  2VKJ A;  3PJA A;  4JV5 T;  2LKG A;  3QNU A;  2DHR A;  3BQL A;  3LG7 A;  5L3F B;  3RQU A;  3NVO A;  5AQH B;  4DV7 T;  4PJJ A;  5AQM B;  3ZLI A;  4ZI7 E;  2BKP A;  2CMR A;  1T7S A;  4JUY A;  4NXM T;  2ZLY A;  2HHH T;  2JMK A;  2YKS A;  4JI2 T;  2XM1 A;  3I9Y A;  2V8S V;  3RYI E;  4UEL A;  4ZI3 D;  5KDM C;  5L3D B;  4ASK A;  4AQF C;  2W66 A;  5LGU B;  5IHY A;  4WBN E;  2V7M A;  1KK7 A;  1WR6 A;  2XPK A;  4DR7 T;  3OTO T;  2WB5 A;  3P50 A;  4IDN A;  4CI1 B;  2I6H A;  3GMI A;  3AA0 B;  1G73 A;  3P4Q A;  4H9Q C;  3KV4 A;  5LHH B;  5LHG B;  1SHZ C;  3EVY A;  3KV5 A;  3KBT A;  2WM9 A;  4KBM B;  2QRX A;  3K3N A;  2L9Q A;  2X9W A;  1IBL T;  1QSD A;  2DNX A;  2WBL A;  3UU5 A;  1IAP A;  4LF7 T;  1OED C;  2X0L B;  4Z90 A;  4DV6 T;  3M3Z B;  5FYM A;  2J47 A;  4CN1 A;  4PFP A;  2NOX A;  2CXF A;  5HEJ A;  3OKQ A;  1UUS A;  2WU2 A;  4AQG A;  3LJC A;  3CVR A;  3KBU A;  3ETU A;  2VUR A;  3AE3 A;  2E5L T;  5AQF B;  1ZOY A;  3X1D A;  2BKO A;  3EUH A;  2XAH B;  2KSR A;  3O1I A;  5L3G B;  3T1Y T;  2HPL A;  4QH1 A;  3IA3 A;  3SS1 A;  4IST A;  3MZK B;  4Z91 A;  3HL6 A;  4DV3 T;  4DV0 T;  4B6X A;  3UTK A;  4YSZ A;  3NBX X;  5JDF A;  3O1J A;  3UUB A;  3OJA A;  2XHE B;  3L39 A;  4AKR B;  2XAG B;  2CPT A;  3LK4 2;  4ANJ A;  3GWH A;  1HNZ T;  3L09 A;  2CXL A;  4U2Y A;  4LF5 T;  2XZE A;  5C3J A;  4TWD A;  2FUP A;  2WDR A;  4A97 A;  3QK6 A;  3LBX B;  1ZKE A;  3NRX A;  2LSJ A;  3PV0 F;  1VCT A;  3IEE A;  4IL9 A;  4KMC A;  2D9D A;  1US7 B;  4M1P A;  4I43 B;  5FXX A;  1OED B;  3LFM A;  2UU9 T;  3I9W A;  3Q5E A;  2CM0 A;  2V6Y A;  1HR0 T;  1OWA A;  2YK0 A;  3WAK A;  4DR3 T;  5FY1 A;  4AQY T;  5AQG B;  4AIU A;  4L9I A;  3AXJ A;  3CX8 B;  3CWZ B;  3J7Y q;  5A1L A;  4YHH T;  2WDV A;  2FBW A;  3K8P C;  3PU8 A;  2J1D G;  4EB6 E;  4YJ2 E;  3TKL B;  5FMN A;  1VCS A;  2L3L A;  3EAM A;  2Z6E A;  1T8B A;  4TWF A;  1LKX A;  3RF1 A;  5C8Y E;  2AXD S;  3PUG A;  3ZN1 B;  3CPZ A;  2QYW A;  1YKH B;  5EK3 A;  2HN2 A;  1KF6 A;  3RI5 A;  3BQK A;  2OV9 A;  3RIF A;  3RPU A;  4EEB A;  5FY7 A;  3PDY A;  2LRK A;  5FL1 A;  4AKL A;  5BMV E;  5JDM A;  5AQS B;  4NXN T;  5L3C B;  3PE0 A;  3HKE E;  2W63 A;  2J4G A;  1V9D A;  3V5S A;  4BAY B;  3EAB A;  4H9R C;  4HE8 A;  2DCF A;  1BR2 A;  5JRC B;  2SPC A;  5AQI B;  4DR1 T;  3EDU A;  3TLW A;  1Y64 B;  2E9X C;  3L8R A;  1YQ3 A;  3VR8 A;  1BR4 A;  2YIN A;  3UU4 A;  3N9Q A;  1T72 A;  3RIA A;  1J5W A;  3CQG B;  1D0Z A;  4PK5 A;  4AXP A;  2QA7 A;  4DV2 T;  4L0R A;  5ABE A;  3C64 A;  2WWU A;  2D0T A;  3F31 A;  2V5D A;  5DQW A;  2CA5 A;  3KIN B;  2VKH A;  2NW7 A;  4GYS A;  1ZHC A;  1XZY A;  2LOS A;  3RHW A;  2CHO A;  2F4V T;  2VKD A;  2BDE A;  2MOZ A;  5CJ5 A;  2V7I A;  3HKC E;  2E8I A;  3VRB A;  2MAW A;  2MYS A;  5LGN B;  4ZI3 C;  4LMK A;  2Y8D A;  1ZP0 A;  2PTF A;  5EZY E;  2C5K T;  1FJG T;  2CEA A;  3A8Y C;  3Q5W A;  2EHO D;  2H7O A;  1MMA A;  4WYV A;  1UK5 A;  1XMO T;  1YW0 A;  1KNR A;  5KXJ A;  3ZN0 B;  2X0H A;  1HX1 B;  4EED A;  5JR9 C;  2VAS A;  4ZZC A;  4X1K E;  2PJQ A;  4DVD A;  2YDS A;  4HKA A;  3F2E A;  2H89 A;  2JMH A;  4H63 H;  4ZI2 D;  3E22 E;  2LSK A;  1E2A A;  4U72 A;  1KNZ A;  2ES0 A;  3BK9 A;  3HKB E;  4U3C A;  3NKZ A;  3SOL A;  3O9X A;  4ZS3 A;  3ZMZ B;  3FXE B;  4KHZ F;  4LF9 T;  2XQ5 A;  4O4I E;  3OBV E;  2E9X B;  1FEW A;  3ONX A;  5M4Y A;  2E2A A;  2WY2 A;  4ILU A;  2FJA A;  1G8X A;  5FXZ A;  5AQQ B;  5AQR B;  3VR9 A;  5LHI B;  4IE5 A;  2M6B A;  2IW5 B;  4X66 T;  2XSB A;  4X5T A;  2X68 A;  5H6R B;  3LSV A;  5FP3 A;  4PJL A;  3EI0 A;  3RIU A;  3UU6 A;  1WRD A;  5H6Q B;  4OYJ A;  2CWY A;  4CXY A;  4P0A A;  3PUX F;  5AQL B;  1W9R A;  3ZC0 A;  4AKG A;  3R84 B;  3PUW F;  4IDO A;  3AE5 A;  4NUU A;  1MIV A;  4QKN A;  3K3Q C;  3U78 A;  2J62 A;  1HG5 A;  2Q9Q A;  1XDP A;  4H9O C;  1D1C A;  1I94 T;  4HEA A;  3OYX A;  1DU2 A;  2MBG A;  4MLK A;  2XQY A;  2NW8 A;  1NEN A;  4YLH A;  3FXD B;  2YU1 A;  4U2Z A;  2C0S A;  3KV9 A;  3TLS A;  4MHC A;  2LKH A;  3U3I A;  4O4L E;  5JR9 B;  3PJA J;  4LML A;  3MJX A;  3JAE A;  1WLX A;  3I1A A;  2KIN B;  3E0Z A;  4TV9 E;  4O8S A;  4XBF B;  4HFH A;  4FI5 A;  4QWN B;  4TNW A;  2VVN A;  2BG9 A;  3VU7 H;  2P9B A;  4CI2 B;  3DTO A;  3NWI A;  3H3M A;  1WYC A;  4YJ3 E;  1W0A A;  5EK4 A;  4CN6 A;  1YQ4 A;  2V1D B;  4AKH A;  5J2U E;  1W0B A;  3KV6 A;  1UX4 A;  3PUA A;  2JQH A;  2PG8 A;  3TLT A;  1HF8 A;  1M62 A;  3K3O A;  4PK6 A;  2DL1 A;  4TUY E;  5LA6 E;  3Q5D A;  4F6R C;  2JPF A;  1NAF A;  4IDZ A;  3QB5 A;  3OPC A;  2IML A;  5ADX L;  3RKG A;  1UX5 A;  2YEV C;  2OA5 A;  1FMV A;  4PNI A;  5IWA T;  1KEY A;  2HH7 A;  4L5G A;  4IDP A;  1MMN A;  1N34 T;  3W15 B;  4PW8 A;  2H7V C;  3ZKR A;  1MNE A;  3N9O A;  3RC3 A;  4CXW A;  4B3S T;  2IC9 A;  1BR0 A;  5JDH A;  3QB5 K;  3QUJ A;  3P4P A;  1LVK A;  3AEA A;  4UF0 B;  5AQN B;  1JNR A;  2IIU A;  4EOZ B;  3ZMV B;  3AA1 B;  5L3B B;  3CQX C;  3UU3 A;  1HS7 A;  2LSG A;  5FXV A;  4C91 A;  1FMW A;  2H88 A;  3ETV A;  4X1Y E;  5J2T E;  3AEG A;  5LG3 A;  4EYY R;  3RYC E;  4DR2 T;  2VQE T;  2BS2 A;  5ETW A;  2BBH A;  2W00 A;  3AE7 A;  4IE4 A;  1HNX T;  3FBZ A;  2K5B B;  4K0K T;  4I55 E;  3AE8 A;  3WI3 A;  2XM2 A;  2WZH A;  3RH3 A;  4DUZ T;  3P7I A;  1U5P A;  4JBW F;  4UIG A;  5DAB A;  1UGO A;  3N2O A;  1XDO A;  4E7S A;  2IHR 1;  4P09 A;  4JI4 T;  1X9B A;  3CX7 B;  4DMV A;  1SA0 E;  3GA8 A;  4UVA B;  4ZS2 A;  4GKK T;  3QC9 A;  3ANW B;  2RA1 A;  4YTN A;  3AEC A;  1HTJ F;  4I50 E;  4YY3 T;  2N9D A;  4DUY T;  2EHO C;  2KLQ A;  4K0U A;  2VL0 A;  2W2U A;  3ZT7 A;  5ABF B;  3PU3 A;  2I0M A;  4GYR A;  3SFE A;  4AQF A;  3N9N A;  2M67 A;  4BJM A;  4ZI2 C;  3RLF F;  4HWC A;  4X1I E;  1IJ6 A;  2KT9 A;  5IUX A;  2W4X A;  3AE6 A;  3A7M A;  1Z8U A;  2X0Y A;  5LYJ E;  3LBX A;  3H3A A;  1NEK A;  5TAO A;  2YOE A;  2XQ6 A;  4P0B A;  2WMO A;  4NPP A;  4YTM A;  4CI3 B;  1OXZ A;  2X66 A;  1OED A;  4UVB B;  3CK6 A;  4OYK A;  4EYU A;  4ZOL E;  5JDQ A;  1IBM T;  5HEH A;  3T1H T;  4HWD A;  4J2C A;  3PUZ F;  4GIW A;  3ZCI A;  5LBM A;  2NP9 A;  2JJ9 A;  4WW0 A;  4X20 E;  2YDR A;  3AA7 B;  2FJD A;  1UUR A;  2WSS V;  3MK7 C;  2ODV A;  4EV6 A;  2UXB T;  3SWH A;  4WNK A;  4BJN A;  3VKH A;  2K3W A;  4NUV A;  4YHJ A;  2ZMA A;  1S35 A;  3Q5X A;  3RRC A;  3ZT6 A;  2DWG A;  2LSI A;  4QX8 B;  2UUB T;  2XAF B;  2M6I A;  3RYF E;  2C5I T;  1H7C A;  5CA0 E;  5LP6 E;  4HWI B;  2KND A;  4KI0 F;  4E7Z A;  4IE0 A;  3N9L A;  3DP7 A;  2EHO B;  2UXN B;  4HGA A;  4JEU B;  5CA1 E;  4CN4 A;  4IL4 A;  4HTE A;  5ABH A;  5JH7 E;  4LFA T;  2WP9 A;  2CWO A;  5JTG A;  2X67 A;  4KHP T;  5CB4 E;  2NR4 A;  2BVM A;  4U31 A;  5HCJ A;  5JRC A;  2LE8 A;  4I4T E;  3RKO A;  3EHZ A;  3CQC B;  3PTR B;  4COF A;  2ZM6 T;  1D1A A;  4LF6 T;  3CIR A;  1R8I A;  4LFC T;  1KFY A;  2VK9 A;  3F57 A;  1YD8 G;  5AQT B;  2XQ4 A;  1E1H B;  2XAS B;  4JYA T;  4N78 D;  3RYH E;  4B3M T;  4JI3 T;  2K9A A;  3SRZ A;  3ZMS B;  4U7I A;  1FIO A;  4X64 T;  2WAU A;  2VB6 A;  2IDO B;  5E0O A;  3IHR A;  3N2K E;  3ESL A;  3ZST A;  3ZCJ A;  5AQJ B;  4LMJ A;  1J5E T;  2NTY A;  4OK0 A;  2XQ8 A;  2D2S A;  4HFB A;  4HN9 A;  2IUB A;  3FZM B;  2XY8 B;  4KUM B;  2K48 A;  1Z0P A;  3GN5 B;  2LOP A;  2G0U A;  1X79 A;  4DR4 T;  3H37 A;  2K24 A;  1S94 A;  4FJO A;  5AQV B;  3UU8 A;  2LHN A;  3ZPO A;  4H63 V;  1T98 A;  2DI4 A;  4DMW A;  5LB7 B;  5LJN A;  3AVS A;  3FZF B;  4ILB A;  2NWB A;  5FL0 A;  1XMQ T;  4EZH A;  3MXZ A;  4ADZ A;  1NWM X;  5HYA A;  2ZM2 A;  4PAG A;  3JAD A;  1B7T A;  2E9X A;  5HXR A;  5LMN T;  2XAQ B;  2VL8 A;  5GON E;  3ZEF B;  2DLR A;  3SFD A;  3P4S A;  3QOF A;  2LM2 A;  2N2N A;  1HG2 A;  3T8O A;  2CXD A;  2ODU A;  4PK4 A;  4AKI A;  5CFB A;  2N1G A;  5IYZ E;  3EDV A;  3LK2 B;  2LJL A;  3I0O A;  3B5M A;  2MTQ A;  3UQ7 A;  5HXH A;  3NZP A;  5KX5 E;  3UQ4 A;  3ONL C;  3VRA A;  3ZSS A;  2HPJ A;  3VKG A;  2QVA A;  1Y01 A;  3O1H A;  2IAK A;  2LM9 A;  2XJ7 A;  5JR9 A;  4HFE A;  2PFV A;  3P4R A;  3BQI A;  2PBI A;  5LBQ B;  3G06 A;  4ZEY A;  4DND A;  3ZT5 A;  5FXW A;  1SUM B;  4DV5 T;  3N2G E;  4G2A A;  1LRZ A;  3DJB A;  3AAA B;  5HAX A;  1GQE A;  3LK3 B;  2A9U A;  5LGT B;  1IZN B;  4ZHQ E;  3Q2M A;  1L0V A;  4EIW A;  4JI5 T;  3ZJ2 A;  4QXH B;  2XUE A;  2W67 A;  4B3R T;  2RP4 A;  1QUU A;  5AQO B;  2B1E A;  1LVF A;  4JLE A;  5AQU B;  3IF8 B;  5FKY A;  2KXP B;  4UEM A;  5AFU L;  3S4U A;  5LXT E;  4EGW A;  2W61 A;  2BS3 A;  5AQK B;  2X9H A;  3CKD A;  1YKE B;  1UCU A;  2NTX A;  3ZYL A;  3FZL B;  3TLU A;  3AE1 A;  4H9P C;  5FNV E;  1QLB A;  3NRY A;  4UF0 A;  2Q9Q D;  3AED A;  2UXC T;  4IRE A;  3HA4 A;  3RRW A;  4QXB B;  3UUM A;  1D1B A;  3JC6 D;  2AE9 A;  1EZ3 A;  4UV9 B;  2JQQ A;  4UVC B;  4TNV A;  1W09 A;  4X62 T;  2WCA A;  2OLT A;  2XQA A;  4PJM A;  2WZI A;  2A3D A;  5C2T A;  2V5C A;  2VWA A;  4JI8 T;  1I6Z A;  4MBQ A;  3AVR A;  2V7J A;  3C4Z A;  5EK2 A;  3JCF A;  4QHO A;  4X65 T;  4IE7 A;  2UXD T;  4O2B E;  4IT4 A;  4I0U A;  2V6X A;  2LEH A;  3P4W A;  2UXX B;  3AA6 B;  2ZM8 A;  4ISS A;  4QXC B;  2IC6 A;  3AEF A;  5HXC A;  3FB2 A;  3RGL A;  3M65 A;  3ANW A;  4TWH A;  3RX6 A;  4DID B;  5L4E A;  2LSY A;  4ILA A;  3AAE B;  2VVS A;  2CBJ A;  5ABF A;  4TX5 A;  2BZB A;  2KMF A;  4DV4 T;  3KFW X;  2XQ9 A;  3RC8 A;  3ONJ A;  2WQY A;  4O2A E;  2ACZ A;  2I59 A;  4O4H E;  2BG9 E;  3HI2 A;  5FVK A;  1U4Q A;  3Q9D A;  5HEU A;  3MAC A;  2JIW A;  3AE4 A;  3ZMU B;  4JI6 T;  3D0T A;  5HXE A;  3C4W A;  5JRE A;  5HXS A;  2XSA A;  4H9N C;  2GK9 A;  2V26 A;  3ZYM A;  4ZZB A;  5F8P A;  4LFB T;  4ILC A;  2X9Y A;  2QGS A;  4HWF A;  3R6N A;  2BBJ A;  1MMD A;  4LF4 T;  1HX8 A;  3WAJ A;  3OYZ A;  3HR0 A;  1E7P A;  5L4H A;  3ZYK A;  4YT0 A;  1D0Y A;  3A5X A;  4DR5 T;  5JDG A;  1N32 T;  1D0X A;  4AI6 A;  2ZM0 A;  4EAH A;  4YSY A;  2KWI B;  5JDN A;  3FZH B;  5CGM A;  4V1A v;  4KP3 C;  3OVU A;  2V6Y B;  3J9X 1;  1MMG A;  4GK5 E;  2WS3 A;  4BA9 A;  2YN6 A;  3UUX B;  3AXJ B;  2V7L A;  2D5U A;  4A56 A;  4AIS A;  2R6G F;  4ERR A;  5F5W A;  3C4X A;  2W0G A;  4Q25 A;  2EHO A;  3I0Q A;  2CRB A;  5BR8 T;  4JEH B;  3N9M A;  2XTL A;  5HWX A;  1ZV4 X;  4YSX A;  4TZ4 C;  2UUC T;  2LHR A;  4C90 A;  4ZXL A;  1XNR T;  5LCY A;  2XQ7 A;  1N36 T;  3HKD E;  1MIW A;  2KZ7 B;  2XAJ B;  5J0Z A;  5HWY A;  1IBK T;  4MAL A;  1HFA A;  1XNQ T;  1HNW T;  3RQW A;  4O4J E;  2MPK A;  4PFO A;  5LMU T;  4U33 A;  2WU5 A;  3NZQ A;  3PUS A;  3N9P A;  3MKD A;  2BVL A;  2Y6X A;  4JI0 T;  3AAI A;  3AE9 A;  4LF8 T;  2UUA T;  5FY0 A;  1YXR A;  3C98 B;  4EXT A;  2H3R A;  4G63 A;  2YU2 A;  3VHL A; 
#chains in the Genus database with same CATH homology
 3EDV A;  3PUR A;  4CXW A;  3LK2 B;  3FHN A;  2IC9 A;  2LJL A;  1BR0 A;  5JDH A;  3I0O A;  3QUJ A;  3QK6 A;  2MTQ A;  4CQI A;  4H9S E;  1LVK A;  3N5L A;  3ZJ1 A;  3LBX B;  5HXH A;  1ZKE A;  3NZP A;  5KX5 E;  3E08 A;  3NRX A;  4UF0 B;  2X51 A;  2LSJ A;  4EOZ B;  3ZMV B;  1AJ3 A;  3AA1 B;  3IEE A;  5L3B B;  4KMC A;  3CQX C;  2HPJ A;  1HS7 A;  1US7 B;  2A2F X;  4M1P A;  3VKG A;  4I43 B;  5FXX A;  2LSG A;  5FXV A;  4IHJ E;  2A72 A;  3O1H A;  3LFM A;  3I9W A;  1HCI A;  2IAK A;  2LM9 A;  3PUQ A;  4C91 A;  5L3E B;  2CM0 A;  3UUN A;  1FMW A;  5JR9 A;  1OWA A;  1WYB A;  4IE6 A;  2YK0 A;  3WAK A;  3L3P A;  5FY1 A;  2VKO A;  3ETV A;  4X1Y E;  1MND A;  5J2T E;  1MIY A;  3GN5 A;  4L9I A;  2PFV A;  3CX8 B;  4EYY R;  3CWZ B;  3RYC E;  3J7Y q;  5A1L A;  5ETW A;  2Q9Q C;  2W00 A;  3BQI A;  5DJQ C;  2PBI A;  3K8P C;  5DQV A;  5LBQ B;  3PU8 A;  2W62 A;  4IE4 A;  2J1D G;  3FBZ A;  2K5B B;  4HFV A;  4EB6 E;  4YJ2 E;  3TKL B;  5FMN A;  4I55 E;  3JC6 C;  4DND A;  3ZC1 A;  5FXW A;  2L3L A;  4CXX A;  2Z6E A;  3C51 A;  3WI3 A;  3N2G E;  3RH3 A;  1LKX A;  4G2A A;  1LRZ A;  3DJB A;  5C8Y E;  3P7I A;  1U5P A;  3AAA B;  4XAX B;  3PUG A;  5HAX A;  3LK3 B;  5LGT B;  4UIG A;  3ZN1 B;  3CPZ A;  1IZN B;  5DAB A;  3N2O A;  4E7S A;  1VRB A;  1YKH B;  5EK3 A;  4P09 A;  4ZHQ E;  3Q2M A;  4EIW A;  3BQK A;  3CX7 B;  3ZJ2 A;  4DMV A;  4QXH B;  3RPU A;  5JQG E;  1SA0 E;  2XUE A;  4GK0 E;  3GA8 A;  5LOV E;  3KVA A;  4UVA B;  4ZS2 A;  3PDY A;  5FY7 A;  3QC9 A;  3CML A;  3ANW B;  2RA1 A;  2RP4 A;  1QUU A;  4QX7 B;  2B1E A;  3AB3 B;  1LVF A;  4JLE A;  4AKL A;  2V7K A;  5BMV E;  3FBL A;  3IF8 B;  3UUL A;  5JDM A;  1HTJ F;  4I50 E;  5L3C B;  2N9D A;  5LNK A;  2EHO C;  4TV8 E;  2KLQ A;  3PE0 A;  4K0U A;  2KXP B;  1BR1 A;  3HKE E;  2CLY C;  2W63 A;  4UEM A;  3PU3 A;  5AFU L;  3S4U A;  5LXT E;  4GYR A;  1V9D A;  3V5S A;  2W61 A;  4BAY B;  4DO0 A;  4H9R C;  4HE8 A;  4UXN B;  4AQF A;  3N9N A;  2M67 A;  4PJN A;  2DCF A;  4BJM A;  4ZI2 C;  1BR2 A;  2X9H A;  2SPC A;  5JRC B;  3CKD A;  4X1I E;  3EDU A;  1IJ6 A;  4UV8 B;  1Y64 B;  1YKE B;  2KT9 A;  2E9X C;  5L2L A;  1UCU A;  2NTX A;  2LT3 A;  1VOM A;  3ZYL A;  4MFR A;  3C50 A;  1BR4 A;  2YIN A;  3UFE A;  5LYJ E;  4H9P C;  5FNV E;  3N9Q A;  2CCQ A;  4U74 A;  3LBX A;  3NRY A;  3H3A A;  3CQG B;  1D0Z A;  1O3X A;  1ZEE A;  4UF0 A;  5TAO A;  3UT5 E;  4PK5 A;  4EZ4 A;  5LJM A;  3V5U A;  2Q9Q D;  5JVD E;  4AXP A;  4P0B A;  3CX6 B;  4OHF A;  2QA7 A;  2WMO A;  3HA4 A;  4WBO A;  4CI3 B;  3RRW A;  4QXB B;  1OXZ A;  2D0U A;  3MA9 A;  1D1B A;  3JC6 D;  4L0R A;  3UUM A;  3C64 A;  2WWU A;  2D0T A;  2X66 A;  3F31 A;  1EZ3 A;  5DQW A;  4UVB B;  2CA5 A;  3KIN B;  4OYK A;  4EYU A;  4UV9 B;  2JQQ A;  4UVC B;  2CE7 A;  2VKH A;  2NW7 A;  2Q9Q B;  4GYS A;  2ACX A;  2NW9 A;  4ZOL E;  5JDQ A;  4GOU A;  1ZHC A;  1IJ5 A;  2C5J A;  2LOS A;  4J2C A;  4GIW A;  3ZCI A;  5LBM A;  2VKD A;  2BDE A;  2NP9 A;  2JJ9 A;  2MOZ A;  4WW0 A;  4PJM A;  4X20 E;  2A3D A;  3AA7 B;  3KDS E;  2V7I A;  2WSS V;  3MK7 C;  5F3J A;  3HKC E;  2E8I A;  2VWA A;  2ODV A;  4MBQ A;  2MYS A;  3AVR A;  2V7J A;  5LGN B;  3SWH A;  4WNK A;  4BJN A;  4ZI3 C;  2Y8D A;  3VKH A;  4NUV A;  4IGU A;  3C4Z A;  2JRK A;  5EK2 A;  2L8K A;  4YHJ A;  2ZMA A;  5EZY E;  2C5K T;  4QHO A;  1S35 A;  2CEA A;  4IE7 A;  3B57 A;  2DWK A;  2X9X A;  3Q5W A;  3Q5X A;  4O2B E;  2EHO D;  2H7O A;  1MMA A;  3RRC A;  3IBP A;  2DWG A;  3KVB A;  1YW0 A;  2LSI A;  4QX8 B;  2LEH A;  2XAF B;  3ZN0 B;  3RYF E;  5JR9 C;  2C5I T;  1H7C A;  5CA0 E;  2UXX B;  2VAS A;  5J1G A;  3AA6 B;  3P8C D;  2PJQ A;  4X1K E;  4DBR A;  4DVD A;  5KMG P;  2KND A;  5LP6 E;  3O4X E;  4Z8X A;  2ZM8 A;  4ISS A;  4HKA A;  3F2E A;  4QXC B;  2IC6 A;  2JMH A;  4H63 H;  4OFZ A;  4ZI2 D;  3E22 E;  4E7Z A;  2LSK A;  4IE0 A;  3N9L A;  5HXC A;  3DP7 A;  2EHO B;  3FB2 A;  2UXN B;  4XZC A;  2E9X D;  2WMN A;  4U72 A;  2ES0 A;  3BK9 A;  3HKB E;  4HGA A;  4JEU B;  2CLY B;  1KNZ A;  3M65 A;  4DBQ A;  3ANW A;  3B13 A;  5CA1 E;  3RX6 A;  3SOL A;  3O9X A;  4HTE A;  2Y48 B;  4ZS3 A;  3ZMZ B;  5LG4 A;  3ZMT B;  2LSY A;  4TN7 B;  3FXE B;  4YFS A;  5JH7 E;  1CUN A;  3AAE B;  2CWO A;  4O4I E;  3OBV E;  2X67 A;  5CB4 E;  5JDL A;  2E9X B;  2KWH A;  4CZZ B;  1FEW A;  2BVM A;  4IIJ E;  4TX5 A;  2BZB A;  2KMF A;  3ONX A;  5M4Y A;  2VKJ A;  3KFW X;  4ILU A;  3RC8 A;  1G8X A;  5FXZ A;  4O2A E;  2I59 A;  4O4H E;  3HI2 A;  2DHR A;  5JRC A;  3BQL A;  3LG7 A;  5LHI B;  5L3F B;  1U4Q A;  2LE8 A;  3Q9D A;  3MAC A;  4I4T E;  4IE5 A;  3RKO A;  3CQC B;  3PTR B;  4PJJ A;  3ZMU B;  2IW5 B;  3D0T A;  3ZLI A;  5HXE A;  3C4W A;  4ZI7 E;  2CMR A;  5JRE A;  2X68 A;  5HXS A;  5H6R B;  4H9N C;  1D1A A;  2GK9 A;  4JUY A;  5FP3 A;  2V26 A;  2ZLY A;  3ZYM A;  4PJL A;  2VK9 A;  3F57 A;  1YD8 G;  1WRD A;  2JMK A;  4OYJ A;  5H6Q B;  1E1H B;  2CWY A;  4CXY A;  4P0A A;  3ZC0 A;  3I9Y A;  2XAS B;  4AKG A;  5F8P A;  4N78 D;  2X9Y A;  3RYH E;  3RYI E;  2QGS A;  3R84 B;  3R6N A;  2K9A A;  3SRZ A;  4UEL A;  4ZI3 D;  3ZMS B;  4NUU A;  5KDM C;  1MIV A;  5L3D B;  4QKN A;  1FIO A;  1MMD A;  4ASK A;  3K3Q C;  3U78 A;  4AQF C;  5LGU B;  2WAU A;  1HX8 A;  5IHY A;  3WAJ A;  1HG5 A;  2Q9Q A;  4WBN E;  2V7M A;  2VB6 A;  4H9O C;  3OYZ A;  5E0O A;  3HR0 A;  1D1C A;  3IHR A;  3ZYK A;  3VHL A;  3N2K E;  1D0Y A;  1KK7 A;  3A5X A;  1WR6 A;  4HEA A;  3OYX A;  5JDG A;  3ESL A;  2MBG A;  1D0X A;  4MLK A;  4AI6 A;  2XQY A;  2NW8 A;  3ZCJ A;  2ZM0 A;  4CI1 B;  3GMI A;  4YLH A;  3AA0 B;  4EAH A;  3FXD B;  1G73 A;  2KWI B;  2YU1 A;  5JDN A;  2C0S A;  4H9Q C;  3KV4 A;  3KV9 A;  2NTY A;  5LHH B;  5LHG B;  1SHZ C;  3EVY A;  3KV5 A;  4MHC A;  4OK0 A;  3KBT A;  4KP3 C;  4V1A v;  3U3I A;  2D2S A;  2WM9 A;  4HN9 A;  4KBM B;  4O4L E;  3J9X 1;  3K3N A;  2L9Q A;  5JR9 B;  1MMG A;  4GK5 E;  4KUM B;  2K48 A;  2X9W A;  4BA9 A;  1QSD A;  2DNX A;  2WBL A;  1Z0P A;  3UUX B;  3MJX A;  1IAP A;  3GN5 B;  1WLX A;  3I1A A;  2KIN B;  2V7L A;  2LOP A;  2X0L B;  2G0U A;  3E0Z A;  4TV9 E;  1X79 A;  2D5U A;  5FYM A;  3H37 A;  4A56 A;  2K24 A;  1S94 A;  4FJO A;  2LHN A;  4O8S A;  4PFP A;  3ZPO A;  4XBF B;  4H63 V;  2NOX A;  4ERR A;  2CXF A;  3OKQ A;  4FI5 A;  1T98 A;  4QWN B;  2DI4 A;  3C4X A;  4AQG A;  3LJC A;  3CVR A;  3VU7 H;  2W0G A;  3KBU A;  2EHO A;  2P9B A;  3ETU A;  3I0Q A;  4CI2 B;  3DTO A;  4JEH B;  4DMW A;  3N9M A;  1WYC A;  2XTL A;  4YJ3 E;  5LJN A;  5EK4 A;  5HWX A;  2V1D B;  3EUH A;  1ZV4 X;  2XAH B;  3AVS A;  5J2U E;  4AKH A;  4TZ4 C;  2LHR A;  2NWB A;  3O1I A;  4EZH A;  5L3G B;  3KV6 A;  4C90 A;  3MXZ A;  4ADZ A;  1NWM X;  1UX4 A;  2HPL A;  3PUA A;  2PG8 A;  5HYA A;  2ZM2 A;  1HF8 A;  3K3O A;  4PK6 A;  5LCY A;  4PAG A;  3SS1 A;  4IST A;  1B7T A;  2E9X A;  3HKD E;  1MIW A;  2KZ7 B;  5HXR A;  2XAJ B;  3MZK B;  4TUY E;  5LA6 E;  5HWY A;  2XAQ B;  2VL8 A;  3HL6 A;  4F6R C;  2JPF A;  4MAL A;  1HFA A;  1NAF A;  5GON E;  3ZEF B;  4IDZ A;  4O4J E;  4PFO A;  2DLR A;  4B6X A;  3UTK A;  5ADX L;  3NZQ A;  1UX5 A;  2YEV C;  2OA5 A;  1FMV A;  2N2N A;  3PUS A;  4PNI A;  1HG2 A;  3N9P A;  3T8O A;  3NBX X;  3MKD A;  5JDF A;  2BVL A;  2CXD A;  3O1J A;  2HH7 A;  2Y6X A;  4L5G A;  3AAI A;  3OJA A;  2ODU A;  2XHE B;  4AKR B;  4PK4 A;  2XAG B;  1MMN A;  3LK4 2;  4AKI A;  3W15 B;  4ANJ A;  3GWH A;  5FY0 A;  3C98 B;  4PW8 A;  2H7V C;  1MNE A;  4EXT A;  2H3R A;  3L09 A;  4G63 A;  3N9O A;  3RC3 A;  2N1G A;  2YU2 A;  5IYZ E;  2CXL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...