3CX7B

Crystal structure of pdzrhogef rgrgs domain in a complex with galpha-13 bound to gdp-alf4
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
196
structure length
193
Chain Sequence
LIIGPEEDYDPGNESDIIFQDLEKLKSHPAYLVVFLRYILSQADPGPLLFYLCSEVYQQTNPKDSRSLGKDIWNIFLEKNAPLRVKIPEMLQAEIDLRLRNNEDPRNVLCEAQEAVMLEIQEQINDYRSKRTLGLGSLYGENDLLGLDGDPLRERQMAEKQLAALGDILSKYEEDRSAPMDFAVNTFMSHAGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Signaling protein
molecule keywords Guanine Nucleotide-Binding Protein Galpha 13
publication title Recognition of the Activated States of Galpha13 by the rgRGS Domain of PDZRhoGEF.
pubmed doi rcsb
source organism Mus musculus
total genus 64
structure length 193
sequence length 196
ec nomenclature
pdb deposition date 2008-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF09128 RGS-like Regulator of G protein signalling-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1850 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3cx7B00
1SHZC 4YHJA 4WBOA 1IAPA 2ACXA 2PBIA 3C4ZA 4L9IA 3QC9A 2DLRA 2ES0A 3C4WA 4WNKA 3C4XA 4GOUA 3C51A 3T8OA 3CX8B 2A72A 3C50A 1ZV4X 2I59A 4PNIA 3AB3B 3CX6B 1HTJF 3CX7B 4IGUA
chains in the Genus database with same CATH superfamily
4IDNA 4Z91A 3X1DA 2JRKA 2VK9A 5FKYA 3ZT5A 2XAFB 1W0BA 3RYIE 5L3EB 2OV9A 4HFHA 2DWKA 2X9XA 4PAGA 1N36T 4ZHQE 3CPZA 3NKZA 3ZSTA 3NWIA 1XZYA 1X79A 3ZEFB 2VVSA 4CI1B 1N34T 3AE2A 1MMNA 3AE5A 2XQ8A 3N9NA 5AQLB 2CXLA 2LKGA 2W61A 2XUEA 4WW0A 4G2AA 3ZMVB 2ZM2A 3AA7B 3ZT7A 4GIWA 4UR9A 3UU8A 2BDEA 2J62A 3O1IA 2QYWA 2DCFA 5FY7A 2ODVA 4CQIA 4DV1T 4TWFA 3CX7B 5HXCA 4JI8T 1IBKT 1IAPA 2ZM6T 1WCRA 3KVAA 4GK0E 3AE7A 4KHZF 2PG8A 2LOPA 2MYSA 3ZJ2A 4H9PC 3RLFF 2XTLA 3MZKB 3OTOT 3PTRB 2NP9A 4HFBA 5CGMA 3ESLA 3I9YA 3E22E 2LOSA 2Q9QA 2AXDS 3HKEE 2G0UA 4UF0B 4WYVA 2UXDT 3JAEA 3U78A 1CHUA 3UULA 2Y6XA 5E0OA 3HA4A 3QK6A 2VQET 5HEUA 3AE8A 2LRLA 2OA5A 5AQTB 1YXRA 4A98A 4X64T 2H88A 3G06A 4X66T 4EEDA 5L47A 4QX8B 4Q25A 2FJBA 1MMDA 1WYBA 2M6IA 2CHNA 2M6BA 4ISSA 4BJNA 4DUYT 2D9DA 3RGLA 4U31A 3N2OA 4IHJE 2VKJA 4GK5E 3ETUA 3FXEB 1MIYA 2NW9A 3RH3A 4ILAA 4ASKA 3IBPA 4DMVA 2XQ6A 4JUYA 4EB6E 4HKAA 2PJQA 3RYHE 4ADZA 2B76A 1BR1A 2HN2A 2H3RA 4PK4A 1NENA 1UUSA 2XQAA 5F3JA 4XAXB 4ZI3D 4BA9A 3SRZA 3T1HT 4O4HE 3ONLC 5GONE 3PUXF 2N2NA 2BS4A 2WDRA 2H7VC 4J2CA 3AVRA 2X9HA 4TWDA 3CMLA 5IHYA 4CXYA 1HG2A 4GKKT 4LMKA 3P7IA 1ZP0A 1E2AA 2CXFA 3N9PA 2CRBA 5HEJA 2WBLA 1N32T 3WAKA 2W67A 3HL6A 3RPUA 2QVAA 3OKQA 3M65A 5LGUB 4IIJE 5JR9A 3RI5A 4JEHB 1BR4A 2P9BA 4TWHA 5HYAA 4CN1A 4DR5T 2NOXA 5AQQB 1HNZT 3L39A 5IWAT 1HCIA 1S35A 1BR2A 2NR4A 5FY1A 3LK3B 3RIUC 1D1CA 1VCTA 4PK5A 3ZC1A 3UQ4A 3HKDE 1MIVA 3TLVA 1T98A 1FIOA 2X0LB 3Q5XA 5JTGA 1O3XA 2PFVA 5HEGA 2LLYA 2AE9A 4GYSA 4PJNA 1W0AA 4HGAA 2KWIB 3IHRA 3RRCA 3C4WA 4YT0A 3KFWX 3C51A 2LSYA 4GKJT 5EK2A 2YDSA 1Y64B 2E2AA 3OBVE 4LF7T 5KMGP 5LGNB 4EAHA 2BKNA 3L09A 3FZHB 4QH1A 4CI2B 3EVYA 2IHR1 3DP7A 4XZCA 2WB5A 5JRCA 1Z8UA 4O2BE 2BG9C 1U4QA 2J47A 2I6HA 4OYKA 2EHOC 3LBXB 4HFIA 2E5LT 2C0SA 5AQMB 3HKBE 5LGTB 3ZSSA 3CK6A 4QXHB 2L3LA 2CLYC 3LSVA 3CWZB 4UIGA 5HXEA 3IF8B 4LF4T 4DIDB 5L3BB 5FL0A 3RIUA 4O2AE 3VRAA 5L3CB 2MOZA 2UUBT 2ZMAA 4DO0A 2XAHB 3FBZA 4UELA 4X1YE 4L5GA 2JQHA 3AEBA 4O4LE 3UTKA 4KBMB 2IIUA 3AEDA 2RA1A 2BG9B 2DL1A 4HWHA 1HX1B 3BQLA 2EHOB 4LFAT 4BAYB 3KBUA 2Y8DA 3AE4A 4N78D 5ADXL 3AE9A 2DI4A 2FBWA 2YU2A 1I6ZA 1T8BA 2CLYB 1LVFA 4IDQA 4PFOA 4EOZB 2A3DA 3JADA 2IC9A 5LHGB 3RX6A 1UK5A 2X67A 2HH7A 3PJAJ 3TLSA 2VKDA 3AE1A 3L3PA 4JLEA 4FI5A 5LOVE 1EZ3A 5AQKB 3ZCIA 4CN4A 5H6RB 4I4TE 5HXSA 4JI3T 5J1GA 2E9XA 3AECA 5KDMC 2WSSV 3K1SA 1IBLT 2ACZA 5L2LA 4ZI2D 4JI7T 3GN5A 1J5WA 2Y48B 2ACXA 2BVLA 4H9QC 4LF9T 2DNXA 4ZEYA 3B5MA 1MNDA 2A2FX 3OPCA 3EI0A 3JC6D 1ZKEA 3MACA 2OLTA 4FJOA 3ANWA 1HX8A 4DV3T 5CA1E 3CQCB 2V6YA 4X1KE 3JAFA 3UUMA 4MALA 5CA0E 3NZQA 4AKLA 4QKNA 4DVDA 4DR3T 5L3GB 3VR9A 4PNIA 2BBJA 2VL0A 2D0UA 3KBTA 2WCAA 2JQ9A 5J0ZA 2E9XD 1XDOA 2E5VA 3UUXB 4ISTA 4JBWF 3RC3A 1Y01A 2XAJB 3FB2A 2XSBA 4HWIB 4HFDA 3D0TA 3TLUA 2XY8B 3RKGA 5F8PA 3UFGA 3AEGA 2H7OA 3V5UA 4HN9A 3LK2B 2XQYA 4H63V 4OX9T 2V1DB 3EUHA 2J1DG 2UXXB 1YKEB 4ANJA 2H89A 1OEDA 4UVCB 2MAWA 3AVSA 5LHHB 2RP4A 2VWAA 4IREA 1KF6A 3K8PC 2XQ9A 2GK9A 3IEEA 2FJDA 2J4GA 3AE3A 3B13A 5KXJA 4TZ4C 5LA6E 5HWYA 1FJGT 3ZMZB 3CQGB 2X51A 4ERRA 1YW0A 3F31A 1XDPA 4ZI3C 4LF6T 2YK0A 4WBOA 4EYUA 4AQYT 3QOFA 2DHRA 1KK7A 4AQFC 1LKXA 4CXWA 5IYZE 1W9RA 2KINB 4EEBA 2CBJA 4X65T 3ZT6A 5FYMA 3UQ7A 4U7YA 5FY0A 4B3RT 4KX6A 4ZOLE 2WY2A 2BZBA 2YDRA 2V7MA 5FNVE 3ETVA 4O4IE 2V5CA 2JMHA 3AB3B 1R8IA 3QUJA 2ZLYA 1DU2A 1YQ3A 5FVKA 3ZKRA 5J2UE 3DTOA 1JNRA 1GQEA 2L8KA 2K9AA 4IT4A 4X5TA 5LCYA 3UU4A 2C5JA 1HNXT 5JDLA 4PJMA 4UF0A 1VOMA 5LBQB 2HHHT 4BJMA 4P09A 2V6XA 4UVBB 2V26A 2BVMA 3Q5WA 4HFVA 2MBGA 4QHOA 5JDHA 2Q9QD 2BKOA 2MPKA 2JQQA 3KV9A 3LG7A 4UV8B 1VCSA 4KP3C 5HAXA 3B57A 3K3OA 1QUUA 3PUZF 4DNDA 3A5XA 4CN6A 4U74A 5BR8T 4NUUA 4H63H 3TLWA 3RIAA 1YQ4A 2W00A 5LYJE 4Z90A 4I50E 4YJ2E 3HI2A 1YKHB 4LFCT 3H3AA 3UU3A 3RC8A 2NW8A 1CUNA 2D2SA 3SWHA 4K0KT 3ZLIA 5AQRB 3M3ZB 4OFZA 3PU3A 3AXJB 2JQKA 2WMNA 3AA1B 1W09A 2WAUA 3O1JA 4IE5A 2FJAA 5HEOA 2XQ3A 3AA6B 3PUWF 3O9XA 1XWMA 2BS2A 4DMWA 2K5BB 3C4XA 4WBNE 3FBLA 3A8YC 4C91A 1WYCA 3N2KE 3PUSA 3E08A 4A56A 5LJMA 2XZEA 2ZM0A 4EIWA 3UT5E 2LSIA 3A7MA 1D0XA 4U7IA 2RPAA 3V5SA 5HXHA 2YOEA 3PUVF 4NIQA 2NWBA 1WR6A 4V1Av 4QWNB 1BR0A 2LJLA 2WWVA 4U72A 1UCUA 2A9UA 2UUAT 1US7B 3NRXA 1QLBA 5DJQC 3MA9A 1ZHCA 3SFDA 5AQUB 2PTFA 2CHOA 3KV6A 3Q2MA 4ZZBA 2HN1A 5KX5E 2UUCT 3I1AA 2A72A 3EAMA 5CJ5A 2NW7A 1UX5A 5HEHA 1IBMT 3ZJ1A 4QXCB 1NEKA 4KI0F 5LMNT 1D0YA 2C5IT 4LFBT 3VU7H 4JV5T 2CM0A 5A1LA 4DV5T 2BKPA 3R84B 5FP3A 3PDYA 4TV8E 4MFRA 3K3QC 4G63A 4YTMA 4HEAA 4HWFA 2JPFA 5LBMA 4WNKA 2K48A 1U5PA 4TN7B 3GWHA 2NTXA 5IUXA 4NPPA 4EZ4A 2W4XA 3RKOA 2VB6A 2YKSA 4DV4T 1MNEA 4L9IA 3P4RA 4Z8XA 3FXDB 1N33T 4H9OC 3NZPA 4B3TT 5HCMA 4MHCA 4DBRA 4F8HA 3LBXA 5JDNA 2KWHA 3ZCJA 1E1HB 1X9BA 3U3IA 5FVLA 3EDVA 3MXZA 5JQGE 2LEHA 2ES0A 3ZYMA 3LK42 3RF1A 4YHHT 3MKDA 5LG3A 2YDQA 5FXZA 3BQKA 4B3ST 4DR1T 4JI6T 4X62T 3E0ZA 3RIFA 5AQIB 3PJAA 4PJJA 3C98B 4DBQA 2V7IA 5ABFB 5L3DB 2LHNA 4DV7T 2VURA 3CX6B 1NAFA 1T7SA 2YU1A 3AAEB 1J1JA 4YHJA 2PBIA 2BG9A 1UGOA 4AKHA 2L9QA 2IUBA 2EHOA 2BBHA 2KNDA 3CKDA 4O4JE 4YTNA 4YSXA 3AAAB 4U2YA 4UEMA 3SOLA 1IZNB 3PURA 2WDVA 2XASB 3QB5A 2LSJA 3UUBA 3QC9A 5LXTE 5L3FB 4IDOA 2WU5A 3RRWA 2W63A 2QGSA 4YXDA 2BS3A 2XM2A 4CXXA 4JI4T 5HCJA 4IL4A 4F6RC 4DR2T 2D0TA 4L0RA 4JI5T 5FXWA 4ILBA 4HFCA 2XM1A 3PV0F 3AE6A 2KZ7B 4GYRA 2XAGB 4KHPT 5FMNA 4HWDA 3RQWA 3KVBA 3ZMSB 3CQXC 5FXXA 2ODUA 5ABGA 2N9DA 3P4PA 3O4XE 2W0GA 3QNUA 1OEDE 1SE7A 3KINB 4EZHA 5AQJB 3UU5A 3FZKB 1KNZA 2W66A 4EYYR 4HFEA 4IL9A 2XQ4A 4E7SA 4NXNT 3ZMUB 3ZN1B 1D0ZA 4AKGA 2LE8A 4OYJA 1B7TA 4IE0A 2Q9QC 3NBXX 3I9WA 4KUMB 1G8XA 2NTYA 2WZIA 2C5KT 4IE7A 3Q5DA 4DV0T 4X1IE 2CMRA 3K3NA 4YSZA 1HG5A 3EABA 1HFAA 1IJ5A 3FZLB 1ZEEA 2I59A 4A5XA 3P4QA 1JNZA 2X9WA 4AIUA 2VKOA 3J7Yq 4ZS3A 4YFSA 2IMLA 4JEUB 4PK6A 4TNVA 4MLKA 2WP9A 1SUMB 1FMWA 4TNWA 2N1GA 5AQVB 4B6XA 2Q9QB 2V5DA 5JDFA 5L4EA 1OWAA 1ZOYA 2WQYA 3EDUA 3GA8A 3PUQA 3FZMB 2VVNA 5AQPB 4TV9E 4YTPA 2UU9T 3ABVA 5M4YA 4ILUA 4GOUA 5JREA 3ZYKA 3F2EA 1LRZA 4DV2T 3N2GE 2LRKA 5FXVA 2UXNB 4P0AA 3F57A 1MIWA 4I0UA 3ZC0A 4YJ3E 2DLRA 3SFEA 3ZMTB 3T8OA 4UXNB 4AKIA 1ZV4X 4IE4A 1E7PA 4OHFA 3UU6A 4H9NC 3TKLB 3ZPOA 3OYXA 2HPJA 4DV6T 4CZZB 2SPCA 4TUYE 1YD8G 4HWCA 3VRBA 2Z6EA 4JI1T 4CI3B 2QRXA 4NXMT 4NUVA 4EGWA 4YY3T 2KLQA 4K0UA 2CWYA 2B1EA 3MJXA 2WWUA 4E7ZA 3RYFE 4AQFA 5LMUT 2LSKA 1M7KA 4U2ZA 1AJ3A 2XAQB 3W15B 5C2TA 4HE8A 5ABEA 5JR9C 4H9SE 3C50A 4O8SA 4ZI7E 4X20E 3PUYF 2HPLA 2QA7A 3JCFA 5L4HA 1IJ6A 3H3MA 5JDMA 2FJEA 3OYZA 3OVUA 2VQFT 2WDQA 3CX8B 3NRYA 1V9DA 2YN6A 3DJBA 2CE7A 2LKHA 3LJCA 2XJ7A 2MTQA 5TAOA 2WS3A 5F5WA 4ZS2A 1Z0PA 3T1YT 4AKRB 1KNPA 3AEEA 2W62A 3LFMA 2K3WA 2UXBT 5C8YE 2IW5B 1HF8A 4P0BA 3KV5A 5JR9B 4U3CA 5HWXA 5LB7B 3IA3A 1HNWT 4ZXLA 1NWMX 5DQWA 3RHWA 3AXJA 3WI3A 2UXCT 5JDQA 4JI0T 1T72A 2JMKA 1WFDA 1XMOT 4OK0A 3FZFB 1KFYA 4IDPA 3PUAA 4AXPA 2CXDA 2M67A 1HS7A 3LDQB 4JYAT 3BQIA 2LM9A 4YSYA 2FUPA 3ZYLA 1WRDA 1UURA 5FL1A 2CA5A 4QH4A 4LMJA 1LVKA 3R6NA 2KT9A 1HTJF 4ZZCA 3P4SA 3I0OA 4C90A 4XBFB 4LF5T 2ZM8A 3GMIA 3UFEA 1OXZA 5LP6E 4ZI2C 3NVOA 4U33A 3KV4A 4DR4T 4COFA 1KNRA 5CFBA 5JRCB 1WLXA 4UV9B 3VKGA 3PU8A 5DABA 3L8RA 5AQHB 3VR8A 2JJ9A 2V7JA 3JC6C 1SA0E 2W2UA 2F4VT 1WR0A 4PJLA 2WMOA 3SS1A 5LJNA 1J5ET 2K24A 4P1NA 3O1HA 2CCQA 3J9X1 4PFPA 5AQSB 1HR0T 2XQ5A 2KSRA 2YEVC 2D5UA 3N9OA 4LMLA 2X0HA 3ONJA 1S94A 3QB5K 3CVRA 2E9XC 1FMVA 2VKHA 1MMGA 4A97A 1SHZC 2VASA 3C4ZA 3VKHA 2I0MA 4IE6A 5JVDE 5AQFB 2LM2A 3Q9DA 2XHEB 3N9LA 1XMQT 4WZXA 3P50A 5H6QB 4I43B 2WU2A 1UX4A 5HXRA 4DR7T 2CPTA 3AA0B 2LSGA 5AQOB 4IGUA 4EXTA 2BG9E 2XPKA 2LT3A 3Q5EA 4DR6T 5C3JA 2R6GF 5LG4A 2LHRA 1XNQT 4QH5A 2CEAA 3N9QA 3RQUA 2IC6A 2E9XB 2E8IA 4QXBB 3PUGA 3C64A 1G73A 4QX7B 2DWGA 3S4UA 3HKCE 4B3MT 3ZN0B 2WM9A 5ETWA 2KXPB 3P4WA 3GN5B 5JDGA 2X66A 2KMFA 4I55E 1QSDA 5ABFA 5J2TE 1FEWA 4LF8T 4AISA 5JH7E 4UVAB 5LNKA 3UUNA 3RYCE 5EK3A 1D1BA 3H37A 5ABHA 1D1AA 1M62A 3ONXA 5AQNB 5EK4A 3ANWB 3N9MA 2V6YB 3TLTA 5DQVA 3FHNA 4DUZT 4YLHA 4IDZA 3HR0A 3VHLA 3AAIA 2WZHA 2V8SV 1OEDC 1MMAA 2V7KA 3EHZA 2X9YA 3AEFA 3I0QA 3P8CD 5BMVE 1XNRT 3N5LA 2EHOD 1KEYA 5EZYE 3OJAA 2V7LA 2YINA 4JI2T 4PW8A 2X68A 2IDOB 3WAJA 3KDSE 3MK7C 2CWOA 1I94T 2XQ7A 3AEAA 1H7CA 2IAKA 4EV6A 2CBIA 4ILCA 4AQGA 1VRBA 3CIRA 4HTEA 4KMCA 5AFUL 1L0VA 4AI6A 2XSAA 4TX5A 4H9RC 5LHIB 5AQGB 4MBQA 5CB4E 2X0YA 3BK9A 1OEDB 4M1PA 3PE0A 2VL8A 2JIWA
chains in the Genus database with same CATH topology
3OYXA 4BAYB 3KBUA 2Y8DA 2HPJA 4N78D 5ADXL 1US7B 2DI4A 3NRXA 4CZZB 2SPCA 2JRKA 2YU2A 2VK9A 4TUYE 5DJQC 3MA9A 1ZHCA 1YD8G 2Z6EA 2CLYB 1LVFA 3KV6A 4CI3B 3Q2MA 2XAFB 4PFOA 4EOZB 2A3DA 3RYIE 5L3EB 4NUVA 2IC9A 2DWKA 2X9XA 4PAGA 5KX5E 5LHGB 3RX6A 4ZHQE 3CPZA 3I1AA 2X67A 2A72A 2KLQA 4K0UA 2CWYA 1X79A 3ZEFB 2HH7A 2B1EA 2NW7A 3MJXA 2VKDA 2WWUA 4E7ZA 4CI1B 3L3PA 4JLEA 3RYFE 1UX5A 4FI5A 5LOVE 3ZJ1A 4AQFA 4QXCB 1EZ3A 2LSKA 3ZCIA 5H6RB 1MMNA 3N9NA 1AJ3A 4I4TE 1D0YA 5HXSA 2XAQB 5J1GA 3W15B 2E9XA 2CXLA 5KDMC 2C5IT 2WSSV 4HE8A 2W61A 5JR9C 5L2LA 2XUEA 4H9SE 3VU7H 3C50A 4ZI2D 4O8SA 2CM0A 4WW0A 5A1LA 4G2AA 3ZMVB 4X20E 4ZI7E 2ZM2A 3AA7B 3GN5A 3R84B 5FP3A 3PDYA 4TV8E 2HPLA 4GIWA 2QA7A 2Y48B 2ACXA 2BVLA 4MFRA 4H9QC 1IJ6A 2BDEA 3K3QC 3O1IA 4G63A 5JDMA 4HEAA 2DNXA 2DCFA 3OYZA 2JPFA 5LBMA 4WNKA 2K48A 1U5PA 5FY7A 1MNDA 2A2FX 4TN7B 3GWHA 3CX8B 3NRYA 1V9DA 2ODVA 2NTXA 4CQIA 3DJBA 3JC6D 1ZKEA 2CE7A 3CX7B 3MACA 3LJCA 5HXCA 4EZ4A 2MTQA 3RKOA 5TAOA 2VB6A 4FJOA 1IAPA 3ANWA 1HX8A 4ZS2A 3KVAA 1Z0PA 4GK0E 5CA1E 1MNEA 3CQCB 4L9IA 4AKRB 4X1KE 3LFMA 2W62A 4Z8XA 3FXDB 2PG8A 3UUMA 2LOPA 4MALA 5CA0E 3NZQA 5C8YE 2IW5B 2MYSA 4H9OC 3ZJ2A 4AKLA 1HF8A 3NZPA 4QKNA 4H9PC 4DVDA 2XTLA 4P0BA 5L3GB 3MZKB 4PNIA 3KV5A 5JR9B 3PTRB 2NP9A 4MHCA 5HWXA 2D0UA 3ESLA 3I9YA 4DBRA 3LBXA 5JDNA 3KBTA 2KWHA 3E22E 3ZCJA 2LOSA 1E1HB 2Q9QA 1NWMX 3U3IA 2E9XD 5DQWA 3HKEE 3EDVA 3MXZA 5JQGE 2G0UA 2LEHA 3WI3A 2ES0A 3ZYMA 4UF0B 3LK42 5JDQA 2JMKA 3UUXB 3U78A 4OK0A 3MKDA 4ISTA 3UULA 5FXZA 3BQKA 2XAJB 3PUAA 3RC3A 2Y6XA 3FB2A 4AXPA 2CXDA 5E0OA 3HA4A 2M67A 1HS7A 3QK6A 3E0ZA 3BQIA 2LM9A 2OA5A 3D0TA 5F8PA 4PJJA 3C98B 4DBQA 3ZYLA 1WRDA 2H7OA 2V7IA 2CA5A 3V5UA 4HN9A 3LK2B 5L3DB 2LHNA 2XQYA 4H63V 1LVKA 2V1DB 3CX6B 3EUHA 2KT9A 3R6NA 1NAFA 1HTJF 4QX8B 2J1DG 2UXXB 2YU1A 3AAEB 3I0OA 4C90A 4XBFB 1YKEB 4YHJA 2ZM8A 1MMDA 2PBIA 3GMIA 3UFEA 4ANJA 1WYBA 4AKHA 2L9QA 4UVCB 1OXZA 2EHOA 5LP6E 4ZI2C 4ISSA 4BJNA 3AVSA 5LHHB 2RP4A 2VWAA 3KV4A 2KNDA 3CKDA 4O4JE 3N2OA 3K8PC 3AAAB 4IHJE 4UEMA 2VKJA 3SOLA 4GK5E 2GK9A 5JRCB 3IEEA 1IZNB 3ETUA 3FXEB 3PURA 1WLXA 4UV9B 3B13A 2XASB 3VKGA 2LSJA 3PU8A 4TZ4C 1MIYA 5DABA 2NW9A 5LA6E 3QC9A 5LXTE 5HWYA 3RH3A 5L3FB 3RRWA 2JJ9A 2V7JA 3ZMZB 4ASKA 2W63A 3CQGB 3IBPA 4DMVA 3JC6C 1SA0E 4JUYA 2QGSA 4EB6E 2X51A 4ERRA 1YW0A 3F31A 4HKAA 2PJQA 4PJLA 3RYHE 4ADZA 2WMOA 3SS1A 5LJNA 1BR1A 4ZI3C 2H3RA 2K24A 4PK4A 4CXXA 3O1HA 2YK0A 5F3JA 4F6RC 4WBOA 4XAXB 4EYUA 2CCQA 3J9X1 4PFPA 4ZI3D 2DHRA 4BA9A 3SRZA 2D0TA 4L0RA 1KK7A 5FXWA 2YEVC 4AQFC 1LKXA 2D5UA 3N9OA 4CXWA 4O4HE 5GONE 5IYZE 1S94A 2KINB 2N2NA 3CVRA 5FYMA 2E9XC 2H7VC 4J2CA 3AVRA 2X9HA 1FMVA 2VKHA 1MMGA 5FY0A 2KZ7B 1SHZC 2VASA 4GYRA 2XAGB 3C4ZA 4ZOLE 3VKHA 3CMLA 4IE6A 5IHYA 5JVDE 3Q9DA 4CXYA 1HG2A 2XHEB 2BZBA 5FMNA 3N9LA 2V7MA 5H6QB 5FNVE 4I43B 1UX4A 5HXRA 3P7IA 3KVBA 3ZMSB 3CQXC 3ETVA 4O4IE 5FXXA 2CXFA 2JMHA 2LSGA 2ODUA 3AA0B 3AB3B 3N9PA 2N9DA 2WBLA 3O4XE 3QUJA 4IGUA 2W0GA 4EXTA 2ZLYA 3WAKA 3HL6A 3RPUA 3OKQA 3M65A 5LGUB 3KINB 4EZHA 4IIJE 5JR9A 4JEHB 5J2UE 2LT3A 3DTOA 1BR4A 2P9BA 5LG4A 5HYAA 2LHRA 2L8KA 2K9AA 2CEAA 3N9QA 1KNZA 4EYYR 5LCYA 2NOXA 2C5JA 5JDLA 4PJMA 4UF0A 2IC6A 1HCIA 1VOMA 1S35A 1BR2A 5LBQB 2E9XB 4E7SA 5FY1A 3ZMUB 3LK3B 3ZN1B 1D0ZA 2E8IA 4QXBB 4AKGA 2LE8A 4BJMA 3PUGA 3C64A 4P09A 4UVBB 1D1CA 1G73A 2V26A 4OYJA 4QX7B 1B7TA 2BVMA 2DWGA 3HKCE 3S4UA 3Q5WA 3ZN0B 2WM9A 5ETWA 4PK5A 2KXPB 4HFVA 3GN5B 2Q9QC 4IE0A 3ZC1A 2X66A 5JDGA 2KMFA 4I55E 4QHOA 2MBGA 3NBXX 3I9WA 3HKDE 4KUMB 1MIVA 1G8XA 2NTYA 5JDHA 1QSDA 2C5KT 4IE7A 1T98A 1FIOA 2Q9QD 2JQQA 5J2TE 3KV9A 2X0LB 3Q5XA 1FEWA 3LG7A 5JH7E 1O3XA 4X1IE 2PFVA 4UVAB 4UV8B 5LNKA 2CMRA 3K3NA 4KP3C 4GYSA 4PJNA 3UUNA 3RYCE 4HGAA 1HG5A 2KWIB 5HAXA 3IHRA 5EK3A 3RRCA 3C4WA 3B57A 3K3OA 1QUUA 1HFAA 1D1BA 1IJ5A 4DNDA 3A5XA 3KFWX 3C51A 2LSYA 3H37A 4U74A 5EK2A 1D1AA 1Y64B 1ZEEA 3ONXA 2I59A 3ANWB 3N9MA 5EK4A 3OBVE 4NUUA 4H63H 5KMGP 2X9WA 2VKOA 5LGNB 5DQVA 3J7Yq 2W00A 4ZS3A 4YFSA 4EAHA 3FHNA 5LYJE 4JEUB 3L09A 4PK6A 4YLHA 4I50E 4YJ2E 3HI2A 1YKHB 4MLKA 3EVYA 4CI2B 4XZCA 3DP7A 1FMWA 4IDZA 5JRCA 3HR0A 2N1GA 3VHLA 3AAIA 4O2BE 3H3AA 3RC8A 2NW8A 1U4QA 4B6XA 1CUNA 4OYKA 2EHOC 3LBXB 1MMAA 2V7KA 2D2SA 2C0SA 2Q9QB 2X9YA 3SWHA 3ZLIA 4OFZA 3HKBE 5JDFA 3I0QA 5LGTB 3PU3A 3P8CD 3AA1B 2WMNA 5BMVE 3N5LA 2WAUA 1OWAA 2EHOD 3EDUA 3O1JA 3GA8A 4QXHB 2L3LA 3PUQA 2CLYC 3OJAA 4IE5A 2V7LA 5EZYE 2YINA 3CWZB 4UIGA 4PW8A 2X68A 5HXEA 4TV9E 3WAJA 3AA6B 3IF8B 3KDSE 3MK7C 3O9XA 4DMWA 2K5BB 3C4XA 4WBNE 5M4YA 3FBLA 4ILUA 2CWOA 4GOUA 5L3BB 5JREA 4C91A 3ZYKA 1H7CA 3F2EA 1LRZA 1WYCA 2IAKA 3N2KE 3PUSA 4O2AE 3N2GE 5FXVA 3E08A 4A56A 5L3CB 5LJMA 4AQGA 1VRBA 2ZM0A 2MOZA 4HTEA 4EIWA 2UXNB 4P0AA 3UT5E 2ZMAA 4DO0A 2XAHB 2LSIA 3FBZA 4KMCA 5AFUL 3F57A 4UELA 1D0XA 1MIWA 4AI6A 4X1YE 4TX5A 4L5GA 3V5SA 4H9RC 3ZC0A 4YJ3E 5HXHA 2DLRA 4O4LE 4MBQA 3UTKA 5LHIB 4KBMB 3ZMTB 5CB4E 2NWBA 1WR6A 3T8OA 4UXNB 4QWNB 4V1Av 1BR0A 2RA1A 4AKIA 1ZV4X 3BK9A 2LJLA 4IE4A 3BQLA 4M1PA 4OHFA 3PE0A 2EHOB 2VL8A 4H9NC 3TKLB 3ZPOA 4U72A 1UCUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SHZ C;  4YHJ A;  4WBO A;  1IAP A;  2ACX A;  2PBI A;  3C4Z A;  4L9I A;  3QC9 A;  2DLR A;  2ES0 A;  3C4W A;  4WNK A;  3C4X A;  4GOU A;  3C51 A;  3T8O A;  3CX8 B;  2A72 A;  3C50 A;  1ZV4 X;  2I59 A;  4PNI A;  3AB3 B;  3CX6 B;  1HTJ F;  3CX7 B;  4IGU A; 
#chains in the Genus database with same CATH topology
 4IDN A;  4Z91 A;  3X1D A;  2JRK A;  2VK9 A;  5FKY A;  3ZT5 A;  2XAF B;  1W0B A;  3RYI E;  5L3E B;  2OV9 A;  4HFH A;  2DWK A;  2X9X A;  4PAG A;  1N36 T;  4ZHQ E;  3CPZ A;  3NKZ A;  3ZST A;  3NWI A;  1XZY A;  1X79 A;  3ZEF B;  2VVS A;  4CI1 B;  1N34 T;  3AE2 A;  1MMN A;  3AE5 A;  2XQ8 A;  3N9N A;  5AQL B;  2CXL A;  2LKG A;  2W61 A;  2XUE A;  4WW0 A;  4G2A A;  3ZMV B;  2ZM2 A;  3AA7 B;  3ZT7 A;  4GIW A;  4UR9 A;  3UU8 A;  2BDE A;  2J62 A;  3O1I A;  2QYW A;  2DCF A;  5FY7 A;  2ODV A;  4CQI A;  4DV1 T;  4TWF A;  3CX7 B;  5HXC A;  4JI8 T;  1IBK T;  1IAP A;  2ZM6 T;  1WCR A;  3KVA A;  4GK0 E;  3AE7 A;  4KHZ F;  2PG8 A;  2LOP A;  2MYS A;  3ZJ2 A;  4H9P C;  3RLF F;  2XTL A;  3MZK B;  3OTO T;  3PTR B;  2NP9 A;  4HFB A;  5CGM A;  3ESL A;  3I9Y A;  3E22 E;  2LOS A;  2Q9Q A;  2AXD S;  3HKE E;  2G0U A;  4UF0 B;  4WYV A;  2UXD T;  3JAE A;  3U78 A;  1CHU A;  3UUL A;  2Y6X A;  5E0O A;  3HA4 A;  3QK6 A;  2VQE T;  5HEU A;  3AE8 A;  2LRL A;  2OA5 A;  5AQT B;  1YXR A;  4A98 A;  4X64 T;  2H88 A;  3G06 A;  4X66 T;  4EED A;  5L47 A;  4QX8 B;  4Q25 A;  2FJB A;  1MMD A;  1WYB A;  2M6I A;  2CHN A;  2M6B A;  4ISS A;  4BJN A;  4DUY T;  2D9D A;  3RGL A;  4U31 A;  3N2O A;  4IHJ E;  2VKJ A;  4GK5 E;  3ETU A;  3FXE B;  1MIY A;  2NW9 A;  3RH3 A;  4ILA A;  4ASK A;  3IBP A;  4DMV A;  2XQ6 A;  4JUY A;  4EB6 E;  4HKA A;  2PJQ A;  3RYH E;  4ADZ A;  2B76 A;  1BR1 A;  2HN2 A;  2H3R A;  4PK4 A;  1NEN A;  1UUS A;  2XQA A;  5F3J A;  4XAX B;  4ZI3 D;  4BA9 A;  3SRZ A;  3T1H T;  4O4H E;  3ONL C;  5GON E;  3PUX F;  2N2N A;  2BS4 A;  2WDR A;  2H7V C;  4J2C A;  3AVR A;  2X9H A;  4TWD A;  3CML A;  5IHY A;  4CXY A;  1HG2 A;  4GKK T;  4LMK A;  3P7I A;  1ZP0 A;  1E2A A;  2CXF A;  3N9P A;  2CRB A;  5HEJ A;  2WBL A;  1N32 T;  3WAK A;  2W67 A;  3HL6 A;  3RPU A;  2QVA A;  3OKQ A;  3M65 A;  5LGU B;  4IIJ E;  5JR9 A;  3RI5 A;  4JEH B;  1BR4 A;  2P9B A;  4TWH A;  5HYA A;  4CN1 A;  4DR5 T;  2NOX A;  5AQQ B;  1HNZ T;  3L39 A;  5IWA T;  1HCI A;  1S35 A;  1BR2 A;  2NR4 A;  5FY1 A;  3LK3 B;  3RIU C;  1D1C A;  1VCT A;  4PK5 A;  3ZC1 A;  3UQ4 A;  3HKD E;  1MIV A;  3TLV A;  1T98 A;  1FIO A;  2X0L B;  3Q5X A;  5JTG A;  1O3X A;  2PFV A;  5HEG A;  2LLY A;  2AE9 A;  4GYS A;  4PJN A;  1W0A A;  4HGA A;  2KWI B;  3IHR A;  3RRC A;  3C4W A;  4YT0 A;  3KFW X;  3C51 A;  2LSY A;  4GKJ T;  5EK2 A;  2YDS A;  1Y64 B;  2E2A A;  3OBV E;  4LF7 T;  5KMG P;  5LGN B;  4EAH A;  2BKN A;  3L09 A;  3FZH B;  4QH1 A;  4CI2 B;  3EVY A;  2IHR 1;  3DP7 A;  4XZC A;  2WB5 A;  5JRC A;  1Z8U A;  4O2B E;  2BG9 C;  1U4Q A;  2J47 A;  2I6H A;  4OYK A;  2EHO C;  3LBX B;  4HFI A;  2E5L T;  2C0S A;  5AQM B;  3HKB E;  5LGT B;  3ZSS A;  3CK6 A;  4QXH B;  2L3L A;  2CLY C;  3LSV A;  3CWZ B;  4UIG A;  5HXE A;  3IF8 B;  4LF4 T;  4DID B;  5L3B B;  5FL0 A;  3RIU A;  4O2A E;  3VRA A;  5L3C B;  2MOZ A;  2UUB T;  2ZMA A;  4DO0 A;  2XAH B;  3FBZ A;  4UEL A;  4X1Y E;  4L5G A;  2JQH A;  3AEB A;  4O4L E;  3UTK A;  4KBM B;  2IIU A;  3AED A;  2RA1 A;  2BG9 B;  2DL1 A;  4HWH A;  1HX1 B;  3BQL A;  2EHO B;  4LFA T;  4BAY B;  3KBU A;  2Y8D A;  3AE4 A;  4N78 D;  5ADX L;  3AE9 A;  2DI4 A;  2FBW A;  2YU2 A;  1I6Z A;  1T8B A;  2CLY B;  1LVF A;  4IDQ A;  4PFO A;  4EOZ B;  2A3D A;  3JAD A;  2IC9 A;  5LHG B;  3RX6 A;  1UK5 A;  2X67 A;  2HH7 A;  3PJA J;  3TLS A;  2VKD A;  3AE1 A;  3L3P A;  4JLE A;  4FI5 A;  5LOV E;  1EZ3 A;  5AQK B;  3ZCI A;  4CN4 A;  5H6R B;  4I4T E;  5HXS A;  4JI3 T;  5J1G A;  2E9X A;  3AEC A;  5KDM C;  2WSS V;  3K1S A;  1IBL T;  2ACZ A;  5L2L A;  4ZI2 D;  4JI7 T;  3GN5 A;  1J5W A;  2Y48 B;  2ACX A;  2BVL A;  4H9Q C;  4LF9 T;  2DNX A;  4ZEY A;  3B5M A;  1MND A;  2A2F X;  3OPC A;  3EI0 A;  3JC6 D;  1ZKE A;  3MAC A;  2OLT A;  4FJO A;  3ANW A;  1HX8 A;  4DV3 T;  5CA1 E;  3CQC B;  2V6Y A;  4X1K E;  3JAF A;  3UUM A;  4MAL A;  5CA0 E;  3NZQ A;  4AKL A;  4QKN A;  4DVD A;  4DR3 T;  5L3G B;  3VR9 A;  4PNI A;  2BBJ A;  2VL0 A;  2D0U A;  3KBT A;  2WCA A;  2JQ9 A;  5J0Z A;  2E9X D;  1XDO A;  2E5V A;  3UUX B;  4IST A;  4JBW F;  3RC3 A;  1Y01 A;  2XAJ B;  3FB2 A;  2XSB A;  4HWI B;  4HFD A;  3D0T A;  3TLU A;  2XY8 B;  3RKG A;  5F8P A;  3UFG A;  3AEG A;  2H7O A;  3V5U A;  4HN9 A;  3LK2 B;  2XQY A;  4H63 V;  4OX9 T;  2V1D B;  3EUH A;  2J1D G;  2UXX B;  1YKE B;  4ANJ A;  2H89 A;  1OED A;  4UVC B;  2MAW A;  3AVS A;  5LHH B;  2RP4 A;  2VWA A;  4IRE A;  1KF6 A;  3K8P C;  2XQ9 A;  2GK9 A;  3IEE A;  2FJD A;  2J4G A;  3AE3 A;  3B13 A;  5KXJ A;  4TZ4 C;  5LA6 E;  5HWY A;  1FJG T;  3ZMZ B;  3CQG B;  2X51 A;  4ERR A;  1YW0 A;  3F31 A;  1XDP A;  4ZI3 C;  4LF6 T;  2YK0 A;  4WBO A;  4EYU A;  4AQY T;  3QOF A;  2DHR A;  1KK7 A;  4AQF C;  1LKX A;  4CXW A;  5IYZ E;  1W9R A;  2KIN B;  4EEB A;  2CBJ A;  4X65 T;  3ZT6 A;  5FYM A;  3UQ7 A;  4U7Y A;  5FY0 A;  4B3R T;  4KX6 A;  4ZOL E;  2WY2 A;  2BZB A;  2YDR A;  2V7M A;  5FNV E;  3ETV A;  4O4I E;  2V5C A;  2JMH A;  3AB3 B;  1R8I A;  3QUJ A;  2ZLY A;  1DU2 A;  1YQ3 A;  5FVK A;  3ZKR A;  5J2U E;  3DTO A;  1JNR A;  1GQE A;  2L8K A;  2K9A A;  4IT4 A;  4X5T A;  5LCY A;  3UU4 A;  2C5J A;  1HNX T;  5JDL A;  4PJM A;  4UF0 A;  1VOM A;  5LBQ B;  2HHH T;  4BJM A;  4P09 A;  2V6X A;  4UVB B;  2V26 A;  2BVM A;  3Q5W A;  4HFV A;  2MBG A;  4QHO A;  5JDH A;  2Q9Q D;  2BKO A;  2MPK A;  2JQQ A;  3KV9 A;  3LG7 A;  4UV8 B;  1VCS A;  4KP3 C;  5HAX A;  3B57 A;  3K3O A;  1QUU A;  3PUZ F;  4DND A;  3A5X A;  4CN6 A;  4U74 A;  5BR8 T;  4NUU A;  4H63 H;  3TLW A;  3RIA A;  1YQ4 A;  2W00 A;  5LYJ E;  4Z90 A;  4I50 E;  4YJ2 E;  3HI2 A;  1YKH B;  4LFC T;  3H3A A;  3UU3 A;  3RC8 A;  2NW8 A;  1CUN A;  2D2S A;  3SWH A;  4K0K T;  3ZLI A;  5AQR B;  3M3Z B;  4OFZ A;  3PU3 A;  3AXJ B;  2JQK A;  2WMN A;  3AA1 B;  1W09 A;  2WAU A;  3O1J A;  4IE5 A;  2FJA A;  5HEO A;  2XQ3 A;  3AA6 B;  3PUW F;  3O9X A;  1XWM A;  2BS2 A;  4DMW A;  2K5B B;  3C4X A;  4WBN E;  3FBL A;  3A8Y C;  4C91 A;  1WYC A;  3N2K E;  3PUS A;  3E08 A;  4A56 A;  5LJM A;  2XZE A;  2ZM0 A;  4EIW A;  3UT5 E;  2LSI A;  3A7M A;  1D0X A;  4U7I A;  2RPA A;  3V5S A;  5HXH A;  2YOE A;  3PUV F;  4NIQ A;  2NWB A;  1WR6 A;  4V1A v;  4QWN B;  1BR0 A;  2LJL A;  2WWV A;  4U72 A;  1UCU A;  2A9U A;  2UUA T;  1US7 B;  3NRX A;  1QLB A;  5DJQ C;  3MA9 A;  1ZHC A;  3SFD A;  5AQU B;  2PTF A;  2CHO A;  3KV6 A;  3Q2M A;  4ZZB A;  2HN1 A;  5KX5 E;  2UUC T;  3I1A A;  2A72 A;  3EAM A;  5CJ5 A;  2NW7 A;  1UX5 A;  5HEH A;  1IBM T;  3ZJ1 A;  4QXC B;  1NEK A;  4KI0 F;  5LMN T;  1D0Y A;  2C5I T;  4LFB T;  3VU7 H;  4JV5 T;  2CM0 A;  5A1L A;  4DV5 T;  2BKP A;  3R84 B;  5FP3 A;  3PDY A;  4TV8 E;  4MFR A;  3K3Q C;  4G63 A;  4YTM A;  4HEA A;  4HWF A;  2JPF A;  5LBM A;  4WNK A;  2K48 A;  1U5P A;  4TN7 B;  3GWH A;  2NTX A;  5IUX A;  4NPP A;  4EZ4 A;  2W4X A;  3RKO A;  2VB6 A;  2YKS A;  4DV4 T;  1MNE A;  4L9I A;  3P4R A;  4Z8X A;  3FXD B;  1N33 T;  4H9O C;  3NZP A;  4B3T T;  5HCM A;  4MHC A;  4DBR A;  4F8H A;  3LBX A;  5JDN A;  2KWH A;  3ZCJ A;  1E1H B;  1X9B A;  3U3I A;  5FVL A;  3EDV A;  3MXZ A;  5JQG E;  2LEH A;  2ES0 A;  3ZYM A;  3LK4 2;  3RF1 A;  4YHH T;  3MKD A;  5LG3 A;  2YDQ A;  5FXZ A;  3BQK A;  4B3S T;  4DR1 T;  4JI6 T;  4X62 T;  3E0Z A;  3RIF A;  5AQI B;  3PJA A;  4PJJ A;  3C98 B;  4DBQ A;  2V7I A;  5ABF B;  5L3D B;  2LHN A;  4DV7 T;  2VUR A;  3CX6 B;  1NAF A;  1T7S A;  2YU1 A;  3AAE B;  1J1J A;  4YHJ A;  2PBI A;  2BG9 A;  1UGO A;  4AKH A;  2L9Q A;  2IUB A;  2EHO A;  2BBH A;  2KND A;  3CKD A;  4O4J E;  4YTN A;  4YSX A;  3AAA B;  4U2Y A;  4UEM A;  3SOL A;  1IZN B;  3PUR A;  2WDV A;  2XAS B;  3QB5 A;  2LSJ A;  3UUB A;  3QC9 A;  5LXT E;  5L3F B;  4IDO A;  2WU5 A;  3RRW A;  2W63 A;  2QGS A;  4YXD A;  2BS3 A;  2XM2 A;  4CXX A;  4JI4 T;  5HCJ A;  4IL4 A;  4F6R C;  4DR2 T;  2D0T A;  4L0R A;  4JI5 T;  5FXW A;  4ILB A;  4HFC A;  2XM1 A;  3PV0 F;  3AE6 A;  2KZ7 B;  4GYR A;  2XAG B;  4KHP T;  5FMN A;  4HWD A;  3RQW A;  3KVB A;  3ZMS B;  3CQX C;  5FXX A;  2ODU A;  5ABG A;  2N9D A;  3P4P A;  3O4X E;  2W0G A;  3QNU A;  1OED E;  1SE7 A;  3KIN B;  4EZH A;  5AQJ B;  3UU5 A;  3FZK B;  1KNZ A;  2W66 A;  4EYY R;  4HFE A;  4IL9 A;  2XQ4 A;  4E7S A;  4NXN T;  3ZMU B;  3ZN1 B;  1D0Z A;  4AKG A;  2LE8 A;  4OYJ A;  1B7T A;  4IE0 A;  2Q9Q C;  3NBX X;  3I9W A;  4KUM B;  1G8X A;  2NTY A;  2WZI A;  2C5K T;  4IE7 A;  3Q5D A;  4DV0 T;  4X1I E;  2CMR A;  3K3N A;  4YSZ A;  1HG5 A;  3EAB A;  1HFA A;  1IJ5 A;  3FZL B;  1ZEE A;  2I59 A;  4A5X A;  3P4Q A;  1JNZ A;  2X9W A;  4AIU A;  2VKO A;  3J7Y q;  4ZS3 A;  4YFS A;  2IML A;  4JEU B;  4PK6 A;  4TNV A;  4MLK A;  2WP9 A;  1SUM B;  1FMW A;  4TNW A;  2N1G A;  5AQV B;  4B6X A;  2Q9Q B;  2V5D A;  5JDF A;  5L4E A;  1OWA A;  1ZOY A;  2WQY A;  3EDU A;  3GA8 A;  3PUQ A;  3FZM B;  2VVN A;  5AQP B;  4TV9 E;  4YTP A;  2UU9 T;  3ABV A;  5M4Y A;  4ILU A;  4GOU A;  5JRE A;  3ZYK A;  3F2E A;  1LRZ A;  4DV2 T;  3N2G E;  2LRK A;  5FXV A;  2UXN B;  4P0A A;  3F57 A;  1MIW A;  4I0U A;  3ZC0 A;  4YJ3 E;  2DLR A;  3SFE A;  3ZMT B;  3T8O A;  4UXN B;  4AKI A;  1ZV4 X;  4IE4 A;  1E7P A;  4OHF A;  3UU6 A;  4H9N C;  3TKL B;  3ZPO A;  3OYX A;  2HPJ A;  4DV6 T;  4CZZ B;  2SPC A;  4TUY E;  1YD8 G;  4HWC A;  3VRB A;  2Z6E A;  4JI1 T;  4CI3 B;  2QRX A;  4NXM T;  4NUV A;  4EGW A;  4YY3 T;  2KLQ A;  4K0U A;  2CWY A;  2B1E A;  3MJX A;  2WWU A;  4E7Z A;  3RYF E;  4AQF A;  5LMU T;  2LSK A;  1M7K A;  4U2Z A;  1AJ3 A;  2XAQ B;  3W15 B;  5C2T A;  4HE8 A;  5ABE A;  5JR9 C;  4H9S E;  3C50 A;  4O8S A;  4ZI7 E;  4X20 E;  3PUY F;  2HPL A;  2QA7 A;  3JCF A;  5L4H A;  1IJ6 A;  3H3M A;  5JDM A;  2FJE A;  3OYZ A;  3OVU A;  2VQF T;  2WDQ A;  3CX8 B;  3NRY A;  1V9D A;  2YN6 A;  3DJB A;  2CE7 A;  2LKH A;  3LJC A;  2XJ7 A;  2MTQ A;  5TAO A;  2WS3 A;  5F5W A;  4ZS2 A;  1Z0P A;  3T1Y T;  4AKR B;  1KNP A;  3AEE A;  2W62 A;  3LFM A;  2K3W A;  2UXB T;  5C8Y E;  2IW5 B;  1HF8 A;  4P0B A;  3KV5 A;  5JR9 B;  4U3C A;  5HWX A;  5LB7 B;  3IA3 A;  1HNW T;  4ZXL A;  1NWM X;  5DQW A;  3RHW A;  3AXJ A;  3WI3 A;  2UXC T;  5JDQ A;  4JI0 T;  1T72 A;  2JMK A;  1WFD A;  1XMO T;  4OK0 A;  3FZF B;  1KFY A;  4IDP A;  3PUA A;  4AXP A;  2CXD A;  2M67 A;  1HS7 A;  3LDQ B;  4JYA T;  3BQI A;  2LM9 A;  4YSY A;  2FUP A;  3ZYL A;  1WRD A;  1UUR A;  5FL1 A;  2CA5 A;  4QH4 A;  4LMJ A;  1LVK A;  3R6N A;  2KT9 A;  1HTJ F;  4ZZC A;  3P4S A;  3I0O A;  4C90 A;  4XBF B;  4LF5 T;  2ZM8 A;  3GMI A;  3UFE A;  1OXZ A;  5LP6 E;  4ZI2 C;  3NVO A;  4U33 A;  3KV4 A;  4DR4 T;  4COF A;  1KNR A;  5CFB A;  5JRC B;  1WLX A;  4UV9 B;  3VKG A;  3PU8 A;  5DAB A;  3L8R A;  5AQH B;  3VR8 A;  2JJ9 A;  2V7J A;  3JC6 C;  1SA0 E;  2W2U A;  2F4V T;  1WR0 A;  4PJL A;  2WMO A;  3SS1 A;  5LJN A;  1J5E T;  2K24 A;  4P1N A;  3O1H A;  2CCQ A;  3J9X 1;  4PFP A;  5AQS B;  1HR0 T;  2XQ5 A;  2KSR A;  2YEV C;  2D5U A;  3N9O A;  4LML A;  2X0H A;  3ONJ A;  1S94 A;  3QB5 K;  3CVR A;  2E9X C;  1FMV A;  2VKH A;  1MMG A;  4A97 A;  1SHZ C;  2VAS A;  3C4Z A;  3VKH A;  2I0M A;  4IE6 A;  5JVD E;  5AQF B;  2LM2 A;  3Q9D A;  2XHE B;  3N9L A;  1XMQ T;  4WZX A;  3P50 A;  5H6Q B;  4I43 B;  2WU2 A;  1UX4 A;  5HXR A;  4DR7 T;  2CPT A;  3AA0 B;  2LSG A;  5AQO B;  4IGU A;  4EXT A;  2BG9 E;  2XPK A;  2LT3 A;  3Q5E A;  4DR6 T;  5C3J A;  2R6G F;  5LG4 A;  2LHR A;  1XNQ T;  4QH5 A;  2CEA A;  3N9Q A;  3RQU A;  2IC6 A;  2E9X B;  2E8I A;  4QXB B;  3PUG A;  3C64 A;  1G73 A;  4QX7 B;  2DWG A;  3S4U A;  3HKC E;  4B3M T;  3ZN0 B;  2WM9 A;  5ETW A;  2KXP B;  3P4W A;  3GN5 B;  5JDG A;  2X66 A;  2KMF A;  4I55 E;  1QSD A;  5ABF A;  5J2T E;  1FEW A;  4LF8 T;  4AIS A;  5JH7 E;  4UVA B;  5LNK A;  3UUN A;  3RYC E;  5EK3 A;  1D1B A;  3H37 A;  5ABH A;  1D1A A;  1M62 A;  3ONX A;  5AQN B;  5EK4 A;  3ANW B;  3N9M A;  2V6Y B;  3TLT A;  5DQV A;  3FHN A;  4DUZ T;  4YLH A;  4IDZ A;  3HR0 A;  3VHL A;  3AAI A;  2WZH A;  2V8S V;  1OED C;  1MMA A;  2V7K A;  3EHZ A;  2X9Y A;  3AEF A;  3I0Q A;  3P8C D;  5BMV E;  1XNR T;  3N5L A;  2EHO D;  1KEY A;  5EZY E;  3OJA A;  2V7L A;  2YIN A;  4JI2 T;  4PW8 A;  2X68 A;  2IDO B;  3WAJ A;  3KDS E;  3MK7 C;  2CWO A;  1I94 T;  2XQ7 A;  3AEA A;  1H7C A;  2IAK A;  4EV6 A;  2CBI A;  4ILC A;  4AQG A;  1VRB A;  3CIR A;  4HTE A;  4KMC A;  5AFU L;  1L0V A;  4AI6 A;  2XSA A;  4TX5 A;  4H9R C;  5LHI B;  5AQG B;  4MBQ A;  5CB4 E;  2X0Y A;  3BK9 A;  1OED B;  4M1P A;  3PE0 A;  2VL8 A;  2JIW A; 
#chains in the Genus database with same CATH homology
 3OYX A;  4BAY B;  3KBU A;  2Y8D A;  2HPJ A;  4N78 D;  5ADX L;  1US7 B;  2DI4 A;  3NRX A;  4CZZ B;  2SPC A;  2JRK A;  2YU2 A;  2VK9 A;  4TUY E;  5DJQ C;  3MA9 A;  1ZHC A;  1YD8 G;  2Z6E A;  2CLY B;  1LVF A;  3KV6 A;  4CI3 B;  3Q2M A;  2XAF B;  4PFO A;  4EOZ B;  2A3D A;  3RYI E;  5L3E B;  4NUV A;  2IC9 A;  2DWK A;  2X9X A;  4PAG A;  5KX5 E;  5LHG B;  3RX6 A;  4ZHQ E;  3CPZ A;  3I1A A;  2X67 A;  2A72 A;  2KLQ A;  4K0U A;  2CWY A;  1X79 A;  3ZEF B;  2HH7 A;  2B1E A;  2NW7 A;  3MJX A;  2VKD A;  2WWU A;  4E7Z A;  4CI1 B;  3L3P A;  4JLE A;  3RYF E;  1UX5 A;  4FI5 A;  5LOV E;  3ZJ1 A;  4AQF A;  4QXC B;  1EZ3 A;  2LSK A;  3ZCI A;  5H6R B;  1MMN A;  3N9N A;  1AJ3 A;  4I4T E;  1D0Y A;  5HXS A;  2XAQ B;  5J1G A;  3W15 B;  2E9X A;  2CXL A;  5KDM C;  2C5I T;  2WSS V;  4HE8 A;  2W61 A;  5JR9 C;  5L2L A;  2XUE A;  4H9S E;  3VU7 H;  3C50 A;  4ZI2 D;  4O8S A;  2CM0 A;  4WW0 A;  5A1L A;  4G2A A;  3ZMV B;  4X20 E;  4ZI7 E;  2ZM2 A;  3AA7 B;  3GN5 A;  3R84 B;  5FP3 A;  3PDY A;  4TV8 E;  2HPL A;  4GIW A;  2QA7 A;  2Y48 B;  2ACX A;  2BVL A;  4MFR A;  4H9Q C;  1IJ6 A;  2BDE A;  3K3Q C;  3O1I A;  4G63 A;  5JDM A;  4HEA A;  2DNX A;  2DCF A;  3OYZ A;  2JPF A;  5LBM A;  4WNK A;  2K48 A;  1U5P A;  5FY7 A;  1MND A;  2A2F X;  4TN7 B;  3GWH A;  3CX8 B;  3NRY A;  1V9D A;  2ODV A;  2NTX A;  4CQI A;  3DJB A;  3JC6 D;  1ZKE A;  2CE7 A;  3CX7 B;  3MAC A;  3LJC A;  5HXC A;  4EZ4 A;  2MTQ A;  3RKO A;  5TAO A;  2VB6 A;  4FJO A;  1IAP A;  3ANW A;  1HX8 A;  4ZS2 A;  3KVA A;  1Z0P A;  4GK0 E;  5CA1 E;  1MNE A;  3CQC B;  4L9I A;  4AKR B;  4X1K E;  3LFM A;  2W62 A;  4Z8X A;  3FXD B;  2PG8 A;  3UUM A;  2LOP A;  4MAL A;  5CA0 E;  3NZQ A;  5C8Y E;  2IW5 B;  2MYS A;  4H9O C;  3ZJ2 A;  4AKL A;  1HF8 A;  3NZP A;  4QKN A;  4H9P C;  4DVD A;  2XTL A;  4P0B A;  5L3G B;  3MZK B;  4PNI A;  3KV5 A;  5JR9 B;  3PTR B;  2NP9 A;  4MHC A;  5HWX A;  2D0U A;  3ESL A;  3I9Y A;  4DBR A;  3LBX A;  5JDN A;  3KBT A;  2KWH A;  3E22 E;  3ZCJ A;  2LOS A;  1E1H B;  2Q9Q A;  1NWM X;  3U3I A;  2E9X D;  5DQW A;  3HKE E;  3EDV A;  3MXZ A;  5JQG E;  2G0U A;  2LEH A;  3WI3 A;  2ES0 A;  3ZYM A;  4UF0 B;  3LK4 2;  5JDQ A;  2JMK A;  3UUX B;  3U78 A;  4OK0 A;  3MKD A;  4IST A;  3UUL A;  5FXZ A;  3BQK A;  2XAJ B;  3PUA A;  3RC3 A;  2Y6X A;  3FB2 A;  4AXP A;  2CXD A;  5E0O A;  3HA4 A;  2M67 A;  1HS7 A;  3QK6 A;  3E0Z A;  3BQI A;  2LM9 A;  2OA5 A;  3D0T A;  5F8P A;  4PJJ A;  3C98 B;  4DBQ A;  3ZYL A;  1WRD A;  2H7O A;  2V7I A;  2CA5 A;  3V5U A;  4HN9 A;  3LK2 B;  5L3D B;  2LHN A;  2XQY A;  4H63 V;  1LVK A;  2V1D B;  3CX6 B;  3EUH A;  2KT9 A;  3R6N A;  1NAF A;  1HTJ F;  4QX8 B;  2J1D G;  2UXX B;  2YU1 A;  3AAE B;  3I0O A;  4C90 A;  4XBF B;  1YKE B;  4YHJ A;  2ZM8 A;  1MMD A;  2PBI A;  3GMI A;  3UFE A;  4ANJ A;  1WYB A;  4AKH A;  2L9Q A;  4UVC B;  1OXZ A;  2EHO A;  5LP6 E;  4ZI2 C;  4ISS A;  4BJN A;  3AVS A;  5LHH B;  2RP4 A;  2VWA A;  3KV4 A;  2KND A;  3CKD A;  4O4J E;  3N2O A;  3K8P C;  3AAA B;  4IHJ E;  4UEM A;  2VKJ A;  3SOL A;  4GK5 E;  2GK9 A;  5JRC B;  3IEE A;  1IZN B;  3ETU A;  3FXE B;  3PUR A;  1WLX A;  4UV9 B;  3B13 A;  2XAS B;  3VKG A;  2LSJ A;  3PU8 A;  4TZ4 C;  1MIY A;  5DAB A;  2NW9 A;  5LA6 E;  3QC9 A;  5LXT E;  5HWY A;  3RH3 A;  5L3F B;  3RRW A;  2JJ9 A;  2V7J A;  3ZMZ B;  4ASK A;  2W63 A;  3CQG B;  3IBP A;  4DMV A;  3JC6 C;  1SA0 E;  4JUY A;  2QGS A;  4EB6 E;  2X51 A;  4ERR A;  1YW0 A;  3F31 A;  4HKA A;  2PJQ A;  4PJL A;  3RYH E;  4ADZ A;  2WMO A;  3SS1 A;  5LJN A;  1BR1 A;  4ZI3 C;  2H3R A;  2K24 A;  4PK4 A;  4CXX A;  3O1H A;  2YK0 A;  5F3J A;  4F6R C;  4WBO A;  4XAX B;  4EYU A;  2CCQ A;  3J9X 1;  4PFP A;  4ZI3 D;  2DHR A;  4BA9 A;  3SRZ A;  2D0T A;  4L0R A;  1KK7 A;  5FXW A;  2YEV C;  4AQF C;  1LKX A;  2D5U A;  3N9O A;  4CXW A;  4O4H E;  5GON E;  5IYZ E;  1S94 A;  2KIN B;  2N2N A;  3CVR A;  5FYM A;  2E9X C;  2H7V C;  4J2C A;  3AVR A;  2X9H A;  1FMV A;  2VKH A;  1MMG A;  5FY0 A;  2KZ7 B;  1SHZ C;  2VAS A;  4GYR A;  2XAG B;  3C4Z A;  4ZOL E;  3VKH A;  3CML A;  4IE6 A;  5IHY A;  5JVD E;  3Q9D A;  4CXY A;  1HG2 A;  2XHE B;  2BZB A;  5FMN A;  3N9L A;  2V7M A;  5H6Q B;  5FNV E;  4I43 B;  1UX4 A;  5HXR A;  3P7I A;  3KVB A;  3ZMS B;  3CQX C;  3ETV A;  4O4I E;  5FXX A;  2CXF A;  2JMH A;  2LSG A;  2ODU A;  3AA0 B;  3AB3 B;  3N9P A;  2N9D A;  2WBL A;  3O4X E;  3QUJ A;  4IGU A;  2W0G A;  4EXT A;  2ZLY A;  3WAK A;  3HL6 A;  3RPU A;  3OKQ A;  3M65 A;  5LGU B;  3KIN B;  4EZH A;  4IIJ E;  5JR9 A;  4JEH B;  5J2U E;  2LT3 A;  3DTO A;  1BR4 A;  2P9B A;  5LG4 A;  5HYA A;  2LHR A;  2L8K A;  2K9A A;  2CEA A;  3N9Q A;  1KNZ A;  4EYY R;  5LCY A;  2NOX A;  2C5J A;  5JDL A;  4PJM A;  4UF0 A;  2IC6 A;  1HCI A;  1VOM A;  1S35 A;  1BR2 A;  5LBQ B;  2E9X B;  4E7S A;  5FY1 A;  3ZMU B;  3LK3 B;  3ZN1 B;  1D0Z A;  2E8I A;  4QXB B;  4AKG A;  2LE8 A;  4BJM A;  3PUG A;  3C64 A;  4P09 A;  4UVB B;  1D1C A;  1G73 A;  2V26 A;  4OYJ A;  4QX7 B;  1B7T A;  2BVM A;  2DWG A;  3HKC E;  3S4U A;  3Q5W A;  3ZN0 B;  2WM9 A;  5ETW A;  4PK5 A;  2KXP B;  4HFV A;  3GN5 B;  2Q9Q C;  4IE0 A;  3ZC1 A;  2X66 A;  5JDG A;  2KMF A;  4I55 E;  4QHO A;  2MBG A;  3NBX X;  3I9W A;  3HKD E;  4KUM B;  1MIV A;  1G8X A;  2NTY A;  5JDH A;  1QSD A;  2C5K T;  4IE7 A;  1T98 A;  1FIO A;  2Q9Q D;  2JQQ A;  5J2T E;  3KV9 A;  2X0L B;  3Q5X A;  1FEW A;  3LG7 A;  5JH7 E;  1O3X A;  4X1I E;  2PFV A;  4UVA B;  4UV8 B;  5LNK A;  2CMR A;  3K3N A;  4KP3 C;  4GYS A;  4PJN A;  3UUN A;  3RYC E;  4HGA A;  1HG5 A;  2KWI B;  5HAX A;  3IHR A;  5EK3 A;  3RRC A;  3C4W A;  3B57 A;  3K3O A;  1QUU A;  1HFA A;  1D1B A;  1IJ5 A;  4DND A;  3A5X A;  3KFW X;  3C51 A;  2LSY A;  3H37 A;  4U74 A;  5EK2 A;  1D1A A;  1Y64 B;  1ZEE A;  3ONX A;  2I59 A;  3ANW B;  3N9M A;  5EK4 A;  3OBV E;  4NUU A;  4H63 H;  5KMG P;  2X9W A;  2VKO A;  5LGN B;  5DQV A;  3J7Y q;  2W00 A;  4ZS3 A;  4YFS A;  4EAH A;  3FHN A;  5LYJ E;  4JEU B;  3L09 A;  4PK6 A;  4YLH A;  4I50 E;  4YJ2 E;  3HI2 A;  1YKH B;  4MLK A;  3EVY A;  4CI2 B;  4XZC A;  3DP7 A;  1FMW A;  4IDZ A;  5JRC A;  3HR0 A;  2N1G A;  3VHL A;  3AAI A;  4O2B E;  3H3A A;  3RC8 A;  2NW8 A;  1U4Q A;  4B6X A;  1CUN A;  4OYK A;  2EHO C;  3LBX B;  1MMA A;  2V7K A;  2D2S A;  2C0S A;  2Q9Q B;  2X9Y A;  3SWH A;  3ZLI A;  4OFZ A;  3HKB E;  5JDF A;  3I0Q A;  5LGT B;  3PU3 A;  3P8C D;  3AA1 B;  2WMN A;  5BMV E;  3N5L A;  2WAU A;  1OWA A;  2EHO D;  3EDU A;  3O1J A;  3GA8 A;  4QXH B;  2L3L A;  3PUQ A;  2CLY C;  3OJA A;  4IE5 A;  2V7L A;  5EZY E;  2YIN A;  3CWZ B;  4UIG A;  4PW8 A;  2X68 A;  5HXE A;  4TV9 E;  3WAJ A;  3AA6 B;  3IF8 B;  3KDS E;  3MK7 C;  3O9X A;  4DMW A;  2K5B B;  3C4X A;  4WBN E;  5M4Y A;  3FBL A;  4ILU A;  2CWO A;  4GOU A;  5L3B B;  5JRE A;  4C91 A;  3ZYK A;  1H7C A;  3F2E A;  1LRZ A;  1WYC A;  2IAK A;  3N2K E;  3PUS A;  4O2A E;  3N2G E;  5FXV A;  3E08 A;  4A56 A;  5L3C B;  5LJM A;  4AQG A;  1VRB A;  2ZM0 A;  2MOZ A;  4HTE A;  4EIW A;  2UXN B;  4P0A A;  3UT5 E;  2ZMA A;  4DO0 A;  2XAH B;  2LSI A;  3FBZ A;  4KMC A;  5AFU L;  3F57 A;  4UEL A;  1D0X A;  1MIW A;  4AI6 A;  4X1Y E;  4TX5 A;  4L5G A;  3V5S A;  4H9R C;  3ZC0 A;  4YJ3 E;  5HXH A;  2DLR A;  4O4L E;  4MBQ A;  3UTK A;  5LHI B;  4KBM B;  3ZMT B;  5CB4 E;  2NWB A;  1WR6 A;  3T8O A;  4UXN B;  4QWN B;  4V1A v;  1BR0 A;  2RA1 A;  4AKI A;  1ZV4 X;  3BK9 A;  2LJL A;  4IE4 A;  3BQL A;  4M1P A;  4OHF A;  3PE0 A;  2EHO B;  2VL8 A;  4H9N C;  3TKL B;  3ZPO A;  4U72 A;  1UCU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...