3CX7B

Crystal structure of pdzrhogef rgrgs domain in a complex with galpha-13 bound to gdp-alf4
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
196
structure length
193
Chain Sequence
b'LIIGPEEDYDPGNESDIIFQDLEKLKSHPAYLVVFLRYILSQADPGPLLFYLCSEVYQQTNPKDSRSLGKDIWNIFLEKNAPLRVKIPEMLQAEIDLRLRNNEDPRNVLCEAQEAVMLEIQEQINDYRSKRTLGLGSLYGENDLLGLDGDPLRERQMAEKQLAALGDILSKYEEDRSAPMDFAVNTFMSHAGI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Guanine Nucleotide-Binding Protein Galpha 13
publication title Recognition of the Activated States of Galpha13 by the rgRGS Domain of PDZRhoGEF.
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein
total genus 64
structure length 193
sequence length 196
ec nomenclature
pdb deposition date 2008-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF09128 RGS-like Regulator of G protein signalling-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1850 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3cx7B00
1ZV4X 1IAPA 3CX8B 2PBIA 2I59A 4WNKA 3T8OA 3CX6B 2ES0A 3AB3B 4L9IA 3C51A 4GOUA 4IGUA 3C4ZA 3CX7B 2ACXA 3C4XA 3C50A 4YHJA 3C4WA 3QC9A 2DLRA 1SHZC 1HTJF 2A72A 4PNIA 4WBOA
chains in the Genus database with same CATH superfamily
2WDQA 4HFVA 4O2BE 1T98A 4X66T 2N2NA 3P50A 4YSZA 5LBQB 4QX7B 4O8SA 3GWHA 4O4JE 4TUYE 3HL6A 4TN7B 4YT0A 2K24A 5EZYE 3AE1A 1M62A 4QHOA 3FZFB 3A5XA 4ASKA 4X1IE 5AQUB 3K3NA 3PUSA 3LFMA 2JMKA 4CN6A 2BDEA 2A2FX 2KXPB 3ZYKA 2LSYA 2Z6EA 3FZLB 4WBOA 2D2SA 2AE9A 2FUPA 1CUNA 3L3PA 2CM0A 3EI0A 4PJLA 4OYKA 1VRBA 2WM9A 3ZN0B 4ZZBA 4ISSA 3HR0A 3UQ4A 1YXRA 4OHFA 5ABGA 1HR0T 2PG8A 4KHPT 2XQ8A 1Z8UA 4Z91A 5LBMA 2E9XD 5H6QB 1L0VA 4YFSA 2Q9QC 1KFYA 1HX1B 4MHCA 1XMOT 4PK5A 5LJMA 3ESLA 1NAFA 2PTFA 2BS4A 1E7PA 4ZI3D 3P4SA 3N9LA 3IEEA 2C5KT 2LM2A 2H7OA 2ZM6T 2WP9A 2ZM0A 4TV8E 3JADA 2ZM8A 4HGAA 5AQSB 4DV4T 2V6YB 4WZXA 3UU3A 2ACZA 1KK7A 2WU2A 4OK0A 2V1DB 4ILAA 3RPUA 2E9XA 1HG2A 2CLYB 3C4XA 2JIWA 4QH1A 4IHJE 3NRXA 5LJNA 2KMFA 2F4VT 3VU7H 1XMQT 2VWAA 3T1HT 3FZMB 2UXBT 1LVFA 5ABFB 4NXNT 1JNRA 4N78D 1EZ3A 4LFCT 2UU9T 4AQFA 1FJGT 3W15B 2IUBA 5LG3A 4E7SA 4DV3T 3RHWA 1T7SA 4GYSA 2QRXA 4ZS3A 4TNWA 3AAAB 5EK4A 2YU2A 4DR4T 2CXLA 2FJAA 2ZM2A 2NR4A 3P7IA 2E5LT 5ETWA 2I6HA 2VKDA 3AEDA 2BKOA 4JI5T 5L3EB 3EAMA 3ZKRA 1KEYA 4EB6E 2YDRA 2W4XA 3C4ZA 3PUYF 4X20E 4Z8XA 4K0KT 1W9RA 2DI4A 3JAEA 3VKHA 3QK6A 1X79A 4H9NC 3RIUA 4UELA 2I0MA 3L09A 2YDSA 5HEJA 5LP6E 3FHNA 4PW8A 2JQ9A 4JEHB 5AQLB 3UT5E 3AE3A 4GIWA 2CMRA 3LK42 4KI0F 1WYBA 2IC9A 2SPCA 2Y6XA 3IHRA 2LRLA 3ZT5A 4QXHB 1WFDA 4MLKA 2V5CA 3LDQB 5LCYA 2HPJA 1OEDB 3CX6B 2HN2A 3ETUA 2RPAA 5LA6E 2H7VC 3ONXA 3ZT7A 3EHZA 1Y64B 3JC6C 4BJMA 4DBRA 3T1YT 2X67A 4EXTA 4LMJA 1WRDA 2XM2A 2X9WA 3HKCE 3KV4A 3UTKA 2N9DA 1XWMA 3ZCJA 3RYCE 4Q25A 4CI3B 4TWDA 5J1GA 3LBXB 2XAGB 1XNRT 2KINB 4AQYT 2CE7A 2BZBA 3CKDA 2WDRA 2VK9A 2Q9QD 2Y8DA 4U74A 5AQMB 4AI6A 2XQ4A 3LBXA 1SUMB 3KV5A 3KINB 2BG9E 2K9AA 3ZC0A 4JUYA 2IHR1 2UXCT 2UXDT 2WDVA 1D1AA 4DO0A 3PJAJ 3PUVF 2X9XA 2XHEB 3AA7B 4P0BA 4GK0E 3KV6A 4COFA 2ODVA 5FKYA 2E2AA 4WNKA 2OLTA 5KMGP 4LMKA 1E1HB 3D0TA 3V5SA 3CWZB 4QWNB 4X5TA 3C4WA 2XAHB 2N1GA 2LLYA 4IT4A 3I9WA 2XQ7A 1S94A 1XDOA 2PBIA 5FMNA 1I94T 2VASA 4C91A 3RGLA 3O4XE 5L4EA 3MJXA 3UUBA 3P4WA 4LF9T 1NWMX 1YQ3A 5HWYA 5H6RB 5LHIB 1ZV4X 3ZC1A 3N2KE 5ABEA 4KP3C 3LJCA 4LMLA 4QX8B 3IA3A 3PUAA 3UFEA 4IL4A 4AQFC 2VKHA 2NTYA 1X9BA 4X1YE 3RKOA 4U2ZA 2NWBA 2JJ9A 4UV9B 1T72A 3QOFA 3AEBA 1KNPA 4HFCA 4AKGA 3PUWF 4M1PA 1ZEEA 1S35A 1MNDA 2WB5A 5FP3A 4FJOA 4DV2T 3HA4A 4O2AE 3FB2A 4OYJA 5AQGB 5JVDE 3ZJ2A 2CEAA 4TWHA 5HWXA 3K1SA 4JI1T 2UXXB 4OFZA 3AEAA 5LG4A 1XDPA 2C5IT 1HNXT 3P8CD 3EUHA 1M7KA 2VURA 3C98B 4B6XA 2J1DG 3ZJ1A 2YINA 4X1KE 1YD8G 4B3ST 2XQAA 3AEGA 1YW0A 2YEVC 4PFPA 2LEHA 3PU8A 1MMAA 1WR0A 3FBLA 3RIUC 1XNQT 3RH3A 2X0HA 1JNZA 1U4QA 2CRBA 4PJJA 4YHJA 3S4UA 5HCMA 3SOLA 4H9PC 4JI2T 5J2UE 2XAQB 4DR2T 4PFOA 2C0SA 4J2CA 5GONE 3KBUA 4EEBA 1HX8A 4DUZT 2ACXA 4A98A 3E0ZA 4CZZB 1W09A 4WYVA 4YHHT 4HKAA 2DWKA 5JH7E 3JC6D 2MOZA 4DR6T 4TZ4C 5JR9B 5AQKB 5JREA 3C51A 3A7MA 3NZQA 2MAWA 3I9YA 2V26A 1QLBA 3E08A 3SFDA 1IJ5A 3RIFA 2CWOA 3RQWA 2VKJA 3F57A 4XZCA 3RC8A 4AKRB 2BS3A 3CVRA 2IW5B 5JDMA 4DNDA 3DJBA 3AE5A 1WR6A 2QVAA 4CI2B 3I0OA 4YLHA 2CBIA 2ODUA 5LYJE 1MMGA 5ADXL 2JPFA 3PUQA 2MTQA 4ZI2C 2LJLA 4EYYR 3PTRB 3K3QC 2LT3A 3FZKB 4U3CA 4U33A 4UR9A 2WBLA 5JDNA 2LSKA 2V5DA 4KX6A 3NZPA 1HFAA 3JAFA 3I1AA 5HXCA 4X64T 1IAPA 1IZNB 3UUMA 3TLUA 2E5VA 4H63V 2WMNA 3VR9A 2XSBA 3K3OA 5JDHA 1NEKA 3RYIE 3PV0F 4NXMT 3AVSA 3KFWX 2A72A 5F5WA 2CCQA 3NKZA 4QH5A 1MIVA 1D0XA 2UUCT 5FY1A 3KDSE 4IGUA 4ISTA 4X65T 5AQRB 5IHYA 3AXJB 1LVKA 1IBKT 2V6YA 2XSAA 4HWCA 4G63A 1ZOYA 2VL8A 3A8YC 5FYMA 4YTNA 2OA5A 2WSSV 2V7MA 3CPZA 4YJ3E 2W2UA 2V8SV 2XQYA 4DV0T 4FI5A 2VKOA 1FIOA 4I43B 3SWHA 2W61A 5ABFA 2XAJB 3GN5B 5AQPB 3R84B 3FZHB 4NUVA 3BQKA 5AQIB 4HFIA 5IUXA 2X66A 3ZSSA 2MBGA 4YTPA 1WLXA 4EYUA 5FY7A 5JDQA 4YSXA 3P4RA 3P4QA 3ZPOA 3Q5WA 4LF4T 4L5GA 4MBQA 4DV7T 3J7Yq 2L9QA 5TAOA 1OXZA 2DNXA 3QB5A 2PFVA 2X0YA 1AJ3A 4DVDA 4IDNA 3N9QA 4PK6A 3LG7A 2V7JA 4A5XA 3BK9A 3AE7A 3TKLB 3UU5A 4EGWA 1YKHB 4AXPA 3NVOA 4UEMA 3RQUA 5AQHB 4P0AA 5FNVE 2UUAT 2W0GA 5FXZA 3UU6A 1J5WA 3CX8B 4TX5A 4P1NA 3HKDE 2BVLA 3UQ7A 3M65A 4YY3T 3Q5XA 5J0ZA 3PJAA 3WAJA 4IDQA 2CHOA 5HAXA 1J1JA 5JR9C 4HTEA 2WS3A 4AKLA 3TLTA 5AFUL 4Z90A 4I4TE 4ZZCA 5LGTB 1UCUA 4GKJT 1Y01A 4K0UA 3FXDB 4L9IA 5J2TE 2LRKA 1FEWA 4JYAT 3SRZA 2NW8A 4U7YA 3VRAA 3R6NA 4HWFA 1HNZT 4F8HA 2FJDA 4GK5E 2B76A 5A1LA 4AIUA 1OEDA 1R8IA 2XPKA 4QXCB 4ZI2D 1XZYA 3UU8A 4LF7T 2L3LA 2D5UA 3WI3A 5KX5E 2VB6A 5L3FB 4IIJE 4G2AA 2AXDS 2M67A 3KV9A 3PDYA 1HF8A 2ES0A 3VRBA 1D1CA 2K3WA 4P09A 2BKPA 3CK6A 1KNZA 2XASB 2JQKA 2LE8A 2R6GF 2LOSA 3UUXB 3ZMTB 3SFEA 3TLVA 3U3IA 2WU5A 3ZEFB 1SA0E 3RF1A 2BG9B 4BAYB 1FMVA 2ZMAA 1VOMA 4HWHA 2QA7A 2IC6A 3ZMSB 2LKGA 2LSIA 4UXNB 5LMNT 4DR5T 5F3JA 2Q9QB 3ZYMA 2WCAA 4I55E 4YJ2E 1MIWA 3N9OA 4JI8T 5L3BB 2NTXA 5LHHB 3BQLA 3RYHE 5HEUA 2CLYC 3AA0B 1UX4A 3DP7A 2NP9A 4EEDA 1G73A 3RRWA 3UFGA 4NUUA 4ZOLE 4B3TT 3OYXA 2X9YA 3KBTA 2CBJA 2W67A 3QNUA 2LHRA 1US7B 2H3RA 4AISA 5AQFB 3AB3B 4DR3T 1MNEA 4JBWF 4DMWA 1HCIA 2XM1A 2CPTA 2HHHT 1HTJF 4JI6T 3ZN1B 2IMLA 4I0UA 4QXBB 3ONLC 2KNDA 5AQVB 1LRZA 2K5BB 3PURA 4O4LE 3OYZA 5C2TA 3MACA 1BR4A 3N9PA 3OTOT 5F8PA 1UUSA 3ZSTA 3L39A 4HFEA 1GQEA 2EHOB 2NW9A 2V7KA 3N9NA 2J4GA 5CJ5A 1KF6A 3LSVA 2LSJA 2KSRA 4CN4A 4BJNA 4CXWA 5JRCB 4PJNA 4LF6T 3AE2A 4EOZB 5LGNB 3AVRA 3NRYA 2WQYA 4HWDA 5L4HA 4UF0B 4H9OC 5AQNB 3MKDA 2V7LA 3GMIA 5JDGA 2KWHA 4GKKT 3C64A 3N2OA 1D0ZA 4UVCB 3PE0A 1H7CA 4LFAT 3MA9A 4ERRA 3RYFE 1WCRA 4A97A 3C50A 5LB7B 2YOEA 4KMCA 4ZXLA 4ZI7E 3ZCIA 5HEGA 4CXYA 3GA8A 5HEHA 4IE0A 2JRKA 1OEDC 4U7IA 4X62T 4O4HE 5JR9A 1U5PA 2VQFT 4CXXA 1ZHCA 4AQGA 4BA9A 4H9QC 5AQJB 4H9RC 2CWYA 2K48A 2V7IA 2MYSA 2KLQA 2YN6A 1W0AA 1UK5A 3AE8A 3RLFF 3H3AA 5L2LA 4V1Av 2YK0A 4CQIA 4L0RA 3AE6A 1QSDA 4JI7T 2X51A 3AE9A 3PUGA 4B3MT 3CX7B 2MPKA 2J47A 5LMUT 4DR1T 3AE4A 5CGMA 4PJMA 5JTGA 4JI4T 3OBVE 5C8YE 1LKXA 3N9MA 2D9DA 4ZEYA 2FBWA 2IDOB 2XAFB 4JI0T 1YKEB 4C90A 3N5LA 3AEEA 4HWIB 3F2EA 2WWVA 3NBXX 2BG9C 3EDVA 2GK9A 1MMNA 3DTOA 3ETVA 3AAEB 3O1HA 4DV5T 4U72A 3B57A 3V5UA 5FXXA 5AQOB 5DQWA 4EZHA 2DCFA 3VKGA 4WW0A 4XBFB 4GYRA 2FJBA 5HXEA 3RIAA 1DU2A 2LOPA 1SE7A 5FL0A 2E9XB 2KWIB 2X68A 4ILCA 5M4YA 1HG5A 3O1JA 5L3DB 3MXZA 4EAHA 5KXJA 2UUBT 4B3RT 2BBJA 3ZMUB 2BS2A 5CA0E 2QYWA 4IDZA 4IE7A 2CA5A 4DIDB 5L47A 3AXJA 3HKEE 3OJAA 5DJQC 4PNIA 3J9X1 2FJEA 2A9UA 1BR1A 3WAKA 5BR8T 5HXHA 3RI5A 3FBZA 3CQGB 1MIYA 1D1BA 2XJ7A 1V9DA 4CI1B 2HH7A 5CB4E 5FXWA 2XY8B 2RA1A 2LM9A 2D0TA 5AQQB 4KUMB 3H3MA 3GN5A 4UIGA 2I59A 3Q5EA 4YTMA 4QH4A 2HN1A 3FXEB 2DLRA 3P4PA 3BQIA 2DL1A 4IE5A 3RC3A 4ZS2A 2EHOC 2C5JA 3Q5DA 2UXNB 4DV1T 5LHGB 2YKSA 4HFHA 3L8RA 3RKGA 1B7TA 4UVAB 5EK2A 4JV5T 1UGOA 2OV9A 1NENA 3MZKB 2WY2A 3K8PC 1W0BA 4CN1A 4HE8A 2Y48B 5JQGE 3UULA 3HI2A 2XQ5A 4YSYA 4H9SE 3NWIA 5LGUB 4U31A 4HFDA 1HNWT 1D0YA 4DBQA 2CXDA 1ZP0A 2BBHA 2KT9A 5FVKA 1OEDE 1N34T 2WZHA 4GOUA 1VCTA 1T8BA 3ABVA 3ANWB 2CHNA 4IL9A 2XZEA 3UU4A 5L3GB 1J5ET 3X1DA 5HEOA 2XQ9A 4HN9A 2YU1A 2LSGA 4WBNE 3AEFA 2JMHA 3H37A 4XAXB 4IDPA 3RRCA 4F6RC 3ANWA 5IYZE 4HFBA 4DV6T 3PU3A 2IIUA 2W00A 5FVLA 3AA1B 5FY0A 4MALA 4UVBB 3ONJA 2KZ7B 3AAIA 4E7ZA 4UV8B 2E8IA 5HCJA 4QKNA 3PUZF 2P9BA 4TWFA 2J62A 3UUNA 4U2YA 2XTLA 2XQ3A 3RX6A 4AKHA 5EK3A 3AA6B 2DWGA 5HXRA 4LF5T 4TV9E 1O3XA 3KVBA 3T8OA 5DQVA 5DABA 1IBLT 3ZLIA 4ANJA 3HKBE 1HS7A 5CFBA 3IF8B 1FMWA 2W62A 4KHZF 5JDLA 3TLSA 2BKNA 2M6BA 2YDQA 5LOVE 4HEAA 2V6XA 5IWAT 5FXVA 4KBMB 2BG9A 5C3JA 4IE6A 2NW7A 3VHLA 5LXTE 2ZLYA 1KNRA 3CIRA 4IE4A 3JCFA 2H88A 4NIQA 2Q9QA 2CXFA 4EZ4A 4JEUB 2XQ6A 3EVYA 2E9XC 1WYCA 3EDUA 2XUEA 3F31A 3Q2MA 1VCSA 1E2AA 5L3CB 2WZIA 4PK4A 3ZMVB 1OWAA 4YXDA 4ZI3C 4DR7T 1ZKEA 1SHZC 3QB5K 4ILBA 1UURA 2PJQA 3ZT6A 2W63A 4ILUA 4EIWA 2L8KA 1YQ4A 2RP4A 3G06A 4LF8T 2W66A 3IBPA 1G8XA 3Q9DA 1N33T 2VQET 2X9HA 2VL0A 3O9XA 2HPLA 4EV6A 2WAUA 3B5MA 3U78A 2IAKA 2EHOD 2VVNA 2QGSA 3SS1A 3OVUA 2NOXA 2BVMA 5FL1A 4AKIA 1N36T 4LFBT 2WWUA 4O4IE 4IREA 3B13A 5CA1E 5AQTB 2WMOA 4A56A 2VVSA 3I0QA 1IJ6A 2JQHA 2D0UA 3CQXC 4JI3T 3OPCA 1N32T 5ABHA 4DUYT 3ZMZB 5E0OA 2B1EA 2DHRA 1BR0A 1I6ZA 3AECA 3QC9A 3EABA 2LHNA 2LKHA 4H63H 2A3DA 3QUJA 3VR8A 2EHOA 4ADZA 1QUUA 3LK3B 5LNKA 2JQQA 3CQCB 4TNVA 1IBMT 3CMLA 4PAGA 1CHUA 1MMDA 1Z0PA 3MK7C 4DMVA 3LK2B 3KVAA 4JLEA 3N2GE 3OKQA 5KDMC 2X0LB 3PUXF 4I50E 5JRCA 4ZHQE 4MFRA 5HXSA 5BMVE 2G0UA 3E22E 4OX9T 4UF0A 3TLWA 4NPPA 4IDOA 5JDFA 2M6IA 3ZYLA 3O1IA 5HYAA 1BR2A 3M3ZB 1UX5A 2H89A
chains in the Genus database with same CATH topology
1ZV4X 1UCUA 2CA5A 4HFVA 3N2KE 4O2BE 3ZC1A 5LGTB 4KP3C 1T98A 4K0UA 3LJCA 3FXDB 4QX8B 2N2NA 4L9IA 3PUAA 3UFEA 5J2TE 4AQFC 1FEWA 5LBQB 2VKHA 2NTYA 3SRZA 2NW8A 4X1YE 3RKOA 4QX7B 3HKEE 4O8SA 3R6NA 3GWHA 4O4JE 3OJAA 2NWBA 2JJ9A 4UV9B 5DJQC 4TUYE 3HL6A 4PNIA 4TN7B 4GK5E 5A1LA 2K24A 3J9X1 4AKGA 5EZYE 4M1PA 1ZEEA 1S35A 1MNDA 1BR1A 4QHOA 4QXCB 3WAKA 5FP3A 4ZI2D 5HXHA 3A5XA 4FJOA 3FBZA 2L3LA 3CQGB 3HA4A 2D5UA 4O2AE 3FB2A 4OYJA 5JVDE 4ASKA 3WI3A 2CEAA 4IDZA 4X1IE 3ZJ2A 5KX5E 5HWXA 3K3NA 1MIYA 1D1BA 1V9DA 2UXXB 3LFMA 2JMKA 3PUSA 4CI1B 2HH7A 2VB6A 4OFZA 5CB4E 5FXWA 5L3FB 4IIJE 2BDEA 2A2FX 2RA1A 2LM9A 2KXPB 2D0TA 3ZYKA 4KUMB 2LSYA 4G2AA 2Z6EA 5LG4A 4WBOA 3GN5A 2D2SA 4UIGA 2C5IT 2M67A 3KV9A 2I59A 3P8CD 3EUHA 3PDYA 1HF8A 2ES0A 3C98B 1CUNA 1D1CA 3L3PA 4P09A 4B6XA 2CM0A 2J1DG 4PJLA 3FXEB 3ZJ1A 2YINA 4X1KE 4OYKA 1YD8G 1VRBA 2DLRA 2WM9A 1KNZA 3BQIA 3ZN0B 2XASB 4IE5A 1YW0A 2LE8A 2YEVC 3RC3A 2LOSA 3UUXB 4ISSA 4ZS2A 4PFPA 3ZMTB 2EHOC 2C5JA 2LEHA 3U3IA 3HR0A 2UXNB 3PU8A 4OHFA 1MMAA 2PG8A 5LHGB 3FBLA 3ZEFB 1SA0E 3RH3A 4BAYB 1FMVA 5LBMA 2ZMAA 1B7TA 2E9XD 5H6QB 1VOMA 4UVAB 1U4QA 5EK2A 4PJJA 2QA7A 4YHJA 3S4UA 4YFSA 2IC6A 3ZMSB 2Q9QC 2LSIA 3SOLA 4H9PC 4MHCA 5J2UE 3MZKB 4PK5A 4UXNB 5LJMA 3ESLA 2XAQB 1NAFA 5F3JA 4ZI3D 2Q9QB 3K8PC 3N9LA 4PFOA 3IEEA 2C0SA 3ZYMA 4J2CA 5GONE 2C5KT 4I55E 4YJ2E 3KBUA 4HE8A 2Y48B 2H7OA 5JQGE 1HX8A 1MIWA 2ZM0A 4TV8E 3UULA 3HI2A 3N9OA 2ACXA 4H9SE 2ZM8A 3E0ZA 5LGUB 5L3BB 4HGAA 4CZZB 2NTXA 5LHHB 1D0YA 3BQLA 3RYHE 4HKAA 2DWKA 4DBQA 2CXDA 5JH7E 3JC6D 2MOZA 1KK7A 4TZ4C 2KT9A 2CLYC 3AA0B 4OK0A 2V1DB 5JR9B 3RPUA 5JREA 2E9XA 3C51A 1UX4A 3DP7A 4GOUA 1HG2A 2CLYB 3C4XA 2NP9A 3ANWB 1G73A 4IHJE 3RRWA 3NRXA 3NZQA 5LJNA 5L3GB 3I9YA 2V26A 2KMFA 4NUUA 4ZOLE 4HN9A 3VU7H 3OYXA 2YU1A 3E08A 2X9YA 2VWAA 3KBTA 2LSGA 2LHRA 4WBNE 1US7B 2H3RA 1LVFA 2JMHA 3AB3B 3H37A 4XAXB 3RRCA 1MNEA 4N78D 3ANWA 5IYZE 4F6RC 1EZ3A 4DMWA 5LHIB 4AQFA 1IJ5A 3W15B 3PU3A 1HCIA 4E7SA 2CWOA 2VKJA 2W00A 3F57A 1HTJF 4XZCA 3RC8A 3ZN1B 4AKRB 3AA1B 3CVRA 2IW5B 5FY0A 5JDMA 4MALA 4GYSA 4QXBB 4UVBB 4DNDA 2KNDA 3DJBA 1WR6A 4ZS3A 2KZ7B 3AAIA 4E7ZA 1LRZA 2K5BB 3AAAB 3PURA 5EK4A 4O4LE 4UV8B 2E8IA 2YU2A 4CI2B 2CXLA 2ZM2A 3I0OA 4QKNA 4YLHA 2ODUA 3P7IA 3OYZA 5LYJE 3MACA 1MMGA 5ETWA 1BR4A 2VKDA 3N9PA 2P9BA 5F8PA 5ADXL 3UUNA 2JPFA 5L3EB 2XTLA 3RX6A 3PUQA 2MTQA 4AKHA 5EK3A 4EB6E 3AA6B 4ZI2C 2LJLA 4EYYR 2DWGA 3PTRB 5HXRA 4TV9E 1O3XA 2EHOB 2LT3A 3K3QC 3KVBA 3T8OA 5DQVA 5DABA 2NW9A 3C4ZA 2WBLA 2V7KA 5JDNA 2LSKA 3ZLIA 4ANJA 3N9NA 3NZPA 3HKBE 1HFAA 1HS7A 4X20E 3IF8B 1FMWA 2W62A 5JDLA 3I1AA 4Z8XA 5HXCA 5LOVE 2DI4A 3VKHA 2LSJA 4HEAA 5FXVA 4KBMB 1IAPA 1IZNB 3UUMA 3QK6A 4BJNA 4CXWA 5JRCB 4PJNA 4H63V 4IE6A 1X79A 2NW7A 4H9NC 2WMNA 3VHLA 5LXTE 2ZLYA 4EOZB 4UELA 5LGNB 3AVRA 3NRYA 3K3OA 5JDHA 3L09A 4UF0B 4H9OC 4IE4A 3MKDA 2V7LA 3GMIA 3RYIE 5JDGA 2KWHA 3AVSA 3KFWX 3C64A 3N2OA 2Q9QA 1D0ZA 2A72A 2CXFA 4UVCB 4EZ4A 4JEUB 2CCQA 3EVYA 5LP6E 1MIVA 3FHNA 4PW8A 1D0XA 2E9XC 3PE0A 1H7CA 1WYCA 4JEHB 5FY1A 3UT5E 3MA9A 4ERRA 3KDSE 3EDUA 4GIWA 2XUEA 3F31A 3Q2MA 4IGUA 3RYFE 5L3CB 2CMRA 3C50A 4ISTA 4PK4A 4KMCA 3ZMVB 4ZI7E 3ZCIA 3LK42 1OWAA 1WYBA 2IC9A 4ZI3C 5IHYA 2SPCA 4CXYA 1LVKA 2Y6XA 3GA8A 1ZKEA 1SHZC 3IHRA 2PJQA 4IE0A 4QXHB 2JRKA 4MLKA 2W63A 4ILUA 4EIWA 2L8KA 4G63A 4O4HE 2RP4A 5JR9A 5LCYA 2VL8A 2HPJA 3CX6B 3IBPA 1U5PA 5FYMA 1G8XA 3Q9DA 3ETUA 4CXXA 2X9HA 2OA5A 1ZHCA 2WSSV 2V7MA 3CPZA 5LA6E 2H7VC 4YJ3E 4AQGA 3O9XA 2XQYA 4BA9A 3ONXA 4H9QC 4FI5A 2HPLA 4H9RC 2CWYA 1Y64B 3JC6C 2K48A 2VKOA 4BJMA 2WAUA 2V7IA 4DBRA 2MYSA 2X67A 4EXTA 3U78A 1WRDA 2KLQA 1FIOA 2X9WA 2IAKA 3HKCE 4I43B 3SWHA 2W61A 3KV4A 2EHOD 3SS1A 2QGSA 2XAJB 3GN5B 3UTKA 2N9DA 3H3AA 2NOXA 4V1Av 2BVMA 2YK0A 4CQIA 5L2LA 3R84B 4L0RA 3RYCE 4NUVA 3ZCJA 4AKIA 4CI3B 1QSDA 5J1GA 3BQKA 3LBXB 2X51A 3PUGA 2WWUA 3CX7B 4O4IE 2XAGB 2KINB 3B13A 5CA1E 2CE7A 2BZBA 2WMOA 4A56A 3I0QA 4PJMA 3CKDA 3OBVE 2VK9A 1IJ6A 2X66A 2MBGA 2Q9QD 2Y8DA 5C8YE 1WLXA 4U74A 4EYUA 2D0UA 5FY7A 1LKXA 3CQXC 4AI6A 5JDQA 3N9MA 3ZPOA 3Q5WA 3LBXA 4L5GA 4MBQA 3KV5A 3J7Yq 3KINB 2XAFB 3ZMZB 2L9QA 5E0OA 2B1EA 2DHRA 1BR0A 5TAOA 1OXZA 2K9AA 1YKEB 3ZC0A 2DNXA 4C90A 3QC9A 3N5LA 4JUYA 2LHNA 2PFVA 1D1AA 4DO0A 4H63H 2A3DA 2X9XA 3F2EA 3QUJA 1AJ3A 2XHEB 4DVDA 3NBXX 3AA7B 4P0BA 4GK0E 2EHOA 3KV6A 4ADZA 1QUUA 3EDVA 3N9QA 2ODVA 3LK3B 5LNKA 4WNKA 2GK9A 1MMNA 2JQQA 3CQCB 5KMGP 3CMLA 4PAGA 1E1HB 3D0TA 3DTOA 4PK6A 1MMDA 3LG7A 3ETVA 3V5SA 1Z0PA 2V7JA 3AAEB 3MK7C 3O1HA 4DMVA 3CWZB 3BK9A 4U72A 4QWNB 3B57A 3LK2B 3TKLB 3V5UA 3C4WA 2XAHB 5FXXA 1YKHB 4AXPA 2N1GA 3KVAA 4JLEA 4UEMA 3I9WA 5DQWA 3N2GE 4EZHA 2DCFA 4P0AA 5FNVE 3VKGA 3OKQA 4WW0A 5KDMC 2W0GA 2X0LB 4I50E 4GYRA 5FXZA 4XBFB 1S94A 5JRCA 5HXEA 4TX5A 3CX8B 2PBIA 5FMNA 4ZHQE 3HKDE 4MFRA 5HXSA 2BVLA 2VASA 5BMVE 2G0UA 3E22E 4C91A 2LOPA 4UF0A 3O4XE 3M65A 3Q5XA 2E9XB 2KWIB 2X68A 5M4YA 3WAJA 1HG5A 5JDFA 3MJXA 3O1JA 5L3DB 3ZYLA 3O1IA 3MXZA 1BR2A 4EAHA 5HYAA 5HAXA 1UX5A 1NWMX 5HWYA 5JR9C 4HTEA 5H6RB 3ZMUB 4AKLA 5AFUL 5CA0E 4I4TE 4IE7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZV4 X;  1IAP A;  3CX8 B;  2PBI A;  2I59 A;  4WNK A;  3T8O A;  3CX6 B;  2ES0 A;  3AB3 B;  4L9I A;  3C51 A;  4GOU A;  4IGU A;  3C4Z A;  3CX7 B;  2ACX A;  3C4X A;  3C50 A;  4YHJ A;  3C4W A;  3QC9 A;  2DLR A;  1SHZ C;  1HTJ F;  2A72 A;  4PNI A;  4WBO A; 
#chains in the Genus database with same CATH topology
 2WDQ A;  4HFV A;  4O2B E;  1T98 A;  4X66 T;  2N2N A;  3P50 A;  4YSZ A;  5LBQ B;  4QX7 B;  4O8S A;  3GWH A;  4O4J E;  4TUY E;  3HL6 A;  4TN7 B;  4YT0 A;  2K24 A;  5EZY E;  3AE1 A;  1M62 A;  4QHO A;  3FZF B;  3A5X A;  4ASK A;  4X1I E;  5AQU B;  3K3N A;  3PUS A;  3LFM A;  2JMK A;  4CN6 A;  2BDE A;  2A2F X;  2KXP B;  3ZYK A;  2LSY A;  2Z6E A;  3FZL B;  4WBO A;  2D2S A;  2AE9 A;  2FUP A;  1CUN A;  3L3P A;  2CM0 A;  3EI0 A;  4PJL A;  4OYK A;  1VRB A;  2WM9 A;  3ZN0 B;  4ZZB A;  4ISS A;  3HR0 A;  3UQ4 A;  1YXR A;  4OHF A;  5ABG A;  1HR0 T;  2PG8 A;  4KHP T;  2XQ8 A;  1Z8U A;  4Z91 A;  5LBM A;  2E9X D;  5H6Q B;  1L0V A;  4YFS A;  2Q9Q C;  1KFY A;  1HX1 B;  4MHC A;  1XMO T;  4PK5 A;  5LJM A;  3ESL A;  1NAF A;  2PTF A;  2BS4 A;  1E7P A;  4ZI3 D;  3P4S A;  3N9L A;  3IEE A;  2C5K T;  2LM2 A;  2H7O A;  2ZM6 T;  2WP9 A;  2ZM0 A;  4TV8 E;  3JAD A;  2ZM8 A;  4HGA A;  5AQS B;  4DV4 T;  2V6Y B;  4WZX A;  3UU3 A;  2ACZ A;  1KK7 A;  2WU2 A;  4OK0 A;  2V1D B;  4ILA A;  3RPU A;  2E9X A;  1HG2 A;  2CLY B;  3C4X A;  2JIW A;  4QH1 A;  4IHJ E;  3NRX A;  5LJN A;  2KMF A;  2F4V T;  3VU7 H;  1XMQ T;  2VWA A;  3T1H T;  3FZM B;  2UXB T;  1LVF A;  5ABF B;  4NXN T;  1JNR A;  4N78 D;  1EZ3 A;  4LFC T;  2UU9 T;  4AQF A;  1FJG T;  3W15 B;  2IUB A;  5LG3 A;  4E7S A;  4DV3 T;  3RHW A;  1T7S A;  4GYS A;  2QRX A;  4ZS3 A;  4TNW A;  3AAA B;  5EK4 A;  2YU2 A;  4DR4 T;  2CXL A;  2FJA A;  2ZM2 A;  2NR4 A;  3P7I A;  2E5L T;  5ETW A;  2I6H A;  2VKD A;  3AED A;  2BKO A;  4JI5 T;  5L3E B;  3EAM A;  3ZKR A;  1KEY A;  4EB6 E;  2YDR A;  2W4X A;  3C4Z A;  3PUY F;  4X20 E;  4Z8X A;  4K0K T;  1W9R A;  2DI4 A;  3JAE A;  3VKH A;  3QK6 A;  1X79 A;  4H9N C;  3RIU A;  4UEL A;  2I0M A;  3L09 A;  2YDS A;  5HEJ A;  5LP6 E;  3FHN A;  4PW8 A;  2JQ9 A;  4JEH B;  5AQL B;  3UT5 E;  3AE3 A;  4GIW A;  2CMR A;  3LK4 2;  4KI0 F;  1WYB A;  2IC9 A;  2SPC A;  2Y6X A;  3IHR A;  2LRL A;  3ZT5 A;  4QXH B;  1WFD A;  4MLK A;  2V5C A;  3LDQ B;  5LCY A;  2HPJ A;  1OED B;  3CX6 B;  2HN2 A;  3ETU A;  2RPA A;  5LA6 E;  2H7V C;  3ONX A;  3ZT7 A;  3EHZ A;  1Y64 B;  3JC6 C;  4BJM A;  4DBR A;  3T1Y T;  2X67 A;  4EXT A;  4LMJ A;  1WRD A;  2XM2 A;  2X9W A;  3HKC E;  3KV4 A;  3UTK A;  2N9D A;  1XWM A;  3ZCJ A;  3RYC E;  4Q25 A;  4CI3 B;  4TWD A;  5J1G A;  3LBX B;  2XAG B;  1XNR T;  2KIN B;  4AQY T;  2CE7 A;  2BZB A;  3CKD A;  2WDR A;  2VK9 A;  2Q9Q D;  2Y8D A;  4U74 A;  5AQM B;  4AI6 A;  2XQ4 A;  3LBX A;  1SUM B;  3KV5 A;  3KIN B;  2BG9 E;  2K9A A;  3ZC0 A;  4JUY A;  2IHR 1;  2UXC T;  2UXD T;  2WDV A;  1D1A A;  4DO0 A;  3PJA J;  3PUV F;  2X9X A;  2XHE B;  3AA7 B;  4P0B A;  4GK0 E;  3KV6 A;  4COF A;  2ODV A;  5FKY A;  2E2A A;  4WNK A;  2OLT A;  5KMG P;  4LMK A;  1E1H B;  3D0T A;  3V5S A;  3CWZ B;  4QWN B;  4X5T A;  3C4W A;  2XAH B;  2N1G A;  2LLY A;  4IT4 A;  3I9W A;  2XQ7 A;  1S94 A;  1XDO A;  2PBI A;  5FMN A;  1I94 T;  2VAS A;  4C91 A;  3RGL A;  3O4X E;  5L4E A;  3MJX A;  3UUB A;  3P4W A;  4LF9 T;  1NWM X;  1YQ3 A;  5HWY A;  5H6R B;  5LHI B;  1ZV4 X;  3ZC1 A;  3N2K E;  5ABE A;  4KP3 C;  3LJC A;  4LML A;  4QX8 B;  3IA3 A;  3PUA A;  3UFE A;  4IL4 A;  4AQF C;  2VKH A;  2NTY A;  1X9B A;  4X1Y E;  3RKO A;  4U2Z A;  2NWB A;  2JJ9 A;  4UV9 B;  1T72 A;  3QOF A;  3AEB A;  1KNP A;  4HFC A;  4AKG A;  3PUW F;  4M1P A;  1ZEE A;  1S35 A;  1MND A;  2WB5 A;  5FP3 A;  4FJO A;  4DV2 T;  3HA4 A;  4O2A E;  3FB2 A;  4OYJ A;  5AQG B;  5JVD E;  3ZJ2 A;  2CEA A;  4TWH A;  5HWX A;  3K1S A;  4JI1 T;  2UXX B;  4OFZ A;  3AEA A;  5LG4 A;  1XDP A;  2C5I T;  1HNX T;  3P8C D;  3EUH A;  1M7K A;  2VUR A;  3C98 B;  4B6X A;  2J1D G;  3ZJ1 A;  2YIN A;  4X1K E;  1YD8 G;  4B3S T;  2XQA A;  3AEG A;  1YW0 A;  2YEV C;  4PFP A;  2LEH A;  3PU8 A;  1MMA A;  1WR0 A;  3FBL A;  3RIU C;  1XNQ T;  3RH3 A;  2X0H A;  1JNZ A;  1U4Q A;  2CRB A;  4PJJ A;  4YHJ A;  3S4U A;  5HCM A;  3SOL A;  4H9P C;  4JI2 T;  5J2U E;  2XAQ B;  4DR2 T;  4PFO A;  2C0S A;  4J2C A;  5GON E;  3KBU A;  4EEB A;  1HX8 A;  4DUZ T;  2ACX A;  4A98 A;  3E0Z A;  4CZZ B;  1W09 A;  4WYV A;  4YHH T;  4HKA A;  2DWK A;  5JH7 E;  3JC6 D;  2MOZ A;  4DR6 T;  4TZ4 C;  5JR9 B;  5AQK B;  5JRE A;  3C51 A;  3A7M A;  3NZQ A;  2MAW A;  3I9Y A;  2V26 A;  1QLB A;  3E08 A;  3SFD A;  1IJ5 A;  3RIF A;  2CWO A;  3RQW A;  2VKJ A;  3F57 A;  4XZC A;  3RC8 A;  4AKR B;  2BS3 A;  3CVR A;  2IW5 B;  5JDM A;  4DND A;  3DJB A;  3AE5 A;  1WR6 A;  2QVA A;  4CI2 B;  3I0O A;  4YLH A;  2CBI A;  2ODU A;  5LYJ E;  1MMG A;  5ADX L;  2JPF A;  3PUQ A;  2MTQ A;  4ZI2 C;  2LJL A;  4EYY R;  3PTR B;  3K3Q C;  2LT3 A;  3FZK B;  4U3C A;  4U33 A;  4UR9 A;  2WBL A;  5JDN A;  2LSK A;  2V5D A;  4KX6 A;  3NZP A;  1HFA A;  3JAF A;  3I1A A;  5HXC A;  4X64 T;  1IAP A;  1IZN B;  3UUM A;  3TLU A;  2E5V A;  4H63 V;  2WMN A;  3VR9 A;  2XSB A;  3K3O A;  5JDH A;  1NEK A;  3RYI E;  3PV0 F;  4NXM T;  3AVS A;  3KFW X;  2A72 A;  5F5W A;  2CCQ A;  3NKZ A;  4QH5 A;  1MIV A;  1D0X A;  2UUC T;  5FY1 A;  3KDS E;  4IGU A;  4IST A;  4X65 T;  5AQR B;  5IHY A;  3AXJ B;  1LVK A;  1IBK T;  2V6Y A;  2XSA A;  4HWC A;  4G63 A;  1ZOY A;  2VL8 A;  3A8Y C;  5FYM A;  4YTN A;  2OA5 A;  2WSS V;  2V7M A;  3CPZ A;  4YJ3 E;  2W2U A;  2V8S V;  2XQY A;  4DV0 T;  4FI5 A;  2VKO A;  1FIO A;  4I43 B;  3SWH A;  2W61 A;  5ABF A;  2XAJ B;  3GN5 B;  5AQP B;  3R84 B;  3FZH B;  4NUV A;  3BQK A;  5AQI B;  4HFI A;  5IUX A;  2X66 A;  3ZSS A;  2MBG A;  4YTP A;  1WLX A;  4EYU A;  5FY7 A;  5JDQ A;  4YSX A;  3P4R A;  3P4Q A;  3ZPO A;  3Q5W A;  4LF4 T;  4L5G A;  4MBQ A;  4DV7 T;  3J7Y q;  2L9Q A;  5TAO A;  1OXZ A;  2DNX A;  3QB5 A;  2PFV A;  2X0Y A;  1AJ3 A;  4DVD A;  4IDN A;  3N9Q A;  4PK6 A;  3LG7 A;  2V7J A;  4A5X A;  3BK9 A;  3AE7 A;  3TKL B;  3UU5 A;  4EGW A;  1YKH B;  4AXP A;  3NVO A;  4UEM A;  3RQU A;  5AQH B;  4P0A A;  5FNV E;  2UUA T;  2W0G A;  5FXZ A;  3UU6 A;  1J5W A;  3CX8 B;  4TX5 A;  4P1N A;  3HKD E;  2BVL A;  3UQ7 A;  3M65 A;  4YY3 T;  3Q5X A;  5J0Z A;  3PJA A;  3WAJ A;  4IDQ A;  2CHO A;  5HAX A;  1J1J A;  5JR9 C;  4HTE A;  2WS3 A;  4AKL A;  3TLT A;  5AFU L;  4Z90 A;  4I4T E;  4ZZC A;  5LGT B;  1UCU A;  4GKJ T;  1Y01 A;  4K0U A;  3FXD B;  4L9I A;  5J2T E;  2LRK A;  1FEW A;  4JYA T;  3SRZ A;  2NW8 A;  4U7Y A;  3VRA A;  3R6N A;  4HWF A;  1HNZ T;  4F8H A;  2FJD A;  4GK5 E;  2B76 A;  5A1L A;  4AIU A;  1OED A;  1R8I A;  2XPK A;  4QXC B;  4ZI2 D;  1XZY A;  3UU8 A;  4LF7 T;  2L3L A;  2D5U A;  3WI3 A;  5KX5 E;  2VB6 A;  5L3F B;  4IIJ E;  4G2A A;  2AXD S;  2M67 A;  3KV9 A;  3PDY A;  1HF8 A;  2ES0 A;  3VRB A;  1D1C A;  2K3W A;  4P09 A;  2BKP A;  3CK6 A;  1KNZ A;  2XAS B;  2JQK A;  2LE8 A;  2R6G F;  2LOS A;  3UUX B;  3ZMT B;  3SFE A;  3TLV A;  3U3I A;  2WU5 A;  3ZEF B;  1SA0 E;  3RF1 A;  2BG9 B;  4BAY B;  1FMV A;  2ZMA A;  1VOM A;  4HWH A;  2QA7 A;  2IC6 A;  3ZMS B;  2LKG A;  2LSI A;  4UXN B;  5LMN T;  4DR5 T;  5F3J A;  2Q9Q B;  3ZYM A;  2WCA A;  4I55 E;  4YJ2 E;  1MIW A;  3N9O A;  4JI8 T;  5L3B B;  2NTX A;  5LHH B;  3BQL A;  3RYH E;  5HEU A;  2CLY C;  3AA0 B;  1UX4 A;  3DP7 A;  2NP9 A;  4EED A;  1G73 A;  3RRW A;  3UFG A;  4NUU A;  4ZOL E;  4B3T T;  3OYX A;  2X9Y A;  3KBT A;  2CBJ A;  2W67 A;  3QNU A;  2LHR A;  1US7 B;  2H3R A;  4AIS A;  5AQF B;  3AB3 B;  4DR3 T;  1MNE A;  4JBW F;  4DMW A;  1HCI A;  2XM1 A;  2CPT A;  2HHH T;  1HTJ F;  4JI6 T;  3ZN1 B;  2IML A;  4I0U A;  4QXB B;  3ONL C;  2KND A;  5AQV B;  1LRZ A;  2K5B B;  3PUR A;  4O4L E;  3OYZ A;  5C2T A;  3MAC A;  1BR4 A;  3N9P A;  3OTO T;  5F8P A;  1UUS A;  3ZST A;  3L39 A;  4HFE A;  1GQE A;  2EHO B;  2NW9 A;  2V7K A;  3N9N A;  2J4G A;  5CJ5 A;  1KF6 A;  3LSV A;  2LSJ A;  2KSR A;  4CN4 A;  4BJN A;  4CXW A;  5JRC B;  4PJN A;  4LF6 T;  3AE2 A;  4EOZ B;  5LGN B;  3AVR A;  3NRY A;  2WQY A;  4HWD A;  5L4H A;  4UF0 B;  4H9O C;  5AQN B;  3MKD A;  2V7L A;  3GMI A;  5JDG A;  2KWH A;  4GKK T;  3C64 A;  3N2O A;  1D0Z A;  4UVC B;  3PE0 A;  1H7C A;  4LFA T;  3MA9 A;  4ERR A;  3RYF E;  1WCR A;  4A97 A;  3C50 A;  5LB7 B;  2YOE A;  4KMC A;  4ZXL A;  4ZI7 E;  3ZCI A;  5HEG A;  4CXY A;  3GA8 A;  5HEH A;  4IE0 A;  2JRK A;  1OED C;  4U7I A;  4X62 T;  4O4H E;  5JR9 A;  1U5P A;  2VQF T;  4CXX A;  1ZHC A;  4AQG A;  4BA9 A;  4H9Q C;  5AQJ B;  4H9R C;  2CWY A;  2K48 A;  2V7I A;  2MYS A;  2KLQ A;  2YN6 A;  1W0A A;  1UK5 A;  3AE8 A;  3RLF F;  3H3A A;  5L2L A;  4V1A v;  2YK0 A;  4CQI A;  4L0R A;  3AE6 A;  1QSD A;  4JI7 T;  2X51 A;  3AE9 A;  3PUG A;  4B3M T;  3CX7 B;  2MPK A;  2J47 A;  5LMU T;  4DR1 T;  3AE4 A;  5CGM A;  4PJM A;  5JTG A;  4JI4 T;  3OBV E;  5C8Y E;  1LKX A;  3N9M A;  2D9D A;  4ZEY A;  2FBW A;  2IDO B;  2XAF B;  4JI0 T;  1YKE B;  4C90 A;  3N5L A;  3AEE A;  4HWI B;  3F2E A;  2WWV A;  3NBX X;  2BG9 C;  3EDV A;  2GK9 A;  1MMN A;  3DTO A;  3ETV A;  3AAE B;  3O1H A;  4DV5 T;  4U72 A;  3B57 A;  3V5U A;  5FXX A;  5AQO B;  5DQW A;  4EZH A;  2DCF A;  3VKG A;  4WW0 A;  4XBF B;  4GYR A;  2FJB A;  5HXE A;  3RIA A;  1DU2 A;  2LOP A;  1SE7 A;  5FL0 A;  2E9X B;  2KWI B;  2X68 A;  4ILC A;  5M4Y A;  1HG5 A;  3O1J A;  5L3D B;  3MXZ A;  4EAH A;  5KXJ A;  2UUB T;  4B3R T;  2BBJ A;  3ZMU B;  2BS2 A;  5CA0 E;  2QYW A;  4IDZ A;  4IE7 A;  2CA5 A;  4DID B;  5L47 A;  3AXJ A;  3HKE E;  3OJA A;  5DJQ C;  4PNI A;  3J9X 1;  2FJE A;  2A9U A;  1BR1 A;  3WAK A;  5BR8 T;  5HXH A;  3RI5 A;  3FBZ A;  3CQG B;  1MIY A;  1D1B A;  2XJ7 A;  1V9D A;  4CI1 B;  2HH7 A;  5CB4 E;  5FXW A;  2XY8 B;  2RA1 A;  2LM9 A;  2D0T A;  5AQQ B;  4KUM B;  3H3M A;  3GN5 A;  4UIG A;  2I59 A;  3Q5E A;  4YTM A;  4QH4 A;  2HN1 A;  3FXE B;  2DLR A;  3P4P A;  3BQI A;  2DL1 A;  4IE5 A;  3RC3 A;  4ZS2 A;  2EHO C;  2C5J A;  3Q5D A;  2UXN B;  4DV1 T;  5LHG B;  2YKS A;  4HFH A;  3L8R A;  3RKG A;  1B7T A;  4UVA B;  5EK2 A;  4JV5 T;  1UGO A;  2OV9 A;  1NEN A;  3MZK B;  2WY2 A;  3K8P C;  1W0B A;  4CN1 A;  4HE8 A;  2Y48 B;  5JQG E;  3UUL A;  3HI2 A;  2XQ5 A;  4YSY A;  4H9S E;  3NWI A;  5LGU B;  4U31 A;  4HFD A;  1HNW T;  1D0Y A;  4DBQ A;  2CXD A;  1ZP0 A;  2BBH A;  2KT9 A;  5FVK A;  1OED E;  1N34 T;  2WZH A;  4GOU A;  1VCT A;  1T8B A;  3ABV A;  3ANW B;  2CHN A;  4IL9 A;  2XZE A;  3UU4 A;  5L3G B;  1J5E T;  3X1D A;  5HEO A;  2XQ9 A;  4HN9 A;  2YU1 A;  2LSG A;  4WBN E;  3AEF A;  2JMH A;  3H37 A;  4XAX B;  4IDP A;  3RRC A;  4F6R C;  3ANW A;  5IYZ E;  4HFB A;  4DV6 T;  3PU3 A;  2IIU A;  2W00 A;  5FVL A;  3AA1 B;  5FY0 A;  4MAL A;  4UVB B;  3ONJ A;  2KZ7 B;  3AAI A;  4E7Z A;  4UV8 B;  2E8I A;  5HCJ A;  4QKN A;  3PUZ F;  2P9B A;  4TWF A;  2J62 A;  3UUN A;  4U2Y A;  2XTL A;  2XQ3 A;  3RX6 A;  4AKH A;  5EK3 A;  3AA6 B;  2DWG A;  5HXR A;  4LF5 T;  4TV9 E;  1O3X A;  3KVB A;  3T8O A;  5DQV A;  5DAB A;  1IBL T;  3ZLI A;  4ANJ A;  3HKB E;  1HS7 A;  5CFB A;  3IF8 B;  1FMW A;  2W62 A;  4KHZ F;  5JDL A;  3TLS A;  2BKN A;  2M6B A;  2YDQ A;  5LOV E;  4HEA A;  2V6X A;  5IWA T;  5FXV A;  4KBM B;  2BG9 A;  5C3J A;  4IE6 A;  2NW7 A;  3VHL A;  5LXT E;  2ZLY A;  1KNR A;  3CIR A;  4IE4 A;  3JCF A;  2H88 A;  4NIQ A;  2Q9Q A;  2CXF A;  4EZ4 A;  4JEU B;  2XQ6 A;  3EVY A;  2E9X C;  1WYC A;  3EDU A;  2XUE A;  3F31 A;  3Q2M A;  1VCS A;  1E2A A;  5L3C B;  2WZI A;  4PK4 A;  3ZMV B;  1OWA A;  4YXD A;  4ZI3 C;  4DR7 T;  1ZKE A;  1SHZ C;  3QB5 K;  4ILB A;  1UUR A;  2PJQ A;  3ZT6 A;  2W63 A;  4ILU A;  4EIW A;  2L8K A;  1YQ4 A;  2RP4 A;  3G06 A;  4LF8 T;  2W66 A;  3IBP A;  1G8X A;  3Q9D A;  1N33 T;  2VQE T;  2X9H A;  2VL0 A;  3O9X A;  2HPL A;  4EV6 A;  2WAU A;  3B5M A;  3U78 A;  2IAK A;  2EHO D;  2VVN A;  2QGS A;  3SS1 A;  3OVU A;  2NOX A;  2BVM A;  5FL1 A;  4AKI A;  1N36 T;  4LFB T;  2WWU A;  4O4I E;  4IRE A;  3B13 A;  5CA1 E;  5AQT B;  2WMO A;  4A56 A;  2VVS A;  3I0Q A;  1IJ6 A;  2JQH A;  2D0U A;  3CQX C;  4JI3 T;  3OPC A;  1N32 T;  5ABH A;  4DUY T;  3ZMZ B;  5E0O A;  2B1E A;  2DHR A;  1BR0 A;  1I6Z A;  3AEC A;  3QC9 A;  3EAB A;  2LHN A;  2LKH A;  4H63 H;  2A3D A;  3QUJ A;  3VR8 A;  2EHO A;  4ADZ A;  1QUU A;  3LK3 B;  5LNK A;  2JQQ A;  3CQC B;  4TNV A;  1IBM T;  3CML A;  4PAG A;  1CHU A;  1MMD A;  1Z0P A;  3MK7 C;  4DMV A;  3LK2 B;  3KVA A;  4JLE A;  3N2G E;  3OKQ A;  5KDM C;  2X0L B;  3PUX F;  4I50 E;  5JRC A;  4ZHQ E;  4MFR A;  5HXS A;  5BMV E;  2G0U A;  3E22 E;  4OX9 T;  4UF0 A;  3TLW A;  4NPP A;  4IDO A;  5JDF A;  2M6I A;  3ZYL A;  3O1I A;  5HYA A;  1BR2 A;  3M3Z B;  1UX5 A;  2H89 A; 
#chains in the Genus database with same CATH homology
 1ZV4 X;  1UCU A;  2CA5 A;  4HFV A;  3N2K E;  4O2B E;  3ZC1 A;  5LGT B;  4KP3 C;  1T98 A;  4K0U A;  3LJC A;  3FXD B;  4QX8 B;  2N2N A;  4L9I A;  3PUA A;  3UFE A;  5J2T E;  4AQF C;  1FEW A;  5LBQ B;  2VKH A;  2NTY A;  3SRZ A;  2NW8 A;  4X1Y E;  3RKO A;  4QX7 B;  3HKE E;  4O8S A;  3R6N A;  3GWH A;  4O4J E;  3OJA A;  2NWB A;  2JJ9 A;  4UV9 B;  5DJQ C;  4TUY E;  3HL6 A;  4PNI A;  4TN7 B;  4GK5 E;  5A1L A;  2K24 A;  3J9X 1;  4AKG A;  5EZY E;  4M1P A;  1ZEE A;  1S35 A;  1MND A;  1BR1 A;  4QHO A;  4QXC B;  3WAK A;  5FP3 A;  4ZI2 D;  5HXH A;  3A5X A;  4FJO A;  3FBZ A;  2L3L A;  3CQG B;  3HA4 A;  2D5U A;  4O2A E;  3FB2 A;  4OYJ A;  5JVD E;  4ASK A;  3WI3 A;  2CEA A;  4IDZ A;  4X1I E;  3ZJ2 A;  5KX5 E;  5HWX A;  3K3N A;  1MIY A;  1D1B A;  1V9D A;  2UXX B;  3LFM A;  2JMK A;  3PUS A;  4CI1 B;  2HH7 A;  2VB6 A;  4OFZ A;  5CB4 E;  5FXW A;  5L3F B;  4IIJ E;  2BDE A;  2A2F X;  2RA1 A;  2LM9 A;  2KXP B;  2D0T A;  3ZYK A;  4KUM B;  2LSY A;  4G2A A;  2Z6E A;  5LG4 A;  4WBO A;  3GN5 A;  2D2S A;  4UIG A;  2C5I T;  2M67 A;  3KV9 A;  2I59 A;  3P8C D;  3EUH A;  3PDY A;  1HF8 A;  2ES0 A;  3C98 B;  1CUN A;  1D1C A;  3L3P A;  4P09 A;  4B6X A;  2CM0 A;  2J1D G;  4PJL A;  3FXE B;  3ZJ1 A;  2YIN A;  4X1K E;  4OYK A;  1YD8 G;  1VRB A;  2DLR A;  2WM9 A;  1KNZ A;  3BQI A;  3ZN0 B;  2XAS B;  4IE5 A;  1YW0 A;  2LE8 A;  2YEV C;  3RC3 A;  2LOS A;  3UUX B;  4ISS A;  4ZS2 A;  4PFP A;  3ZMT B;  2EHO C;  2C5J A;  2LEH A;  3U3I A;  3HR0 A;  2UXN B;  3PU8 A;  4OHF A;  1MMA A;  2PG8 A;  5LHG B;  3FBL A;  3ZEF B;  1SA0 E;  3RH3 A;  4BAY B;  1FMV A;  5LBM A;  2ZMA A;  1B7T A;  2E9X D;  5H6Q B;  1VOM A;  4UVA B;  1U4Q A;  5EK2 A;  4PJJ A;  2QA7 A;  4YHJ A;  3S4U A;  4YFS A;  2IC6 A;  3ZMS B;  2Q9Q C;  2LSI A;  3SOL A;  4H9P C;  4MHC A;  5J2U E;  3MZK B;  4PK5 A;  4UXN B;  5LJM A;  3ESL A;  2XAQ B;  1NAF A;  5F3J A;  4ZI3 D;  2Q9Q B;  3K8P C;  3N9L A;  4PFO A;  3IEE A;  2C0S A;  3ZYM A;  4J2C A;  5GON E;  2C5K T;  4I55 E;  4YJ2 E;  3KBU A;  4HE8 A;  2Y48 B;  2H7O A;  5JQG E;  1HX8 A;  1MIW A;  2ZM0 A;  4TV8 E;  3UUL A;  3HI2 A;  3N9O A;  2ACX A;  4H9S E;  2ZM8 A;  3E0Z A;  5LGU B;  5L3B B;  4HGA A;  4CZZ B;  2NTX A;  5LHH B;  1D0Y A;  3BQL A;  3RYH E;  4HKA A;  2DWK A;  4DBQ A;  2CXD A;  5JH7 E;  3JC6 D;  2MOZ A;  1KK7 A;  4TZ4 C;  2KT9 A;  2CLY C;  3AA0 B;  4OK0 A;  2V1D B;  5JR9 B;  3RPU A;  5JRE A;  2E9X A;  3C51 A;  1UX4 A;  3DP7 A;  4GOU A;  1HG2 A;  2CLY B;  3C4X A;  2NP9 A;  3ANW B;  1G73 A;  4IHJ E;  3RRW A;  3NRX A;  3NZQ A;  5LJN A;  5L3G B;  3I9Y A;  2V26 A;  2KMF A;  4NUU A;  4ZOL E;  4HN9 A;  3VU7 H;  3OYX A;  2YU1 A;  3E08 A;  2X9Y A;  2VWA A;  3KBT A;  2LSG A;  2LHR A;  4WBN E;  1US7 B;  2H3R A;  1LVF A;  2JMH A;  3AB3 B;  3H37 A;  4XAX B;  3RRC A;  1MNE A;  4N78 D;  3ANW A;  5IYZ E;  4F6R C;  1EZ3 A;  4DMW A;  5LHI B;  4AQF A;  1IJ5 A;  3W15 B;  3PU3 A;  1HCI A;  4E7S A;  2CWO A;  2VKJ A;  2W00 A;  3F57 A;  1HTJ F;  4XZC A;  3RC8 A;  3ZN1 B;  4AKR B;  3AA1 B;  3CVR A;  2IW5 B;  5FY0 A;  5JDM A;  4MAL A;  4GYS A;  4QXB B;  4UVB B;  4DND A;  2KND A;  3DJB A;  1WR6 A;  4ZS3 A;  2KZ7 B;  3AAI A;  4E7Z A;  1LRZ A;  2K5B B;  3AAA B;  3PUR A;  5EK4 A;  4O4L E;  4UV8 B;  2E8I A;  2YU2 A;  4CI2 B;  2CXL A;  2ZM2 A;  3I0O A;  4QKN A;  4YLH A;  2ODU A;  3P7I A;  3OYZ A;  5LYJ E;  3MAC A;  1MMG A;  5ETW A;  1BR4 A;  2VKD A;  3N9P A;  2P9B A;  5F8P A;  5ADX L;  3UUN A;  2JPF A;  5L3E B;  2XTL A;  3RX6 A;  3PUQ A;  2MTQ A;  4AKH A;  5EK3 A;  4EB6 E;  3AA6 B;  4ZI2 C;  2LJL A;  4EYY R;  2DWG A;  3PTR B;  5HXR A;  4TV9 E;  1O3X A;  2EHO B;  2LT3 A;  3K3Q C;  3KVB A;  3T8O A;  5DQV A;  5DAB A;  2NW9 A;  3C4Z A;  2WBL A;  2V7K A;  5JDN A;  2LSK A;  3ZLI A;  4ANJ A;  3N9N A;  3NZP A;  3HKB E;  1HFA A;  1HS7 A;  4X20 E;  3IF8 B;  1FMW A;  2W62 A;  5JDL A;  3I1A A;  4Z8X A;  5HXC A;  5LOV E;  2DI4 A;  3VKH A;  2LSJ A;  4HEA A;  5FXV A;  4KBM B;  1IAP A;  1IZN B;  3UUM A;  3QK6 A;  4BJN A;  4CXW A;  5JRC B;  4PJN A;  4H63 V;  4IE6 A;  1X79 A;  2NW7 A;  4H9N C;  2WMN A;  3VHL A;  5LXT E;  2ZLY A;  4EOZ B;  4UEL A;  5LGN B;  3AVR A;  3NRY A;  3K3O A;  5JDH A;  3L09 A;  4UF0 B;  4H9O C;  4IE4 A;  3MKD A;  2V7L A;  3GMI A;  3RYI E;  5JDG A;  2KWH A;  3AVS A;  3KFW X;  3C64 A;  3N2O A;  2Q9Q A;  1D0Z A;  2A72 A;  2CXF A;  4UVC B;  4EZ4 A;  4JEU B;  2CCQ A;  3EVY A;  5LP6 E;  1MIV A;  3FHN A;  4PW8 A;  1D0X A;  2E9X C;  3PE0 A;  1H7C A;  1WYC A;  4JEH B;  5FY1 A;  3UT5 E;  3MA9 A;  4ERR A;  3KDS E;  3EDU A;  4GIW A;  2XUE A;  3F31 A;  3Q2M A;  4IGU A;  3RYF E;  5L3C B;  2CMR A;  3C50 A;  4IST A;  4PK4 A;  4KMC A;  3ZMV B;  4ZI7 E;  3ZCI A;  3LK4 2;  1OWA A;  1WYB A;  2IC9 A;  4ZI3 C;  5IHY A;  2SPC A;  4CXY A;  1LVK A;  2Y6X A;  3GA8 A;  1ZKE A;  1SHZ C;  3IHR A;  2PJQ A;  4IE0 A;  4QXH B;  2JRK A;  4MLK A;  2W63 A;  4ILU A;  4EIW A;  2L8K A;  4G63 A;  4O4H E;  2RP4 A;  5JR9 A;  5LCY A;  2VL8 A;  2HPJ A;  3CX6 B;  3IBP A;  1U5P A;  5FYM A;  1G8X A;  3Q9D A;  3ETU A;  4CXX A;  2X9H A;  2OA5 A;  1ZHC A;  2WSS V;  2V7M A;  3CPZ A;  5LA6 E;  2H7V C;  4YJ3 E;  4AQG A;  3O9X A;  2XQY A;  4BA9 A;  3ONX A;  4H9Q C;  4FI5 A;  2HPL A;  4H9R C;  2CWY A;  1Y64 B;  3JC6 C;  2K48 A;  2VKO A;  4BJM A;  2WAU A;  2V7I A;  4DBR A;  2MYS A;  2X67 A;  4EXT A;  3U78 A;  1WRD A;  2KLQ A;  1FIO A;  2X9W A;  2IAK A;  3HKC E;  4I43 B;  3SWH A;  2W61 A;  3KV4 A;  2EHO D;  3SS1 A;  2QGS A;  2XAJ B;  3GN5 B;  3UTK A;  2N9D A;  3H3A A;  2NOX A;  4V1A v;  2BVM A;  2YK0 A;  4CQI A;  5L2L A;  3R84 B;  4L0R A;  3RYC E;  4NUV A;  3ZCJ A;  4AKI A;  4CI3 B;  1QSD A;  5J1G A;  3BQK A;  3LBX B;  2X51 A;  3PUG A;  2WWU A;  3CX7 B;  4O4I E;  2XAG B;  2KIN B;  3B13 A;  5CA1 E;  2CE7 A;  2BZB A;  2WMO A;  4A56 A;  3I0Q A;  4PJM A;  3CKD A;  3OBV E;  2VK9 A;  1IJ6 A;  2X66 A;  2MBG A;  2Q9Q D;  2Y8D A;  5C8Y E;  1WLX A;  4U74 A;  4EYU A;  2D0U A;  5FY7 A;  1LKX A;  3CQX C;  4AI6 A;  5JDQ A;  3N9M A;  3ZPO A;  3Q5W A;  3LBX A;  4L5G A;  4MBQ A;  3KV5 A;  3J7Y q;  3KIN B;  2XAF B;  3ZMZ B;  2L9Q A;  5E0O A;  2B1E A;  2DHR A;  1BR0 A;  5TAO A;  1OXZ A;  2K9A A;  1YKE B;  3ZC0 A;  2DNX A;  4C90 A;  3QC9 A;  3N5L A;  4JUY A;  2LHN A;  2PFV A;  1D1A A;  4DO0 A;  4H63 H;  2A3D A;  2X9X A;  3F2E A;  3QUJ A;  1AJ3 A;  2XHE B;  4DVD A;  3NBX X;  3AA7 B;  4P0B A;  4GK0 E;  2EHO A;  3KV6 A;  4ADZ A;  1QUU A;  3EDV A;  3N9Q A;  2ODV A;  3LK3 B;  5LNK A;  4WNK A;  2GK9 A;  1MMN A;  2JQQ A;  3CQC B;  5KMG P;  3CML A;  4PAG A;  1E1H B;  3D0T A;  3DTO A;  4PK6 A;  1MMD A;  3LG7 A;  3ETV A;  3V5S A;  1Z0P A;  2V7J A;  3AAE B;  3MK7 C;  3O1H A;  4DMV A;  3CWZ B;  3BK9 A;  4U72 A;  4QWN B;  3B57 A;  3LK2 B;  3TKL B;  3V5U A;  3C4W A;  2XAH B;  5FXX A;  1YKH B;  4AXP A;  2N1G A;  3KVA A;  4JLE A;  4UEM A;  3I9W A;  5DQW A;  3N2G E;  4EZH A;  2DCF A;  4P0A A;  5FNV E;  3VKG A;  3OKQ A;  4WW0 A;  5KDM C;  2W0G A;  2X0L B;  4I50 E;  4GYR A;  5FXZ A;  4XBF B;  1S94 A;  5JRC A;  5HXE A;  4TX5 A;  3CX8 B;  2PBI A;  5FMN A;  4ZHQ E;  3HKD E;  4MFR A;  5HXS A;  2BVL A;  2VAS A;  5BMV E;  2G0U A;  3E22 E;  4C91 A;  2LOP A;  4UF0 A;  3O4X E;  3M65 A;  3Q5X A;  2E9X B;  2KWI B;  2X68 A;  5M4Y A;  3WAJ A;  1HG5 A;  5JDF A;  3MJX A;  3O1J A;  5L3D B;  3ZYL A;  3O1I A;  3MXZ A;  1BR2 A;  4EAH A;  5HYA A;  5HAX A;  1UX5 A;  1NWM X;  5HWY A;  5JR9 C;  4HTE A;  5H6R B;  3ZMU B;  4AKL A;  5AFU L;  5CA0 E;  4I4T E;  4IE7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...