4DV2T

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, c912a
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
total genus 33
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 4dv2T00
2F4VT 4JI3T 4LFAT 4LFCT 4NXNT 1IBMT 4GKKT 4DR3T 4B3TT 4KHPT 2UU9T 1N32T 4JI6T 4JI8T 1HNXT 4DUYT 4LF4T 4LF8T 4B3RT 4DV1T 4B3MT 2UUAT 2UUBT 4OX9T 4JI4T 1FJGT 4DR6T 4JI2T 2UXBT 4AQYT 4DUZT 1IBKT 4DR1T 5BR8T 2E5LT 3T1YT 4LF6T 2UUCT 4NXMT 2ZM6T 2UXCT 4X64T 4JI1T 4X65T 3T1HT 1XNRT 4JI5T 1J5ET 4X62T 1N33T 4DV2T 4B3ST 4DV0T 4JV5T 1XMOT 4DR2T 1I94T 4K0KT 1XNQT 4LFBT 4DV5T 3OTOT 4YY3T 2HHHT 4DV7T 4X66T 2VQET 4JI0T 1HR0T 2UXDT 4DR7T 4DV3T 4DR5T 4GKJT 2VQFT 4LF7T 4JI7T 1N34T 1IBLT 5LMUT 4JYAT 4DV6T 1HNWT 4LF5T 1HNZT 5LMNT 1N36T 4LF9T 4DV4T 4DR4T 4YHHT 5IWAT 1XMQT
chains in the Genus database with same CATH superfamily
3ZT5A 1IJ5A 3RIUC 2L9QA 4UELA 3GN5A 4KI0F 4ZS2A 4O4IE 1E7PA 4HTEA 4JI6T 2LKHA 4LF4T 2D0TA 5CA0E 3WAJA 4EV6A 4IREA 2LOSA 2LKGA 5CA1E 5AFUL 2UUBT 2CM0A 1E1HB 1LRZA 3G06A 1BR2A 4PK6A 3H37A 4XBFB 2D9DA 4QXHB 4U3CA 2E5LT 3PUGA 2W0GA 2ZM6T 3ZYLA 5L3BB 3ZSSA 3BK9A 3ZYKA 2E9XC 3J9X1 2XAHB 2BKOA 3PV0F 4DV7T 2XQ7A 2CCQA 4O2AE 3FZMB 3JC6D 3EDVA 3AE4A 4EXTA 4B6XA 5L3CB 4MBQA 3VKGA 4P09A 1Y64B 3ZEFB 3K3QC 3N2OA 1T98A 2LSGA 4YXDA 2BVMA 4DV4T 2D5UA 3AVRA 3EI0A 2EHOB 2NW7A 2V6YB 3CMLA 4CQIA 3RGLA 2XM1A 4JI8T 4H63H 3LDQB 4F6RC 2V6XA 4DMVA 3CWZB 3O1HA 2K48A 4COFA 3N9NA 2JQKA 5KXJA 3K8PC 2C5IT 5H6QB 5KMGP 2FBWA 1D1AA 2WDRA 2ZLYA 1UCUA 5KDMC 2XQ9A 4DVDA 1QSDA 1JNZA 3N9OA 3PJAA 3IA3A 3UFEA 2W63A 1Y01A 2CLYC 3FXDB 2AE9A 5FVKA 4EEDA 4DR7T 3N2KE 2WQYA 3IF8B 4TN7B 5L4EA 2A3DA 4JYAT 4BAYB 4P0AA 2ZMAA 4ILCA 3AEEA 5TAOA 1Z0PA 5C3JA 3KBUA 3SWHA 4F8HA 2BS2A 4TV9E 3EABA 2EHOA 4HFCA 2V6YA 4CI1B 5DQVA 2LJLA 3VR9A 2CHNA 3CQXC 4ERRA 2XSBA 3AXJA 4GOUA 2KWIB 4Z91A 5L3DB 3MACA 4TX5A 5JVDE 3N9LA 1MIYA 1HX8A 2RP4A 1ZV4X 3PTRB 2I0MA 5JR9C 3C98B 3RPUA 4OX9T 1HS7A 4IDZA 3NZPA 4JI2T 3AE5A 4DR1T 5LGNB 2Q9QD 4L9IA 3VKHA 4UV8B 4EYYR 5C2TA 5JTGA 4GYRA 2I6HA 3AE1A 3DTOA 3JADA 4JI5T 3ABVA 4ANJA 4CI3B 4JV5T 3Q5DA 1CUNA 3AVSA 2CPTA 4OK0A 3O9XA 1V9DA 3KBTA 5LHHB 2KLQA 4JI0T 4C91A 2H7OA 3IBPA 2CBJA 3P4RA 4A5XA 2IC9A 4AQFC 2XAQB 2XJ7A 4QWNB 2WSSV 2VURA 3N9PA 1W09A 3NZQA 2W00A 1GQEA 3AE3A 3F2EA 1H7CA 1WR6A 4J2CA 2MYSA 3CK6A 4PNIA 2KWHA 4LFAT 4KP3C 5LYJE 2L3LA 2CXFA 4B3TT 3E22E 2E5VA 4KHPT 2WS3A 2UU9T 3RLFF 4ILBA 2WDVA 1VCSA 3C51A 3FB2A 1XDPA 5FKYA 3UULA 2DNXA 3OYXA 5AQMB 1E2AA 3MA9A 3VR8A 2XPKA 2ES0A 3LK42 1SE7A 4ZI2C 4AIUA 5AQSB 4DUZT 2BBJA 3L09A 2B1EA 2HN1A 2RA1A 2XQ3A 3BQLA 3AEBA 3UFGA 1KFYA 5BR8T 2XQ4A 4H9SE 2LHRA 2KMFA 3AEDA 2UXCT 4NUUA 3I9WA 3AA7B 1J5ET 3ONLC 4B3ST 4DR2T 3K3NA 5JDHA 1T7SA 4BJMA 3OJAA 3OTOT 3LSVA 5LGUB 2WCAA 3Q5XA 1OEDB 1BR4A 3AE2A 3TLSA 5AQPB 4HGAA 2CMRA 3RC8A 3RRCA 3I1AA 1MMAA 3UU5A 1N34T 4H63V 1IBLT 5LMUT 4UV9B 1ZKEA 1SUMB 2VB6A 4YJ2E 4CXWA 2HH7A 3SOLA 2CBIA 1XWMA 2FJAA 3LFMA 5JDLA 2YN6A 3AAIA 5FXVA 4IE4A 5ABGA 2FJBA 3PE0A 4UVAB 3AB3B 4O4HE 2LSIA 4LMLA 3WI3A 2QGSA 3B57A 3CX6B 1D0XA 5AQOB 2IMLA 3A8YC 2IHR1 3R84B 3NKZA 2WP9A 5FP3A 5LXTE 5JQGE 3RYFE 5HCJA 1MNEA 2IDOB 5JRCA 3S4UA 2E9XB 3SRZA 2CXDA 1VOMA 3PUVF 1I6ZA 5J1GA 3FXEB 3L3PA 5AQKB 4GK5E 2VWAA 5LGTB 4DV5T 4UR9A 1HG2A 3EUHA 2YU2A 2WZHA 4L0RA 2WY2A 2UXDT 1UGOA 5HWYA 4AKIA 5AQRB 3ZJ2A 2XQYA 4JI7T 2C0SA 2XAGB 1JNRA 3RIUA 1IAPA 5FYMA 2J47A 3NBXX 2BDEA 2LEHA 3FBLA 3MXZA 3O1IA 4JEUB 3JCFA 2DWKA 2XHEB 4WNKA 1OWAA 2CEAA 4IT4A 5LBMA 2VVNA 1X79A 2C5JA 1OEDC 3I0QA 4XAXB 3NRXA 4U74A 2JIWA 5AQFB 4NXNT 4CZZB 2UXXB 5FY0A 3JC6C 5LJMA 4QH5A 1HG5A 4B3MT 3C4ZA 4JI4T 4E7ZA 2DWGA 4TWDA 5FNVE 4AQYT 5JDMA 4EZHA 2ZM0A 5JDNA 4HWFA 4HWHA 3VU7H 1S94A 3QB5A 5HXSA 2MOZA 2CLYB 3C4XA 2JPFA 4DO0A 3BQKA 3TLUA 3PU8A 5LBQB 2H3RA 3WAKA 4AI6A 3RH3A 5AQJB 2L8KA 3UT5E 3IEEA 3L39A 2XQ6A 3A5XA 2XQAA 4PJMA 3PUWF 3P4QA 4O4LE 3QC9A 3RHWA 2WWUA 1BR1A 3UUMA 1L0VA 5IUXA 4ILAA 4ZOLE 5H6RB 5CGMA 5L4HA 5FXWA 1IBMT 3EVYA 4YHJA 5JR9B 3K1SA 4I43B 1HNXT 5ADXL 2FJDA 5LCYA 1LVFA 4A98A 4DIDB 4V1Av 2K3WA 5HEHA 5FY1A 4O8SA 2X51A 2A9UA 3O4XE 2CRBA 4JBWF 2VL0A 2UUCT 2KINB 1R8IA 4YT0A 1HF8A 3RYIE 5GONE 1XNRT 2BZBA 3P4SA 4ZI3D 5L3EB 4ZS3A 4X66T 5HEUA 3TKLB 1VRBA 3AECA 3ZLIA 3Q9DA 4IDNA 5FL0A 1WRDA 1HR0T 4CI2B 3RKOA 4H9QC 2JQQA 4I55E 3ZCJA 4GKJT 3EDUA 2BS3A 2KT9A 2X66A 4QHOA 3CX7B 4AQGA 2H7VC 3CVRA 2H89A 1HX1B 3GA8A 3OPCA 3R6NA 4X5TA 2Q9QC 3QK6A 4DBQA 2VKDA 4M1PA 4N78D 2LSYA 5F8PA 5HEJA 3ZMUB 5JR9A 4DR4T 2WMOA 2HN2A 2B76A 4LFCT 5JDFA 4HFVA 5AQTB 4GKKT 3P8CD 1FIOA 2PG8A 2YK0A 4DV1T 2C5KT 2ZM2A 4AKRB 3UU6A 4U7IA 2KSRA 1KEYA 1W0BA 5AQVB 5AQQB 3NRYA 3P7IA 4E7SA 2JMKA 4QKNA 2UXNB 2BKPA 4DMWA 1S35A 5M4YA 4EZ4A 2XQ8A 5FMNA 2CA5A 4UF0B 4UVBB 1KK7A 3Q5WA 2YDSA 4AQFA 4YFSA 1MNDA 2M67A 2ZM8A 4HFBA 4IL4A 5L2LA 1N33T 3W15B 4FJOA 3B13A 5EK3A 2VQET 2LT3A 1FMVA 3FZHB 5FXZA 3FZLB 1YKEB 1B7TA 2DCFA 2XY8B 1T8BA 3LBXB 3ZMSB 4UEMA 1FEWA 2QVAA 3ZPOA 3MZKB 3AAAB 1MIVA 2BKNA 2BS4A 2WU2A 2R6GF 5JREA 3KV9A 2BBHA 3LK2B 2DLRA 3HKBE 3FBZA 2V1DB 4MALA 4YSYA 2BG9C 4WYVA 4OFZA 4QH4A 5IWAT 1XMQT 1YXRA 3RI5A 4TNVA 3RF1A 4NUVA 4DUYT 3Q2MA 2CHOA 4XZCA 2DL1A 4B3RT 4ISTA 1HTJF 3FHNA 2X9YA 4TWHA 2WZIA 4CXXA 3VRAA 2V8SV 2E8IA 3NWIA 5AQHB 1MMGA 1M7KA 3ZMTB 4WBOA 3AA6B 5AQLB 4DV2T 2NR4A 3KV6A 4X20E 3UUBA 2HHHT 1WLXA 4YTNA 1YW0A 2EHOD 2V7KA 3P4WA 4H9PC 3VRBA 5C8YE 5JDGA 3BQIA 5AQGB 2JMHA 4LF7T 3IHRA 5HEOA 3LK3B 4PFOA 2XUEA 4HFIA 1ZEEA 3AE7A 2JRKA 3KFWX 5ABFB 2VVSA 3AE6A 4Z90A 4ILUA 5LMNT 1D0ZA 3JAEA 3L8RA 3OYZA 1J5WA 1QUUA 4PJJA 2YDQA 4HN9A 3H3AA 4JEHB 2M6BA 3RIFA 4YSZA 2WMNA 1D1BA 2JQHA 4BJNA 3RQUA 4HFEA 4OHFA 5L3FB 4O2BE 4I0UA 5AQIB 2XQ5A 3CIRA 4NXMT 3RC3A 2HPLA 3E08A 2IC6A 5ABEA 1YD8G 4FI5A 3ONJA 5DQWA 1ZHCA 3QNUA 5HXRA 4HEAA 2QA7A 2VASA 2LOPA 1QLBA 4NPPA 4P0BA 3TLTA 3HA4A 5E0OA 4PJNA 4YSXA 3LJCA 1KF6A 2LLYA 4YLHA 2YKSA 2J1DG 4AISA 5ABFA 5DJQC 1OEDA 4AKHA 3D0TA 4IGUA 4Q25A 3Q5EA 2CXLA 3EAMA 3N2GE 3GN5B 3E0ZA 2XM2A 2N1GA 2H88A 1OXZA 3FZFB 4CN4A 1VCTA 4TV8E 3HR0A 5F5WA 4U2YA 1WYBA 4KX6A 2MTQA 2X9WA 1N32T 2Y8DA 3UUXB 2SPCA 1SA0E 3AE9A 5HYAA 3I0OA 5LB7B 3CQGB 3TLWA 5HAXA 3PUZF 5HXCA 4EYUA 4TUYE 1U4QA 2XTLA 3QB5K 3U78A 2AXDS 3JAFA 2M6IA 1IBKT 5LP6E 2MPKA 3T1YT 5F3JA 4IE0A 4KHZF 3HKDE 5LHIB 1OEDE 3O1JA 4X62T 3ZMZB 4HWDA 2E9XA 2V7LA 1XDOA 5HEGA 4ZHQE 2LHNA 5FY7A 1M62A 3KVBA 5CB4E 2V26A 3CKDA 1NWMX 1LVKA 4DR5T 3V5UA 3AE8A 3ONXA 1IZNB 1G8XA 3QUJA 4ISSA 4EGWA 4KMCA 2Q9QB 2Z6EA 3VHLA 1DU2A 1YQ3A 1O3XA 5BMVE 3UU4A 3KV4A 4UVCB 3ZJ1A 2X0LB 2CE7A 1G73A 1UK5A 2QRXA 4DBRA 2V7JA 2F4VT 4CN1A 4U33A 4ZI3C 4I50E 3KDSE 3OVUA 4A97A 5L3GB 1MMNA 2BVLA 4IL9A 4PW8A 2VK9A 3C50A 2DI4A 3RYHE 2UUAT 3ZN0B 4GK0E 2V5CA 4X1YE 3ANWB 4P1NA 2OA5A 5LG3A 4U2ZA 3RX6A 1MIWA 2MAWA 4L5GA 4TWFA 2LE8A 4JUYA 4A56A 3T8OA 1BR0A 4ZXLA 4X64T 3GWHA 4JI1T 5ABHA 2Y48B 4UXNB 5J2UE 4ZZBA 4EAHA 4DV0T 1XMOT 1I94T 2NTXA 2NW9A 3ZCIA 4YY3T 5FVLA 2X67A 4PK5A 4ZZCA 4IE7A 4AXPA 2Q9QA 2WWVA 5EK4A 5HWXA 2WDQA 3AEFA 4IDQA 4EB6E 3PUAA 2A72A 2D2SA 2KXPB 4EIWA 5LG4A 1HCIA 1W9RA 2BG9B 2V5DA 3AXJB 3RYCE 4IDPA 1N36T 2I59A 4LF9T 2E9XD 4LMKA 3OKQA 3UU3A 2W66A 5FL1A 2X0YA 4IE6A 4IE5A 4HFDA 3CX8B 3UQ7A 4QX8B 4YTPA 3ANWA 2KZ7B 3M65A 3DJBA 3K3OA 3F57A 5HCMA 3X1DA 1D1CA 2V7IA 1KNZA 3PU3A 5AQUB 2YDRA 2KNDA 3ZT6A 4HFHA 4TZ4C 2HPJA 1NAFA 1ZP0A 3F31A 2DHRA 5HXHA 3P50A 3AEGA 3AA1B 5AQNB 4NIQA 2N2NA 2K9AA 1XNQT 2LRLA 4CXYA 2LSKA 4OYKA 1UURA 3PURA 5A1LA 4DV3T 4ZI7E 2VQFT 2J62A 5EK2A 4ASKA 1D0YA 4EEBA 2BG9A 3I9YA 2IW5B 5CJ5A 4DNDA 1YQ4A 1IJ6A 4MFRA 1HNWT 4UIGA 2G0UA 2NOXA 2QYWA 2FJEA 1WCRA 1KNRA 2JJ9A 4IIJE 2IUBA 3PDYA 1UX5A 3TLVA 4HWCA 4K0UA 2Y6XA 4MLKA 4MHCA 2MBGA 2EHOC 1WFDA 5LOVE 4YTMA 4Z8XA 4DR6T 4WW0A 2V7MA 1US7B 3SFEA 3A7MA 2OLTA 3UU8A 2FUPA 3P4PA 3ZC1A 3MJXA 2XZEA 4WZXA 2BG9E 4X65T 3UQ4A 2XSAA 4UF0A 3HI2A 4K0KT 2PFVA 1EZ3A 2K24A 3ESLA 4HE8A 3SS1A 1HFAA 4I4TE 4PK4A 3SFDA 3ZC0A 4U31A 2CWOA 3CQCB 3MKDA 4KUMB 2NP9A 2WBLA 3J7Yq 3ETVA 3N9MA 1NENA 4QXCB 4OYJA 4HKAA 3RQWA 2NWBA 4DV6T 5HXEA 4C90A 3U3IA 3H3MA 3ZN1B 4LF5T 4WBNE 3LBXA 4ZEYA 4EOZB 1X9BA 4BA9A 4KBMB 4QH1A 3M3ZB 4ADZA 2VKOA 2X0HA 2LM9A 1UX4A 3UTKA 5L47A 4U7YA 2X9XA 3PJAJ 5DABA 2P9BA 5ETWA 1ZOYA 4HWIB 4DR3T 2YOEA 2OV9A 5LA6E 4LF8T 4X1IE 2VKJA 1KNPA 5JRCB 3HL6A 1FJGT 3PUXF 2IIUA 4AKLA 1T72A 1U5PA 2ACXA 2LM2A 5LHGB 3RIAA 5EZYE 2WM9A 3MK7C 2W4XA 3PUYF 2XAFB 3CPZA 2XASB 2NW8A 2CWYA 2YINA 4LFBT 2LRKA 4LMJA 2W62A 3KV5A 4CN6A 1LKXA 1W0AA 3AAEB 1MMDA 2W2UA 4GYSA 2D0UA 1UUSA 4PJLA 3OBVE 5J0ZA 4U72A 3ZT7A 3UUNA 5LJNA 2VKHA 2PJQA 4TNWA 4ZI2D 3EHZA 2ACZA 1SHZC 4YJ3E 2GK9A 2A2FX 1HNZT 3RRWA 4H9NC 3DP7A 2NTYA 1FMWA 3KVAA 3ETUA 4YHHT 3KINB 5IHYA 4JI3T 1YKHB 3NVOA 4G2AA 3V5SA 5LNKA 5JDQA 5J2TE 1XZYA 3C4WA 4QX7B 3ZKRA 4IDOA 2PTFA 2N9DA 2XAJB 3ZYMA 2YEVC 5CFBA 1WR0A 2RPAA 4GIWA 2UXBT 1CHUA 3C64A 2W67A 3B5MA 3GMIA 2K5BB 4IHJE 3PUQA 5IYZE 4LF6T 2JQ9A 3ZSTA 3AEAA 1Z8UA 2X68A 3HKCE 3LG7A 2LSJA 1J1JA 4H9OC 3T1HT 2YU1A 5KX5E 3PUSA 3RKGA 4QXBB 4PAGA 4O4JE 4X1KE 3AA0B 4PFPA 2WB5A 2WU5A 3HKEE 3N9QA 3FZKB 3N5LA 5FXXA 5JH7E 2VL8A 4JLEA 2ODUA 2E2AA 2W61A 2IAKA 2WAUA 4G63A 3QOFA 2PBIA 1WYCA 3ZMVB 2ODVA 4AKGA 1NEKA 4H9RC 2J4GA 1AJ3A 2X9HA
chains in the Genus database with same CATH topology
2F4VT 4JI3T 4LFAT 4LFCT 4NXNT 1IBMT 4GKKT 4DR3T 4B3TT 4KHPT 2UU9T 1N32T 4JI6T 4JI8T 1HNXT 4DUYT 4LF4T 4LF8T 4B3RT 4DV1T 4B3MT 2UUAT 2UUBT 4OX9T 4JI4T 1FJGT 4DR6T 4JI2T 2UXBT 4AQYT 4DUZT 1IBKT 4DR1T 5BR8T 2E5LT 3T1YT 4LF6T 2UUCT 4NXMT 2ZM6T 2UXCT 4X64T 4JI1T 4X65T 3T1HT 1XNRT 4JI5T 1J5ET 4X62T 1N33T 4DV2T 4B3ST 4DV0T 4JV5T 1XMOT 4DR2T 1I94T 4K0KT 1XNQT 4LFBT 4DV5T 3OTOT 4YY3T 2HHHT 4DV7T 4X66T 2VQET 4JI0T 1HR0T 2UXDT 4DR7T 4DV3T 4DR5T 4GKJT 2VQFT 4LF7T 4JI7T 1N34T 1IBLT 5LMUT 4JYAT 4DV6T 1HNWT 4LF5T 1HNZT 5LMNT 1N36T 4LF9T 4DV4T 4DR4T 4YHHT 5IWAT 1XMQT
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F4V T;  4JI3 T;  4LFA T;  4LFC T;  4NXN T;  1IBM T;  4GKK T;  4DR3 T;  4B3T T;  4KHP T;  2UU9 T;  1N32 T;  4JI6 T;  4JI8 T;  1HNX T;  4DUY T;  4LF4 T;  4LF8 T;  4B3R T;  4DV1 T;  4B3M T;  2UUA T;  2UUB T;  4OX9 T;  4JI4 T;  1FJG T;  4DR6 T;  4JI2 T;  2UXB T;  4AQY T;  4DUZ T;  1IBK T;  4DR1 T;  5BR8 T;  2E5L T;  3T1Y T;  4LF6 T;  2UUC T;  4NXM T;  2ZM6 T;  2UXC T;  4X64 T;  4JI1 T;  4X65 T;  3T1H T;  1XNR T;  4JI5 T;  1J5E T;  4X62 T;  1N33 T;  4DV2 T;  4B3S T;  4DV0 T;  4JV5 T;  1XMO T;  4DR2 T;  1I94 T;  4K0K T;  1XNQ T;  4LFB T;  4DV5 T;  3OTO T;  4YY3 T;  2HHH T;  4DV7 T;  4X66 T;  2VQE T;  4JI0 T;  1HR0 T;  2UXD T;  4DR7 T;  4DV3 T;  4DR5 T;  4GKJ T;  2VQF T;  4LF7 T;  4JI7 T;  1N34 T;  1IBL T;  5LMU T;  4JYA T;  4DV6 T;  1HNW T;  4LF5 T;  1HNZ T;  5LMN T;  1N36 T;  4LF9 T;  4DV4 T;  4DR4 T;  4YHH T;  5IWA T;  1XMQ T; 
#chains in the Genus database with same CATH topology
 3ZT5 A;  1IJ5 A;  3RIU C;  2L9Q A;  4UEL A;  3GN5 A;  4KI0 F;  4ZS2 A;  4O4I E;  1E7P A;  4HTE A;  4JI6 T;  2LKH A;  4LF4 T;  2D0T A;  5CA0 E;  3WAJ A;  4EV6 A;  4IRE A;  2LOS A;  2LKG A;  5CA1 E;  5AFU L;  2UUB T;  2CM0 A;  1E1H B;  1LRZ A;  3G06 A;  1BR2 A;  4PK6 A;  3H37 A;  4XBF B;  2D9D A;  4QXH B;  4U3C A;  2E5L T;  3PUG A;  2W0G A;  2ZM6 T;  3ZYL A;  5L3B B;  3ZSS A;  3BK9 A;  3ZYK A;  2E9X C;  3J9X 1;  2XAH B;  2BKO A;  3PV0 F;  4DV7 T;  2XQ7 A;  2CCQ A;  4O2A E;  3FZM B;  3JC6 D;  3EDV A;  3AE4 A;  4EXT A;  4B6X A;  5L3C B;  4MBQ A;  3VKG A;  4P09 A;  1Y64 B;  3ZEF B;  3K3Q C;  3N2O A;  1T98 A;  2LSG A;  4YXD A;  2BVM A;  4DV4 T;  2D5U A;  3AVR A;  3EI0 A;  2EHO B;  2NW7 A;  2V6Y B;  3CML A;  4CQI A;  3RGL A;  2XM1 A;  4JI8 T;  4H63 H;  3LDQ B;  4F6R C;  2V6X A;  4DMV A;  3CWZ B;  3O1H A;  2K48 A;  4COF A;  3N9N A;  2JQK A;  5KXJ A;  3K8P C;  2C5I T;  5H6Q B;  5KMG P;  2FBW A;  1D1A A;  2WDR A;  2ZLY A;  1UCU A;  5KDM C;  2XQ9 A;  4DVD A;  1QSD A;  1JNZ A;  3N9O A;  3PJA A;  3IA3 A;  3UFE A;  2W63 A;  1Y01 A;  2CLY C;  3FXD B;  2AE9 A;  5FVK A;  4EED A;  4DR7 T;  3N2K E;  2WQY A;  3IF8 B;  4TN7 B;  5L4E A;  2A3D A;  4JYA T;  4BAY B;  4P0A A;  2ZMA A;  4ILC A;  3AEE A;  5TAO A;  1Z0P A;  5C3J A;  3KBU A;  3SWH A;  4F8H A;  2BS2 A;  4TV9 E;  3EAB A;  2EHO A;  4HFC A;  2V6Y A;  4CI1 B;  5DQV A;  2LJL A;  3VR9 A;  2CHN A;  3CQX C;  4ERR A;  2XSB A;  3AXJ A;  4GOU A;  2KWI B;  4Z91 A;  5L3D B;  3MAC A;  4TX5 A;  5JVD E;  3N9L A;  1MIY A;  1HX8 A;  2RP4 A;  1ZV4 X;  3PTR B;  2I0M A;  5JR9 C;  3C98 B;  3RPU A;  4OX9 T;  1HS7 A;  4IDZ A;  3NZP A;  4JI2 T;  3AE5 A;  4DR1 T;  5LGN B;  2Q9Q D;  4L9I A;  3VKH A;  4UV8 B;  4EYY R;  5C2T A;  5JTG A;  4GYR A;  2I6H A;  3AE1 A;  3DTO A;  3JAD A;  4JI5 T;  3ABV A;  4ANJ A;  4CI3 B;  4JV5 T;  3Q5D A;  1CUN A;  3AVS A;  2CPT A;  4OK0 A;  3O9X A;  1V9D A;  3KBT A;  5LHH B;  2KLQ A;  4JI0 T;  4C91 A;  2H7O A;  3IBP A;  2CBJ A;  3P4R A;  4A5X A;  2IC9 A;  4AQF C;  2XAQ B;  2XJ7 A;  4QWN B;  2WSS V;  2VUR A;  3N9P A;  1W09 A;  3NZQ A;  2W00 A;  1GQE A;  3AE3 A;  3F2E A;  1H7C A;  1WR6 A;  4J2C A;  2MYS A;  3CK6 A;  4PNI A;  2KWH A;  4LFA T;  4KP3 C;  5LYJ E;  2L3L A;  2CXF A;  4B3T T;  3E22 E;  2E5V A;  4KHP T;  2WS3 A;  2UU9 T;  3RLF F;  4ILB A;  2WDV A;  1VCS A;  3C51 A;  3FB2 A;  1XDP A;  5FKY A;  3UUL A;  2DNX A;  3OYX A;  5AQM B;  1E2A A;  3MA9 A;  3VR8 A;  2XPK A;  2ES0 A;  3LK4 2;  1SE7 A;  4ZI2 C;  4AIU A;  5AQS B;  4DUZ T;  2BBJ A;  3L09 A;  2B1E A;  2HN1 A;  2RA1 A;  2XQ3 A;  3BQL A;  3AEB A;  3UFG A;  1KFY A;  5BR8 T;  2XQ4 A;  4H9S E;  2LHR A;  2KMF A;  3AED A;  2UXC T;  4NUU A;  3I9W A;  3AA7 B;  1J5E T;  3ONL C;  4B3S T;  4DR2 T;  3K3N A;  5JDH A;  1T7S A;  4BJM A;  3OJA A;  3OTO T;  3LSV A;  5LGU B;  2WCA A;  3Q5X A;  1OED B;  1BR4 A;  3AE2 A;  3TLS A;  5AQP B;  4HGA A;  2CMR A;  3RC8 A;  3RRC A;  3I1A A;  1MMA A;  3UU5 A;  1N34 T;  4H63 V;  1IBL T;  5LMU T;  4UV9 B;  1ZKE A;  1SUM B;  2VB6 A;  4YJ2 E;  4CXW A;  2HH7 A;  3SOL A;  2CBI A;  1XWM A;  2FJA A;  3LFM A;  5JDL A;  2YN6 A;  3AAI A;  5FXV A;  4IE4 A;  5ABG A;  2FJB A;  3PE0 A;  4UVA B;  3AB3 B;  4O4H E;  2LSI A;  4LML A;  3WI3 A;  2QGS A;  3B57 A;  3CX6 B;  1D0X A;  5AQO B;  2IML A;  3A8Y C;  2IHR 1;  3R84 B;  3NKZ A;  2WP9 A;  5FP3 A;  5LXT E;  5JQG E;  3RYF E;  5HCJ A;  1MNE A;  2IDO B;  5JRC A;  3S4U A;  2E9X B;  3SRZ A;  2CXD A;  1VOM A;  3PUV F;  1I6Z A;  5J1G A;  3FXE B;  3L3P A;  5AQK B;  4GK5 E;  2VWA A;  5LGT B;  4DV5 T;  4UR9 A;  1HG2 A;  3EUH A;  2YU2 A;  2WZH A;  4L0R A;  2WY2 A;  2UXD T;  1UGO A;  5HWY A;  4AKI A;  5AQR B;  3ZJ2 A;  2XQY A;  4JI7 T;  2C0S A;  2XAG B;  1JNR A;  3RIU A;  1IAP A;  5FYM A;  2J47 A;  3NBX X;  2BDE A;  2LEH A;  3FBL A;  3MXZ A;  3O1I A;  4JEU B;  3JCF A;  2DWK A;  2XHE B;  4WNK A;  1OWA A;  2CEA A;  4IT4 A;  5LBM A;  2VVN A;  1X79 A;  2C5J A;  1OED C;  3I0Q A;  4XAX B;  3NRX A;  4U74 A;  2JIW A;  5AQF B;  4NXN T;  4CZZ B;  2UXX B;  5FY0 A;  3JC6 C;  5LJM A;  4QH5 A;  1HG5 A;  4B3M T;  3C4Z A;  4JI4 T;  4E7Z A;  2DWG A;  4TWD A;  5FNV E;  4AQY T;  5JDM A;  4EZH A;  2ZM0 A;  5JDN A;  4HWF A;  4HWH A;  3VU7 H;  1S94 A;  3QB5 A;  5HXS A;  2MOZ A;  2CLY B;  3C4X A;  2JPF A;  4DO0 A;  3BQK A;  3TLU A;  3PU8 A;  5LBQ B;  2H3R A;  3WAK A;  4AI6 A;  3RH3 A;  5AQJ B;  2L8K A;  3UT5 E;  3IEE A;  3L39 A;  2XQ6 A;  3A5X A;  2XQA A;  4PJM A;  3PUW F;  3P4Q A;  4O4L E;  3QC9 A;  3RHW A;  2WWU A;  1BR1 A;  3UUM A;  1L0V A;  5IUX A;  4ILA A;  4ZOL E;  5H6R B;  5CGM A;  5L4H A;  5FXW A;  1IBM T;  3EVY A;  4YHJ A;  5JR9 B;  3K1S A;  4I43 B;  1HNX T;  5ADX L;  2FJD A;  5LCY A;  1LVF A;  4A98 A;  4DID B;  4V1A v;  2K3W A;  5HEH A;  5FY1 A;  4O8S A;  2X51 A;  2A9U A;  3O4X E;  2CRB A;  4JBW F;  2VL0 A;  2UUC T;  2KIN B;  1R8I A;  4YT0 A;  1HF8 A;  3RYI E;  5GON E;  1XNR T;  2BZB A;  3P4S A;  4ZI3 D;  5L3E B;  4ZS3 A;  4X66 T;  5HEU A;  3TKL B;  1VRB A;  3AEC A;  3ZLI A;  3Q9D A;  4IDN A;  5FL0 A;  1WRD A;  1HR0 T;  4CI2 B;  3RKO A;  4H9Q C;  2JQQ A;  4I55 E;  3ZCJ A;  4GKJ T;  3EDU A;  2BS3 A;  2KT9 A;  2X66 A;  4QHO A;  3CX7 B;  4AQG A;  2H7V C;  3CVR A;  2H89 A;  1HX1 B;  3GA8 A;  3OPC A;  3R6N A;  4X5T A;  2Q9Q C;  3QK6 A;  4DBQ A;  2VKD A;  4M1P A;  4N78 D;  2LSY A;  5F8P A;  5HEJ A;  3ZMU B;  5JR9 A;  4DR4 T;  2WMO A;  2HN2 A;  2B76 A;  4LFC T;  5JDF A;  4HFV A;  5AQT B;  4GKK T;  3P8C D;  1FIO A;  2PG8 A;  2YK0 A;  4DV1 T;  2C5K T;  2ZM2 A;  4AKR B;  3UU6 A;  4U7I A;  2KSR A;  1KEY A;  1W0B A;  5AQV B;  5AQQ B;  3NRY A;  3P7I A;  4E7S A;  2JMK A;  4QKN A;  2UXN B;  2BKP A;  4DMW A;  1S35 A;  5M4Y A;  4EZ4 A;  2XQ8 A;  5FMN A;  2CA5 A;  4UF0 B;  4UVB B;  1KK7 A;  3Q5W A;  2YDS A;  4AQF A;  4YFS A;  1MND A;  2M67 A;  2ZM8 A;  4HFB A;  4IL4 A;  5L2L A;  1N33 T;  3W15 B;  4FJO A;  3B13 A;  5EK3 A;  2VQE T;  2LT3 A;  1FMV A;  3FZH B;  5FXZ A;  3FZL B;  1YKE B;  1B7T A;  2DCF A;  2XY8 B;  1T8B A;  3LBX B;  3ZMS B;  4UEM A;  1FEW A;  2QVA A;  3ZPO A;  3MZK B;  3AAA B;  1MIV A;  2BKN A;  2BS4 A;  2WU2 A;  2R6G F;  5JRE A;  3KV9 A;  2BBH A;  3LK2 B;  2DLR A;  3HKB E;  3FBZ A;  2V1D B;  4MAL A;  4YSY A;  2BG9 C;  4WYV A;  4OFZ A;  4QH4 A;  5IWA T;  1XMQ T;  1YXR A;  3RI5 A;  4TNV A;  3RF1 A;  4NUV A;  4DUY T;  3Q2M A;  2CHO A;  4XZC A;  2DL1 A;  4B3R T;  4IST A;  1HTJ F;  3FHN A;  2X9Y A;  4TWH A;  2WZI A;  4CXX A;  3VRA A;  2V8S V;  2E8I A;  3NWI A;  5AQH B;  1MMG A;  1M7K A;  3ZMT B;  4WBO A;  3AA6 B;  5AQL B;  4DV2 T;  2NR4 A;  3KV6 A;  4X20 E;  3UUB A;  2HHH T;  1WLX A;  4YTN A;  1YW0 A;  2EHO D;  2V7K A;  3P4W A;  4H9P C;  3VRB A;  5C8Y E;  5JDG A;  3BQI A;  5AQG B;  2JMH A;  4LF7 T;  3IHR A;  5HEO A;  3LK3 B;  4PFO A;  2XUE A;  4HFI A;  1ZEE A;  3AE7 A;  2JRK A;  3KFW X;  5ABF B;  2VVS A;  3AE6 A;  4Z90 A;  4ILU A;  5LMN T;  1D0Z A;  3JAE A;  3L8R A;  3OYZ A;  1J5W A;  1QUU A;  4PJJ A;  2YDQ A;  4HN9 A;  3H3A A;  4JEH B;  2M6B A;  3RIF A;  4YSZ A;  2WMN A;  1D1B A;  2JQH A;  4BJN A;  3RQU A;  4HFE A;  4OHF A;  5L3F B;  4O2B E;  4I0U A;  5AQI B;  2XQ5 A;  3CIR A;  4NXM T;  3RC3 A;  2HPL A;  3E08 A;  2IC6 A;  5ABE A;  1YD8 G;  4FI5 A;  3ONJ A;  5DQW A;  1ZHC A;  3QNU A;  5HXR A;  4HEA A;  2QA7 A;  2VAS A;  2LOP A;  1QLB A;  4NPP A;  4P0B A;  3TLT A;  3HA4 A;  5E0O A;  4PJN A;  4YSX A;  3LJC A;  1KF6 A;  2LLY A;  4YLH A;  2YKS A;  2J1D G;  4AIS A;  5ABF A;  5DJQ C;  1OED A;  4AKH A;  3D0T A;  4IGU A;  4Q25 A;  3Q5E A;  2CXL A;  3EAM A;  3N2G E;  3GN5 B;  3E0Z A;  2XM2 A;  2N1G A;  2H88 A;  1OXZ A;  3FZF B;  4CN4 A;  1VCT A;  4TV8 E;  3HR0 A;  5F5W A;  4U2Y A;  1WYB A;  4KX6 A;  2MTQ A;  2X9W A;  1N32 T;  2Y8D A;  3UUX B;  2SPC A;  1SA0 E;  3AE9 A;  5HYA A;  3I0O A;  5LB7 B;  3CQG B;  3TLW A;  5HAX A;  3PUZ F;  5HXC A;  4EYU A;  4TUY E;  1U4Q A;  2XTL A;  3QB5 K;  3U78 A;  2AXD S;  3JAF A;  2M6I A;  1IBK T;  5LP6 E;  2MPK A;  3T1Y T;  5F3J A;  4IE0 A;  4KHZ F;  3HKD E;  5LHI B;  1OED E;  3O1J A;  4X62 T;  3ZMZ B;  4HWD A;  2E9X A;  2V7L A;  1XDO A;  5HEG A;  4ZHQ E;  2LHN A;  5FY7 A;  1M62 A;  3KVB A;  5CB4 E;  2V26 A;  3CKD A;  1NWM X;  1LVK A;  4DR5 T;  3V5U A;  3AE8 A;  3ONX A;  1IZN B;  1G8X A;  3QUJ A;  4ISS A;  4EGW A;  4KMC A;  2Q9Q B;  2Z6E A;  3VHL A;  1DU2 A;  1YQ3 A;  1O3X A;  5BMV E;  3UU4 A;  3KV4 A;  4UVC B;  3ZJ1 A;  2X0L B;  2CE7 A;  1G73 A;  1UK5 A;  2QRX A;  4DBR A;  2V7J A;  2F4V T;  4CN1 A;  4U33 A;  4ZI3 C;  4I50 E;  3KDS E;  3OVU A;  4A97 A;  5L3G B;  1MMN A;  2BVL A;  4IL9 A;  4PW8 A;  2VK9 A;  3C50 A;  2DI4 A;  3RYH E;  2UUA T;  3ZN0 B;  4GK0 E;  2V5C A;  4X1Y E;  3ANW B;  4P1N A;  2OA5 A;  5LG3 A;  4U2Z A;  3RX6 A;  1MIW A;  2MAW A;  4L5G A;  4TWF A;  2LE8 A;  4JUY A;  4A56 A;  3T8O A;  1BR0 A;  4ZXL A;  4X64 T;  3GWH A;  4JI1 T;  5ABH A;  2Y48 B;  4UXN B;  5J2U E;  4ZZB A;  4EAH A;  4DV0 T;  1XMO T;  1I94 T;  2NTX A;  2NW9 A;  3ZCI A;  4YY3 T;  5FVL A;  2X67 A;  4PK5 A;  4ZZC A;  4IE7 A;  4AXP A;  2Q9Q A;  2WWV A;  5EK4 A;  5HWX A;  2WDQ A;  3AEF A;  4IDQ A;  4EB6 E;  3PUA A;  2A72 A;  2D2S A;  2KXP B;  4EIW A;  5LG4 A;  1HCI A;  1W9R A;  2BG9 B;  2V5D A;  3AXJ B;  3RYC E;  4IDP A;  1N36 T;  2I59 A;  4LF9 T;  2E9X D;  4LMK A;  3OKQ A;  3UU3 A;  2W66 A;  5FL1 A;  2X0Y A;  4IE6 A;  4IE5 A;  4HFD A;  3CX8 B;  3UQ7 A;  4QX8 B;  4YTP A;  3ANW A;  2KZ7 B;  3M65 A;  3DJB A;  3K3O A;  3F57 A;  5HCM A;  3X1D A;  1D1C A;  2V7I A;  1KNZ A;  3PU3 A;  5AQU B;  2YDR A;  2KND A;  3ZT6 A;  4HFH A;  4TZ4 C;  2HPJ A;  1NAF A;  1ZP0 A;  3F31 A;  2DHR A;  5HXH A;  3P50 A;  3AEG A;  3AA1 B;  5AQN B;  4NIQ A;  2N2N A;  2K9A A;  1XNQ T;  2LRL A;  4CXY A;  2LSK A;  4OYK A;  1UUR A;  3PUR A;  5A1L A;  4DV3 T;  4ZI7 E;  2VQF T;  2J62 A;  5EK2 A;  4ASK A;  1D0Y A;  4EEB A;  2BG9 A;  3I9Y A;  2IW5 B;  5CJ5 A;  4DND A;  1YQ4 A;  1IJ6 A;  4MFR A;  1HNW T;  4UIG A;  2G0U A;  2NOX A;  2QYW A;  2FJE A;  1WCR A;  1KNR A;  2JJ9 A;  4IIJ E;  2IUB A;  3PDY A;  1UX5 A;  3TLV A;  4HWC A;  4K0U A;  2Y6X A;  4MLK A;  4MHC A;  2MBG A;  2EHO C;  1WFD A;  5LOV E;  4YTM A;  4Z8X A;  4DR6 T;  4WW0 A;  2V7M A;  1US7 B;  3SFE A;  3A7M A;  2OLT A;  3UU8 A;  2FUP A;  3P4P A;  3ZC1 A;  3MJX A;  2XZE A;  4WZX A;  2BG9 E;  4X65 T;  3UQ4 A;  2XSA A;  4UF0 A;  3HI2 A;  4K0K T;  2PFV A;  1EZ3 A;  2K24 A;  3ESL A;  4HE8 A;  3SS1 A;  1HFA A;  4I4T E;  4PK4 A;  3SFD A;  3ZC0 A;  4U31 A;  2CWO A;  3CQC B;  3MKD A;  4KUM B;  2NP9 A;  2WBL A;  3J7Y q;  3ETV A;  3N9M A;  1NEN A;  4QXC B;  4OYJ A;  4HKA A;  3RQW A;  2NWB A;  4DV6 T;  5HXE A;  4C90 A;  3U3I A;  3H3M A;  3ZN1 B;  4LF5 T;  4WBN E;  3LBX A;  4ZEY A;  4EOZ B;  1X9B A;  4BA9 A;  4KBM B;  4QH1 A;  3M3Z B;  4ADZ A;  2VKO A;  2X0H A;  2LM9 A;  1UX4 A;  3UTK A;  5L47 A;  4U7Y A;  2X9X A;  3PJA J;  5DAB A;  2P9B A;  5ETW A;  1ZOY A;  4HWI B;  4DR3 T;  2YOE A;  2OV9 A;  5LA6 E;  4LF8 T;  4X1I E;  2VKJ A;  1KNP A;  5JRC B;  3HL6 A;  1FJG T;  3PUX F;  2IIU A;  4AKL A;  1T72 A;  1U5P A;  2ACX A;  2LM2 A;  5LHG B;  3RIA A;  5EZY E;  2WM9 A;  3MK7 C;  2W4X A;  3PUY F;  2XAF B;  3CPZ A;  2XAS B;  2NW8 A;  2CWY A;  2YIN A;  4LFB T;  2LRK A;  4LMJ A;  2W62 A;  3KV5 A;  4CN6 A;  1LKX A;  1W0A A;  3AAE B;  1MMD A;  2W2U A;  4GYS A;  2D0U A;  1UUS A;  4PJL A;  3OBV E;  5J0Z A;  4U72 A;  3ZT7 A;  3UUN A;  5LJN A;  2VKH A;  2PJQ A;  4TNW A;  4ZI2 D;  3EHZ A;  2ACZ A;  1SHZ C;  4YJ3 E;  2GK9 A;  2A2F X;  1HNZ T;  3RRW A;  4H9N C;  3DP7 A;  2NTY A;  1FMW A;  3KVA A;  3ETU A;  4YHH T;  3KIN B;  5IHY A;  4JI3 T;  1YKH B;  3NVO A;  4G2A A;  3V5S A;  5LNK A;  5JDQ A;  5J2T E;  1XZY A;  3C4W A;  4QX7 B;  3ZKR A;  4IDO A;  2PTF A;  2N9D A;  2XAJ B;  3ZYM A;  2YEV C;  5CFB A;  1WR0 A;  2RPA A;  4GIW A;  2UXB T;  1CHU A;  3C64 A;  2W67 A;  3B5M A;  3GMI A;  2K5B B;  4IHJ E;  3PUQ A;  5IYZ E;  4LF6 T;  2JQ9 A;  3ZST A;  3AEA A;  1Z8U A;  2X68 A;  3HKC E;  3LG7 A;  2LSJ A;  1J1J A;  4H9O C;  3T1H T;  2YU1 A;  5KX5 E;  3PUS A;  3RKG A;  4QXB B;  4PAG A;  4O4J E;  4X1K E;  3AA0 B;  4PFP A;  2WB5 A;  2WU5 A;  3HKE E;  3N9Q A;  3FZK B;  3N5L A;  5FXX A;  5JH7 E;  2VL8 A;  4JLE A;  2ODU A;  2E2A A;  2W61 A;  2IAK A;  2WAU A;  4G63 A;  3QOF A;  2PBI A;  1WYC A;  3ZMV B;  2ODV A;  4AKG A;  1NEK A;  4H9R C;  2J4G A;  1AJ3 A;  2X9H A; 
#chains in the Genus database with same CATH homology
 2F4V T;  4JI3 T;  4LFA T;  4LFC T;  4NXN T;  1IBM T;  4GKK T;  4DR3 T;  4B3T T;  4KHP T;  2UU9 T;  1N32 T;  4JI6 T;  4JI8 T;  1HNX T;  4DUY T;  4LF4 T;  4LF8 T;  4B3R T;  4DV1 T;  4B3M T;  2UUA T;  2UUB T;  4OX9 T;  4JI4 T;  1FJG T;  4DR6 T;  4JI2 T;  2UXB T;  4AQY T;  4DUZ T;  1IBK T;  4DR1 T;  5BR8 T;  2E5L T;  3T1Y T;  4LF6 T;  2UUC T;  4NXM T;  2ZM6 T;  2UXC T;  4X64 T;  4JI1 T;  4X65 T;  3T1H T;  1XNR T;  4JI5 T;  1J5E T;  4X62 T;  1N33 T;  4DV2 T;  4B3S T;  4DV0 T;  4JV5 T;  1XMO T;  4DR2 T;  1I94 T;  4K0K T;  1XNQ T;  4LFB T;  4DV5 T;  3OTO T;  4YY3 T;  2HHH T;  4DV7 T;  4X66 T;  2VQE T;  4JI0 T;  1HR0 T;  2UXD T;  4DR7 T;  4DV3 T;  4DR5 T;  4GKJ T;  2VQF T;  4LF7 T;  4JI7 T;  1N34 T;  1IBL T;  5LMU T;  4JYA T;  4DV6 T;  1HNW T;  4LF5 T;  1HNZ T;  5LMN T;  1N36 T;  4LF9 T;  4DV4 T;  4DR4 T;  4YHH T;  5IWA T;  1XMQ T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...