3CX7B

Crystal structure of pdzrhogef rgrgs domain in a complex with galpha-13 bound to gdp-alf4
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
196
structure length
193
Chain Sequence
LIIGPEEDYDPGNESDIIFQDLEKLKSHPAYLVVFLRYILSQADPGPLLFYLCSEVYQQTNPKDSRSLGKDIWNIFLEKNAPLRVKIPEMLQAEIDLRLRNNEDPRNVLCEAQEAVMLEIQEQINDYRSKRTLGLGSLYGENDLLGLDGDPLRERQMAEKQLAALGDILSKYEEDRSAPMDFAVNTFMSHAGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Recognition of the Activated States of Galpha13 by the rgRGS Domain of PDZRhoGEF.
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein
molecule keywords Guanine Nucleotide-Binding Protein Galpha 13
total genus 64
structure length 193
sequence length 196
ec nomenclature
pdb deposition date 2008-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF09128 RGS-like Regulator of G protein signalling-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1850 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3cx7B00
4IGUA 4GOUA 2ACXA 1IAPA 3AB3B 3C4ZA 2ES0A 3QC9A 3CX6B 1SHZC 3C4XA 4PNIA 4WNKA 1HTJF 3C50A 4L9IA 3CX7B 3CX8B 4WBOA 4YHJA 3C51A 2I59A 2A72A 3T8OA 2PBIA 2DLRA 3C4WA 1ZV4X
chains in the Genus database with same CATH superfamily
5LYJE 3GN5A 5TAOA 3N9NA 2BKOA 4U33A 1T7SA 4IDZA 5AQMB 4X66T 4JI0T 4QX7B 4ZI3C 4YFSA 5HEGA 3ZMZB 5L4HA 5FMNA 5AQIB 2BZBA 3ZMTB 3C4XA 2BBJA 3GN5B 3P4SA 4EZ4A 2CBJA 3OBVE 3M3ZB 4H9NC 3CK6A 4N78D 3RQWA 3ZC0A 2WZHA 4MFRA 3N9OA 4JLEA 2X9YA 4ZI3D 3AEEA 5LHGB 1WRDA 2RPAA 1QUUA 1FIOA 1VCTA 3UFGA 5HEHA 5AQPB 4GK0E 4PJLA 4IDPA 1W09A 2A9UA 3VU7H 5JDGA 5JR9C 3RH3A 3F2EA 5LMNT 1E1HB 2L9QA 4IE6A 3KV6A 4TN7B 4WBOA 1QLBA 4Z91A 1MMAA 2W66A 1D0YA 2EHOC 2XQYA 4YY3T 4CN4A 1HNZT 5FY0A 4IDQA 5AQLB 2NW9A 4GYRA 3OPCA 3GMIA 2J62A 2VWAA 2WDQA 1MMGA 3I0OA 3L39A 2LSYA 5LGTB 2UXNB 4AI6A 1M62A 4GOUA 5CFBA 4DR4T 5L3CB 5L3DB 3QC9A 3B57A 2KWIB 3FXEB 4TNWA 3FB2A 4ZOLE 3J9X1 2B76A 1HG5A 1BR2A 2D2SA 3HA4A 3HR0A 4ILUA 5EZYE 3UFEA 3UUXB 1NAFA 2W0GA 3MACA 3N2OA 3ETVA 2VURA 3O1IA 3RRCA 3TLVA 5JQGE 3NZPA 3C98B 4H9SE 3ZT7A 4LF7T 1YXRA 1LRZA 5J1GA 3LJCA 3ZYLA 5CA1E 3SFDA 2LLYA 2X0HA 5CGMA 1MMNA 2LSKA 3PUZF 2X9HA 1R8IA 5LA6E 4OYJA 3VRBA 2QGSA 2CPTA 2NP9A 4KI0F 2WWUA 3A5XA 2VKOA 3Q5EA 5FY1A 5H6QB 2UXBT 4UXNB 3N9LA 3UUNA 5AQKB 3PE0A 3CMLA 1HR0T 4WBNE 4MHCA 4H9RC 3ESLA 2ZM2A 4LFCT 1YD8G 3ZYKA 4DR1T 4CQIA 1D1CA 3IA3A 1BR1A 1KF6A 3JC6D 3RKOA 4ZI7E 1T98A 1XMOT 4IL4A 5CB4E 5LJMA 5LG3A 3NBXX 1YQ4A 5E0OA 4NPPA 5CJ5A 4FI5A 5AQTB 2XAHB 5HCJA 1MMDA 1WR6A 2E9XD 1HX1B 2MOZA 4U3CA 4WZXA 3ZN0B 4CXWA 5FVKA 5HXSA 4I55E 2XM1A 3PTRB 2HPJA 3CQXC 4DV5T 1WR0A 3ABVA 1G8XA 3KDSE 4TWHA 5LBQB 4HWDA 1DU2A 4AQYT 3RI5A 3LBXB 2FJBA 1YKEB 2BS4A 3AE3A 2LHNA 3VRAA 3AEBA 2CCQA 4A98A 4ZEYA 3B5MA 3IHRA 2UUCT 3ONLC 5HXCA 2E9XA 3ZSSA 5IUXA 1EZ3A 3PJAA 4X1YE 3ZCIA 2BVMA 2LSGA 1LVFA 2H88A 2V6XA 2CXLA 2V7LA 4ERRA 3CKDA 2ZLYA 2KNDA 3K3OA 1WLXA 1OEDC 4YJ2E 2KLQA 5HEUA 3ZYMA 2ES0A 2H7OA 4U2ZA 3RPUA 3H3AA 5KX5E 3VKHA 2WCAA 4YTPA 3RIUC 3PJAJ 2VKJA 4JEUB 5HXHA 4YTMA 2KSRA 3GA8A 1L0VA 3ZC1A 3KINB 3LFMA 2FUPA 3AVSA 3PU3A 3EUHA 5KXJA 2C5IT 3P7IA 3L8RA 3IF8B 4HFCA 3MA9A 4WNKA 5AQFB 4BJMA 2K9AA 4XZCA 4HTEA 3P4RA 4JV5T 1UX5A 4MALA 4X1IE 2DWKA 2XAQB 2V1DB 1D1BA 4O4LE 2XUEA 2C5KT 3CX8B 4UIGA 1IBKT 1IBLT 3ANWB 4B3ST 3AEGA 4EXTA 3K3QC 2WMOA 2XQAA 1ZOYA 3ETUA 4JI7T 5JVDE 2XAGB 4PW8A 2V7MA 1BR4A 2JQ9A 2X0LB 3ANWA 3AXJB 3N9MA 3U78A 5CA0E 3L3PA 3S4UA 4DR2T 2VVSA 4IREA 3AEDA 3TLWA 3PUAA 3ZJ2A 3UUBA 5KMGP 3PUSA 2DWGA 3ZMUB 3UU5A 2BVLA 4M1PA 2DL1A 3EHZA 5BR8T 4B3MT 4CI1B 1M7KA 1SHZC 2VKHA 3UU4A 1FJGT 5ETWA 3CIRA 3E0ZA 4I0UA 1IJ5A 3KVAA 4I4TE 2LM9A 2VB6A 3Q2MA 4MLKA 4ZI2C 3OYXA 1MIVA 4ZZBA 4CXYA 4IE7A 2X0YA 2FJEA 1QSDA 3QOFA 3T1YT 3CQGB 4A97A 4EYYR 4DBQA 4QXCB 4P1NA 3O4XE 1J1JA 1KNRA 4WYVA 3MJXA 2YINA 2BG9B 3SOLA 2C5JA 2IIUA 4AKIA 4HN9A 5ABHA 4QH1A 2IDOB 3TLUA 2Y8DA 3RYHE 3ZKRA 3OKQA 2JIWA 5FP3A 2UXXB 1IAPA 1N34T 4TV9E 1AJ3A 3AE1A 2IC9A 2R6GF 3KFWX 3PDYA 4QXHB 4LMLA 1IJ6A 2VL8A 3CX6B 4UVAB 4CI2B 4BA9A 2V6YA 4JI1T 2E5VA 3AAIA 3ZT6A 1HS7A 2CEAA 3JC6C 2BKPA 2UU9T 3ZSTA 4KP3C 4TWFA 4DBRA 5JRCA 1FMWA 3HKEE 4OK0A 1XZYA 4H63V 1LVKA 2W62A 1HTJF 2FBWA 4LFAT 3R6NA 2NR4A 2YN6A 4ASKA 5EK2A 1Y01A 2YU1A 4X65T 4LFBT 2XAJB 2G0UA 5F8PA 4JI8T 2KMFA 1NEKA 4YHJA 3RF1A 5F3JA 4HFIA 3H3MA 2B1EA 4PJNA 2WWVA 3RX6A 3UUMA 1OEDB 3CVRA 5AFUL 2MBGA 5LNKA 1W9RA 2CM0A 2VL0A 3A8YC 3EDUA 3QB5A 4ISSA 2YDSA 4LMKA 2CE7A 2WAUA 5JDMA 1X79A 4YHHT 4G63A 5IHYA 4ADZA 4HFBA 3KBTA 4EV6A 4DV3T 3VR9A 2BDEA 2E2AA 3O1JA 2X9WA 3AXJA 4IIJE 3ONJA 5HXRA 3AA0B 3K8PC 4IE4A 5FVLA 2M67A 2LE8A 2Y48B 5HYAA 1NWMX 3PUVF 5C3JA 5HAXA 1U5PA 2L3LA 4Z90A 3TLSA 2YDQA 3FBZA 5M4YA 2VK9A 3HI2A 3P4WA 4Z8XA 4DR6T 4JBWF 2JMHA 3O1HA 4F8HA 1N36T 2BBHA 2XAFB 2CBIA 4CN1A 3RC3A 4C91A 4E7ZA 4P09A 2LHRA 5LBMA 1I94T 4UF0A 1MNEA 4J2CA 1N33T 5C8YE 1OXZA 3V5SA 1OEDE 2VQET 3BK9A 3FZLB 3L09A 5H6RB 4PJMA 5IYZE 4AQFC 1W0AA 1IZNB 4HFHA 4BJNA 2XM2A 1KNPA 5AQGB 3OYZA 4ILCA 3ZMSB 4B6XA 2QVAA 4O4HE 1UK5A 4KMCA 4UEMA 4YJ3E 4I43B 1VRBA 1XDPA 3DP7A 2BG9A 2MPKA 4HWHA 2LM2A 3RYCE 1X9BA 2IUBA 3WAKA 1OWAA 3NRXA 5LOVE 2PG8A 2LEHA 4QHOA 3P4QA 3UQ4A 5ABFB 1ZHCA 4QKNA 4PK4A 4HE8A 4YTNA 5JH7E 4DR5T 4PNIA 3PUYF 4AQGA 3UTKA 2LKHA 5JDHA 4QH4A 3N2GE 3RKGA 3AA7B 5LP6E 2CHOA 3NRYA 5FKYA 2YU2A 4COFA 3E22E 5J2UE 4AKHA 2H3RA 1KK7A 4IT4A 4OX9T 5JRCB 4UVCB 1SE7A 1FMVA 2WY2A 5LJNA 4ANJA 4U7YA 1J5WA 3U3IA 3OJAA 1O3XA 3RYIE 3HL6A 2F4VT 3B13A 2XQ9A 5ABGA 4B3RT 4NIQA 2XQ5A 2BKNA 2CXDA 1OEDA 1ZV4X 3PUQA 3QK6A 2X9XA 2WMNA 3AE9A 3C64A 4HWIB 2WQYA 3F31A 4H9OC 4AKLA 5JDNA 3QUJA 5FY7A 3RIAA 3SS1A 4DV0T 1Z8UA 2D0TA 2Z6EA 4U74A 3AAEB 4CXXA 2HPLA 2A3DA 2DHRA 2XJ7A 3NZQA 5JTGA 5LGUB 2N9DA 1WYBA 2X68A 2WU2A 4PK5A 1ZKEA 2WBLA 4OYKA 4H63H 3LSVA 4ZZCA 2IAKA 4IE0A 2KZ7B 4L9IA 5IWAT 1CHUA 1VOMA 3AA6B 1S35A 4YLHA 3LK3B 2JRKA 4IDOA 2MTQA 5DABA 2Y6XA 5AQQB 2IC6A 2OLTA 1B7TA 2WZIA 4YSZA 4NXNT 1ZP0A 3ZPOA 2XQ6A 3FZHB 4AIUA 5HXEA 3P50A 1D1AA 5FXXA 1KNZA 1UURA 2XY8B 1HCIA 1E2AA 1Y64B 4PK6A 1G73A 5AQRB 4C90A 3SRZA 3PUXF 2M6IA 3N5LA 3SFEA 3DTOA 4IGUA 2V6YB 2W00A 3QB5K 2WS3A 2E9XB 4PJJA 4O4JE 4UV9B 3FZKB 5FXZA 2V7JA 5FXVA 4AKRB 5BMVE 2J4GA 3BQIA 4ZI2D 4YXDA 2YK0A 4EAHA 4GK5E 5L2LA 1XNQT 2UXCT 2NW7A 2ODUA 4JI3T 1UUSA 2QYWA 1HX8A 5AQHB 2DI4A 3HKDE 2KT9A 4O2BE 4K0KT 4JUYA 4KHPT 3C50A 3LK2B 1HNWT 5J0ZA 5J2TE 4LMJA 3MZKB 2YOEA 3AAAB 1U4QA 3NKZA 2RP4A 1SUMB 2V5CA 2VQFT 3PU8A 2I0MA 4JI5T 5JREA 3OVUA 1V9DA 3M65A 1KEYA 3P4PA 4U2YA 2K3WA 3H37A 4X1KE 2K5BB 4TNVA 5LHIB 4E7SA 5LXTE 3RHWA 4PFPA 3T1HT 2YEVC 2QA7A 3A7MA 2E5LT 3JCFA 2M6BA 2LOSA 2CMRA 2Q9QD 4GYSA 2ACXA 4HEAA 5FL1A 2FJAA 3LDQB 4YSYA 3J7Yq 2V7KA 2XQ4A 4HWCA 4TWDA 4U31A 2V8SV 4ILBA 2E9XC 4CI3B 2D9DA 2V5DA 5JDLA 2VASA 2LRKA 1VCSA 1JNRA 2XQ7A 5AQVB 4B3TT 4ZS2A 1LKXA 4NUVA 4EEDA 4ZS3A 3P8CD 3KBUA 4AKGA 1YKHB 2NTYA 2OA5A 2JQQA 3CX7B 2V7IA 2CWYA 2N1GA 3PV0F 3MXZA 3RQUA 5JDQA 4EOZB 4NXMT 3PURA 2RA1A 5JDFA 3UU8A 4IHJE 1UX4A 2KINB 3CPZA 4A5XA 4G2AA 2LT3A 3O9XA 1HFAA 3D0TA 2ZM0A 4QWNB 3UULA 4P0AA 3G06A 5AQNB 5HEJA 3KV4A 2JQHA 5FL0A 2LJLA 2P9BA 3C4ZA 2XQ8A 2W63A 4O8SA 3VKGA 4CN6A 3EDVA 2SPCA 2IMLA 3N2KE 3FZFB 2ACZA 4HKAA 2DNXA 2BS3A 5A1LA 2JPFA 2WB5A 3CQCB 2NWBA 3NWIA 4L0RA 1MIYA 3ZCJA 5LG4A 3AE4A 3I9YA 2ZM8A 1FEWA 4EYUA 2D5UA 2NW8A 3I0QA 4AQFA 5DQWA 1XMQT 4PAGA 2UUBT 3AECA 3Q5XA 5F5WA 5HEOA 2I59A 3LK42 4KX6A 5FNVE 4ZXLA 3T8OA 2XTLA 5JR9A 2X67A 4UVBB 3RIUA 5FYMA 3X1DA 4KUMB 4UV8B 3ZT5A 4DMVA 3C4WA 3JADA 5AQUB 4EGWA 4YSXA 4DV4T 2GK9A 4GKJT 1KFYA 2PJQA 3Q5WA 2H7VC 3ZMVB 2WP9A 2ODVA 5JR9B 4AISA 3Q5DA 1WCRA 3MKDA 2XQ3A 5AQOB 3WAJA 4TUYE 1WFDA 4DR7T 3E08A 5EK4A 2UUAT 5FXWA 1UCUA 2CWOA 4KHZF 4JI6T 2XPKA 3N9PA 4MBQA 4P0BA 4LF8T 3W15B 3LBXA 1XNRT 4QXBB 4A56A 5AQSB 2V26A 1US7B 3RRWA 4JYAT 2CLYC 2CRBA 2KWHA 2PFVA 4IL9A 2VVNA 4Q25A 2LOPA 4X62T 4DUYT 3AE2A 3SWHA 1GQEA 2UXDT 2Q9QC 1T8BA 4AXPA 1HG2A 4L5GA 5DQVA 5ABEA 3UT5E 2PBIA 4UF0B 4OFZA 4TZ4C 1W0BA 2EHOD 1T72A 5L47A 4DR3T 4LF6T 4PFOA 4NUUA 3QNUA 3UU6A 2XASB 4HGAA 5AQJB 5L3GB 5LMUT 4H9PC 2EHOB 4V1Av 2K24A 3RC8A 4WW0A 3PUWF 4UELA 4EZHA 3AE8A 3K1SA 3BQKA 5GONE 2X66A 2QRXA 4EB6E 3F57A 3Q9DA 4FJOA 4HFEA 2WDRA 2AE9A 3TKLB 1JNZA 4X5TA 2MAWA 1Z0PA 2BG9C 4X64T 2JMKA 3AE6A 4ISTA 5DJQC 5ABFA 1XWMA 4GIWA 4JI2T 2LKGA 4DO0A 3AEAA 3IEEA 2IW5B 4QX8B 1N32T 2CLYB 1YW0A 2LSJA 3ONXA 1HF8A 3KV5A 2Q9QA 3FZMB 4DVDA 1I6ZA 2VKDA 2ZM6T 2OV9A 5HWXA 2KXPB 3K3NA 1J5ET 4EIWA 3RYFE 2BG9E 2LSIA 1XDOA 2NTXA 1YQ3A 2H89A 2N2NA 3LG7A 5L4EA 2XHEB 4O4IE 2LRLA 2JJ9A 3N9QA 3AB3B 5LHHB 5L3FB 4DV2T 2CXFA 2HH7A 2X51A 3KVBA 5EK3A 5LB7B 3UU3A 1MNDA 1NENA 2DCFA 5HCMA 4XAXB 2IHR1 2MYSA 3RIFA 1IBMT 3AE5A 4KBMB 3VR8A 3AA1B 5LCYA 2YDRA 3EABA 5C2TA 2CHNA 2HN2A 2WM9A 4LF5T 1WYCA 4TV8E 2J1DG 2WSSV 4HFVA 4QH5A 3HKBE 3EI0A 4TX5A 2W61A 2WDVA 2W4XA 2AXDS 3AEFA 3IBPA 4LF4T 1UGOA 4U72A 2FJDA 4DV6T 3ZJ1A 4HWFA 2BS2A 4I50E 2CA5A 3GWHA 5HWYA 1S94A 3R84B 2A72A 2JQKA 3WI3A 4UR9A 3OTOT 2PTFA 2HHHT 3PUGA 2D0UA 3NVOA 4O2AE 4BAYB 4DIDB 4EEBA 1CUNA 3DJBA 3KV9A 1HNXT 2HN1A 3AVRA 3JAFA 2L8KA 3EVYA 4K0UA 4OHFA 3RGLA 5L3BB 1H7CA 4JI4T 2A2FX 4XBFB 3JAEA 3ZEFB 4ZHQE 2W67A 2YKSA 3EAMA 5ADXL 5L3EB 3UQ7A 2W2UA 4YT0A 4HFDA 4DNDA 4DV1T 3CWZB 2EHOA 3I1AA 1D0XA 5LGNB 4CZZB 4DUZT 4H9QC 4U7IA 3V5UA 1D0ZA 4F6RC 4ILAA 5KDMC 4X20E 4LF9T 2XSBA 3MK7C 1SA0E 3RLFF 3TLTA 2I6HA 3I9WA 2K48A 3C51A 2E8IA 2XZEA 2ZMAA 3VHLA 3ZN1B 4DV7T 2XSAA 3BQLA 3FHNA 4IDNA 4IE5A 3ZLIA 2C0SA 3FBLA 4DMWA 2WU5A 4JEHB 3FXDB 3HKCE 2DLRA 1E7PA 1ZEEA 2J47A 2Q9QB 3AE7A 1BR0A 1MIWA 2NOXA 4GKKT
chains in the Genus database with same CATH topology
5LYJE 3GN5A 5TAOA 3N9NA 4IDZA 4QX7B 4ZI3C 4YFSA 3ZMZB 5FMNA 3ZMTB 2BZBA 3C4XA 3GN5B 4EZ4A 5JDHA 3OBVE 4H9NC 4N78D 3ZC0A 4ZI3D 4MFRA 3N9OA 4JLEA 2X9YA 5LHGB 1WRDA 1QUUA 1FIOA 4GK0E 4PJLA 3VU7H 5JDGA 5JR9C 3RH3A 3F2EA 1E1HB 2L9QA 4IE6A 3KV6A 4TN7B 4WBOA 1MMAA 2XQYA 1D0YA 2EHOC 5FY0A 2NW9A 4GYRA 3GMIA 2VWAA 3I0OA 1MMGA 2LSYA 5LGTB 2UXNB 4AI6A 4GOUA 5L3CB 3QC9A 3B57A 2KWIB 3FXEB 4ZOLE 3FB2A 3J9X1 2D2SA 1HG5A 1BR2A 3HA4A 3HR0A 5EZYE 4ILUA 3UFEA 3UUXB 1NAFA 2W0GA 3MACA 3N2OA 3ETVA 3O1IA 3RRCA 5JQGE 3NZPA 3C98B 4H9SE 1LRZA 5J1GA 3LJCA 3ZYLA 5CA1E 1MMNA 2LSKA 5LA6E 2X9HA 4OYJA 2QGSA 2NP9A 2WWUA 3A5XA 2VKOA 5FY1A 5H6QB 4UXNB 3N9LA 3UUNA 3PE0A 3CMLA 4WBNE 4MHCA 4H9RC 3ESLA 2ZM2A 1YD8G 3ZYKA 4CQIA 1D1CA 1BR1A 3RKOA 3JC6D 4ZI7E 1T98A 5CB4E 5LJMA 3NBXX 5E0OA 4FI5A 2XAHB 1MMDA 1WR6A 2E9XD 2MOZA 3ZN0B 4CXWA 5HXSA 4I55E 3PTRB 2HPJA 3CQXC 3KDSE 1G8XA 5LBQB 3LBXB 1YKEB 2LHNA 2CCQA 3IHRA 5HXCA 2E9XA 1EZ3A 4X1YE 3ZCIA 2BVMA 2LSGA 1LVFA 2V7LA 4ERRA 2CXLA 3CKDA 2ZLYA 2KNDA 3K3OA 1WLXA 4YJ2E 2KLQA 3ZYMA 2ES0A 2H7OA 3RPUA 3H3AA 5KX5E 3VKHA 4JEUB 2VKJA 5HXHA 3GA8A 3ZC1A 3KINB 3LFMA 3AVSA 3PU3A 3EUHA 2C5IT 3P7IA 3IF8B 3MA9A 4WNKA 4BJMA 2K9AA 4XZCA 4HTEA 1UX5A 4MALA 4X1IE 2DWKA 2XAQB 2V1DB 1D1BA 4O4LE 2XUEA 3CX8B 2C5KT 4UIGA 3ANWB 4EXTA 3K3QC 2WMOA 3ETUA 5JVDE 2XAGB 4PW8A 2V7MA 1BR4A 2X0LB 3ANWA 3N9MA 3U78A 5CA0E 3L3PA 3S4UA 5KMGP 3PUAA 3ZJ2A 3PUSA 2DWGA 3ZMUB 2BVLA 4M1PA 4CI1B 1SHZC 2VKHA 5ETWA 3E0ZA 1IJ5A 3KVAA 4I4TE 2LM9A 2VB6A 3Q2MA 4MLKA 4ZI2C 3OYXA 1MIVA 4CXYA 4IE7A 1QSDA 3CQGB 4EYYR 4DBQA 4QXCB 3O4XE 3MJXA 2YINA 3SOLA 2C5JA 4AKIA 4HN9A 2Y8DA 3RYHE 3OKQA 2UXXB 1IAPA 4TV9E 2IC9A 3KFWX 3PDYA 4QXHB 1IJ6A 2VL8A 3CX6B 4UVAB 4CI2B 4BA9A 1HS7A 3AAIA 2CEAA 3JC6C 4KP3C 4DBRA 5JRCA 1FMWA 3HKEE 4OK0A 4H63V 1LVKA 2W62A 1HTJF 3R6NA 4ASKA 5EK2A 2YU1A 2XAJB 2G0UA 5F8PA 2KMFA 4YHJA 5F3JA 2B1EA 4PJNA 3RX6A 3UUMA 3CVRA 5AFUL 2MBGA 5LNKA 2CM0A 4ISSA 3EDUA 2CE7A 2WAUA 5JDMA 1X79A 4G63A 5IHYA 4ADZA 3KBTA 2BDEA 3O1JA 5HXRA 2X9WA 4IIJE 3AA0B 3K8PC 4IE4A 5HYAA 2M67A 2LE8A 2Y48B 1NWMX 5HAXA 1U5PA 2L3LA 3FBZA 5M4YA 2VK9A 3HI2A 4Z8XA 2JMHA 3O1HA 2XAFB 4C91A 3RC3A 4E7ZA 4P09A 2LHRA 5LBMA 4UF0A 1MNEA 4J2CA 5C8YE 1OXZA 3V5SA 3BK9A 3L09A 5H6RB 4PJMA 5IYZE 4AQFC 1IZNB 4BJNA 3OYZA 3ZMSB 4B6XA 4YJ3E 4O4HE 4KMCA 4UEMA 4I43B 1VRBA 3DP7A 3RYCE 3WAKA 1OWAA 3NRXA 5LOVE 2PG8A 2LEHA 4QHOA 1ZHCA 4QKNA 4PK4A 4HE8A 5JH7E 4PNIA 4AQGA 3UTKA 3N2GE 3AA7B 5LP6E 3NRYA 2YU2A 3E22E 5J2UE 4AKHA 2H3RA 1KK7A 5JRCB 4UVCB 1FMVA 5LJNA 4ANJA 3U3IA 3OJAA 1O3XA 3RYIE 3HL6A 3B13A 2CXDA 1ZV4X 3PUQA 3QK6A 2X9XA 2WMNA 3C64A 4AKLA 5JDNA 3F31A 4H9OC 3QUJA 5FY7A 3SS1A 2Z6EA 2D0TA 4U74A 3AAEB 4CXXA 2HPLA 2A3DA 2DHRA 3NZQA 5LGUB 2N9DA 1WYBA 2X68A 4PK5A 1ZKEA 2WBLA 4OYKA 4H63H 2IAKA 4IE0A 2KZ7B 4L9IA 3AA6B 1VOMA 4YLHA 1S35A 5FP3A 3LK3B 2JRKA 5DABA 2MTQA 2Y6XA 2IC6A 1B7TA 3ZPOA 5HXEA 1KNZA 1D1AA 5FXXA 4C90A 1HCIA 1Y64B 4PK6A 1G73A 3SRZA 3N5LA 3DTOA 4IGUA 2W00A 2E9XB 4PJJA 4O4JE 4UV9B 5FXZA 2V7JA 5FXVA 4AKRB 5BMVE 3BQIA 4ZI2D 2YK0A 4EAHA 4GK5E 5L2LA 2NW7A 2ODUA 1HX8A 2DI4A 3HKDE 2KT9A 4O2BE 4JUYA 3C50A 3LK2B 5J2TE 3MZKB 3AAAB 1U4QA 2RP4A 3PU8A 5JREA 1V9DA 3M65A 4X1KE 5LXTE 3H37A 5LHIB 2K5BB 4E7SA 4PFPA 2YEVC 2QA7A 2LOSA 2CMRA 2Q9QD 4GYSA 2ACXA 4HEAA 3J7Yq 2V7KA 4CI3B 5L3DB 2E9XC 5JDLA 1AJ3A 2VASA 4ZS2A 1LKXA 4NUVA 4ZS3A 3P8CD 3KBUA 4AKGA 1YKHB 2NTYA 2OA5A 2JQQA 3CX7B 2V7IA 2CWYA 2N1GA 5JDQA 3MXZA 4EOZB 3PURA 2RA1A 5JDFA 4IHJE 1UX4A 2KINB 3CPZA 4G2AA 2LT3A 3O9XA 1HFAA 3D0TA 2ZM0A 4QWNB 3UULA 4P0AA 3KV4A 2LJLA 2P9BA 3C4ZA 4O8SA 2W63A 3VKGA 3EDVA 2SPCA 3N2KE 4HKAA 2DNXA 5A1LA 2JPFA 3CQCB 2NWBA 4L0RA 1MIYA 3ZCJA 5LG4A 3I9YA 2ZM8A 1FEWA 4EYUA 2D5UA 2NW8A 3I0QA 4AQFA 5DQWA 4PAGA 3Q5XA 2I59A 3LK42 5FNVE 3T8OA 2XTLA 5JR9A 2X67A 4UVBB 5FYMA 4KUMB 4UV8B 4DMVA 3C4WA 2GK9A 3ZMVB 2PJQA 3Q5WA 2H7VC 5JR9B 2ODVA 3MKDA 3WAJA 4TUYE 3E08A 5EK4A 5FXWA 1UCUA 2CWOA 3N9PA 4MBQA 4P0BA 3W15B 3LBXA 4QXBB 4A56A 2V26A 1US7B 3RRWA 2CLYC 2KWHA 2PFVA 2LOPA 3SWHA 2Q9QC 4AXPA 1HG2A 4L5GA 5DQVA 3UT5E 2PBIA 4UF0B 4OFZA 4TZ4C 2EHOD 4PFOA 4NUUA 2XASB 4HGAA 5L3GB 4H9PC 2EHOB 4V1Av 2K24A 3RC8A 4WW0A 4UELA 3BQKA 5GONE 2X66A 4EB6E 3F57A 3Q9DA 4FJOA 3TKLB 1Z0PA 2JMKA 4ISTA 5DJQC 4GIWA 4DO0A 2IW5B 3IEEA 4QX8B 2CLYB 1YW0A 2LSJA 3ONXA 1HF8A 3KV5A 2Q9QA 4DVDA 2VKDA 5HWXA 2KXPB 3K3NA 4EIWA 3RYFE 2LSIA 2NTXA 2N2NA 3LG7A 2XHEB 4O4IE 2JJ9A 3N9QA 3AB3B 5LHHB 5L3FB 2CXFA 2HH7A 2X51A 3KVBA 5EK3A 1MNDA 2DCFA 4XAXB 2MYSA 4KBMB 3AA1B 5LCYA 2WM9A 1WYCA 4TV8E 2J1DG 2WSSV 4HFVA 3HKBE 4TX5A 2W61A 3IBPA 4U72A 3ZJ1A 4I50E 3GWHA 2CA5A 5HWYA 1S94A 3R84B 2A72A 3WI3A 3PUGA 2D0UA 4O2AE 4BAYB 1CUNA 3DJBA 3KV9A 3AVRA 2L8KA 3EVYA 4K0UA 4OHFA 5L3BB 1H7CA 2A2FX 4XBFB 3ZEFB 4ZHQE 5L3EB 5ADXL 4DNDA 3CWZB 2EHOA 3I1AA 1D0XA 5LGNB 4CZZB 4H9QC 3V5UA 1D0ZA 4F6RC 5KDMC 4X20E 3MK7C 1SA0E 4EZHA 3VHLA 3I9WA 2K48A 3C51A 2E8IA 2ZMAA 3ZN1B 3BQLA 3FHNA 4IE5A 3ZLIA 4DMWA 2C0SA 3FBLA 4JEHB 3FXDB 3HKCE 2DLRA 1ZEEA 2Q9QB 1BR0A 1MIWA 2NOXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IGU A;  4GOU A;  2ACX A;  1IAP A;  3AB3 B;  3C4Z A;  2ES0 A;  3QC9 A;  3CX6 B;  1SHZ C;  3C4X A;  4PNI A;  4WNK A;  1HTJ F;  3C50 A;  4L9I A;  3CX7 B;  3CX8 B;  4WBO A;  4YHJ A;  3C51 A;  2I59 A;  2A72 A;  3T8O A;  2PBI A;  2DLR A;  3C4W A;  1ZV4 X; 
#chains in the Genus database with same CATH topology
 5LYJ E;  3GN5 A;  5TAO A;  3N9N A;  2BKO A;  4U33 A;  1T7S A;  4IDZ A;  5AQM B;  4X66 T;  4JI0 T;  4QX7 B;  4ZI3 C;  4YFS A;  5HEG A;  3ZMZ B;  5L4H A;  5FMN A;  5AQI B;  2BZB A;  3ZMT B;  3C4X A;  2BBJ A;  3GN5 B;  3P4S A;  4EZ4 A;  2CBJ A;  3OBV E;  3M3Z B;  4H9N C;  3CK6 A;  4N78 D;  3RQW A;  3ZC0 A;  2WZH A;  4MFR A;  3N9O A;  4JLE A;  2X9Y A;  4ZI3 D;  3AEE A;  5LHG B;  1WRD A;  2RPA A;  1QUU A;  1FIO A;  1VCT A;  3UFG A;  5HEH A;  5AQP B;  4GK0 E;  4PJL A;  4IDP A;  1W09 A;  2A9U A;  3VU7 H;  5JDG A;  5JR9 C;  3RH3 A;  3F2E A;  5LMN T;  1E1H B;  2L9Q A;  4IE6 A;  3KV6 A;  4TN7 B;  4WBO A;  1QLB A;  4Z91 A;  1MMA A;  2W66 A;  1D0Y A;  2EHO C;  2XQY A;  4YY3 T;  4CN4 A;  1HNZ T;  5FY0 A;  4IDQ A;  5AQL B;  2NW9 A;  4GYR A;  3OPC A;  3GMI A;  2J62 A;  2VWA A;  2WDQ A;  1MMG A;  3I0O A;  3L39 A;  2LSY A;  5LGT B;  2UXN B;  4AI6 A;  1M62 A;  4GOU A;  5CFB A;  4DR4 T;  5L3C B;  5L3D B;  3QC9 A;  3B57 A;  2KWI B;  3FXE B;  4TNW A;  3FB2 A;  4ZOL E;  3J9X 1;  2B76 A;  1HG5 A;  1BR2 A;  2D2S A;  3HA4 A;  3HR0 A;  4ILU A;  5EZY E;  3UFE A;  3UUX B;  1NAF A;  2W0G A;  3MAC A;  3N2O A;  3ETV A;  2VUR A;  3O1I A;  3RRC A;  3TLV A;  5JQG E;  3NZP A;  3C98 B;  4H9S E;  3ZT7 A;  4LF7 T;  1YXR A;  1LRZ A;  5J1G A;  3LJC A;  3ZYL A;  5CA1 E;  3SFD A;  2LLY A;  2X0H A;  5CGM A;  1MMN A;  2LSK A;  3PUZ F;  2X9H A;  1R8I A;  5LA6 E;  4OYJ A;  3VRB A;  2QGS A;  2CPT A;  2NP9 A;  4KI0 F;  2WWU A;  3A5X A;  2VKO A;  3Q5E A;  5FY1 A;  5H6Q B;  2UXB T;  4UXN B;  3N9L A;  3UUN A;  5AQK B;  3PE0 A;  3CML A;  1HR0 T;  4WBN E;  4MHC A;  4H9R C;  3ESL A;  2ZM2 A;  4LFC T;  1YD8 G;  3ZYK A;  4DR1 T;  4CQI A;  1D1C A;  3IA3 A;  1BR1 A;  1KF6 A;  3JC6 D;  3RKO A;  4ZI7 E;  1T98 A;  1XMO T;  4IL4 A;  5CB4 E;  5LJM A;  5LG3 A;  3NBX X;  1YQ4 A;  5E0O A;  4NPP A;  5CJ5 A;  4FI5 A;  5AQT B;  2XAH B;  5HCJ A;  1MMD A;  1WR6 A;  2E9X D;  1HX1 B;  2MOZ A;  4U3C A;  4WZX A;  3ZN0 B;  4CXW A;  5FVK A;  5HXS A;  4I55 E;  2XM1 A;  3PTR B;  2HPJ A;  3CQX C;  4DV5 T;  1WR0 A;  3ABV A;  1G8X A;  3KDS E;  4TWH A;  5LBQ B;  4HWD A;  1DU2 A;  4AQY T;  3RI5 A;  3LBX B;  2FJB A;  1YKE B;  2BS4 A;  3AE3 A;  2LHN A;  3VRA A;  3AEB A;  2CCQ A;  4A98 A;  4ZEY A;  3B5M A;  3IHR A;  2UUC T;  3ONL C;  5HXC A;  2E9X A;  3ZSS A;  5IUX A;  1EZ3 A;  3PJA A;  4X1Y E;  3ZCI A;  2BVM A;  2LSG A;  1LVF A;  2H88 A;  2V6X A;  2CXL A;  2V7L A;  4ERR A;  3CKD A;  2ZLY A;  2KND A;  3K3O A;  1WLX A;  1OED C;  4YJ2 E;  2KLQ A;  5HEU A;  3ZYM A;  2ES0 A;  2H7O A;  4U2Z A;  3RPU A;  3H3A A;  5KX5 E;  3VKH A;  2WCA A;  4YTP A;  3RIU C;  3PJA J;  2VKJ A;  4JEU B;  5HXH A;  4YTM A;  2KSR A;  3GA8 A;  1L0V A;  3ZC1 A;  3KIN B;  3LFM A;  2FUP A;  3AVS A;  3PU3 A;  3EUH A;  5KXJ A;  2C5I T;  3P7I A;  3L8R A;  3IF8 B;  4HFC A;  3MA9 A;  4WNK A;  5AQF B;  4BJM A;  2K9A A;  4XZC A;  4HTE A;  3P4R A;  4JV5 T;  1UX5 A;  4MAL A;  4X1I E;  2DWK A;  2XAQ B;  2V1D B;  1D1B A;  4O4L E;  2XUE A;  2C5K T;  3CX8 B;  4UIG A;  1IBK T;  1IBL T;  3ANW B;  4B3S T;  3AEG A;  4EXT A;  3K3Q C;  2WMO A;  2XQA A;  1ZOY A;  3ETU A;  4JI7 T;  5JVD E;  2XAG B;  4PW8 A;  2V7M A;  1BR4 A;  2JQ9 A;  2X0L B;  3ANW A;  3AXJ B;  3N9M A;  3U78 A;  5CA0 E;  3L3P A;  3S4U A;  4DR2 T;  2VVS A;  4IRE A;  3AED A;  3TLW A;  3PUA A;  3ZJ2 A;  3UUB A;  5KMG P;  3PUS A;  2DWG A;  3ZMU B;  3UU5 A;  2BVL A;  4M1P A;  2DL1 A;  3EHZ A;  5BR8 T;  4B3M T;  4CI1 B;  1M7K A;  1SHZ C;  2VKH A;  3UU4 A;  1FJG T;  5ETW A;  3CIR A;  3E0Z A;  4I0U A;  1IJ5 A;  3KVA A;  4I4T E;  2LM9 A;  2VB6 A;  3Q2M A;  4MLK A;  4ZI2 C;  3OYX A;  1MIV A;  4ZZB A;  4CXY A;  4IE7 A;  2X0Y A;  2FJE A;  1QSD A;  3QOF A;  3T1Y T;  3CQG B;  4A97 A;  4EYY R;  4DBQ A;  4QXC B;  4P1N A;  3O4X E;  1J1J A;  1KNR A;  4WYV A;  3MJX A;  2YIN A;  2BG9 B;  3SOL A;  2C5J A;  2IIU A;  4AKI A;  4HN9 A;  5ABH A;  4QH1 A;  2IDO B;  3TLU A;  2Y8D A;  3RYH E;  3ZKR A;  3OKQ A;  2JIW A;  5FP3 A;  2UXX B;  1IAP A;  1N34 T;  4TV9 E;  1AJ3 A;  3AE1 A;  2IC9 A;  2R6G F;  3KFW X;  3PDY A;  4QXH B;  4LML A;  1IJ6 A;  2VL8 A;  3CX6 B;  4UVA B;  4CI2 B;  4BA9 A;  2V6Y A;  4JI1 T;  2E5V A;  3AAI A;  3ZT6 A;  1HS7 A;  2CEA A;  3JC6 C;  2BKP A;  2UU9 T;  3ZST A;  4KP3 C;  4TWF A;  4DBR A;  5JRC A;  1FMW A;  3HKE E;  4OK0 A;  1XZY A;  4H63 V;  1LVK A;  2W62 A;  1HTJ F;  2FBW A;  4LFA T;  3R6N A;  2NR4 A;  2YN6 A;  4ASK A;  5EK2 A;  1Y01 A;  2YU1 A;  4X65 T;  4LFB T;  2XAJ B;  2G0U A;  5F8P A;  4JI8 T;  2KMF A;  1NEK A;  4YHJ A;  3RF1 A;  5F3J A;  4HFI A;  3H3M A;  2B1E A;  4PJN A;  2WWV A;  3RX6 A;  3UUM A;  1OED B;  3CVR A;  5AFU L;  2MBG A;  5LNK A;  1W9R A;  2CM0 A;  2VL0 A;  3A8Y C;  3EDU A;  3QB5 A;  4ISS A;  2YDS A;  4LMK A;  2CE7 A;  2WAU A;  5JDM A;  1X79 A;  4YHH T;  4G63 A;  5IHY A;  4ADZ A;  4HFB A;  3KBT A;  4EV6 A;  4DV3 T;  3VR9 A;  2BDE A;  2E2A A;  3O1J A;  2X9W A;  3AXJ A;  4IIJ E;  3ONJ A;  5HXR A;  3AA0 B;  3K8P C;  4IE4 A;  5FVL A;  2M67 A;  2LE8 A;  2Y48 B;  5HYA A;  1NWM X;  3PUV F;  5C3J A;  5HAX A;  1U5P A;  2L3L A;  4Z90 A;  3TLS A;  2YDQ A;  3FBZ A;  5M4Y A;  2VK9 A;  3HI2 A;  3P4W A;  4Z8X A;  4DR6 T;  4JBW F;  2JMH A;  3O1H A;  4F8H A;  1N36 T;  2BBH A;  2XAF B;  2CBI A;  4CN1 A;  3RC3 A;  4C91 A;  4E7Z A;  4P09 A;  2LHR A;  5LBM A;  1I94 T;  4UF0 A;  1MNE A;  4J2C A;  1N33 T;  5C8Y E;  1OXZ A;  3V5S A;  1OED E;  2VQE T;  3BK9 A;  3FZL B;  3L09 A;  5H6R B;  4PJM A;  5IYZ E;  4AQF C;  1W0A A;  1IZN B;  4HFH A;  4BJN A;  2XM2 A;  1KNP A;  5AQG B;  3OYZ A;  4ILC A;  3ZMS B;  4B6X A;  2QVA A;  4O4H E;  1UK5 A;  4KMC A;  4UEM A;  4YJ3 E;  4I43 B;  1VRB A;  1XDP A;  3DP7 A;  2BG9 A;  2MPK A;  4HWH A;  2LM2 A;  3RYC E;  1X9B A;  2IUB A;  3WAK A;  1OWA A;  3NRX A;  5LOV E;  2PG8 A;  2LEH A;  4QHO A;  3P4Q A;  3UQ4 A;  5ABF B;  1ZHC A;  4QKN A;  4PK4 A;  4HE8 A;  4YTN A;  5JH7 E;  4DR5 T;  4PNI A;  3PUY F;  4AQG A;  3UTK A;  2LKH A;  5JDH A;  4QH4 A;  3N2G E;  3RKG A;  3AA7 B;  5LP6 E;  2CHO A;  3NRY A;  5FKY A;  2YU2 A;  4COF A;  3E22 E;  5J2U E;  4AKH A;  2H3R A;  1KK7 A;  4IT4 A;  4OX9 T;  5JRC B;  4UVC B;  1SE7 A;  1FMV A;  2WY2 A;  5LJN A;  4ANJ A;  4U7Y A;  1J5W A;  3U3I A;  3OJA A;  1O3X A;  3RYI E;  3HL6 A;  2F4V T;  3B13 A;  2XQ9 A;  5ABG A;  4B3R T;  4NIQ A;  2XQ5 A;  2BKN A;  2CXD A;  1OED A;  1ZV4 X;  3PUQ A;  3QK6 A;  2X9X A;  2WMN A;  3AE9 A;  3C64 A;  4HWI B;  2WQY A;  3F31 A;  4H9O C;  4AKL A;  5JDN A;  3QUJ A;  5FY7 A;  3RIA A;  3SS1 A;  4DV0 T;  1Z8U A;  2D0T A;  2Z6E A;  4U74 A;  3AAE B;  4CXX A;  2HPL A;  2A3D A;  2DHR A;  2XJ7 A;  3NZQ A;  5JTG A;  5LGU B;  2N9D A;  1WYB A;  2X68 A;  2WU2 A;  4PK5 A;  1ZKE A;  2WBL A;  4OYK A;  4H63 H;  3LSV A;  4ZZC A;  2IAK A;  4IE0 A;  2KZ7 B;  4L9I A;  5IWA T;  1CHU A;  1VOM A;  3AA6 B;  1S35 A;  4YLH A;  3LK3 B;  2JRK A;  4IDO A;  2MTQ A;  5DAB A;  2Y6X A;  5AQQ B;  2IC6 A;  2OLT A;  1B7T A;  2WZI A;  4YSZ A;  4NXN T;  1ZP0 A;  3ZPO A;  2XQ6 A;  3FZH B;  4AIU A;  5HXE A;  3P50 A;  1D1A A;  5FXX A;  1KNZ A;  1UUR A;  2XY8 B;  1HCI A;  1E2A A;  1Y64 B;  4PK6 A;  1G73 A;  5AQR B;  4C90 A;  3SRZ A;  3PUX F;  2M6I A;  3N5L A;  3SFE A;  3DTO A;  4IGU A;  2V6Y B;  2W00 A;  3QB5 K;  2WS3 A;  2E9X B;  4PJJ A;  4O4J E;  4UV9 B;  3FZK B;  5FXZ A;  2V7J A;  5FXV A;  4AKR B;  5BMV E;  2J4G A;  3BQI A;  4ZI2 D;  4YXD A;  2YK0 A;  4EAH A;  4GK5 E;  5L2L A;  1XNQ T;  2UXC T;  2NW7 A;  2ODU A;  4JI3 T;  1UUS A;  2QYW A;  1HX8 A;  5AQH B;  2DI4 A;  3HKD E;  2KT9 A;  4O2B E;  4K0K T;  4JUY A;  4KHP T;  3C50 A;  3LK2 B;  1HNW T;  5J0Z A;  5J2T E;  4LMJ A;  3MZK B;  2YOE A;  3AAA B;  1U4Q A;  3NKZ A;  2RP4 A;  1SUM B;  2V5C A;  2VQF T;  3PU8 A;  2I0M A;  4JI5 T;  5JRE A;  3OVU A;  1V9D A;  3M65 A;  1KEY A;  3P4P A;  4U2Y A;  2K3W A;  3H37 A;  4X1K E;  2K5B B;  4TNV A;  5LHI B;  4E7S A;  5LXT E;  3RHW A;  4PFP A;  3T1H T;  2YEV C;  2QA7 A;  3A7M A;  2E5L T;  3JCF A;  2M6B A;  2LOS A;  2CMR A;  2Q9Q D;  4GYS A;  2ACX A;  4HEA A;  5FL1 A;  2FJA A;  3LDQ B;  4YSY A;  3J7Y q;  2V7K A;  2XQ4 A;  4HWC A;  4TWD A;  4U31 A;  2V8S V;  4ILB A;  2E9X C;  4CI3 B;  2D9D A;  2V5D A;  5JDL A;  2VAS A;  2LRK A;  1VCS A;  1JNR A;  2XQ7 A;  5AQV B;  4B3T T;  4ZS2 A;  1LKX A;  4NUV A;  4EED A;  4ZS3 A;  3P8C D;  3KBU A;  4AKG A;  1YKH B;  2NTY A;  2OA5 A;  2JQQ A;  3CX7 B;  2V7I A;  2CWY A;  2N1G A;  3PV0 F;  3MXZ A;  3RQU A;  5JDQ A;  4EOZ B;  4NXM T;  3PUR A;  2RA1 A;  5JDF A;  3UU8 A;  4IHJ E;  1UX4 A;  2KIN B;  3CPZ A;  4A5X A;  4G2A A;  2LT3 A;  3O9X A;  1HFA A;  3D0T A;  2ZM0 A;  4QWN B;  3UUL A;  4P0A A;  3G06 A;  5AQN B;  5HEJ A;  3KV4 A;  2JQH A;  5FL0 A;  2LJL A;  2P9B A;  3C4Z A;  2XQ8 A;  2W63 A;  4O8S A;  3VKG A;  4CN6 A;  3EDV A;  2SPC A;  2IML A;  3N2K E;  3FZF B;  2ACZ A;  4HKA A;  2DNX A;  2BS3 A;  5A1L A;  2JPF A;  2WB5 A;  3CQC B;  2NWB A;  3NWI A;  4L0R A;  1MIY A;  3ZCJ A;  5LG4 A;  3AE4 A;  3I9Y A;  2ZM8 A;  1FEW A;  4EYU A;  2D5U A;  2NW8 A;  3I0Q A;  4AQF A;  5DQW A;  1XMQ T;  4PAG A;  2UUB T;  3AEC A;  3Q5X A;  5F5W A;  5HEO A;  2I59 A;  3LK4 2;  4KX6 A;  5FNV E;  4ZXL A;  3T8O A;  2XTL A;  5JR9 A;  2X67 A;  4UVB B;  3RIU A;  5FYM A;  3X1D A;  4KUM B;  4UV8 B;  3ZT5 A;  4DMV A;  3C4W A;  3JAD A;  5AQU B;  4EGW A;  4YSX A;  4DV4 T;  2GK9 A;  4GKJ T;  1KFY A;  2PJQ A;  3Q5W A;  2H7V C;  3ZMV B;  2WP9 A;  2ODV A;  5JR9 B;  4AIS A;  3Q5D A;  1WCR A;  3MKD A;  2XQ3 A;  5AQO B;  3WAJ A;  4TUY E;  1WFD A;  4DR7 T;  3E08 A;  5EK4 A;  2UUA T;  5FXW A;  1UCU A;  2CWO A;  4KHZ F;  4JI6 T;  2XPK A;  3N9P A;  4MBQ A;  4P0B A;  4LF8 T;  3W15 B;  3LBX A;  1XNR T;  4QXB B;  4A56 A;  5AQS B;  2V26 A;  1US7 B;  3RRW A;  4JYA T;  2CLY C;  2CRB A;  2KWH A;  2PFV A;  4IL9 A;  2VVN A;  4Q25 A;  2LOP A;  4X62 T;  4DUY T;  3AE2 A;  3SWH A;  1GQE A;  2UXD T;  2Q9Q C;  1T8B A;  4AXP A;  1HG2 A;  4L5G A;  5DQV A;  5ABE A;  3UT5 E;  2PBI A;  4UF0 B;  4OFZ A;  4TZ4 C;  1W0B A;  2EHO D;  1T72 A;  5L47 A;  4DR3 T;  4LF6 T;  4PFO A;  4NUU A;  3QNU A;  3UU6 A;  2XAS B;  4HGA A;  5AQJ B;  5L3G B;  5LMU T;  4H9P C;  2EHO B;  4V1A v;  2K24 A;  3RC8 A;  4WW0 A;  3PUW F;  4UEL A;  4EZH A;  3AE8 A;  3K1S A;  3BQK A;  5GON E;  2X66 A;  2QRX A;  4EB6 E;  3F57 A;  3Q9D A;  4FJO A;  4HFE A;  2WDR A;  2AE9 A;  3TKL B;  1JNZ A;  4X5T A;  2MAW A;  1Z0P A;  2BG9 C;  4X64 T;  2JMK A;  3AE6 A;  4IST A;  5DJQ C;  5ABF A;  1XWM A;  4GIW A;  4JI2 T;  2LKG A;  4DO0 A;  3AEA A;  3IEE A;  2IW5 B;  4QX8 B;  1N32 T;  2CLY B;  1YW0 A;  2LSJ A;  3ONX A;  1HF8 A;  3KV5 A;  2Q9Q A;  3FZM B;  4DVD A;  1I6Z A;  2VKD A;  2ZM6 T;  2OV9 A;  5HWX A;  2KXP B;  3K3N A;  1J5E T;  4EIW A;  3RYF E;  2BG9 E;  2LSI A;  1XDO A;  2NTX A;  1YQ3 A;  2H89 A;  2N2N A;  3LG7 A;  5L4E A;  2XHE B;  4O4I E;  2LRL A;  2JJ9 A;  3N9Q A;  3AB3 B;  5LHH B;  5L3F B;  4DV2 T;  2CXF A;  2HH7 A;  2X51 A;  3KVB A;  5EK3 A;  5LB7 B;  3UU3 A;  1MND A;  1NEN A;  2DCF A;  5HCM A;  4XAX B;  2IHR 1;  2MYS A;  3RIF A;  1IBM T;  3AE5 A;  4KBM B;  3VR8 A;  3AA1 B;  5LCY A;  2YDR A;  3EAB A;  5C2T A;  2CHN A;  2HN2 A;  2WM9 A;  4LF5 T;  1WYC A;  4TV8 E;  2J1D G;  2WSS V;  4HFV A;  4QH5 A;  3HKB E;  3EI0 A;  4TX5 A;  2W61 A;  2WDV A;  2W4X A;  2AXD S;  3AEF A;  3IBP A;  4LF4 T;  1UGO A;  4U72 A;  2FJD A;  4DV6 T;  3ZJ1 A;  4HWF A;  2BS2 A;  4I50 E;  2CA5 A;  3GWH A;  5HWY A;  1S94 A;  3R84 B;  2A72 A;  2JQK A;  3WI3 A;  4UR9 A;  3OTO T;  2PTF A;  2HHH T;  3PUG A;  2D0U A;  3NVO A;  4O2A E;  4BAY B;  4DID B;  4EEB A;  1CUN A;  3DJB A;  3KV9 A;  1HNX T;  2HN1 A;  3AVR A;  3JAF A;  2L8K A;  3EVY A;  4K0U A;  4OHF A;  3RGL A;  5L3B B;  1H7C A;  4JI4 T;  2A2F X;  4XBF B;  3JAE A;  3ZEF B;  4ZHQ E;  2W67 A;  2YKS A;  3EAM A;  5ADX L;  5L3E B;  3UQ7 A;  2W2U A;  4YT0 A;  4HFD A;  4DND A;  4DV1 T;  3CWZ B;  2EHO A;  3I1A A;  1D0X A;  5LGN B;  4CZZ B;  4DUZ T;  4H9Q C;  4U7I A;  3V5U A;  1D0Z A;  4F6R C;  4ILA A;  5KDM C;  4X20 E;  4LF9 T;  2XSB A;  3MK7 C;  1SA0 E;  3RLF F;  3TLT A;  2I6H A;  3I9W A;  2K48 A;  3C51 A;  2E8I A;  2XZE A;  2ZMA A;  3VHL A;  3ZN1 B;  4DV7 T;  2XSA A;  3BQL A;  3FHN A;  4IDN A;  4IE5 A;  3ZLI A;  2C0S A;  3FBL A;  4DMW A;  2WU5 A;  4JEH B;  3FXD B;  3HKC E;  2DLR A;  1E7P A;  1ZEE A;  2J47 A;  2Q9Q B;  3AE7 A;  1BR0 A;  1MIW A;  2NOX A;  4GKK T; 
#chains in the Genus database with same CATH homology
 5LYJ E;  3GN5 A;  5TAO A;  3N9N A;  4IDZ A;  4QX7 B;  4ZI3 C;  4YFS A;  3ZMZ B;  5FMN A;  3ZMT B;  2BZB A;  3C4X A;  3GN5 B;  4EZ4 A;  5JDH A;  3OBV E;  4H9N C;  4N78 D;  3ZC0 A;  4ZI3 D;  4MFR A;  3N9O A;  4JLE A;  2X9Y A;  5LHG B;  1WRD A;  1QUU A;  1FIO A;  4GK0 E;  4PJL A;  3VU7 H;  5JDG A;  5JR9 C;  3RH3 A;  3F2E A;  1E1H B;  2L9Q A;  4IE6 A;  3KV6 A;  4TN7 B;  4WBO A;  1MMA A;  2XQY A;  1D0Y A;  2EHO C;  5FY0 A;  2NW9 A;  4GYR A;  3GMI A;  2VWA A;  3I0O A;  1MMG A;  2LSY A;  5LGT B;  2UXN B;  4AI6 A;  4GOU A;  5L3C B;  3QC9 A;  3B57 A;  2KWI B;  3FXE B;  4ZOL E;  3FB2 A;  3J9X 1;  2D2S A;  1HG5 A;  1BR2 A;  3HA4 A;  3HR0 A;  5EZY E;  4ILU A;  3UFE A;  3UUX B;  1NAF A;  2W0G A;  3MAC A;  3N2O A;  3ETV A;  3O1I A;  3RRC A;  5JQG E;  3NZP A;  3C98 B;  4H9S E;  1LRZ A;  5J1G A;  3LJC A;  3ZYL A;  5CA1 E;  1MMN A;  2LSK A;  5LA6 E;  2X9H A;  4OYJ A;  2QGS A;  2NP9 A;  2WWU A;  3A5X A;  2VKO A;  5FY1 A;  5H6Q B;  4UXN B;  3N9L A;  3UUN A;  3PE0 A;  3CML A;  4WBN E;  4MHC A;  4H9R C;  3ESL A;  2ZM2 A;  1YD8 G;  3ZYK A;  4CQI A;  1D1C A;  1BR1 A;  3RKO A;  3JC6 D;  4ZI7 E;  1T98 A;  5CB4 E;  5LJM A;  3NBX X;  5E0O A;  4FI5 A;  2XAH B;  1MMD A;  1WR6 A;  2E9X D;  2MOZ A;  3ZN0 B;  4CXW A;  5HXS A;  4I55 E;  3PTR B;  2HPJ A;  3CQX C;  3KDS E;  1G8X A;  5LBQ B;  3LBX B;  1YKE B;  2LHN A;  2CCQ A;  3IHR A;  5HXC A;  2E9X A;  1EZ3 A;  4X1Y E;  3ZCI A;  2BVM A;  2LSG A;  1LVF A;  2V7L A;  4ERR A;  2CXL A;  3CKD A;  2ZLY A;  2KND A;  3K3O A;  1WLX A;  4YJ2 E;  2KLQ A;  3ZYM A;  2ES0 A;  2H7O A;  3RPU A;  3H3A A;  5KX5 E;  3VKH A;  4JEU B;  2VKJ A;  5HXH A;  3GA8 A;  3ZC1 A;  3KIN B;  3LFM A;  3AVS A;  3PU3 A;  3EUH A;  2C5I T;  3P7I A;  3IF8 B;  3MA9 A;  4WNK A;  4BJM A;  2K9A A;  4XZC A;  4HTE A;  1UX5 A;  4MAL A;  4X1I E;  2DWK A;  2XAQ B;  2V1D B;  1D1B A;  4O4L E;  2XUE A;  3CX8 B;  2C5K T;  4UIG A;  3ANW B;  4EXT A;  3K3Q C;  2WMO A;  3ETU A;  5JVD E;  2XAG B;  4PW8 A;  2V7M A;  1BR4 A;  2X0L B;  3ANW A;  3N9M A;  3U78 A;  5CA0 E;  3L3P A;  3S4U A;  5KMG P;  3PUA A;  3ZJ2 A;  3PUS A;  2DWG A;  3ZMU B;  2BVL A;  4M1P A;  4CI1 B;  1SHZ C;  2VKH A;  5ETW A;  3E0Z A;  1IJ5 A;  3KVA A;  4I4T E;  2LM9 A;  2VB6 A;  3Q2M A;  4MLK A;  4ZI2 C;  3OYX A;  1MIV A;  4CXY A;  4IE7 A;  1QSD A;  3CQG B;  4EYY R;  4DBQ A;  4QXC B;  3O4X E;  3MJX A;  2YIN A;  3SOL A;  2C5J A;  4AKI A;  4HN9 A;  2Y8D A;  3RYH E;  3OKQ A;  2UXX B;  1IAP A;  4TV9 E;  2IC9 A;  3KFW X;  3PDY A;  4QXH B;  1IJ6 A;  2VL8 A;  3CX6 B;  4UVA B;  4CI2 B;  4BA9 A;  1HS7 A;  3AAI A;  2CEA A;  3JC6 C;  4KP3 C;  4DBR A;  5JRC A;  1FMW A;  3HKE E;  4OK0 A;  4H63 V;  1LVK A;  2W62 A;  1HTJ F;  3R6N A;  4ASK A;  5EK2 A;  2YU1 A;  2XAJ B;  2G0U A;  5F8P A;  2KMF A;  4YHJ A;  5F3J A;  2B1E A;  4PJN A;  3RX6 A;  3UUM A;  3CVR A;  5AFU L;  2MBG A;  5LNK A;  2CM0 A;  4ISS A;  3EDU A;  2CE7 A;  2WAU A;  5JDM A;  1X79 A;  4G63 A;  5IHY A;  4ADZ A;  3KBT A;  2BDE A;  3O1J A;  5HXR A;  2X9W A;  4IIJ E;  3AA0 B;  3K8P C;  4IE4 A;  5HYA A;  2M67 A;  2LE8 A;  2Y48 B;  1NWM X;  5HAX A;  1U5P A;  2L3L A;  3FBZ A;  5M4Y A;  2VK9 A;  3HI2 A;  4Z8X A;  2JMH A;  3O1H A;  2XAF B;  4C91 A;  3RC3 A;  4E7Z A;  4P09 A;  2LHR A;  5LBM A;  4UF0 A;  1MNE A;  4J2C A;  5C8Y E;  1OXZ A;  3V5S A;  3BK9 A;  3L09 A;  5H6R B;  4PJM A;  5IYZ E;  4AQF C;  1IZN B;  4BJN A;  3OYZ A;  3ZMS B;  4B6X A;  4YJ3 E;  4O4H E;  4KMC A;  4UEM A;  4I43 B;  1VRB A;  3DP7 A;  3RYC E;  3WAK A;  1OWA A;  3NRX A;  5LOV E;  2PG8 A;  2LEH A;  4QHO A;  1ZHC A;  4QKN A;  4PK4 A;  4HE8 A;  5JH7 E;  4PNI A;  4AQG A;  3UTK A;  3N2G E;  3AA7 B;  5LP6 E;  3NRY A;  2YU2 A;  3E22 E;  5J2U E;  4AKH A;  2H3R A;  1KK7 A;  5JRC B;  4UVC B;  1FMV A;  5LJN A;  4ANJ A;  3U3I A;  3OJA A;  1O3X A;  3RYI E;  3HL6 A;  3B13 A;  2CXD A;  1ZV4 X;  3PUQ A;  3QK6 A;  2X9X A;  2WMN A;  3C64 A;  4AKL A;  5JDN A;  3F31 A;  4H9O C;  3QUJ A;  5FY7 A;  3SS1 A;  2Z6E A;  2D0T A;  4U74 A;  3AAE B;  4CXX A;  2HPL A;  2A3D A;  2DHR A;  3NZQ A;  5LGU B;  2N9D A;  1WYB A;  2X68 A;  4PK5 A;  1ZKE A;  2WBL A;  4OYK A;  4H63 H;  2IAK A;  4IE0 A;  2KZ7 B;  4L9I A;  3AA6 B;  1VOM A;  4YLH A;  1S35 A;  5FP3 A;  3LK3 B;  2JRK A;  5DAB A;  2MTQ A;  2Y6X A;  2IC6 A;  1B7T A;  3ZPO A;  5HXE A;  1KNZ A;  1D1A A;  5FXX A;  4C90 A;  1HCI A;  1Y64 B;  4PK6 A;  1G73 A;  3SRZ A;  3N5L A;  3DTO A;  4IGU A;  2W00 A;  2E9X B;  4PJJ A;  4O4J E;  4UV9 B;  5FXZ A;  2V7J A;  5FXV A;  4AKR B;  5BMV E;  3BQI A;  4ZI2 D;  2YK0 A;  4EAH A;  4GK5 E;  5L2L A;  2NW7 A;  2ODU A;  1HX8 A;  2DI4 A;  3HKD E;  2KT9 A;  4O2B E;  4JUY A;  3C50 A;  3LK2 B;  5J2T E;  3MZK B;  3AAA B;  1U4Q A;  2RP4 A;  3PU8 A;  5JRE A;  1V9D A;  3M65 A;  4X1K E;  5LXT E;  3H37 A;  5LHI B;  2K5B B;  4E7S A;  4PFP A;  2YEV C;  2QA7 A;  2LOS A;  2CMR A;  2Q9Q D;  4GYS A;  2ACX A;  4HEA A;  3J7Y q;  2V7K A;  4CI3 B;  5L3D B;  2E9X C;  5JDL A;  1AJ3 A;  2VAS A;  4ZS2 A;  1LKX A;  4NUV A;  4ZS3 A;  3P8C D;  3KBU A;  4AKG A;  1YKH B;  2NTY A;  2OA5 A;  2JQQ A;  3CX7 B;  2V7I A;  2CWY A;  2N1G A;  5JDQ A;  3MXZ A;  4EOZ B;  3PUR A;  2RA1 A;  5JDF A;  4IHJ E;  1UX4 A;  2KIN B;  3CPZ A;  4G2A A;  2LT3 A;  3O9X A;  1HFA A;  3D0T A;  2ZM0 A;  4QWN B;  3UUL A;  4P0A A;  3KV4 A;  2LJL A;  2P9B A;  3C4Z A;  4O8S A;  2W63 A;  3VKG A;  3EDV A;  2SPC A;  3N2K E;  4HKA A;  2DNX A;  5A1L A;  2JPF A;  3CQC B;  2NWB A;  4L0R A;  1MIY A;  3ZCJ A;  5LG4 A;  3I9Y A;  2ZM8 A;  1FEW A;  4EYU A;  2D5U A;  2NW8 A;  3I0Q A;  4AQF A;  5DQW A;  4PAG A;  3Q5X A;  2I59 A;  3LK4 2;  5FNV E;  3T8O A;  2XTL A;  5JR9 A;  2X67 A;  4UVB B;  5FYM A;  4KUM B;  4UV8 B;  4DMV A;  3C4W A;  2GK9 A;  3ZMV B;  2PJQ A;  3Q5W A;  2H7V C;  5JR9 B;  2ODV A;  3MKD A;  3WAJ A;  4TUY E;  3E08 A;  5EK4 A;  5FXW A;  1UCU A;  2CWO A;  3N9P A;  4MBQ A;  4P0B A;  3W15 B;  3LBX A;  4QXB B;  4A56 A;  2V26 A;  1US7 B;  3RRW A;  2CLY C;  2KWH A;  2PFV A;  2LOP A;  3SWH A;  2Q9Q C;  4AXP A;  1HG2 A;  4L5G A;  5DQV A;  3UT5 E;  2PBI A;  4UF0 B;  4OFZ A;  4TZ4 C;  2EHO D;  4PFO A;  4NUU A;  2XAS B;  4HGA A;  5L3G B;  4H9P C;  2EHO B;  4V1A v;  2K24 A;  3RC8 A;  4WW0 A;  4UEL A;  3BQK A;  5GON E;  2X66 A;  4EB6 E;  3F57 A;  3Q9D A;  4FJO A;  3TKL B;  1Z0P A;  2JMK A;  4IST A;  5DJQ C;  4GIW A;  4DO0 A;  2IW5 B;  3IEE A;  4QX8 B;  2CLY B;  1YW0 A;  2LSJ A;  3ONX A;  1HF8 A;  3KV5 A;  2Q9Q A;  4DVD A;  2VKD A;  5HWX A;  2KXP B;  3K3N A;  4EIW A;  3RYF E;  2LSI A;  2NTX A;  2N2N A;  3LG7 A;  2XHE B;  4O4I E;  2JJ9 A;  3N9Q A;  3AB3 B;  5LHH B;  5L3F B;  2CXF A;  2HH7 A;  2X51 A;  3KVB A;  5EK3 A;  1MND A;  2DCF A;  4XAX B;  2MYS A;  4KBM B;  3AA1 B;  5LCY A;  2WM9 A;  1WYC A;  4TV8 E;  2J1D G;  2WSS V;  4HFV A;  3HKB E;  4TX5 A;  2W61 A;  3IBP A;  4U72 A;  3ZJ1 A;  4I50 E;  3GWH A;  2CA5 A;  5HWY A;  1S94 A;  3R84 B;  2A72 A;  3WI3 A;  3PUG A;  2D0U A;  4O2A E;  4BAY B;  1CUN A;  3DJB A;  3KV9 A;  3AVR A;  2L8K A;  3EVY A;  4K0U A;  4OHF A;  5L3B B;  1H7C A;  2A2F X;  4XBF B;  3ZEF B;  4ZHQ E;  5L3E B;  5ADX L;  4DND A;  3CWZ B;  2EHO A;  3I1A A;  1D0X A;  5LGN B;  4CZZ B;  4H9Q C;  3V5U A;  1D0Z A;  4F6R C;  5KDM C;  4X20 E;  3MK7 C;  1SA0 E;  4EZH A;  3VHL A;  3I9W A;  2K48 A;  3C51 A;  2E8I A;  2ZMA A;  3ZN1 B;  3BQL A;  3FHN A;  4IE5 A;  3ZLI A;  4DMW A;  2C0S A;  3FBL A;  4JEH B;  3FXD B;  3HKC E;  2DLR A;  1ZEE A;  2Q9Q B;  1BR0 A;  1MIW A;  2NOX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...