2LHRA

Solution structure of staphylococcus aureus isdh linker domain
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
78
structure length
78
Chain Sequence
SDDYVDEETYNLQKLLAPYHKAKTLERQVYELEKLQEKLPEKYKAEYKKKLDQTRVELADQVKSAVTEFENVTPTNDQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Metal transport
molecule keywords Iron-regulated surface determinant protein H
publication title Staphylococcus aureus Uses a Novel Multidomain Receptor to Break Apart Human Hemoglobin and Steal Its Heme.
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus
total genus 21
structure length 78
sequence length 78
ec nomenclature
pdb deposition date 2011-08-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1270 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2lhrA00
2LHRA
chains in the Genus database with same CATH superfamily
1NAFA 3PUWF 2V8SV 1WR0A 2F4VT 3CVRA 3ZT5A 3CMLA 2JIWA 4DBRA 3KV6A 2XTLA 2IMLA 4CI3B 4IDNA 2X9WA 1WR6A 2KNDA 4A98A 3MACA 2OV9A 4ZI3D 4IL9A 3VKHA 3I9YA 2BKPA 3TLWA 3W15B 4WBNE 3IEEA 3AXJB 2DWGA 2UXNB 1YQ3A 1L0VA 4DR5T 4GOUA 3AE8A 3AA6B 4TN7B 2CPTA 4QXCB 3OPCA 2V5CA 1HG2A 1T8BA 3CX7B 3TLUA 3UFGA 2UUAT 3UT5E 3MA9A 3CQXC 4EAHA 4GYRA 4A5XA 1OEDA 1MMDA 3DTOA 5JREA 3AA1B 1E1HB 5L3GB 2H89A 4DR3T 5H6QB 5J1GA 5JR9C 5L4EA 3CK6A 2CMRA 3CPZA 3O1HA 1FMVA 4JI5T 2XAFB 3C4WA 4NUUA 5HXCA 4NXNT 4TX5A 4UR9A 1MMNA 4ILCA 2XQ6A 1UCUA 2Y48B 1Z8UA 3GWHA 4JI3T 3EAMA 4FI5A 2HH7A 3AE4A 2D0UA 4X64T 2NW7A 4QHOA 2KXPB 1S35A 4EEDA 3LBXA 3HKEE 2BKOA 4JI0T 3JCFA 3AEAA 1MNEA 4QXHB 4TV8E 2LHRA 2KINB 2LM9A 3QNUA 2Z6EA 2XPKA 3KBUA 2X68A 4UF0B 3K8PC 5DQWA 5HXRA 4B3MT 1W9RA 3PUVF 3RGLA 2C0SA 2VKDA 3HL6A 3MJXA 4ISTA 4L5GA 5BMVE 2NOXA 2X51A 5LJMA 3RQWA 5KDMC 2XZEA 3AE5A 4JI8T 4MBQA 4KP3C 3UULA 3RLFF 4C91A 2V7LA 3PV0F 3Q9DA 3SFEA 3LG7A 2W66A 4GIWA 2V7JA 3PU8A 4WBOA 5C2TA 2AE9A 2K24A 2ZMAA 4WYVA 4DR6T 3HKBE 4YJ2E 2IW5B 5HCJA 2OLTA 2ODUA 5LB7B 5AQMB 3ZN1B 5LG3A 5LNKA 1ZP0A 1D0XA 2YEVC 5LHHB 4KHPT 4YXDA 4LF5T 5LHIB 4H9QC 4N78D 5F3JA 1NENA 3T8OA 3P4PA 2H3RA 3BQIA 5ABFA 4OFZA 2K9AA 3FXDB 4UVAB 3UUBA 1B7TA 4YT0A 3VR9A 1QUUA 3U3IA 1UGOA 3LK3B 2HN2A 5JVDE 4PJNA 3OBVE 2YDSA 2WDRA 4IGUA 2I59A 4Z91A 1EZ3A 5FXVA 4LF6T 2UU9T 3RPUA 5IWAT 2QA7A 4ISSA 1W0AA 4CI2B 3UUNA 3H37A 3FZFB 2NP9A 2PG8A 5JDGA 4QH4A 5AQPB 3N9QA 3IA3A 4UEMA 3D0TA 5FNVE 3QUJA 4LFCT 3FHNA 1DU2A 5ABHA 3AE2A 3AEBA 2YDQA 2IC9A 3OYZA 2V26A 2XAGB 4CN6A 3P4QA 2N9DA 4P09A 3HKDE 4DBQA 3CKDA 4X1IE 4L0RA 2QYWA 5AQKB 2E9XA 3JC6D 4G63A 4OYJA 4LMLA 2X9XA 4EGWA 5LG4A 4HFVA 3NRYA 2IIUA 2Q9QA 1N34T 1ZV4X 4IE0A 3UQ4A 5AQHB 3TKLB 2AXDS 2FUPA 2IUBA 1MIWA 2DWKA 4X1KE 2VB6A 3N9PA 4IE6A 3L3PA 2LOSA 1MMAA 3B5MA 4U7YA 4LF4T 3RIFA 3RKOA 1UUSA 2CRBA 2J4GA 4UXNB 3X1DA 4YHHT 3FB2A 2HPJA 3RI5A 2A72A 1E7PA 4EZ4A 3UU8A 5DQVA 5EK3A 5JDFA 1WFDA 5HEHA 1MNDA 2WM9A 3AA7B 3AE6A 2HHHT 4X1YE 3K3QC 2W62A 5LGNB 4DV6T 2ODVA 4MFRA 3C50A 4JLEA 4ZHQE 3BQKA 5EZYE 4GK0E 1ZKEA 3V5UA 5FKYA 3CQCB 3MXZA 4CXYA 2PJQA 5LXTE 2P9BA 3FZLB 5F5WA 5HEUA 2BZBA 2XM2A 3SWHA 1LVFA 5HXEA 2JMKA 2M6BA 5LBMA 4U3CA 5TAOA 3BQLA 3UUXB 1XNQT 1US7B 2M6IA 2D5UA 4WW0A 1J5WA 5ABEA 5FMNA 4ZI7E 2CHNA 2JJ9A 2PFVA 4MHCA 4H9PC 2JPFA 3EUHA 2GK9A 3ZMZB 1AJ3A 4GYSA 5FP3A 2FJBA 2LE8A 5GONE 2A2FX 2YU2A 4DVDA 2YDRA 5ETWA 5CA0E 3Q2MA 3C64A 2MTQA 5FL0A 4AQGA 4IREA 5FY7A 1XMOT 4PW8A 3VR8A 1J5ET 5FVLA 3OJAA 4F8HA 3ZT7A 4DUYT 3PTRB 1HG5A 2V7KA 3GMIA 3AE9A 4ZI2D 5KX5E 2LKGA 5LMNT 3ONLC 2UXDT 5L3BB 4E7SA 3A7MA 1W0BA 4M1PA 3O1IA 3KDSE 3RKGA 3AECA 3ZSSA 4ILAA 5AFUL 2WBLA 2KLQA 2XHEB 3FZMB 3ZSTA 3PUXF 2R6GF 1KNZA 3M65A 3A8YC 3KV4A 5JDMA 3C51A 3LK42 3RC8A 2YKSA 2V6YA 3ZMSB 2NTXA 1YQ4A 1HX8A 3IF8B 1YXRA 3L09A 5BR8T 5J0ZA 4IT4A 2XQYA 4YSYA 4I55E 3KINB 2VKJA 1XMQT 2UUCT 1KFYA 2C5JA 5HXSA 3RIUA 2WU2A 3J9X1 4U72A 4JBWF 2KT9A 2MAWA 2W0GA 1X79A 3GN5B 4PAGA 2NTYA 5CA1E 2H7VC 4DV2T 4PJLA 2ZM8A 1ZHCA 1OWAA 1FEWA 3E08A 2LJLA 5FXWA 4OX9T 2LSIA 3ETVA 4P1NA 3UU4A 2E5LT 1D1BA 4PFPA 1T7SA 3E0ZA 2D9DA 3UFEA 4BJNA 4YSZA 3KBTA 2X0HA 4UV8B 2QVAA 4U31A 5ABFB 2X0LB 4ANJA 4CZZB 5EK2A 5LGTB 5KXJA 4J2CA 1U4QA 1IBKT 1Z0PA 1LKXA 2J47A 3FZHB 3ZCJA 4QXBB 3ZLIA 4CN4A 1IJ6A 3QB5A 4AQFA 4H63H 5JDQA 4E7ZA 1G8XA 4DNDA 2H7OA 4AXPA 2C5IT 3N5LA 5HEOA 1HNZT 4YTNA 4LFBT 5HCMA 4U2ZA 1VCTA 3EHZA 2WY2A 3DJBA 4U33A 4TUYE 5DABA 3QOFA 3UQ7A 4IE5A 3V5SA 2KWHA 3O9XA 3OYXA 4IDPA 4COFA 2FJDA 4CQIA 2WMNA 4YTMA 1WCRA 2VURA 2YOEA 2E2AA 4LF8T 4AISA 2CBIA 4ZI2C 3O1JA 2EHOD 3ANWA 4DV3T 5DJQC 4I4TE 2LRLA 5L4HA 1YKHB 2E9XB 1KK7A 2XJ7A 4H9NC 4H9SE 4JV5T 3WAKA 2RPAA 4DR7T 5AQTB 3ZYMA 4YJ3E 2BG9E 3N9NA 2X9YA 3P7IA 4PK5A 4YSXA 2Q9QB 2XASB 3RC3A 3VRAA 2QGSA 3PUAA 2BBHA 2XQ9A 2ACXA 4LF9T 2BS4A 3NVOA 3EI0A 1HFAA 4DUZT 1U5PA 2CA5A 1YD8G 3ZCIA 5JTGA 3L39A 4ZI3C 4P0BA 3FBLA 3N9MA 2V1DB 2WB5A 4KMCA 1BR4A 1R8IA 2BS2A 1VRBA 4O4IE 4X20E 3RF1A 2WWVA 3PUQA 4HWIB 4AIUA 4PJMA 4QKNA 3AEGA 2BVLA 3RYFE 2LSYA 3PUGA 4EOZB 5JDHA 3NBXX 4TNVA 4XAXB 2NR4A 3RIAA 4YTPA 5AQQB 1BR1A 5CJ5A 4B3TT 4QWNB 4HFHA 2NW9A 4IE4A 4B6XA 2ZLYA 4DMVA 5HAXA 4X65T 4H63V 3PU3A 4FJOA 4Q25A 2D2SA 5JR9A 2JRKA 2VKHA 1HR0T 2CEAA 3Q5XA 4HGAA 4AKLA 1LVKA 3H3MA 1UX5A 2CHOA 1CHUA 1S94A 5IYZE 1Y64B 1GQEA 3CQGB 2VL0A 2HPLA 5EK4A 3FBZA 2H88A 2UXCT 2W67A 2J1DG 2CLYB 4CN1A 5AQNB 2B1EA 4UF0A 2MYSA 5ABGA 3LSVA 4UV9B 2CXFA 1WYBA 2Y8DA 4QH1A 3AEDA 2LLYA 4A56A 2XSAA 2JQQA 1VCSA 2KWIB 2QRXA 3J7Yq 2J62A 4JUYA 2LRKA 4HFIA 4AI6A 2XQ5A 1NWMX 2VWAA 3AEEA 2WZIA 2UUBT 4CXXA 4HFCA 1YKEB 3IBPA 3ESLA 4CXWA 2I0MA 2BG9C 2EHOB 5LHGB 1KF6A 2N1GA 5JDLA 3HR0A 4AKRB 4TWHA 3SFDA 3N2GE 2CWOA 2WMOA 1HTJF 2JQHA 4A97A 3SS1A 1ZEEA 2BBJA 4EB6E 4TZ4C 4LMKA 4H9RC 3ZMTB 1JNRA 3ZJ2A 5C3JA 3N2KE 2X66A 4HFDA 1MIVA 1YW0A 3I1AA 5AQIB 2ZM2A 5F8PA 3O4XE 2LOPA 4ZEYA 2MPKA 1SHZC 3AE3A 2ZM6T 3M3ZB 1IAPA 2CE7A 1BR2A 4BJMA 4ZXLA 5AQRB 3LFMA 1E2AA 3AA0B 3TLSA 4DV5T 3P8CD 4ZOLE 4GKJT 1OEDB 3MK7C 4EV6A 4UELA 3QC9A 2VVNA 3UU5A 2L9QA 4IL4A 2XAJB 5A1LA 4AQYT 2PTFA 4O4LE 3VKGA 1MIYA 3ONXA 3RYIE 2FJEA 3PDYA 2M67A 1O3XA 5KMGP 4AKHA 5AQVB 2DNXA 3HI2A 4DV7T 4DR1T 4KHZF 4V1Av 2KZ7B 2W63A 4ZZBA 1M62A 1D1AA 4HWDA 2N2NA 2IAKA 1UX4A 4F6RC 2RA1A 3KV9A 2MBGA 2ACZA 2E9XD 1D0YA 5L3EB 2Y6XA 1T72A 4ILUA 4XBFB 3ZT6A 1IZNB 3RYHE 3QB5K 4UVCB 3WI3A 2Q9QD 3ZMUB 2K48A 4HE8A 3JC6C 2XQ4A 4JI1T 3LBXB 4U74A 4TNWA 1IBLT 4YFSA 2NWBA 5JRCA 4HFEA 4PJJA 2KMFA 4HFBA 2A3DA 4IDQA 3ZKRA 1V9DA 3R6NA 4DR4T 3ZC0A 2VVSA 3EABA 2VKOA 4JEHB 1XZYA 4X66T 2LKHA 5L47A 2BG9A 3ZEFB 4HWHA 4WZXA 5C8YE 4P0AA 5LP6E 5ADXL 3JADA 2LSJA 3B13A 2DCFA 3UU3A 1HNXT 1UURA 5J2UE 4LF7T 2XQ7A 3RHWA 4DMWA 2W2UA 3IHRA 4L9IA 3N2OA 3JAFA 3BK9A 4B3RT 4Z90A 4Z8XA 5CFBA 3EDVA 2YINA 5L3CB 5LA6E 1QLBA 2PBIA 2LM2A 3VU7H 1WYCA 1WLXA 4K0KT 2DL1A 2KSRA 4I0UA 2D0TA 4U2YA 3TLVA 3ABVA 3PJAJ 3F2EA 4JI6T 4QX8B 4O2BE 2YU1A 2CWYA 1MMGA 2IC6A 3UTKA 3LDQB 4X62T 2BKNA 4JI2T 4LMJA 4QX7B 4IDZA 2CM0A 4GK5E 4MLKA 5L3FB 5E0OA 1KNPA 3LK2B 1OXZA 5JR9B 1LRZA 4PK4A 2WS3A 5FXXA 5HEGA 3RRWA 4ERRA 4H9OC 2RP4A 4NXMT 3KV5A 3EDUA 3NWIA 5AQGB 3I9WA 1UK5A 3C98B 2E5VA 2XM1A 1HX1B 2V7IA 1IJ5A 2E9XC 2L8KA 2E8IA 4DV4T 1N36T 4NUVA 5M4YA 5HEJA 2WWUA 3AAIA 3CX8B 2VQFT 1QSDA 2XQ3A 5FVKA 2VL8A 3G06A 2Q9QC 3P50A 3SRZA 5FXZA 4I43B 2YN6A 5LMUT 1SUMB 3GA8A 2LEHA 3P4SA 1FMWA 4EEBA 2JQ9A 3R84B 3QK6A 5IHYA 2XAHB 1HS7A 2W61A 1J1JA 3AXJA 4HEAA 1N32T 3E22E 5CGMA 2CCQA 3GN5A 3RQUA 3PUZF 4ADZA 4ZS2A 2VQET 3RX6A 2DLRA 2WAUA 5JH7E 2G0UA 4QH5A 4WNKA 4DV1T 5JDNA 4IE7A 2I6HA 3PJAA 2W00A 3LJCA 4G2AA 4OK0A 3HKCE 1HCIA 5AQUB 3SOLA 1HNWT 1XDOA 4OHFA 4YY3T 4OYKA 2FJAA 3Q5DA 2DHRA 2XQAA 3N9LA 2MOZA 2WP9A 4EYUA 5LBQB 1OEDE 4TWFA 2WSSV 4TWDA 3I0OA 1D0ZA 3ETUA 3AVSA 3OTOT 3AAAB 3C4ZA 4CI1B 3K1SA 4HWFA 2FBWA 1BR0A 2UXXB 2NW8A 2V5DA 3ZYKA 4X5TA 3KVBA 2XSBA 4PNIA 1N33T 4UVBB 4EXTA 3P4WA 3P4RA 3UU6A 2W4XA 2YK0A 5L2LA 5FY1A 2CLYC 5LJNA 3TLTA 2WQYA 1IBMT 3FZKB 4JI4T 4AKIA 4C90A 5AQLB 3T1YT 5AQFB 3ZJ1A 3AE1A 2WCAA 1SE7A 3RRCA 1T98A 2CXLA 2BVMA 3ZC1A 2K5BB 3T1HT 2ES0A 4GKKT 1FIOA 2A9UA 4HN9A 4ZZCA 4EIWA 4O4JE 1G73A 3H3AA 2CXDA 4DR2T 4ASKA 4JYAT 3AB3B 4NIQA 2WDQA 2XY8B 3VHLA 3AAEB 1Y01A 5CB4E 3MZKB 5IUXA 4BAYB 2EHOC 2X0YA 2XUEA 3CWZB 3B57A 4O2AE 2LSKA 2V6XA 3HA4A 1I94T 2SPCA 4O4HE 3C4XA 5JRCB 1FJGT 4KI0F 5J2TE 4B3ST 4DO0A 3K3OA 2LSGA 3JAEA 1KEYA 2V6YB 2WZHA 2JQKA 3NKZA 1XWMA 5HWYA 3L8RA 3F57A 4I50E 3RIUC 3U78A 4XZCA 1ZOYA 3NRXA 3ZN0B 3ZYLA 2CBJA 5FL1A 3AE7A 3KVAA 3A5XA 3OKQA 1XDPA 2DI4A 2LT3A 3ONJA 2BS3A 3PURA 4PK6A 5HWXA 3I0QA 2BG9B 5LGUB 3Q5EA 1M7KA 2X67A 4IDOA 1D1CA 3F31A 1HF8A 4MALA 2IHR1 4HTEA 3AVRA 3ZPOA 2IDOB 3Q5WA 4JEUB 3PUSA 3EVYA 2VASA 5AQOB 2V7MA 4HKAA 5LOVE 4NPPA 1OEDC 1WRDA 4DIDB 3K3NA 3MKDA 5HXHA 4O8SA 1CUNA 2LHNA 1W09A 4K0UA 5FY0A 3RYCE 2UXBT 3DP7A 4EYYR 4KUMB 1VOMA 1XNRT 1SA0E 3CX6B 4AQFC 4IHJE 4JI7T 1I6ZA 3OVUA 2L3LA 2XAQB 2VK9A 4KX6A 2C5KT 2HN1A 2OA5A 3FXEB 5H6RB 4YLHA 3CIRA 3N9OA 5HYAA 3ZMVB 4KBMB 5AQJB 2XQ8A 4ILBA 3WAJA 3KFWX 4TV9E 1H7CA 5LCYA 2K3WA 4BA9A 4U7IA 3UUMA 1KNRA 5L3DB 5FYMA 4EZHA 5JQGE 4PFOA 4UIGA 3S4UA 2B76A 4YHJA 4DV0T 2WU5A 4LFAT 2JMHA 2X9HA 2BDEA 3PUYF 4ZS3A 5LYJE 3RH3A 3PE0A 3VRBA 1X9BA 4IIJE 2WDVA 2EHOA 3ANWB 5AQSB 3AEFA 1NEKA 4AKGA 2ZM0A 3NZQA 4HWCA 3NZPA 1JNZA
chains in the Genus database with same CATH topology
1NAFA 3BQKA 3PU3A 4FJOA 5JR9A 2D2SA 2JRKA 5EZYE 4GK0E 1ZKEA 2V7IA 3CVRA 1IJ5A 3CMLA 2VKHA 2E9XC 2L8KA 4DBRA 3V5UA 2E8IA 3KV6A 2XTLA 2CEAA 3CQCB 3MXZA 4NUVA 4CXYA 5M4YA 4CI3B 2PJQA 2WWUA 2X9WA 3Q5XA 5LXTE 4HGAA 1WR6A 2KNDA 3AAIA 3CX8B 1QSDA 2P9BA 3MACA 4ZI3D 4AKLA 1LVKA 2BZBA 1UX5A 3SWHA 1LVFA 5HXEA 2VL8A 2Q9QC 2JMKA 5LBMA 3SRZA 5FXZA 3VKHA 3I9YA 4I43B 1S94A 3W15B 4WBNE 5IYZE 1Y64B 5TAOA 3CQGB 3IEEA 3BQLA 2HPLA 5EK4A 3UUXB 2DWGA 1US7B 2D5UA 2UXNB 4WW0A 3FBZA 3GA8A 5FMNA 4ZI7E 2J1DG 2LEHA 4GOUA 3AA6B 4TN7B 2CLYB 1FMWA 2JJ9A 2PFVA 4QXCB 3R84B 2B1EA 3QK6A 4UF0A 5IHYA 1HG2A 2MYSA 4MHCA 2XAHB 4H9PC 3CX7B 1HS7A 2W61A 2JPFA 3EUHA 2GK9A 3ZMZB 1AJ3A 4UV9B 2CXFA 1WYBA 4HEAA 3E22E 4GYSA 2Y8DA 3UT5E 5FP3A 3MA9A 2CCQA 3GN5A 4A56A 2LE8A 2JQQA 3CQXC 2KWIB 5GONE 2A2FX 2YU2A 4DVDA 4EAHA 4ADZA 4ZS2A 5ETWA 4GYRA 3J7Yq 4JUYA 3Q2MA 3C64A 3RX6A 5CA0E 2DLRA 2MTQA 2WAUA 4AQGA 4AI6A 1MMDA 5JH7E 2G0UA 3DTOA 4WNKA 5JREA 1NWMX 3AA1B 5FY7A 5JDNA 1E1HB 4IE7A 5L3GB 2VWAA 2W00A 3LJCA 4PW8A 5H6QB 4G2AA 5J1GA 4CXXA 4OK0A 3HKCE 1YKEB 1HCIA 3IBPA 3OJAA 5JR9C 3SOLA 3ESLA 4CXWA 2EHOB 5LHGB 3PTRB 1HG5A 2V7KA 3GMIA 2CMRA 3CPZA 4OHFA 3O1HA 4ZI2D 2N1GA 5KX5E 4OYKA 1FMVA 2XAFB 2DHRA 3C4WA 3HR0A 5JDLA 3N9LA 2MOZA 5L3BB 4EYUA 4NUUA 4E7SA 5HXCA 4AKRB 5LBQB 3N2GE 4M1PA 4TX5A 3O1IA 3KDSE 1MMNA 2CWOA 2WSSV 2WMOA 1HTJF 3I0OA 3SS1A 1UCUA 1D0ZA 2Y48B 3ETUA 5AFUL 3AVSA 1ZEEA 3GWHA 2WBLA 4EB6E 2KLQA 2XHEB 4TZ4C 4FI5A 2HH7A 4H9RC 3ZMTB 3AAAB 1KNZA 3ZJ2A 3M65A 3KV4A 3C4ZA 5JDMA 2D0UA 3C51A 3LK42 3N2KE 2X66A 4CI1B 2NW7A 3RC8A 3ZMSB 4QHOA 1MIVA 2NTXA 1YW0A 2KXPB 3I1AA 1BR0A 2UXXB 2NW8A 2ZM2A 1S35A 5F8PA 3LBXA 3HKEE 3O4XE 1HX8A 3ZYKA 2LOPA 3KVBA 3IF8B 3L09A 4PNIA 1SHZC 4UVBB 1MNEA 4QXHB 4TV8E 2LHRA 4EXTA 2KINB 2XQYA 2LM9A 4I55E 3KINB 2Z6EA 2VKJA 3KBUA 1IAPA 2YK0A 5L2LA 2CE7A 2CLYC 2X68A 4UF0B 5FY1A 5LJNA 1BR2A 3K8PC 5DQWA 5HXRA 4BJMA 2C5JA 5HXSA 4AKIA 4C90A 2C0SA 2VKDA 3J9X1 3HL6A 4U72A 3MJXA 3ZJ1A 4ISTA 2KT9A 3LFMA 2W0GA 1X79A 3GN5B 4PAGA 1T98A 3RRCA 2NTYA 5CA1E 2H7VC 4L5GA 5BMVE 2NOXA 2X51A 3AA0B 2CXLA 5LJMA 5KDMC 2BVMA 3P8CD 3ZC1A 2K5BB 4PJLA 2ZM8A 4ZOLE 4MBQA 1ZHCA 4KP3C 3UULA 2ES0A 1OWAA 3MK7C 1FIOA 4UELA 3QC9A 4C91A 2V7LA 4HN9A 1FEWA 3Q9DA 3E08A 4O4JE 2LJLA 5FXWA 4EIWA 3LG7A 2L9QA 1G73A 2XAJB 5A1LA 3H3AA 4GIWA 2CXDA 4O4LE 2LSIA 3ETVA 2V7JA 3PU8A 4WBOA 3VKGA 4ASKA 1MIYA 3ONXA 3RYIE 3AB3B 1D1BA 2K24A 4PFPA 3PDYA 2ZMAA 2M67A 1O3XA 5KMGP 3VHLA 3E0ZA 4AKHA 3HKBE 2DNXA 3AAEB 3HI2A 4YJ2E 3UFEA 5CB4E 3MZKB 4BJNA 3KBTA 2EHOC 4BAYB 4V1Av 4UV8B 2XUEA 2IW5B 3CWZB 2KZ7B 3B57A 4O2AE 2LSKA 2W63A 3HA4A 2X0LB 4ANJA 2ODUA 4CZZB 1D1AA 5EK2A 5LGTB 2N2NA 4J2CA 3ZN1B 2IAKA 1UX4A 1U4QA 4F6RC 2RA1A 3KV9A 5LNKA 1Z0PA 1D0XA 2MBGA 1LKXA 2YEVC 2E9XD 5LHHB 3ZCJA 2SPCA 4QXBB 3ZLIA 1D0YA 4O4HE 3C4XA 5LHIB 5L3EB 2Y6XA 5JRCB 4H9QC 1IJ6A 4ILUA 4N78D 4AQFA 5F3JA 5J2TE 4XBFB 4DO0A 4H63H 3T8OA 3K3OA 1IZNB 2H3RA 3RYHE 2LSGA 3BQIA 4UVCB 1G8XA 4E7ZA 5JDQA 4DNDA 4OFZA 2H7OA 3WI3A 2K9AA 3FXDB 4AXPA 2C5IT 3N5LA 2Q9QD 3ZMUB 2K48A 4HE8A 3JC6C 4UVAB 5HWYA 3F57A 1B7TA 3LBXB 4I50E 1QUUA 4U74A 3U78A 4XZCA 3ZN0B 3NRXA 3U3IA 4YFSA 3ZYLA 2NWBA 3KVAA 3LK3B 3A5XA 5JRCA 3OKQA 2DI4A 2LT3A 4PJJA 5JVDE 4PJNA 3OBVE 3PURA 2KMFA 4PK6A 2A3DA 5HWXA 3DJBA 3I0QA 1V9DA 3R6NA 4IGUA 5LGUB 2I59A 4TUYE 3ZC0A 1EZ3A 5DABA 5FXVA 2X67A 2VKOA 1D1CA 3F31A 4IE5A 1HF8A 4JEHB 4MALA 3RPUA 4HTEA 2QA7A 3AVRA 4ISSA 3V5SA 3ZPOA 2KWHA 3O9XA 3Q5WA 4CI2B 3UUNA 3OYXA 4JEUB 4CQIA 2WMNA 3PUSA 3H37A 3EVYA 2VASA 2NP9A 2PG8A 5JDGA 3ZEFB 2V7MA 4HKAA 3N9QA 5LOVE 4ZI2C 3O1JA 2EHOD 3ANWA 4UEMA 5C8YE 4P0AA 1WRDA 3K3NA 5LP6E 3D0TA 5FNVE 3MKDA 5ADXL 5HXHA 5DJQC 4I4TE 4O8SA 3QUJA 3FHNA 2LSJA 1CUNA 2LHNA 3B13A 2DCFA 1YKHB 4K0UA 2E9XB 2IC9A 1KK7A 3OYZA 4H9NC 4H9SE 5FY0A 3RYCE 3WAKA 5J2UE 2V26A 2XAGB 3DP7A 4DMWA 2N9DA 4EYYR 3ZYMA 4P09A 3IHRA 4KUMB 4YJ3E 4L9IA 1VOMA 3HKDE 3N2OA 4DBQA 3CKDA 1SA0E 3CX6B 3N9NA 4AQFC 2X9YA 3BK9A 4IHJE 4X1IE 3P7IA 4PK5A 4Z8XA 2Q9QB 2XASB 3RC3A 2QGSA 3PUAA 4L0RA 2L3LA 2XAQB 2ACXA 2VK9A 3EDVA 2E9XA 2YINA 3JC6D 5L3CB 4G63A 4OYJA 2C5KT 2OA5A 5LA6E 2PBIA 2X9XA 3VU7H 3FXEB 5H6RB 1WYCA 1WLXA 1HFAA 1U5PA 5LG4A 4YLHA 2CA5A 1YD8G 3ZCIA 4HFVA 4ZI3C 4P0BA 3FBLA 3NRYA 2D0TA 3N9MA 3N9OA 2V1DB 2Q9QA 5HYAA 4KMCA 1BR4A 1ZV4X 4IE0A 3ZMVB 3F2EA 3TKLB 1VRBA 4QX8B 4O4IE 1MIWA 4X20E 4O2BE 2YU1A 4KBMB 3PUQA 2DWKA 4X1KE 2VB6A 4PJMA 4QKNA 3N9PA 2CWYA 3WAJA 1MMGA 3KFWX 4TV9E 2IC6A 1H7CA 4IE6A 3L3PA 2LOSA 2BVLA 3RYFE 3UTKA 5LCYA 1MMAA 2LSYA 4BA9A 3PUGA 3UUMA 4EOZB 5JDHA 3NBXX 5L3DB 5FYMA 4EZHA 5JQGE 4PFOA 4UIGA 4QX7B 3S4UA 4XAXB 4IDZA 2CM0A 4GK5E 4MLKA 3RKOA 4YHJA 5L3FB 5E0OA 4UXNB 2JMHA 2X9HA 2BDEA 3LK2B 4ZS3A 3FB2A 5LYJE 2HPJA 3RH3A 1OXZA 1BR1A 2A72A 1LRZA 3PE0A 5JR9B 4PK4A 4EZ4A 5DQVA 5EK3A 5FXXA 4QWNB 5JDFA 3RRWA 4IIJE 2NW9A 4ERRA 2EHOA 1MNDA 2WM9A 3AA7B 3ANWB 4H9OC 2RP4A 4X1YE 3K3QC 4AKGA 2W62A 3KV5A 4IE4A 4B6XA 2ZM0A 5LGNB 3EDUA 2ZLYA 3NZQA 4DMVA 5HAXA 2ODVA 4MFRA 3C50A 3I9WA 4JLEA 3C98B 3NZPA 4ZHQE 4H63V
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LHR A; 
#chains in the Genus database with same CATH topology
 1NAF A;  3PUW F;  2V8S V;  1WR0 A;  2F4V T;  3CVR A;  3ZT5 A;  3CML A;  2JIW A;  4DBR A;  3KV6 A;  2XTL A;  2IML A;  4CI3 B;  4IDN A;  2X9W A;  1WR6 A;  2KND A;  4A98 A;  3MAC A;  2OV9 A;  4ZI3 D;  4IL9 A;  3VKH A;  3I9Y A;  2BKP A;  3TLW A;  3W15 B;  4WBN E;  3IEE A;  3AXJ B;  2DWG A;  2UXN B;  1YQ3 A;  1L0V A;  4DR5 T;  4GOU A;  3AE8 A;  3AA6 B;  4TN7 B;  2CPT A;  4QXC B;  3OPC A;  2V5C A;  1HG2 A;  1T8B A;  3CX7 B;  3TLU A;  3UFG A;  2UUA T;  3UT5 E;  3MA9 A;  3CQX C;  4EAH A;  4GYR A;  4A5X A;  1OED A;  1MMD A;  3DTO A;  5JRE A;  3AA1 B;  1E1H B;  5L3G B;  2H89 A;  4DR3 T;  5H6Q B;  5J1G A;  5JR9 C;  5L4E A;  3CK6 A;  2CMR A;  3CPZ A;  3O1H A;  1FMV A;  4JI5 T;  2XAF B;  3C4W A;  4NUU A;  5HXC A;  4NXN T;  4TX5 A;  4UR9 A;  1MMN A;  4ILC A;  2XQ6 A;  1UCU A;  2Y48 B;  1Z8U A;  3GWH A;  4JI3 T;  3EAM A;  4FI5 A;  2HH7 A;  3AE4 A;  2D0U A;  4X64 T;  2NW7 A;  4QHO A;  2KXP B;  1S35 A;  4EED A;  3LBX A;  3HKE E;  2BKO A;  4JI0 T;  3JCF A;  3AEA A;  1MNE A;  4QXH B;  4TV8 E;  2LHR A;  2KIN B;  2LM9 A;  3QNU A;  2Z6E A;  2XPK A;  3KBU A;  2X68 A;  4UF0 B;  3K8P C;  5DQW A;  5HXR A;  4B3M T;  1W9R A;  3PUV F;  3RGL A;  2C0S A;  2VKD A;  3HL6 A;  3MJX A;  4IST A;  4L5G A;  5BMV E;  2NOX A;  2X51 A;  5LJM A;  3RQW A;  5KDM C;  2XZE A;  3AE5 A;  4JI8 T;  4MBQ A;  4KP3 C;  3UUL A;  3RLF F;  4C91 A;  2V7L A;  3PV0 F;  3Q9D A;  3SFE A;  3LG7 A;  2W66 A;  4GIW A;  2V7J A;  3PU8 A;  4WBO A;  5C2T A;  2AE9 A;  2K24 A;  2ZMA A;  4WYV A;  4DR6 T;  3HKB E;  4YJ2 E;  2IW5 B;  5HCJ A;  2OLT A;  2ODU A;  5LB7 B;  5AQM B;  3ZN1 B;  5LG3 A;  5LNK A;  1ZP0 A;  1D0X A;  2YEV C;  5LHH B;  4KHP T;  4YXD A;  4LF5 T;  5LHI B;  4H9Q C;  4N78 D;  5F3J A;  1NEN A;  3T8O A;  3P4P A;  2H3R A;  3BQI A;  5ABF A;  4OFZ A;  2K9A A;  3FXD B;  4UVA B;  3UUB A;  1B7T A;  4YT0 A;  3VR9 A;  1QUU A;  3U3I A;  1UGO A;  3LK3 B;  2HN2 A;  5JVD E;  4PJN A;  3OBV E;  2YDS A;  2WDR A;  4IGU A;  2I59 A;  4Z91 A;  1EZ3 A;  5FXV A;  4LF6 T;  2UU9 T;  3RPU A;  5IWA T;  2QA7 A;  4ISS A;  1W0A A;  4CI2 B;  3UUN A;  3H37 A;  3FZF B;  2NP9 A;  2PG8 A;  5JDG A;  4QH4 A;  5AQP B;  3N9Q A;  3IA3 A;  4UEM A;  3D0T A;  5FNV E;  3QUJ A;  4LFC T;  3FHN A;  1DU2 A;  5ABH A;  3AE2 A;  3AEB A;  2YDQ A;  2IC9 A;  3OYZ A;  2V26 A;  2XAG B;  4CN6 A;  3P4Q A;  2N9D A;  4P09 A;  3HKD E;  4DBQ A;  3CKD A;  4X1I E;  4L0R A;  2QYW A;  5AQK B;  2E9X A;  3JC6 D;  4G63 A;  4OYJ A;  4LML A;  2X9X A;  4EGW A;  5LG4 A;  4HFV A;  3NRY A;  2IIU A;  2Q9Q A;  1N34 T;  1ZV4 X;  4IE0 A;  3UQ4 A;  5AQH B;  3TKL B;  2AXD S;  2FUP A;  2IUB A;  1MIW A;  2DWK A;  4X1K E;  2VB6 A;  3N9P A;  4IE6 A;  3L3P A;  2LOS A;  1MMA A;  3B5M A;  4U7Y A;  4LF4 T;  3RIF A;  3RKO A;  1UUS A;  2CRB A;  2J4G A;  4UXN B;  3X1D A;  4YHH T;  3FB2 A;  2HPJ A;  3RI5 A;  2A72 A;  1E7P A;  4EZ4 A;  3UU8 A;  5DQV A;  5EK3 A;  5JDF A;  1WFD A;  5HEH A;  1MND A;  2WM9 A;  3AA7 B;  3AE6 A;  2HHH T;  4X1Y E;  3K3Q C;  2W62 A;  5LGN B;  4DV6 T;  2ODV A;  4MFR A;  3C50 A;  4JLE A;  4ZHQ E;  3BQK A;  5EZY E;  4GK0 E;  1ZKE A;  3V5U A;  5FKY A;  3CQC B;  3MXZ A;  4CXY A;  2PJQ A;  5LXT E;  2P9B A;  3FZL B;  5F5W A;  5HEU A;  2BZB A;  2XM2 A;  3SWH A;  1LVF A;  5HXE A;  2JMK A;  2M6B A;  5LBM A;  4U3C A;  5TAO A;  3BQL A;  3UUX B;  1XNQ T;  1US7 B;  2M6I A;  2D5U A;  4WW0 A;  1J5W A;  5ABE A;  5FMN A;  4ZI7 E;  2CHN A;  2JJ9 A;  2PFV A;  4MHC A;  4H9P C;  2JPF A;  3EUH A;  2GK9 A;  3ZMZ B;  1AJ3 A;  4GYS A;  5FP3 A;  2FJB A;  2LE8 A;  5GON E;  2A2F X;  2YU2 A;  4DVD A;  2YDR A;  5ETW A;  5CA0 E;  3Q2M A;  3C64 A;  2MTQ A;  5FL0 A;  4AQG A;  4IRE A;  5FY7 A;  1XMO T;  4PW8 A;  3VR8 A;  1J5E T;  5FVL A;  3OJA A;  4F8H A;  3ZT7 A;  4DUY T;  3PTR B;  1HG5 A;  2V7K A;  3GMI A;  3AE9 A;  4ZI2 D;  5KX5 E;  2LKG A;  5LMN T;  3ONL C;  2UXD T;  5L3B B;  4E7S A;  3A7M A;  1W0B A;  4M1P A;  3O1I A;  3KDS E;  3RKG A;  3AEC A;  3ZSS A;  4ILA A;  5AFU L;  2WBL A;  2KLQ A;  2XHE B;  3FZM B;  3ZST A;  3PUX F;  2R6G F;  1KNZ A;  3M65 A;  3A8Y C;  3KV4 A;  5JDM A;  3C51 A;  3LK4 2;  3RC8 A;  2YKS A;  2V6Y A;  3ZMS B;  2NTX A;  1YQ4 A;  1HX8 A;  3IF8 B;  1YXR A;  3L09 A;  5BR8 T;  5J0Z A;  4IT4 A;  2XQY A;  4YSY A;  4I55 E;  3KIN B;  2VKJ A;  1XMQ T;  2UUC T;  1KFY A;  2C5J A;  5HXS A;  3RIU A;  2WU2 A;  3J9X 1;  4U72 A;  4JBW F;  2KT9 A;  2MAW A;  2W0G A;  1X79 A;  3GN5 B;  4PAG A;  2NTY A;  5CA1 E;  2H7V C;  4DV2 T;  4PJL A;  2ZM8 A;  1ZHC A;  1OWA A;  1FEW A;  3E08 A;  2LJL A;  5FXW A;  4OX9 T;  2LSI A;  3ETV A;  4P1N A;  3UU4 A;  2E5L T;  1D1B A;  4PFP A;  1T7S A;  3E0Z A;  2D9D A;  3UFE A;  4BJN A;  4YSZ A;  3KBT A;  2X0H A;  4UV8 B;  2QVA A;  4U31 A;  5ABF B;  2X0L B;  4ANJ A;  4CZZ B;  5EK2 A;  5LGT B;  5KXJ A;  4J2C A;  1U4Q A;  1IBK T;  1Z0P A;  1LKX A;  2J47 A;  3FZH B;  3ZCJ A;  4QXB B;  3ZLI A;  4CN4 A;  1IJ6 A;  3QB5 A;  4AQF A;  4H63 H;  5JDQ A;  4E7Z A;  1G8X A;  4DND A;  2H7O A;  4AXP A;  2C5I T;  3N5L A;  5HEO A;  1HNZ T;  4YTN A;  4LFB T;  5HCM A;  4U2Z A;  1VCT A;  3EHZ A;  2WY2 A;  3DJB A;  4U33 A;  4TUY E;  5DAB A;  3QOF A;  3UQ7 A;  4IE5 A;  3V5S A;  2KWH A;  3O9X A;  3OYX A;  4IDP A;  4COF A;  2FJD A;  4CQI A;  2WMN A;  4YTM A;  1WCR A;  2VUR A;  2YOE A;  2E2A A;  4LF8 T;  4AIS A;  2CBI A;  4ZI2 C;  3O1J A;  2EHO D;  3ANW A;  4DV3 T;  5DJQ C;  4I4T E;  2LRL A;  5L4H A;  1YKH B;  2E9X B;  1KK7 A;  2XJ7 A;  4H9N C;  4H9S E;  4JV5 T;  3WAK A;  2RPA A;  4DR7 T;  5AQT B;  3ZYM A;  4YJ3 E;  2BG9 E;  3N9N A;  2X9Y A;  3P7I A;  4PK5 A;  4YSX A;  2Q9Q B;  2XAS B;  3RC3 A;  3VRA A;  2QGS A;  3PUA A;  2BBH A;  2XQ9 A;  2ACX A;  4LF9 T;  2BS4 A;  3NVO A;  3EI0 A;  1HFA A;  4DUZ T;  1U5P A;  2CA5 A;  1YD8 G;  3ZCI A;  5JTG A;  3L39 A;  4ZI3 C;  4P0B A;  3FBL A;  3N9M A;  2V1D B;  2WB5 A;  4KMC A;  1BR4 A;  1R8I A;  2BS2 A;  1VRB A;  4O4I E;  4X20 E;  3RF1 A;  2WWV A;  3PUQ A;  4HWI B;  4AIU A;  4PJM A;  4QKN A;  3AEG A;  2BVL A;  3RYF E;  2LSY A;  3PUG A;  4EOZ B;  5JDH A;  3NBX X;  4TNV A;  4XAX B;  2NR4 A;  3RIA A;  4YTP A;  5AQQ B;  1BR1 A;  5CJ5 A;  4B3T T;  4QWN B;  4HFH A;  2NW9 A;  4IE4 A;  4B6X A;  2ZLY A;  4DMV A;  5HAX A;  4X65 T;  4H63 V;  3PU3 A;  4FJO A;  4Q25 A;  2D2S A;  5JR9 A;  2JRK A;  2VKH A;  1HR0 T;  2CEA A;  3Q5X A;  4HGA A;  4AKL A;  1LVK A;  3H3M A;  1UX5 A;  2CHO A;  1CHU A;  1S94 A;  5IYZ E;  1Y64 B;  1GQE A;  3CQG B;  2VL0 A;  2HPL A;  5EK4 A;  3FBZ A;  2H88 A;  2UXC T;  2W67 A;  2J1D G;  2CLY B;  4CN1 A;  5AQN B;  2B1E A;  4UF0 A;  2MYS A;  5ABG A;  3LSV A;  4UV9 B;  2CXF A;  1WYB A;  2Y8D A;  4QH1 A;  3AED A;  2LLY A;  4A56 A;  2XSA A;  2JQQ A;  1VCS A;  2KWI B;  2QRX A;  3J7Y q;  2J62 A;  4JUY A;  2LRK A;  4HFI A;  4AI6 A;  2XQ5 A;  1NWM X;  2VWA A;  3AEE A;  2WZI A;  2UUB T;  4CXX A;  4HFC A;  1YKE B;  3IBP A;  3ESL A;  4CXW A;  2I0M A;  2BG9 C;  2EHO B;  5LHG B;  1KF6 A;  2N1G A;  5JDL A;  3HR0 A;  4AKR B;  4TWH A;  3SFD A;  3N2G E;  2CWO A;  2WMO A;  1HTJ F;  2JQH A;  4A97 A;  3SS1 A;  1ZEE A;  2BBJ A;  4EB6 E;  4TZ4 C;  4LMK A;  4H9R C;  3ZMT B;  1JNR A;  3ZJ2 A;  5C3J A;  3N2K E;  2X66 A;  4HFD A;  1MIV A;  1YW0 A;  3I1A A;  5AQI B;  2ZM2 A;  5F8P A;  3O4X E;  2LOP A;  4ZEY A;  2MPK A;  1SHZ C;  3AE3 A;  2ZM6 T;  3M3Z B;  1IAP A;  2CE7 A;  1BR2 A;  4BJM A;  4ZXL A;  5AQR B;  3LFM A;  1E2A A;  3AA0 B;  3TLS A;  4DV5 T;  3P8C D;  4ZOL E;  4GKJ T;  1OED B;  3MK7 C;  4EV6 A;  4UEL A;  3QC9 A;  2VVN A;  3UU5 A;  2L9Q A;  4IL4 A;  2XAJ B;  5A1L A;  4AQY T;  2PTF A;  4O4L E;  3VKG A;  1MIY A;  3ONX A;  3RYI E;  2FJE A;  3PDY A;  2M67 A;  1O3X A;  5KMG P;  4AKH A;  5AQV B;  2DNX A;  3HI2 A;  4DV7 T;  4DR1 T;  4KHZ F;  4V1A v;  2KZ7 B;  2W63 A;  4ZZB A;  1M62 A;  1D1A A;  4HWD A;  2N2N A;  2IAK A;  1UX4 A;  4F6R C;  2RA1 A;  3KV9 A;  2MBG A;  2ACZ A;  2E9X D;  1D0Y A;  5L3E B;  2Y6X A;  1T72 A;  4ILU A;  4XBF B;  3ZT6 A;  1IZN B;  3RYH E;  3QB5 K;  4UVC B;  3WI3 A;  2Q9Q D;  3ZMU B;  2K48 A;  4HE8 A;  3JC6 C;  2XQ4 A;  4JI1 T;  3LBX B;  4U74 A;  4TNW A;  1IBL T;  4YFS A;  2NWB A;  5JRC A;  4HFE A;  4PJJ A;  2KMF A;  4HFB A;  2A3D A;  4IDQ A;  3ZKR A;  1V9D A;  3R6N A;  4DR4 T;  3ZC0 A;  2VVS A;  3EAB A;  2VKO A;  4JEH B;  1XZY A;  4X66 T;  2LKH A;  5L47 A;  2BG9 A;  3ZEF B;  4HWH A;  4WZX A;  5C8Y E;  4P0A A;  5LP6 E;  5ADX L;  3JAD A;  2LSJ A;  3B13 A;  2DCF A;  3UU3 A;  1HNX T;  1UUR A;  5J2U E;  4LF7 T;  2XQ7 A;  3RHW A;  4DMW A;  2W2U A;  3IHR A;  4L9I A;  3N2O A;  3JAF A;  3BK9 A;  4B3R T;  4Z90 A;  4Z8X A;  5CFB A;  3EDV A;  2YIN A;  5L3C B;  5LA6 E;  1QLB A;  2PBI A;  2LM2 A;  3VU7 H;  1WYC A;  1WLX A;  4K0K T;  2DL1 A;  2KSR A;  4I0U A;  2D0T A;  4U2Y A;  3TLV A;  3ABV A;  3PJA J;  3F2E A;  4JI6 T;  4QX8 B;  4O2B E;  2YU1 A;  2CWY A;  1MMG A;  2IC6 A;  3UTK A;  3LDQ B;  4X62 T;  2BKN A;  4JI2 T;  4LMJ A;  4QX7 B;  4IDZ A;  2CM0 A;  4GK5 E;  4MLK A;  5L3F B;  5E0O A;  1KNP A;  3LK2 B;  1OXZ A;  5JR9 B;  1LRZ A;  4PK4 A;  2WS3 A;  5FXX A;  5HEG A;  3RRW A;  4ERR A;  4H9O C;  2RP4 A;  4NXM T;  3KV5 A;  3EDU A;  3NWI A;  5AQG B;  3I9W A;  1UK5 A;  3C98 B;  2E5V A;  2XM1 A;  1HX1 B;  2V7I A;  1IJ5 A;  2E9X C;  2L8K A;  2E8I A;  4DV4 T;  1N36 T;  4NUV A;  5M4Y A;  5HEJ A;  2WWU A;  3AAI A;  3CX8 B;  2VQF T;  1QSD A;  2XQ3 A;  5FVK A;  2VL8 A;  3G06 A;  2Q9Q C;  3P50 A;  3SRZ A;  5FXZ A;  4I43 B;  2YN6 A;  5LMU T;  1SUM B;  3GA8 A;  2LEH A;  3P4S A;  1FMW A;  4EEB A;  2JQ9 A;  3R84 B;  3QK6 A;  5IHY A;  2XAH B;  1HS7 A;  2W61 A;  1J1J A;  3AXJ A;  4HEA A;  1N32 T;  3E22 E;  5CGM A;  2CCQ A;  3GN5 A;  3RQU A;  3PUZ F;  4ADZ A;  4ZS2 A;  2VQE T;  3RX6 A;  2DLR A;  2WAU A;  5JH7 E;  2G0U A;  4QH5 A;  4WNK A;  4DV1 T;  5JDN A;  4IE7 A;  2I6H A;  3PJA A;  2W00 A;  3LJC A;  4G2A A;  4OK0 A;  3HKC E;  1HCI A;  5AQU B;  3SOL A;  1HNW T;  1XDO A;  4OHF A;  4YY3 T;  4OYK A;  2FJA A;  3Q5D A;  2DHR A;  2XQA A;  3N9L A;  2MOZ A;  2WP9 A;  4EYU A;  5LBQ B;  1OED E;  4TWF A;  2WSS V;  4TWD A;  3I0O A;  1D0Z A;  3ETU A;  3AVS A;  3OTO T;  3AAA B;  3C4Z A;  4CI1 B;  3K1S A;  4HWF A;  2FBW A;  1BR0 A;  2UXX B;  2NW8 A;  2V5D A;  3ZYK A;  4X5T A;  3KVB A;  2XSB A;  4PNI A;  1N33 T;  4UVB B;  4EXT A;  3P4W A;  3P4R A;  3UU6 A;  2W4X A;  2YK0 A;  5L2L A;  5FY1 A;  2CLY C;  5LJN A;  3TLT A;  2WQY A;  1IBM T;  3FZK B;  4JI4 T;  4AKI A;  4C90 A;  5AQL B;  3T1Y T;  5AQF B;  3ZJ1 A;  3AE1 A;  2WCA A;  1SE7 A;  3RRC A;  1T98 A;  2CXL A;  2BVM A;  3ZC1 A;  2K5B B;  3T1H T;  2ES0 A;  4GKK T;  1FIO A;  2A9U A;  4HN9 A;  4ZZC A;  4EIW A;  4O4J E;  1G73 A;  3H3A A;  2CXD A;  4DR2 T;  4ASK A;  4JYA T;  3AB3 B;  4NIQ A;  2WDQ A;  2XY8 B;  3VHL A;  3AAE B;  1Y01 A;  5CB4 E;  3MZK B;  5IUX A;  4BAY B;  2EHO C;  2X0Y A;  2XUE A;  3CWZ B;  3B57 A;  4O2A E;  2LSK A;  2V6X A;  3HA4 A;  1I94 T;  2SPC A;  4O4H E;  3C4X A;  5JRC B;  1FJG T;  4KI0 F;  5J2T E;  4B3S T;  4DO0 A;  3K3O A;  2LSG A;  3JAE A;  1KEY A;  2V6Y B;  2WZH A;  2JQK A;  3NKZ A;  1XWM A;  5HWY A;  3L8R A;  3F57 A;  4I50 E;  3RIU C;  3U78 A;  4XZC A;  1ZOY A;  3NRX A;  3ZN0 B;  3ZYL A;  2CBJ A;  5FL1 A;  3AE7 A;  3KVA A;  3A5X A;  3OKQ A;  1XDP A;  2DI4 A;  2LT3 A;  3ONJ A;  2BS3 A;  3PUR A;  4PK6 A;  5HWX A;  3I0Q A;  2BG9 B;  5LGU B;  3Q5E A;  1M7K A;  2X67 A;  4IDO A;  1D1C A;  3F31 A;  1HF8 A;  4MAL A;  2IHR 1;  4HTE A;  3AVR A;  3ZPO A;  2IDO B;  3Q5W A;  4JEU B;  3PUS A;  3EVY A;  2VAS A;  5AQO B;  2V7M A;  4HKA A;  5LOV E;  4NPP A;  1OED C;  1WRD A;  4DID B;  3K3N A;  3MKD A;  5HXH A;  4O8S A;  1CUN A;  2LHN A;  1W09 A;  4K0U A;  5FY0 A;  3RYC E;  2UXB T;  3DP7 A;  4EYY R;  4KUM B;  1VOM A;  1XNR T;  1SA0 E;  3CX6 B;  4AQF C;  4IHJ E;  4JI7 T;  1I6Z A;  3OVU A;  2L3L A;  2XAQ B;  2VK9 A;  4KX6 A;  2C5K T;  2HN1 A;  2OA5 A;  3FXE B;  5H6R B;  4YLH A;  3CIR A;  3N9O A;  5HYA A;  3ZMV B;  4KBM B;  5AQJ B;  2XQ8 A;  4ILB A;  3WAJ A;  3KFW X;  4TV9 E;  1H7C A;  5LCY A;  2K3W A;  4BA9 A;  4U7I A;  3UUM A;  1KNR A;  5L3D B;  5FYM A;  4EZH A;  5JQG E;  4PFO A;  4UIG A;  3S4U A;  2B76 A;  4YHJ A;  4DV0 T;  2WU5 A;  4LFA T;  2JMH A;  2X9H A;  2BDE A;  3PUY F;  4ZS3 A;  5LYJ E;  3RH3 A;  3PE0 A;  3VRB A;  1X9B A;  4IIJ E;  2WDV A;  2EHO A;  3ANW B;  5AQS B;  3AEF A;  1NEK A;  4AKG A;  2ZM0 A;  3NZQ A;  4HWC A;  3NZP A;  1JNZ A; 
#chains in the Genus database with same CATH homology
 1NAF A;  3BQK A;  3PU3 A;  4FJO A;  5JR9 A;  2D2S A;  2JRK A;  5EZY E;  4GK0 E;  1ZKE A;  2V7I A;  3CVR A;  1IJ5 A;  3CML A;  2VKH A;  2E9X C;  2L8K A;  4DBR A;  3V5U A;  2E8I A;  3KV6 A;  2XTL A;  2CEA A;  3CQC B;  3MXZ A;  4NUV A;  4CXY A;  5M4Y A;  4CI3 B;  2PJQ A;  2WWU A;  2X9W A;  3Q5X A;  5LXT E;  4HGA A;  1WR6 A;  2KND A;  3AAI A;  3CX8 B;  1QSD A;  2P9B A;  3MAC A;  4ZI3 D;  4AKL A;  1LVK A;  2BZB A;  1UX5 A;  3SWH A;  1LVF A;  5HXE A;  2VL8 A;  2Q9Q C;  2JMK A;  5LBM A;  3SRZ A;  5FXZ A;  3VKH A;  3I9Y A;  4I43 B;  1S94 A;  3W15 B;  4WBN E;  5IYZ E;  1Y64 B;  5TAO A;  3CQG B;  3IEE A;  3BQL A;  2HPL A;  5EK4 A;  3UUX B;  2DWG A;  1US7 B;  2D5U A;  2UXN B;  4WW0 A;  3FBZ A;  3GA8 A;  5FMN A;  4ZI7 E;  2J1D G;  2LEH A;  4GOU A;  3AA6 B;  4TN7 B;  2CLY B;  1FMW A;  2JJ9 A;  2PFV A;  4QXC B;  3R84 B;  2B1E A;  3QK6 A;  4UF0 A;  5IHY A;  1HG2 A;  2MYS A;  4MHC A;  2XAH B;  4H9P C;  3CX7 B;  1HS7 A;  2W61 A;  2JPF A;  3EUH A;  2GK9 A;  3ZMZ B;  1AJ3 A;  4UV9 B;  2CXF A;  1WYB A;  4HEA A;  3E22 E;  4GYS A;  2Y8D A;  3UT5 E;  5FP3 A;  3MA9 A;  2CCQ A;  3GN5 A;  4A56 A;  2LE8 A;  2JQQ A;  3CQX C;  2KWI B;  5GON E;  2A2F X;  2YU2 A;  4DVD A;  4EAH A;  4ADZ A;  4ZS2 A;  5ETW A;  4GYR A;  3J7Y q;  4JUY A;  3Q2M A;  3C64 A;  3RX6 A;  5CA0 E;  2DLR A;  2MTQ A;  2WAU A;  4AQG A;  4AI6 A;  1MMD A;  5JH7 E;  2G0U A;  3DTO A;  4WNK A;  5JRE A;  1NWM X;  3AA1 B;  5FY7 A;  5JDN A;  1E1H B;  4IE7 A;  5L3G B;  2VWA A;  2W00 A;  3LJC A;  4PW8 A;  5H6Q B;  4G2A A;  5J1G A;  4CXX A;  4OK0 A;  3HKC E;  1YKE B;  1HCI A;  3IBP A;  3OJA A;  5JR9 C;  3SOL A;  3ESL A;  4CXW A;  2EHO B;  5LHG B;  3PTR B;  1HG5 A;  2V7K A;  3GMI A;  2CMR A;  3CPZ A;  4OHF A;  3O1H A;  4ZI2 D;  2N1G A;  5KX5 E;  4OYK A;  1FMV A;  2XAF B;  2DHR A;  3C4W A;  3HR0 A;  5JDL A;  3N9L A;  2MOZ A;  5L3B B;  4EYU A;  4NUU A;  4E7S A;  5HXC A;  4AKR B;  5LBQ B;  3N2G E;  4M1P A;  4TX5 A;  3O1I A;  3KDS E;  1MMN A;  2CWO A;  2WSS V;  2WMO A;  1HTJ F;  3I0O A;  3SS1 A;  1UCU A;  1D0Z A;  2Y48 B;  3ETU A;  5AFU L;  3AVS A;  1ZEE A;  3GWH A;  2WBL A;  4EB6 E;  2KLQ A;  2XHE B;  4TZ4 C;  4FI5 A;  2HH7 A;  4H9R C;  3ZMT B;  3AAA B;  1KNZ A;  3ZJ2 A;  3M65 A;  3KV4 A;  3C4Z A;  5JDM A;  2D0U A;  3C51 A;  3LK4 2;  3N2K E;  2X66 A;  4CI1 B;  2NW7 A;  3RC8 A;  3ZMS B;  4QHO A;  1MIV A;  2NTX A;  1YW0 A;  2KXP B;  3I1A A;  1BR0 A;  2UXX B;  2NW8 A;  2ZM2 A;  1S35 A;  5F8P A;  3LBX A;  3HKE E;  3O4X E;  1HX8 A;  3ZYK A;  2LOP A;  3KVB A;  3IF8 B;  3L09 A;  4PNI A;  1SHZ C;  4UVB B;  1MNE A;  4QXH B;  4TV8 E;  2LHR A;  4EXT A;  2KIN B;  2XQY A;  2LM9 A;  4I55 E;  3KIN B;  2Z6E A;  2VKJ A;  3KBU A;  1IAP A;  2YK0 A;  5L2L A;  2CE7 A;  2CLY C;  2X68 A;  4UF0 B;  5FY1 A;  5LJN A;  1BR2 A;  3K8P C;  5DQW A;  5HXR A;  4BJM A;  2C5J A;  5HXS A;  4AKI A;  4C90 A;  2C0S A;  2VKD A;  3J9X 1;  3HL6 A;  4U72 A;  3MJX A;  3ZJ1 A;  4IST A;  2KT9 A;  3LFM A;  2W0G A;  1X79 A;  3GN5 B;  4PAG A;  1T98 A;  3RRC A;  2NTY A;  5CA1 E;  2H7V C;  4L5G A;  5BMV E;  2NOX A;  2X51 A;  3AA0 B;  2CXL A;  5LJM A;  5KDM C;  2BVM A;  3P8C D;  3ZC1 A;  2K5B B;  4PJL A;  2ZM8 A;  4ZOL E;  4MBQ A;  1ZHC A;  4KP3 C;  3UUL A;  2ES0 A;  1OWA A;  3MK7 C;  1FIO A;  4UEL A;  3QC9 A;  4C91 A;  2V7L A;  4HN9 A;  1FEW A;  3Q9D A;  3E08 A;  4O4J E;  2LJL A;  5FXW A;  4EIW A;  3LG7 A;  2L9Q A;  1G73 A;  2XAJ B;  5A1L A;  3H3A A;  4GIW A;  2CXD A;  4O4L E;  2LSI A;  3ETV A;  2V7J A;  3PU8 A;  4WBO A;  3VKG A;  4ASK A;  1MIY A;  3ONX A;  3RYI E;  3AB3 B;  1D1B A;  2K24 A;  4PFP A;  3PDY A;  2ZMA A;  2M67 A;  1O3X A;  5KMG P;  3VHL A;  3E0Z A;  4AKH A;  3HKB E;  2DNX A;  3AAE B;  3HI2 A;  4YJ2 E;  3UFE A;  5CB4 E;  3MZK B;  4BJN A;  3KBT A;  2EHO C;  4BAY B;  4V1A v;  4UV8 B;  2XUE A;  2IW5 B;  3CWZ B;  2KZ7 B;  3B57 A;  4O2A E;  2LSK A;  2W63 A;  3HA4 A;  2X0L B;  4ANJ A;  2ODU A;  4CZZ B;  1D1A A;  5EK2 A;  5LGT B;  2N2N A;  4J2C A;  3ZN1 B;  2IAK A;  1UX4 A;  1U4Q A;  4F6R C;  2RA1 A;  3KV9 A;  5LNK A;  1Z0P A;  1D0X A;  2MBG A;  1LKX A;  2YEV C;  2E9X D;  5LHH B;  3ZCJ A;  2SPC A;  4QXB B;  3ZLI A;  1D0Y A;  4O4H E;  3C4X A;  5LHI B;  5L3E B;  2Y6X A;  5JRC B;  4H9Q C;  1IJ6 A;  4ILU A;  4N78 D;  4AQF A;  5F3J A;  5J2T E;  4XBF B;  4DO0 A;  4H63 H;  3T8O A;  3K3O A;  1IZN B;  2H3R A;  3RYH E;  2LSG A;  3BQI A;  4UVC B;  1G8X A;  4E7Z A;  5JDQ A;  4DND A;  4OFZ A;  2H7O A;  3WI3 A;  2K9A A;  3FXD B;  4AXP A;  2C5I T;  3N5L A;  2Q9Q D;  3ZMU B;  2K48 A;  4HE8 A;  3JC6 C;  4UVA B;  5HWY A;  3F57 A;  1B7T A;  3LBX B;  4I50 E;  1QUU A;  4U74 A;  3U78 A;  4XZC A;  3ZN0 B;  3NRX A;  3U3I A;  4YFS A;  3ZYL A;  2NWB A;  3KVA A;  3LK3 B;  3A5X A;  5JRC A;  3OKQ A;  2DI4 A;  2LT3 A;  4PJJ A;  5JVD E;  4PJN A;  3OBV E;  3PUR A;  2KMF A;  4PK6 A;  2A3D A;  5HWX A;  3DJB A;  3I0Q A;  1V9D A;  3R6N A;  4IGU A;  5LGU B;  2I59 A;  4TUY E;  3ZC0 A;  1EZ3 A;  5DAB A;  5FXV A;  2X67 A;  2VKO A;  1D1C A;  3F31 A;  4IE5 A;  1HF8 A;  4JEH B;  4MAL A;  3RPU A;  4HTE A;  2QA7 A;  3AVR A;  4ISS A;  3V5S A;  3ZPO A;  2KWH A;  3O9X A;  3Q5W A;  4CI2 B;  3UUN A;  3OYX A;  4JEU B;  4CQI A;  2WMN A;  3PUS A;  3H37 A;  3EVY A;  2VAS A;  2NP9 A;  2PG8 A;  5JDG A;  3ZEF B;  2V7M A;  4HKA A;  3N9Q A;  5LOV E;  4ZI2 C;  3O1J A;  2EHO D;  3ANW A;  4UEM A;  5C8Y E;  4P0A A;  1WRD A;  3K3N A;  5LP6 E;  3D0T A;  5FNV E;  3MKD A;  5ADX L;  5HXH A;  5DJQ C;  4I4T E;  4O8S A;  3QUJ A;  3FHN A;  2LSJ A;  1CUN A;  2LHN A;  3B13 A;  2DCF A;  1YKH B;  4K0U A;  2E9X B;  2IC9 A;  1KK7 A;  3OYZ A;  4H9N C;  4H9S E;  5FY0 A;  3RYC E;  3WAK A;  5J2U E;  2V26 A;  2XAG B;  3DP7 A;  4DMW A;  2N9D A;  4EYY R;  3ZYM A;  4P09 A;  3IHR A;  4KUM B;  4YJ3 E;  4L9I A;  1VOM A;  3HKD E;  3N2O A;  4DBQ A;  3CKD A;  1SA0 E;  3CX6 B;  3N9N A;  4AQF C;  2X9Y A;  3BK9 A;  4IHJ E;  4X1I E;  3P7I A;  4PK5 A;  4Z8X A;  2Q9Q B;  2XAS B;  3RC3 A;  2QGS A;  3PUA A;  4L0R A;  2L3L A;  2XAQ B;  2ACX A;  2VK9 A;  3EDV A;  2E9X A;  2YIN A;  3JC6 D;  5L3C B;  4G63 A;  4OYJ A;  2C5K T;  2OA5 A;  5LA6 E;  2PBI A;  2X9X A;  3VU7 H;  3FXE B;  5H6R B;  1WYC A;  1WLX A;  1HFA A;  1U5P A;  5LG4 A;  4YLH A;  2CA5 A;  1YD8 G;  3ZCI A;  4HFV A;  4ZI3 C;  4P0B A;  3FBL A;  3NRY A;  2D0T A;  3N9M A;  3N9O A;  2V1D B;  2Q9Q A;  5HYA A;  4KMC A;  1BR4 A;  1ZV4 X;  4IE0 A;  3ZMV B;  3F2E A;  3TKL B;  1VRB A;  4QX8 B;  4O4I E;  1MIW A;  4X20 E;  4O2B E;  2YU1 A;  4KBM B;  3PUQ A;  2DWK A;  4X1K E;  2VB6 A;  4PJM A;  4QKN A;  3N9P A;  2CWY A;  3WAJ A;  1MMG A;  3KFW X;  4TV9 E;  2IC6 A;  1H7C A;  4IE6 A;  3L3P A;  2LOS A;  2BVL A;  3RYF E;  3UTK A;  5LCY A;  1MMA A;  2LSY A;  4BA9 A;  3PUG A;  3UUM A;  4EOZ B;  5JDH A;  3NBX X;  5L3D B;  5FYM A;  4EZH A;  5JQG E;  4PFO A;  4UIG A;  4QX7 B;  3S4U A;  4XAX B;  4IDZ A;  2CM0 A;  4GK5 E;  4MLK A;  3RKO A;  4YHJ A;  5L3F B;  5E0O A;  4UXN B;  2JMH A;  2X9H A;  2BDE A;  3LK2 B;  4ZS3 A;  3FB2 A;  5LYJ E;  2HPJ A;  3RH3 A;  1OXZ A;  1BR1 A;  2A72 A;  1LRZ A;  3PE0 A;  5JR9 B;  4PK4 A;  4EZ4 A;  5DQV A;  5EK3 A;  5FXX A;  4QWN B;  5JDF A;  3RRW A;  4IIJ E;  2NW9 A;  4ERR A;  2EHO A;  1MND A;  2WM9 A;  3AA7 B;  3ANW B;  4H9O C;  2RP4 A;  4X1Y E;  3K3Q C;  4AKG A;  2W62 A;  3KV5 A;  4IE4 A;  4B6X A;  2ZM0 A;  5LGN B;  3EDU A;  2ZLY A;  3NZQ A;  4DMV A;  5HAX A;  2ODV A;  4MFR A;  3C50 A;  3I9W A;  4JLE A;  3C98 B;  3NZP A;  4ZHQ E;  4H63 V; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...