4DV2T

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, c912a
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
99
structure length
99
Chain Sequence
b'RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome
total genus 33
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 4dv2T00
5LMUT 2UU9T 5LMNT 1FJGT 1N33T 2VQET 1XMQT 4B3TT 4LF8T 4KHPT 4LF7T 4X64T 2UUAT 4JI3T 4B3RT 4X65T 4X66T 1IBLT 4DV5T 4DR2T 3T1HT 5BR8T 4K0KT 1J5ET 4LF4T 1I94T 2E5LT 2UUBT 4JI2T 4DR5T 2HHHT 1IBMT 1HNXT 4DV7T 4B3ST 4JI8T 2UXCT 4JI1T 2UXDT 2VQFT 4YHHT 1XMOT 4DUZT 1HNZT 4LF9T 4JV5T 2F4VT 4LFAT 4DV3T 1N36T 1XNQT 4B3MT 4DR1T 2UUCT 4DR7T 4DR6T 4LFBT 4AQYT 4JI5T 4DR3T 4JYAT 4NXNT 4GKKT 4OX9T 1N32T 4DV1T 4DV6T 4JI7T 4DV0T 1IBKT 1HNWT 4LF6T 4YY3T 4GKJT 4DV2T 4DUYT 4DV4T 1HR0T 3T1YT 3OTOT 4NXMT 4LF5T 4DR4T 4LFCT 2UXBT 4X62T 5IWAT 1N34T 1XNRT 2ZM6T 4JI4T 4JI0T 4JI6T
chains in the Genus database with same CATH superfamily
5CB4E 3RYHE 4A97A 2BG9C 4YSYA 3O4XE 3ZSTA 4HWCA 2K9AA 3PUXF 3JAEA 2VL0A 4IIJE 5LNKA 3T1HT 2Q9QA 5J0ZA 3AVRA 2X0YA 3PUGA 2VVSA 2IC9A 4IE5A 5FL1A 3RRWA 4JI1T 4LF9T 1HNZT 4CZZB 1KK7A 5E0OA 3UFEA 3RIAA 2YINA 1IZNB 3QB5A 5JDLA 5LOVE 2VURA 4ZI3D 5JR9B 3KINB 3TLWA 5BMVE 3DTOA 1ZP0A 3K3QC 3KVBA 3FB2A 2KXPB 2WMNA 4EXTA 3UQ7A 2FJEA 4IDPA 1IJ6A 2BDEA 4HWIB 4DV4T 3ZPOA 3FZFB 1LRZA 3N9NA 3T1YT 2WDVA 2FJBA 3UT5E 4NIQA 2XAQB 5F8PA 1ZEEA 1YQ4A 3RQWA 2XQ9A 2BS3A 5FNVE 3PURA 4ILCA 5HWYA 2BBHA 3KV5A 3B57A 4EAHA 2V5CA 2N1GA 2AE9A 5J2TE 3FZKB 1MMDA 4YTMA 4L0RA 1HX1B 3H3MA 4PJNA 4PNIA 4EV6A 3RLFF 2VKJA 1HS7A 1US7B 1IBLT 3E08A 2P9BA 5ABFB 3ZMVB 1BR1A 3I0OA 2LE8A 2KWHA 4QXHB 2KSRA 3L8RA 5LB7B 1KEYA 2X0LB 4UELA 2CRBA 2KINB 3U3IA 1UGOA 4JV5T 2JRKA 5JQGE 1XNQT 3HKDE 1UX5A 2CEAA 1Z8UA 3S4UA 1D1CA 4U74A 2NR4A 3Q5XA 1ZOYA 3EDUA 4ZI7E 2V6YA 3N9MA 2BG9A 2DCFA 4UEMA 3ETVA 3P8CD 1OXZA 4HEAA 1MIVA 2W63A 2XJ7A 3LK3B 3ZKRA 2KNDA 2YDSA 3OYXA 4ILAA 4TNVA 4EZ4A 1VCSA 3NBXX 5FP3A 3ZN1B 4C90A 1WYBA 3FZMB 4O4LE 5FL0A 4JI0T 5FY0A 2CXDA 3AAEB 3FXDB 3P7IA 4LF7T 4TX5A 3CX8B 1Z0PA 3ONXA 4ZI3C 2XQ6A 4H9PC 1FIOA 2EHOB 4A98A 4Z8XA 1X9BA 2JQQA 1OEDE 2H89A 2HPJA 3V5UA 3I9WA 1OWAA 3PDYA 3MACA 1XWMA 2LRLA 4BJMA 5L3EB 5C3JA 4I55E 4NPPA 4AQGA 4ZHQE 4KHZF 2LOPA 4LFBT 1X79A 5ABEA 2A2FX 3PTRB 1CHUA 4U7YA 4DV1T 4DO0A 1M7KA 4JLEA 3UU6A 5JDFA 3HL6A 3FBLA 2SPCA 3P4QA 4NXMT 3QC9A 1KF6A 2JMHA 3B13A 4QX7B 5HEOA 2BS4A 4I43B 3AE8A 3PUSA 3D0TA 3I9YA 1YKHB 2V7MA 3AAIA 2PJQA 2CLYB 4PFPA 1CUNA 2Y48B 4EOZB 1G73A 5ETWA 4B3TT 1J5WA 4IREA 1WRDA 1NWMX 4KX6A 3AXJB 3AXJA 1HG2A 2CWYA 3AEGA 1NAFA 2ZLYA 4KI0F 2YDQA 2NP9A 4DR5T 2HHHT 5KXJA 5CFBA 3HKBE 2FUPA 4O4IE 3Q9DA 4ILUA 4MLKA 4FI5A 4E7ZA 4G63A 2YEVC 3AE6A 2JPFA 5DQWA 2CA5A 4XZCA 4PJMA 2K5BB 1ZV4X 2D0UA 3AE2A 5M4YA 3BK9A 4DV6T 1W0AA 5H6QB 4CQIA 2MOZA 5FMNA 4DUYT 3B5MA 2XM2A 4O4HE 2IAKA 5HXCA 3G06A 4YSZA 1XNRT 3IF8B 3C4XA 4MFRA 2ZM6T 4AKHA 2VKOA 4JI6T 4AQFC 2N9DA 2WWUA 2VB6A 2NW8A 3LDQB 3RGLA 2V7KA 1KNZA 4HTEA 5HXSA 4ZOLE 5FVLA 2WDQA 4X1IE 2FJAA 4DR2T 3P4WA 4KMCA 2LSGA 3F31A 1YD8G 4TWFA 2LKHA 3ZT7A 2LSIA 2OA5A 4QWNB 2UXCT 4LMLA 3RIUA 5JR9C 4U2ZA 1KNRA 2JQHA 3K8PC 2QRXA 2W66A 4B3MT 3VKHA 3ZCJA 2VWAA 3O1JA 1OEDA 4IDNA 3A5XA 1BR2A 1SE7A 1D1AA 3ETUA 5JDGA 4CN6A 4JYAT 2W62A 3AA0B 3N2GE 4DIDB 1MMGA 2DWGA 3FZHB 3BQKA 3DJBA 3QK6A 4UVAB 3ZMUB 4IDOA 2YDRA 4BAYB 4WBOA 4YTPA 5KDMC 1VRBA 1Y01A 4NUVA 1DU2A 4I4TE 2UXBT 1D0XA 2LSJA 3EDVA 1HG5A 2PG8A 4JI4T 2X9XA 3GN5B 2J1DG 3CPZA 1QSDA 5AQUB 2I0MA 4TV8E 4CXXA 4ZZCA 2QGSA 2CM0A 4L5GA 2BKNA 3AEFA 3AE1A 2WQYA 3J9X1 5HEGA 2K3WA 1WFDA 4YJ2E 3AEDA 4QH4A 2C5KT 5AQOB 5JH7E 4P0AA 4H63V 3NKZA 3ZLIA 5L3CB 1MIYA 3SS1A 3ZEFB 2KWIB 4AKRB 2Q9QB 4LMKA 3QB5K 3PJAJ 4AISA 5CA0E 4JEHB 2A72A 2VK9A 3N5LA 4GOUA 5AQVB 3C98B 1WR0A 3VRBA 3AA1B 3OVUA 4P0BA 3KVAA 2PFVA 3CVRA 3N9OA 4DR4T 4AKGA 5AQNB 4X1YE 4X62T 3WAJA 2XSAA 3T8OA 1LKXA 1W9RA 4UF0A 4U7IA 3R6NA 2JQ9A 4PAGA 2J4GA 1HF8A 3GMIA 2XZEA 4HFIA 2UUAT 4JI3T 2B76A 1T8BA 2D5UA 2MPKA 1V9DA 5EK3A 4WNKA 5JDMA 3ZYMA 4UIGA 3HR0A 1AJ3A 2W67A 1HFAA 3P50A 4CI2B 5CA1E 2X68A 3F2EA 3N9PA 3M3ZB 4IHJE 4UVCB 5DJQC 2ZM8A 4IE0A 2F4VT 1KFYA 1W0BA 2H88A 1KNPA 3J7Yq 2RA1A 4TZ4C 3OYZA 4TWHA 1IJ5A 4ZEYA 1NEKA 3LBXA 1UUSA 4NXNT 4CN4A 2J47A 4Q25A 4JEUB 4JI7T 4O2AE 5F5WA 4H63H 5AQQB 4ANJA 3N9QA 2H7VC 3MKDA 5JTGA 4MALA 3CMLA 3PE0A 2D2SA 3L09A 2V6YB 4P09A 2BG9B 3RPUA 5LBQB 5LG4A 3AB3B 3NWIA 4UV9B 2B1EA 4LF8T 4AI6A 2HN1A 1E7PA 2M6BA 4E7SA 2WU5A 4OYJA 4X65T 3RYFE 4CN1A 1I94T 2LHNA 3QUJA 3RH3A 4ISTA 2V7LA 2CCQA 4B3ST 2YOEA 1EZ3A 1MNDA 3O1HA 5CJ5A 2WWVA 3UU5A 4IL9A 2QVAA 3NRYA 2W2UA 3SFEA 1FEWA 2IW5B 3FXEB 2W4XA 4H9QC 4GKKT 5IUXA 4PW8A 4DV0T 3NZQA 3MXZA 2CPTA 3C4WA 3OBVE 4LF6T 2C5JA 4YTNA 4DV2T 4HFHA 2LHRA 2DL1A 4AKIA 4KBMB 4WZXA 1UURA 2WP9A 5HAXA 3ZCIA 5J1GA 2LT3A 5IWAT 1N34T 2BS2A 4ZI2D 3AA7B 2LM9A 3KV6A 2LSKA 5AQPB 4L9IA 2FJDA 2D0TA 2OLTA 3RRCA 5TAOA 4HFBA 4IGUA 2YU2A 2CBJA 2VQET 3O1IA 4ADZA 5LCYA 3F57A 3AA6B 2Y8DA 4JUYA 3CWZB 2XY8B 1T72A 1XDOA 2E9XC 2WMOA 2MYSA 5ABHA 5L3BB 4FJOA 2CE7A 4ASKA 1JNZA 5CGMA 3IA3A 2XPKA 3AEEA 4LMJA 3SRZA 4IE7A 1FMWA 2IDOB 4YT0A 3MK7C 3RKOA 4AQYT 2IC6A 5FY1A 5HCMA 1Y64B 3LFMA 4H9OC 1BR4A 5AQSB 1IBKT 3PUVF 3RC8A 3O9XA 2OV9A 5JRCB 3A7MA 5JRCA 2LLYA 3Q5EA 4O4JE 1MNEA 3ZJ2A 4HFVA 3E22E 4JBWF 1M62A 5HCJA 3TLTA 4YFSA 5AQLB 2V1DB 5LA6E 4AXPA 1R8IA 4KP3C 3K1SA 3VRAA 3C51A 1HX8A 4HE8A 1YKEB 1N33T 3R84B 4HFCA 2V8SV 2UXXB 4BA9A 2XASB 2BBJA 2ZM2A 4U2YA 3EVYA 2ACXA 3VHLA 5BR8T 2A3DA 4LF4T 3OJAA 4JI2T 4QH5A 1UX4A 4PK6A 4KUMB 2VQFT 3EAMA 3ZJ1A 2GK9A 3CIRA 3A8YC 4ZI2C 1G8XA 1N36T 3ZYKA 2W00A 2J62A 2UUCT 4A5XA 4IE6A 4GYRA 4ZZBA 2CXFA 4DNDA 4DR3T 3ABVA 1FMVA 2XM1A 5C2TA 2EHOD 3EABA 2CWOA 2H3RA 1SUMB 2ODVA 2LOSA 2CMRA 4TNWA 5KX5E 1OEDB 2VL8A 1H7CA 4O8SA 4EZHA 3C64A 2C5IT 2W0GA 3SFDA 3ZMTB 2BKOA 4HFEA 3AEBA 2LM2A 2XQ8A 3CX7B 3AEAA 4XAXB 1MIWA 3MJXA 2XAGB 1XMQT 5EZYE 4X64T 4HKAA 2NTXA 4YJ3E 2WU2A 2YN6A 3W15B 2A9UA 2L3LA 2XQYA 3Q5DA 3GWHA 4CI1B 1B7TA 4AIUA 2E5LT 1WCRA 2D9DA 2HPLA 3PU3A 3RX6A 4JI8T 3BQLA 5HYAA 2X51A 3PV0F 1XMOT 1IAPA 4LFAT 3AE9A 2H7OA 4DVDA 1U5PA 2YKSA 3TKLB 4DR1T 2X66A 5LHIB 3TLSA 3HKCE 5L3GB 2WB5A 1WLXA 4U31A 5FXZA 5JREA 4UXNB 4QKNA 3H37A 1SA0E 1I6ZA 2M6IA 4HN9A 2V5DA 2Y6XA 3X1DA 4WW0A 4YY3T 2BVLA 4CXWA 3EI0A 5JDQA 1UK5A 1XDPA 4HFDA 2ES0A 4YLHA 2IUBA 4AQFA 1D0YA 3Q5WA 5GONE 5HEJA 3IEEA 5LGUB 3UULA 4O2BE 2X9WA 3ZMSB 2V7JA 5AFUL 2V6XA 3UFGA 4EYUA 5L3FB 5LMUT 4HGAA 4K0UA 2JIWA 3UU4A 4CXYA 2E2AA 5FKYA 4KHPT 5AQMB 3AE3A 3ANWB 3N2KE 3ANWA 2WCAA 3WAKA 5AQIB 4OK0A 5IYZE 4B3RT 4IDQA 2ODUA 4UV8B 3LSVA 1S35A 4IE4A 3BQIA 2X67A 1HTJF 4IL4A 4J2CA 4K0KT 1O3XA 2JQKA 4YHJA 5L4HA 4UF0B 3RYCE 4P1NA 2EHOC 3JCFA 5JR9A 2ACZA 5LG3A 2W61A 5HEHA 4QX8B 5C8YE 3UTKA 3UU3A 4YSXA 1D0ZA 5HEUA 3V5SA 3HKEE 3L39A 2PBIA 2Z6EA 2BKPA 3IBPA 2XQAA 5DABA 4ZXLA 2MAWA 2N2NA 3VKGA 2YK0A 4DV3T 2HH7A 2DI4A 3QNUA 4ZS3A 3Q2MA 4EIWA 2XQ3A 3RYIE 4DR7T 4EGWA 5FYMA 3ZT5A 5L3DB 4ZS2A 3KV4A 3PJAA 5ADXL 3ESLA 5FXWA 3MZKB 2XUEA 4PFOA 2XQ5A 1LVKA 3AE4A 1BR0A 2DHRA 1J1JA 5LXTE 2QYWA 4U3CA 2E9XD 1HCIA 3JC6D 3LBXB 2MBGA 3CKDA 4OYKA 2LEHA 3K3NA 5ABFA 3P4SA 2XQ4A 2DNXA 3AE7A 3SOLA 2VASA 4CI3B 4HWDA 2I59A 3AECA 2XAJB 2CLYC 3U78A 2XSBA 4ILBA 1SHZC 3PUAA 2VVNA 4X66T 2M67A 4XBFB 5AQFB 1NENA 2I6HA 2V26A 4ISSA 4PK4A 4GK0E 5ABGA 4V1Av 1E2AA 5FY7A 2QA7A 2UUBT 1L0VA 3ZMZB 4B6XA 1HNXT 4C91A 3FBZA 2LRKA 3KBTA 4HWFA 2K24A 4DUZT 5AQTB 3VR9A 5LJMA 2PTFA 4HWHA 2CHNA 3P4RA 4DBQA 3L3PA 5LJNA 2E5VA 3LK2B 4YXDA 4TV9E 3ZC0A 2X9HA 4AKLA 5JVDE 4OX9T 5HXEA 1S94A 4OHFA 4IT4A 5JDNA 3H3AA 2LKGA 4Z91A 2G0UA 2L9QA 2HN2A 2DWKA 2YU1A 4EEDA 5EK2A 4U72A 4EYYR 2NW7A 3RQUA 3OTOT 4LF5T 4QXCB 4X20E 4I0UA 2IHR1 2WAUA 2EHOA 3E0ZA 2VKHA 4BJNA 2WS3A 4TUYE 2UXNB 3NRXA 5LYJE 5KMGP 1GQEA 2Q9QD 2ZM0A 4MHCA 5LMNT 4G2AA 5LP6E 5LBMA 2FBWA 3LJCA 1JNRA 3AAAB 2DLRA 3ONLC 2LJLA 4U33A 2WSSV 2X0HA 1VOMA 3K3OA 2K48A 3N9LA 1IBMT 3KDSE 5J2UE 4H9SE 3UUMA 4I50E 3CQXC 3JC6C 5HWXA 3PUZF 3KV9A 3RIUC 3PU8A 3OPCA 4PJJA 4X1KE 1UCUA 3P4PA 4JI5T 1MMNA 1U4QA 3FZLB 1OEDC 2E8IA 3JAFA 5DQVA 4PJLA 2XTLA 4EB6E 4F6RC 2CBIA 4WBNE 3FHNA 2WZHA 4LFCT 3AVSA 3PUYF 1ZKEA 4QH1A 2WBLA 3RHWA 5EK4A 5FVKA 5FXVA 2WY2A 3RC3A 5LHGB 2JJ9A 1MMAA 2RP4A 3RF1A 4MBQA 4GK5E 5HXRA 4EEBA 1WYCA 4NUUA 2CHOA 2KZ7B 5AQGB 3EUHA 2JMKA 2KT9A 4ERRA 2XQ7A 3RI5A 3CQGB 2IMLA 4DV7T 2XAHB 4YHHT 2CXLA 4M1PA 1WR6A 5HXHA 3OKQA 3C4ZA 2L8KA 3MA9A 2RPAA 2MTQA 1VCTA 2NTYA 3I0QA 1YXRA 4GYSA 4PK5A 1QUUA 2Q9QC 3VR8A 2WM9A 3QOFA 3ZC1A 2KLQA 1N32T 3UUBA 3C50A 2VKDA 4TN7B 3PUWF 2WZIA 2X9YA 2IIUA 2XAFB 3WI3A 4GIWA 3M65A 3TLUA 3IHRA 4IDZA 4QHOA 4DMVA 2NW9A 3ZN0B 1HR0T 3NZPA 1ZHCA 4F8HA 1LVFA 4H9NC 3UQ4A 3VU7H 3KFWX 3HI2A 2R6GF 3ONJA 2BVMA 5L2LA 4H9RC 5AQRB 2UXDT 1XZYA 4N78D 2UU9T 1FJGT 5JDHA 3NVOA 2E9XB 2E9XA 3CX6B 3RIFA 4TWDA 2BZBA 3LK42 2C0SA 3ZSSA 2LSYA 3UU8A 4DV5T 1J5ET 4UR9A 3AE5A 3LG7A 3JADA 5IHYA 5FXXA 2KMFA 4QXBB 5L47A 5L4EA 1T7SA 2BG9E 3UUXB 3I1AA 3CQCB 2NOXA 2AXDS 2V7IA 5F3JA 3PUQA 3CK6A 1YQ3A 5A1LA 4DMWA 2XHEB 3KBUA 4Z90A 3N2OA 3TLVA 4DR6T 1D1BA 4OFZA 5AQJB 2WDRA 2ZMAA 4UVBB 5AQKB 5LHHB 4X5TA 3ZYLA 3SWHA 4COFA 3ZT6A 3GN5A 1W09A 1HNWT 4GKJT 3EHZA 1YW0A 5H6RB 5LGTB 3DP7A 3UUNA 5LGNB 1QLBA 1E1HB 3HA4A 4WYVA 5AQHB 1T98A 3GA8A 2NWBA 4DBRA 3RKGA 4A56A
chains in the Genus database with same CATH topology
5LMUT 2UU9T 5LMNT 1FJGT 1N33T 2VQET 1XMQT 4B3TT 4LF8T 4KHPT 4LF7T 4X64T 2UUAT 4JI3T 4B3RT 4X65T 4X66T 1IBLT 4DV5T 4DR2T 3T1HT 5BR8T 4K0KT 1J5ET 4LF4T 1I94T 2E5LT 2UUBT 4JI2T 4DR5T 2HHHT 1IBMT 1HNXT 4DV7T 4B3ST 4JI8T 2UXCT 4JI1T 2UXDT 2VQFT 4YHHT 1XMOT 4DUZT 1HNZT 4LF9T 4JV5T 2F4VT 4LFAT 4DV3T 1N36T 1XNQT 4B3MT 4DR1T 2UUCT 4DR7T 4DR6T 4LFBT 4AQYT 4JI5T 4DR3T 4JYAT 4NXNT 4GKKT 4OX9T 1N32T 4DV1T 4DV6T 4JI7T 4DV0T 1IBKT 1HNWT 4LF6T 4YY3T 4GKJT 4DV2T 4DUYT 4DV4T 1HR0T 3T1YT 3OTOT 4NXMT 4LF5T 4DR4T 4LFCT 2UXBT 4X62T 5IWAT 1N34T 1XNRT 2ZM6T 4JI4T 4JI0T 4JI6T
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LMU T;  2UU9 T;  5LMN T;  1FJG T;  1N33 T;  2VQE T;  1XMQ T;  4B3T T;  4LF8 T;  4KHP T;  4LF7 T;  4X64 T;  2UUA T;  4JI3 T;  4B3R T;  4X65 T;  4X66 T;  1IBL T;  4DV5 T;  4DR2 T;  3T1H T;  5BR8 T;  4K0K T;  1J5E T;  4LF4 T;  1I94 T;  2E5L T;  2UUB T;  4JI2 T;  4DR5 T;  2HHH T;  1IBM T;  1HNX T;  4DV7 T;  4B3S T;  4JI8 T;  2UXC T;  4JI1 T;  2UXD T;  2VQF T;  4YHH T;  1XMO T;  4DUZ T;  1HNZ T;  4LF9 T;  4JV5 T;  2F4V T;  4LFA T;  4DV3 T;  1N36 T;  1XNQ T;  4B3M T;  4DR1 T;  2UUC T;  4DR7 T;  4DR6 T;  4LFB T;  4AQY T;  4JI5 T;  4DR3 T;  4JYA T;  4NXN T;  4GKK T;  4OX9 T;  1N32 T;  4DV1 T;  4DV6 T;  4JI7 T;  4DV0 T;  1IBK T;  1HNW T;  4LF6 T;  4YY3 T;  4GKJ T;  4DV2 T;  4DUY T;  4DV4 T;  1HR0 T;  3T1Y T;  3OTO T;  4NXM T;  4LF5 T;  4DR4 T;  4LFC T;  2UXB T;  4X62 T;  5IWA T;  1N34 T;  1XNR T;  2ZM6 T;  4JI4 T;  4JI0 T;  4JI6 T; 
#chains in the Genus database with same CATH topology
 5CB4 E;  3RYH E;  4A97 A;  2BG9 C;  4YSY A;  3O4X E;  3ZST A;  4HWC A;  2K9A A;  3PUX F;  3JAE A;  2VL0 A;  4IIJ E;  5LNK A;  3T1H T;  2Q9Q A;  5J0Z A;  3AVR A;  2X0Y A;  3PUG A;  2VVS A;  2IC9 A;  4IE5 A;  5FL1 A;  3RRW A;  4JI1 T;  4LF9 T;  1HNZ T;  4CZZ B;  1KK7 A;  5E0O A;  3UFE A;  3RIA A;  2YIN A;  1IZN B;  3QB5 A;  5JDL A;  5LOV E;  2VUR A;  4ZI3 D;  5JR9 B;  3KIN B;  3TLW A;  5BMV E;  3DTO A;  1ZP0 A;  3K3Q C;  3KVB A;  3FB2 A;  2KXP B;  2WMN A;  4EXT A;  3UQ7 A;  2FJE A;  4IDP A;  1IJ6 A;  2BDE A;  4HWI B;  4DV4 T;  3ZPO A;  3FZF B;  1LRZ A;  3N9N A;  3T1Y T;  2WDV A;  2FJB A;  3UT5 E;  4NIQ A;  2XAQ B;  5F8P A;  1ZEE A;  1YQ4 A;  3RQW A;  2XQ9 A;  2BS3 A;  5FNV E;  3PUR A;  4ILC A;  5HWY A;  2BBH A;  3KV5 A;  3B57 A;  4EAH A;  2V5C A;  2N1G A;  2AE9 A;  5J2T E;  3FZK B;  1MMD A;  4YTM A;  4L0R A;  1HX1 B;  3H3M A;  4PJN A;  4PNI A;  4EV6 A;  3RLF F;  2VKJ A;  1HS7 A;  1US7 B;  1IBL T;  3E08 A;  2P9B A;  5ABF B;  3ZMV B;  1BR1 A;  3I0O A;  2LE8 A;  2KWH A;  4QXH B;  2KSR A;  3L8R A;  5LB7 B;  1KEY A;  2X0L B;  4UEL A;  2CRB A;  2KIN B;  3U3I A;  1UGO A;  4JV5 T;  2JRK A;  5JQG E;  1XNQ T;  3HKD E;  1UX5 A;  2CEA A;  1Z8U A;  3S4U A;  1D1C A;  4U74 A;  2NR4 A;  3Q5X A;  1ZOY A;  3EDU A;  4ZI7 E;  2V6Y A;  3N9M A;  2BG9 A;  2DCF A;  4UEM A;  3ETV A;  3P8C D;  1OXZ A;  4HEA A;  1MIV A;  2W63 A;  2XJ7 A;  3LK3 B;  3ZKR A;  2KND A;  2YDS A;  3OYX A;  4ILA A;  4TNV A;  4EZ4 A;  1VCS A;  3NBX X;  5FP3 A;  3ZN1 B;  4C90 A;  1WYB A;  3FZM B;  4O4L E;  5FL0 A;  4JI0 T;  5FY0 A;  2CXD A;  3AAE B;  3FXD B;  3P7I A;  4LF7 T;  4TX5 A;  3CX8 B;  1Z0P A;  3ONX A;  4ZI3 C;  2XQ6 A;  4H9P C;  1FIO A;  2EHO B;  4A98 A;  4Z8X A;  1X9B A;  2JQQ A;  1OED E;  2H89 A;  2HPJ A;  3V5U A;  3I9W A;  1OWA A;  3PDY A;  3MAC A;  1XWM A;  2LRL A;  4BJM A;  5L3E B;  5C3J A;  4I55 E;  4NPP A;  4AQG A;  4ZHQ E;  4KHZ F;  2LOP A;  4LFB T;  1X79 A;  5ABE A;  2A2F X;  3PTR B;  1CHU A;  4U7Y A;  4DV1 T;  4DO0 A;  1M7K A;  4JLE A;  3UU6 A;  5JDF A;  3HL6 A;  3FBL A;  2SPC A;  3P4Q A;  4NXM T;  3QC9 A;  1KF6 A;  2JMH A;  3B13 A;  4QX7 B;  5HEO A;  2BS4 A;  4I43 B;  3AE8 A;  3PUS A;  3D0T A;  3I9Y A;  1YKH B;  2V7M A;  3AAI A;  2PJQ A;  2CLY B;  4PFP A;  1CUN A;  2Y48 B;  4EOZ B;  1G73 A;  5ETW A;  4B3T T;  1J5W A;  4IRE A;  1WRD A;  1NWM X;  4KX6 A;  3AXJ B;  3AXJ A;  1HG2 A;  2CWY A;  3AEG A;  1NAF A;  2ZLY A;  4KI0 F;  2YDQ A;  2NP9 A;  4DR5 T;  2HHH T;  5KXJ A;  5CFB A;  3HKB E;  2FUP A;  4O4I E;  3Q9D A;  4ILU A;  4MLK A;  4FI5 A;  4E7Z A;  4G63 A;  2YEV C;  3AE6 A;  2JPF A;  5DQW A;  2CA5 A;  4XZC A;  4PJM A;  2K5B B;  1ZV4 X;  2D0U A;  3AE2 A;  5M4Y A;  3BK9 A;  4DV6 T;  1W0A A;  5H6Q B;  4CQI A;  2MOZ A;  5FMN A;  4DUY T;  3B5M A;  2XM2 A;  4O4H E;  2IAK A;  5HXC A;  3G06 A;  4YSZ A;  1XNR T;  3IF8 B;  3C4X A;  4MFR A;  2ZM6 T;  4AKH A;  2VKO A;  4JI6 T;  4AQF C;  2N9D A;  2WWU A;  2VB6 A;  2NW8 A;  3LDQ B;  3RGL A;  2V7K A;  1KNZ A;  4HTE A;  5HXS A;  4ZOL E;  5FVL A;  2WDQ A;  4X1I E;  2FJA A;  4DR2 T;  3P4W A;  4KMC A;  2LSG A;  3F31 A;  1YD8 G;  4TWF A;  2LKH A;  3ZT7 A;  2LSI A;  2OA5 A;  4QWN B;  2UXC T;  4LML A;  3RIU A;  5JR9 C;  4U2Z A;  1KNR A;  2JQH A;  3K8P C;  2QRX A;  2W66 A;  4B3M T;  3VKH A;  3ZCJ A;  2VWA A;  3O1J A;  1OED A;  4IDN A;  3A5X A;  1BR2 A;  1SE7 A;  1D1A A;  3ETU A;  5JDG A;  4CN6 A;  4JYA T;  2W62 A;  3AA0 B;  3N2G E;  4DID B;  1MMG A;  2DWG A;  3FZH B;  3BQK A;  3DJB A;  3QK6 A;  4UVA B;  3ZMU B;  4IDO A;  2YDR A;  4BAY B;  4WBO A;  4YTP A;  5KDM C;  1VRB A;  1Y01 A;  4NUV A;  1DU2 A;  4I4T E;  2UXB T;  1D0X A;  2LSJ A;  3EDV A;  1HG5 A;  2PG8 A;  4JI4 T;  2X9X A;  3GN5 B;  2J1D G;  3CPZ A;  1QSD A;  5AQU B;  2I0M A;  4TV8 E;  4CXX A;  4ZZC A;  2QGS A;  2CM0 A;  4L5G A;  2BKN A;  3AEF A;  3AE1 A;  2WQY A;  3J9X 1;  5HEG A;  2K3W A;  1WFD A;  4YJ2 E;  3AED A;  4QH4 A;  2C5K T;  5AQO B;  5JH7 E;  4P0A A;  4H63 V;  3NKZ A;  3ZLI A;  5L3C B;  1MIY A;  3SS1 A;  3ZEF B;  2KWI B;  4AKR B;  2Q9Q B;  4LMK A;  3QB5 K;  3PJA J;  4AIS A;  5CA0 E;  4JEH B;  2A72 A;  2VK9 A;  3N5L A;  4GOU A;  5AQV B;  3C98 B;  1WR0 A;  3VRB A;  3AA1 B;  3OVU A;  4P0B A;  3KVA A;  2PFV A;  3CVR A;  3N9O A;  4DR4 T;  4AKG A;  5AQN B;  4X1Y E;  4X62 T;  3WAJ A;  2XSA A;  3T8O A;  1LKX A;  1W9R A;  4UF0 A;  4U7I A;  3R6N A;  2JQ9 A;  4PAG A;  2J4G A;  1HF8 A;  3GMI A;  2XZE A;  4HFI A;  2UUA T;  4JI3 T;  2B76 A;  1T8B A;  2D5U A;  2MPK A;  1V9D A;  5EK3 A;  4WNK A;  5JDM A;  3ZYM A;  4UIG A;  3HR0 A;  1AJ3 A;  2W67 A;  1HFA A;  3P50 A;  4CI2 B;  5CA1 E;  2X68 A;  3F2E A;  3N9P A;  3M3Z B;  4IHJ E;  4UVC B;  5DJQ C;  2ZM8 A;  4IE0 A;  2F4V T;  1KFY A;  1W0B A;  2H88 A;  1KNP A;  3J7Y q;  2RA1 A;  4TZ4 C;  3OYZ A;  4TWH A;  1IJ5 A;  4ZEY A;  1NEK A;  3LBX A;  1UUS A;  4NXN T;  4CN4 A;  2J47 A;  4Q25 A;  4JEU B;  4JI7 T;  4O2A E;  5F5W A;  4H63 H;  5AQQ B;  4ANJ A;  3N9Q A;  2H7V C;  3MKD A;  5JTG A;  4MAL A;  3CML A;  3PE0 A;  2D2S A;  3L09 A;  2V6Y B;  4P09 A;  2BG9 B;  3RPU A;  5LBQ B;  5LG4 A;  3AB3 B;  3NWI A;  4UV9 B;  2B1E A;  4LF8 T;  4AI6 A;  2HN1 A;  1E7P A;  2M6B A;  4E7S A;  2WU5 A;  4OYJ A;  4X65 T;  3RYF E;  4CN1 A;  1I94 T;  2LHN A;  3QUJ A;  3RH3 A;  4IST A;  2V7L A;  2CCQ A;  4B3S T;  2YOE A;  1EZ3 A;  1MND A;  3O1H A;  5CJ5 A;  2WWV A;  3UU5 A;  4IL9 A;  2QVA A;  3NRY A;  2W2U A;  3SFE A;  1FEW A;  2IW5 B;  3FXE B;  2W4X A;  4H9Q C;  4GKK T;  5IUX A;  4PW8 A;  4DV0 T;  3NZQ A;  3MXZ A;  2CPT A;  3C4W A;  3OBV E;  4LF6 T;  2C5J A;  4YTN A;  4DV2 T;  4HFH A;  2LHR A;  2DL1 A;  4AKI A;  4KBM B;  4WZX A;  1UUR A;  2WP9 A;  5HAX A;  3ZCI A;  5J1G A;  2LT3 A;  5IWA T;  1N34 T;  2BS2 A;  4ZI2 D;  3AA7 B;  2LM9 A;  3KV6 A;  2LSK A;  5AQP B;  4L9I A;  2FJD A;  2D0T A;  2OLT A;  3RRC A;  5TAO A;  4HFB A;  4IGU A;  2YU2 A;  2CBJ A;  2VQE T;  3O1I A;  4ADZ A;  5LCY A;  3F57 A;  3AA6 B;  2Y8D A;  4JUY A;  3CWZ B;  2XY8 B;  1T72 A;  1XDO A;  2E9X C;  2WMO A;  2MYS A;  5ABH A;  5L3B B;  4FJO A;  2CE7 A;  4ASK A;  1JNZ A;  5CGM A;  3IA3 A;  2XPK A;  3AEE A;  4LMJ A;  3SRZ A;  4IE7 A;  1FMW A;  2IDO B;  4YT0 A;  3MK7 C;  3RKO A;  4AQY T;  2IC6 A;  5FY1 A;  5HCM A;  1Y64 B;  3LFM A;  4H9O C;  1BR4 A;  5AQS B;  1IBK T;  3PUV F;  3RC8 A;  3O9X A;  2OV9 A;  5JRC B;  3A7M A;  5JRC A;  2LLY A;  3Q5E A;  4O4J E;  1MNE A;  3ZJ2 A;  4HFV A;  3E22 E;  4JBW F;  1M62 A;  5HCJ A;  3TLT A;  4YFS A;  5AQL B;  2V1D B;  5LA6 E;  4AXP A;  1R8I A;  4KP3 C;  3K1S A;  3VRA A;  3C51 A;  1HX8 A;  4HE8 A;  1YKE B;  1N33 T;  3R84 B;  4HFC A;  2V8S V;  2UXX B;  4BA9 A;  2XAS B;  2BBJ A;  2ZM2 A;  4U2Y A;  3EVY A;  2ACX A;  3VHL A;  5BR8 T;  2A3D A;  4LF4 T;  3OJA A;  4JI2 T;  4QH5 A;  1UX4 A;  4PK6 A;  4KUM B;  2VQF T;  3EAM A;  3ZJ1 A;  2GK9 A;  3CIR A;  3A8Y C;  4ZI2 C;  1G8X A;  1N36 T;  3ZYK A;  2W00 A;  2J62 A;  2UUC T;  4A5X A;  4IE6 A;  4GYR A;  4ZZB A;  2CXF A;  4DND A;  4DR3 T;  3ABV A;  1FMV A;  2XM1 A;  5C2T A;  2EHO D;  3EAB A;  2CWO A;  2H3R A;  1SUM B;  2ODV A;  2LOS A;  2CMR A;  4TNW A;  5KX5 E;  1OED B;  2VL8 A;  1H7C A;  4O8S A;  4EZH A;  3C64 A;  2C5I T;  2W0G A;  3SFD A;  3ZMT B;  2BKO A;  4HFE A;  3AEB A;  2LM2 A;  2XQ8 A;  3CX7 B;  3AEA A;  4XAX B;  1MIW A;  3MJX A;  2XAG B;  1XMQ T;  5EZY E;  4X64 T;  4HKA A;  2NTX A;  4YJ3 E;  2WU2 A;  2YN6 A;  3W15 B;  2A9U A;  2L3L A;  2XQY A;  3Q5D A;  3GWH A;  4CI1 B;  1B7T A;  4AIU A;  2E5L T;  1WCR A;  2D9D A;  2HPL A;  3PU3 A;  3RX6 A;  4JI8 T;  3BQL A;  5HYA A;  2X51 A;  3PV0 F;  1XMO T;  1IAP A;  4LFA T;  3AE9 A;  2H7O A;  4DVD A;  1U5P A;  2YKS A;  3TKL B;  4DR1 T;  2X66 A;  5LHI B;  3TLS A;  3HKC E;  5L3G B;  2WB5 A;  1WLX A;  4U31 A;  5FXZ A;  5JRE A;  4UXN B;  4QKN A;  3H37 A;  1SA0 E;  1I6Z A;  2M6I A;  4HN9 A;  2V5D A;  2Y6X A;  3X1D A;  4WW0 A;  4YY3 T;  2BVL A;  4CXW A;  3EI0 A;  5JDQ A;  1UK5 A;  1XDP A;  4HFD A;  2ES0 A;  4YLH A;  2IUB A;  4AQF A;  1D0Y A;  3Q5W A;  5GON E;  5HEJ A;  3IEE A;  5LGU B;  3UUL A;  4O2B E;  2X9W A;  3ZMS B;  2V7J A;  5AFU L;  2V6X A;  3UFG A;  4EYU A;  5L3F B;  5LMU T;  4HGA A;  4K0U A;  2JIW A;  3UU4 A;  4CXY A;  2E2A A;  5FKY A;  4KHP T;  5AQM B;  3AE3 A;  3ANW B;  3N2K E;  3ANW A;  2WCA A;  3WAK A;  5AQI B;  4OK0 A;  5IYZ E;  4B3R T;  4IDQ A;  2ODU A;  4UV8 B;  3LSV A;  1S35 A;  4IE4 A;  3BQI A;  2X67 A;  1HTJ F;  4IL4 A;  4J2C A;  4K0K T;  1O3X A;  2JQK A;  4YHJ A;  5L4H A;  4UF0 B;  3RYC E;  4P1N A;  2EHO C;  3JCF A;  5JR9 A;  2ACZ A;  5LG3 A;  2W61 A;  5HEH A;  4QX8 B;  5C8Y E;  3UTK A;  3UU3 A;  4YSX A;  1D0Z A;  5HEU A;  3V5S A;  3HKE E;  3L39 A;  2PBI A;  2Z6E A;  2BKP A;  3IBP A;  2XQA A;  5DAB A;  4ZXL A;  2MAW A;  2N2N A;  3VKG A;  2YK0 A;  4DV3 T;  2HH7 A;  2DI4 A;  3QNU A;  4ZS3 A;  3Q2M A;  4EIW A;  2XQ3 A;  3RYI E;  4DR7 T;  4EGW A;  5FYM A;  3ZT5 A;  5L3D B;  4ZS2 A;  3KV4 A;  3PJA A;  5ADX L;  3ESL A;  5FXW A;  3MZK B;  2XUE A;  4PFO A;  2XQ5 A;  1LVK A;  3AE4 A;  1BR0 A;  2DHR A;  1J1J A;  5LXT E;  2QYW A;  4U3C A;  2E9X D;  1HCI A;  3JC6 D;  3LBX B;  2MBG A;  3CKD A;  4OYK A;  2LEH A;  3K3N A;  5ABF A;  3P4S A;  2XQ4 A;  2DNX A;  3AE7 A;  3SOL A;  2VAS A;  4CI3 B;  4HWD A;  2I59 A;  3AEC A;  2XAJ B;  2CLY C;  3U78 A;  2XSB A;  4ILB A;  1SHZ C;  3PUA A;  2VVN A;  4X66 T;  2M67 A;  4XBF B;  5AQF B;  1NEN A;  2I6H A;  2V26 A;  4ISS A;  4PK4 A;  4GK0 E;  5ABG A;  4V1A v;  1E2A A;  5FY7 A;  2QA7 A;  2UUB T;  1L0V A;  3ZMZ B;  4B6X A;  1HNX T;  4C91 A;  3FBZ A;  2LRK A;  3KBT A;  4HWF A;  2K24 A;  4DUZ T;  5AQT B;  3VR9 A;  5LJM A;  2PTF A;  4HWH A;  2CHN A;  3P4R A;  4DBQ A;  3L3P A;  5LJN A;  2E5V A;  3LK2 B;  4YXD A;  4TV9 E;  3ZC0 A;  2X9H A;  4AKL A;  5JVD E;  4OX9 T;  5HXE A;  1S94 A;  4OHF A;  4IT4 A;  5JDN A;  3H3A A;  2LKG A;  4Z91 A;  2G0U A;  2L9Q A;  2HN2 A;  2DWK A;  2YU1 A;  4EED A;  5EK2 A;  4U72 A;  4EYY R;  2NW7 A;  3RQU A;  3OTO T;  4LF5 T;  4QXC B;  4X20 E;  4I0U A;  2IHR 1;  2WAU A;  2EHO A;  3E0Z A;  2VKH A;  4BJN A;  2WS3 A;  4TUY E;  2UXN B;  3NRX A;  5LYJ E;  5KMG P;  1GQE A;  2Q9Q D;  2ZM0 A;  4MHC A;  5LMN T;  4G2A A;  5LP6 E;  5LBM A;  2FBW A;  3LJC A;  1JNR A;  3AAA B;  2DLR A;  3ONL C;  2LJL A;  4U33 A;  2WSS V;  2X0H A;  1VOM A;  3K3O A;  2K48 A;  3N9L A;  1IBM T;  3KDS E;  5J2U E;  4H9S E;  3UUM A;  4I50 E;  3CQX C;  3JC6 C;  5HWX A;  3PUZ F;  3KV9 A;  3RIU C;  3PU8 A;  3OPC A;  4PJJ A;  4X1K E;  1UCU A;  3P4P A;  4JI5 T;  1MMN A;  1U4Q A;  3FZL B;  1OED C;  2E8I A;  3JAF A;  5DQV A;  4PJL A;  2XTL A;  4EB6 E;  4F6R C;  2CBI A;  4WBN E;  3FHN A;  2WZH A;  4LFC T;  3AVS A;  3PUY F;  1ZKE A;  4QH1 A;  2WBL A;  3RHW A;  5EK4 A;  5FVK A;  5FXV A;  2WY2 A;  3RC3 A;  5LHG B;  2JJ9 A;  1MMA A;  2RP4 A;  3RF1 A;  4MBQ A;  4GK5 E;  5HXR A;  4EEB A;  1WYC A;  4NUU A;  2CHO A;  2KZ7 B;  5AQG B;  3EUH A;  2JMK A;  2KT9 A;  4ERR A;  2XQ7 A;  3RI5 A;  3CQG B;  2IML A;  4DV7 T;  2XAH B;  4YHH T;  2CXL A;  4M1P A;  1WR6 A;  5HXH A;  3OKQ A;  3C4Z A;  2L8K A;  3MA9 A;  2RPA A;  2MTQ A;  1VCT A;  2NTY A;  3I0Q A;  1YXR A;  4GYS A;  4PK5 A;  1QUU A;  2Q9Q C;  3VR8 A;  2WM9 A;  3QOF A;  3ZC1 A;  2KLQ A;  1N32 T;  3UUB A;  3C50 A;  2VKD A;  4TN7 B;  3PUW F;  2WZI A;  2X9Y A;  2IIU A;  2XAF B;  3WI3 A;  4GIW A;  3M65 A;  3TLU A;  3IHR A;  4IDZ A;  4QHO A;  4DMV A;  2NW9 A;  3ZN0 B;  1HR0 T;  3NZP A;  1ZHC A;  4F8H A;  1LVF A;  4H9N C;  3UQ4 A;  3VU7 H;  3KFW X;  3HI2 A;  2R6G F;  3ONJ A;  2BVM A;  5L2L A;  4H9R C;  5AQR B;  2UXD T;  1XZY A;  4N78 D;  2UU9 T;  1FJG T;  5JDH A;  3NVO A;  2E9X B;  2E9X A;  3CX6 B;  3RIF A;  4TWD A;  2BZB A;  3LK4 2;  2C0S A;  3ZSS A;  2LSY A;  3UU8 A;  4DV5 T;  1J5E T;  4UR9 A;  3AE5 A;  3LG7 A;  3JAD A;  5IHY A;  5FXX A;  2KMF A;  4QXB B;  5L47 A;  5L4E A;  1T7S A;  2BG9 E;  3UUX B;  3I1A A;  3CQC B;  2NOX A;  2AXD S;  2V7I A;  5F3J A;  3PUQ A;  3CK6 A;  1YQ3 A;  5A1L A;  4DMW A;  2XHE B;  3KBU A;  4Z90 A;  3N2O A;  3TLV A;  4DR6 T;  1D1B A;  4OFZ A;  5AQJ B;  2WDR A;  2ZMA A;  4UVB B;  5AQK B;  5LHH B;  4X5T A;  3ZYL A;  3SWH A;  4COF A;  3ZT6 A;  3GN5 A;  1W09 A;  1HNW T;  4GKJ T;  3EHZ A;  1YW0 A;  5H6R B;  5LGT B;  3DP7 A;  3UUN A;  5LGN B;  1QLB A;  1E1H B;  3HA4 A;  4WYV A;  5AQH B;  1T98 A;  3GA8 A;  2NWB A;  4DBR A;  3RKG A;  4A56 A; 
#chains in the Genus database with same CATH homology
 5LMU T;  2UU9 T;  5LMN T;  1FJG T;  1N33 T;  2VQE T;  1XMQ T;  4B3T T;  4LF8 T;  4KHP T;  4LF7 T;  4X64 T;  2UUA T;  4JI3 T;  4B3R T;  4X65 T;  4X66 T;  1IBL T;  4DV5 T;  4DR2 T;  3T1H T;  5BR8 T;  4K0K T;  1J5E T;  4LF4 T;  1I94 T;  2E5L T;  2UUB T;  4JI2 T;  4DR5 T;  2HHH T;  1IBM T;  1HNX T;  4DV7 T;  4B3S T;  4JI8 T;  2UXC T;  4JI1 T;  2UXD T;  2VQF T;  4YHH T;  1XMO T;  4DUZ T;  1HNZ T;  4LF9 T;  4JV5 T;  2F4V T;  4LFA T;  4DV3 T;  1N36 T;  1XNQ T;  4B3M T;  4DR1 T;  2UUC T;  4DR7 T;  4DR6 T;  4LFB T;  4AQY T;  4JI5 T;  4DR3 T;  4JYA T;  4NXN T;  4GKK T;  4OX9 T;  1N32 T;  4DV1 T;  4DV6 T;  4JI7 T;  4DV0 T;  1IBK T;  1HNW T;  4LF6 T;  4YY3 T;  4GKJ T;  4DV2 T;  4DUY T;  4DV4 T;  1HR0 T;  3T1Y T;  3OTO T;  4NXM T;  4LF5 T;  4DR4 T;  4LFC T;  2UXB T;  4X62 T;  5IWA T;  1N34 T;  1XNR T;  2ZM6 T;  4JI4 T;  4JI0 T;  4JI6 T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...