4DV2T

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, c912a
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 33
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 4dv2T00
4DV7T 4DR2T 1HNWT 3T1HT 4K0KT 3OTOT 4JYAT 5BR8T 2VQET 4DUYT 4B3MT 4JI7T 1N36T 4NXMT 1IBKT 4DV2T 4B3ST 4GKJT 5LMNT 2UUAT 4DV0T 1J5ET 4JI6T 4LFAT 1XNRT 2F4VT 4JI2T 1FJGT 2UXCT 4DUZT 2UUBT 4JV5T 4B3TT 2UXBT 4X62T 4DR3T 4DV5T 2UUCT 4B3RT 4X65T 1N33T 4JI4T 4JI1T 4YHHT 1N34T 2HHHT 1IBLT 4DR4T 4LFBT 5IWAT 4X64T 4KHPT 4JI0T 4DV6T 4JI5T 1HNXT 4DV3T 2VQFT 4OX9T 1HNZT 4DV1T 4DR7T 5LMUT 4JI8T 4LF8T 1XNQT 1HR0T 4DR6T 4DV4T 4DR1T 4YY3T 4DR5T 4LF6T 1XMQT 4LF9T 2UXDT 1N32T 1I94T 4LF5T 4X66T 1IBMT 4JI3T 4GKKT 4LF7T 2UU9T 3T1YT 4LFCT 1XMOT 2E5LT 4AQYT 2ZM6T 4NXNT 4LF4T
chains in the Genus database with same CATH superfamily
3MJXA 1WRDA 3AE3A 3LDQB 5E0OA 3MZKB 2B1EA 4UXNB 1WLXA 3OTOT 2BG9B 4C91A 2BS3A 4PW8A 2Y8DA 2LKHA 4I0UA 2J62A 2LLYA 2WDVA 2X67A 1HTJF 4I4TE 1MMAA 2AE9A 2E9XB 4EB6E 4IREA 1D0XA 1UX5A 2CRBA 2X0HA 4B3MT 5HXHA 3JAEA 5DQVA 4DBRA 1WR0A 4YTMA 4UV8B 3UU5A 4ZI7E 1OEDC 2VKOA 1N36T 3I1AA 5H6RB 4CQIA 3L39A 5FL1A 3UU4A 3FXDB 3R84B 3AVSA 5LMNT 3AE2A 3HA4A 4UVBB 3LSVA 3NBXX 2K48A 4LMJA 2H7OA 2BS2A 5LA6E 2H3RA 4G2AA 2XQ4A 5KX5E 2WMOA 4JI6T 2CE7A 4YFSA 1XNRT 2CWOA 2W66A 3UUMA 3VHLA 5L2LA 2BS4A 5AQPB 1N32T 5LGUB 3BQIA 3EUHA 4K0UA 4U31A 5HEUA 3R6NA 3CX7B 4ZZBA 1IJ6A 3FZKB 4EAHA 5LXTE 3AEEA 3N2GE 3OPCA 4DUZT 3FZHB 1HF8A 1KNPA 2WBLA 4H63V 1XDOA 2XZEA 2LT3A 3I0QA 4HGAA 2WCAA 3ZMSB 2UUBT 4JV5T 3Q9DA 3Q2MA 4DR3T 3KV5A 3P50A 5HXSA 3K3QC 2D0UA 2IUBA 2K9AA 4GYRA 4TNVA 3VU7H 3J7Yq 3I0OA 3K8PC 5LBQB 4YHHT 2E2AA 2UXNB 3FZFB 3PUZF 3H3MA 1DU2A 3PUAA 4A56A 3NRXA 2WS3A 3U78A 5IUXA 5JDLA 4TWHA 4LFBT 4NIQA 3RX6A 3MA9A 4MHCA 4EXTA 4AXPA 4WBOA 4AQFA 2I6HA 2N2NA 2BDEA 4PFOA 5JDFA 4MLKA 4EGWA 3ZT7A 1FIOA 1U5PA 3EHZA 4HFVA 5L3DB 3CK6A 3LK3B 3A7MA 1WYCA 2W0GA 4TN7B 4KHPT 2FUPA 2XSAA 5FY0A 1SHZC 5C3JA 2JIWA 2X66A 2RP4A 5AQMB 2CBIA 4X1IE 2EHOC 3UFEA 3O9XA 4IHJE 2UXXB 3AE4A 1E1HB 1JNZA 2PJQA 3EI0A 4EYUA 4DV3T 4OX9T 3RYCE 2E9XC 1MMNA 2XM1A 4DV1T 1KFYA 2BBHA 4JUYA 2V7KA 2YK0A 1MNDA 1KNZA 4HFDA 4QHOA 3O4XE 4TX5A 2VKDA 2FJBA 3AEAA 2E8IA 4OYKA 5LMUT 3TLTA 3UQ4A 3C98B 4X5TA 4JI8T 4LF8T 3C4ZA 1FEWA 2W62A 5C2TA 1HR0T 1MIWA 3C64A 4H9PC 3UU3A 5CGMA 3UTKA 2ACZA 2V7IA 2JPFA 4TV8E 2LKGA 3L8RA 4F6RC 4YY3T 2XQ8A 5ABEA 2D5UA 2X51A 5JDHA 3ZT6A 2DWGA 4U2ZA 5FVKA 2PTFA 1VOMA 1XMQT 2R6GF 2MBGA 2NOXA 2AXDS 4LF9T 4ILUA 1KF6A 3LBXA 3PJAJ 1BR4A 2DHRA 2XJ7A 4JEHB 4CN1A 2WY2A 2QRXA 5F8PA 2BBJA 4E7ZA 3MK7C 4WBNE 3ZMUB 4U3CA 1M62A 1YW0A 1OXZA 2G0UA 4CZZB 3A8YC 1IBMT 2XAQB 4TNWA 1W0BA 3PV0F 1QLBA 2ODVA 3EDUA 4U74A 5A1LA 2CHNA 1OEDE 1OWAA 5AFUL 3I9WA 5L3FB 3NZQA 2WSSV 3Q5DA 3RHWA 2UU9T 3T1YT 2XQ3A 3GMIA 1HG2A 2X9WA 2YU1A 3VR8A 3CMLA 3RLFF 2BZBA 2V26A 1UK5A 4AQYT 5FVLA 4O4IE 5HEHA 4ZI3D 4UEMA 5HCMA 5J1GA 1HNWT 3RGLA 3ONXA 3GN5B 2WWUA 2IW5B 2A3DA 5F3JA 1YKHB 4Q25A 2KWHA 2XUEA 2HPJA 4UV9B 1Z0PA 5ABHA 5HEJA 1W9RA 2D0TA 2X9YA 3Q5WA 3DTOA 4IT4A 3M65A 1JNRA 1MIVA 3QUJA 4ZXLA 5LP6E 3AVRA 4YLHA 5J2UE 3WAJA 5BR8T 5AQRB 5FP3A 4G63A 2P9BA 4IE7A 1ZEEA 2JJ9A 2BVLA 4EEDA 3AA6B 3FXEB 3JC6C 3P7IA 5HEGA 3FBZA 3OJAA 2XAFB 4JI7T 5JDGA 1OEDA 2C5JA 2W2UA 3GA8A 1IBKT 1T98A 3AE6A 3TLVA 3FZLB 4AKRB 2H89A 3AAAB 3UFGA 3CKDA 4CXWA 4BA9A 5HXEA 5AQNB 2Z6EA 1VCTA 2UUAT 3CX6B 5GONE 2KMFA 4PJJA 5AQGB 3HKDE 2ES0A 2XQ9A 4AKLA 4UR9A 1W09A 4QH1A 3RYFE 5CB4E 3UT5E 3N9OA 2LHNA 4M1PA 4A5XA 5FYMA 4LMLA 3EABA 3H37A 2WQYA 2L9QA 4Z90A 5EK4A 1KEYA 2OA5A 4PK5A 1MMDA 2CWYA 4C90A 2UXCT 3AE1A 4IDPA 3BQLA 3C50A 2CEAA 2LJLA 3FBLA 3T8OA 1BR0A 5LNKA 2LRKA 2V7JA 3ZSTA 4F8HA 1MNEA 4B3TT 2UXBT 2UUCT 4DV5T 5CFBA 1HX1B 4FI5A 4N78D 4IDQA 3ZN1B 4MBQA 3ZYMA 2XSBA 4ZI2C 3DP7A 1NWMX 1X9BA 3C4WA 3N2OA 5BMVE 4UVAB 2E5VA 3VKGA 4MFRA 1ZV4X 1IBLT 1QSDA 3B5MA 2ZM2A 4H9OC 2KNDA 5L3GB 4DNDA 4U33A 4I43B 3ONLC 3CPZA 2XY8B 4U7YA 5L4EA 2YDQA 4PK6A 2NP9A 5FMNA 4GK0E 3P4RA 2LSYA 2CM0A 1M7KA 2EHOB 2VVSA 3AB3B 4QKNA 4HWIB 5JR9C 1G8XA 3KBTA 1FMVA 2CXFA 2VVNA 4KUMB 2IAKA 3IBPA 4NPPA 4CXXA 2RPAA 5HEOA 4PJMA 2KINB 2V6YB 5ABFA 2WZIA 2VB6A 3TKLB 4H9RC 1LKXA 1SA0E 3ZC1A 1BR1A 2DI4A 3OBVE 2VQFT 1HNZT 5LG3A 5AQJB 1KK7A 2QGSA 3RH3A 2FJEA 3EVYA 2BKPA 4MALA 2WP9A 2PG8A 1OEDB 4XAXB 3HI2A 5EK2A 1N33T 4ZI3C 2BG9A 5AQKB 2XQYA 3V5SA 4IDNA 3SWHA 1YQ4A 1J5WA 4EZHA 4DV4T 3PUXF 2WDQA 1GQEA 1O3XA 3JCFA 4PNIA 4ZOLE 4L0RA 2LE8A 4YXDA 1Z8UA 2FJDA 5AQOB 3AEFA 3B13A 4TZ4C 5AQHB 4A98A 3UUNA 5LGNB 3ZMVB 3SFDA 2UXDT 2OV9A 4PAGA 5AQIB 3EDVA 2CBJA 3IA3A 3AA1B 4JI4T 3SRZA 4LF5T 1VRBA 2Q9QC 2VWAA 2VK9A 2XM2A 4JI3T 3HKBE 2H7VC 5HWYA 2E9XD 1D1CA 3I9YA 1UGOA 2HH7A 2L3LA 2L8KA 2LHRA 2YDSA 3D0TA 3L09A 3AE7A 3MXZA 5DJQC 5IYZE 3TLWA 3ZPOA 3QNUA 4YT0A 4O4JE 3B57A 1WR6A 5TAOA 3CWZB 4H63H 4ADZA 2E5LT 2BG9C 3L3PA 3AAEB 2WWVA 1UUSA 2DNXA 2Q9QB 4NXNT 3AEBA 3Q5XA 4O4LE 3U3IA 4AKIA 3HKCE 4U7IA 2LEHA 5ABFB 3T1HT 1S35A 5FXWA 1LVFA 2M67A 4A97A 1YD8G 2QYWA 3PUWF 2WM9A 3QK6A 4EIWA 4QWNB 1FMWA 2CLYC 2MTQA 2LSKA 2CLYB 2ZM8A 3ZLIA 4JYAT 3TLUA 5FY7A 3RRCA 2EHOA 5FXVA 2YKSA 4CXYA 3IHRA 5LBMA 3N5LA 3HL6A 5LCYA 3RI5A 2IC6A 4TWDA 3G06A 3J9X1 4BAYB 5KXJA 4ILBA 4AQGA 3H3AA 2MPKA 4GIWA 4KMCA 2CXLA 1YKEB 2XQAA 1ZHCA 4WW0A 1CUNA 5HCJA 4L5GA 3ZMTB 5C8YE 5CA1E 4NXMT 2WZHA 3N9PA 3RIUA 4YSYA 4B3ST 5AQVB 4GKJT 4OFZA 2PBIA 3N9QA 3O1JA 5DABA 3UU6A 4UF0A 4YSZA 4OK0A 4V1Av 2KT9A 5HXRA 3S4UA 2JQ9A 5L3CB 4DV0T 2Q9QD 3ZCJA 1J5ET 4IE0A 3E0ZA 1SE7A 2VASA 4DO0A 4LFAT 2NW9A 3QOFA 4GOUA 2V7LA 3F31A 1W0AA 3AECA 4O2BE 2C5IT 1MMGA 3C51A 3Q5EA 4QH4A 2WAUA 2ZM0A 2JQHA 4UF0B 4JI2T 4EYYR 5HYAA 2F4VT 2X0YA 2DLRA 3FZMB 3PDYA 1T72A 2BG9E 3KBUA 5HXCA 4CI3B 1T8BA 4JEUB 4DBQA 3PUGA 4JBWF 5KDMC 4LF7T 4AI6A 4B3RT 2X9HA 5FNVE 3ZMZB 5AQFB 4I55E 4JI1T 2M6IA 2E9XA 4HFIA 2V1DB 2NW7A 4AKHA 2LRLA 2N9DA 5L47A 3AE9A 1D0YA 4IE5A 3AE8A 4QX8B 2W63A 3PUQA 5JH7E 3UQ7A 3RIFA 4H9NC 4YHJA 3GWHA 4YJ2E 3PU8A 5LG4A 5IWAT 3SFEA 2V5DA 2BVMA 2VURA 4X64T 5LJMA 3N2KE 1D1AA 3PURA 3AEDA 3P4WA 4UVCB 2C0SA 4NUVA 3AE5A 4WZXA 3X1DA 4DVDA 4OHFA 5JQGE 2XAGB 2HPLA 1HG5A 4JI0T 3N9NA 2H88A 3TLSA 4DV6T 2DL1A 3F2EA 3ZCIA 3RIAA 2HN2A 3AA0B 1U4QA 4IIJE 4YJ3E 2JRKA 3NKZA 4I50E 5LOVE 5JR9B 2K3WA 2XASB 5F5WA 2MAWA 4L9IA 3RF1A 1HNXT 3LFMA 4HKAA 3ETUA 3CIRA 3KINB 4AKGA 4ZEYA 5CJ5A 2HN1A 2NR4A 3CVRA 1S94A 3PUVF 3AAIA 2I59A 5JVDE 1US7B 4ZS3A 3P4QA 2Y6XA 3JADA 3A5XA 4EOZB 3ZKRA 5L3EB 5JRCA 3RC3A 4EZ4A 1XNQT 1T7SA 2B76A 2DCFA 5LYJE 4AQFC 4COFA 3RYIE 4IDZA 4GK5E 3GN5A 2K24A 5JDQA 4XZCA 3UU8A 3NZPA 4LF6T 4XBFB 2PFVA 2V5CA 3QC9A 4HE8A 4BJNA 2XQ7A 4KHZF 2CPTA 2CHOA 2SPCA 4HFCA 3ZT5A 1G73A 2GK9A 5AQTB 1HCIA 2A9UA 5JTGA 1E7PA 3E22E 2D9DA 3QB5A 4HWHA 3PUYF 2X0LB 1Y01A 4TWFA 4KI0F 5LGTB 1WYBA 2C5KT 4U72A 4CI1B 1R8IA 2K5BB 3VKHA 5JREA 1VCSA 5JRCB 4QH5A 3ZYKA 3AA7B 1EZ3A 4HFBA 4PJNA 5LJNA 3ANWA 1CHUA 3LK2B 2CCQA 3ETVA 2VL0A 3LBXB 4IL4A 1V9DA 1Y64B 1WCRA 2N1GA 2W61A 3RPUA 5ETWA 4LFCT 1X79A 2XHEB 2EHOD 4KP3C 2BKOA 4ILAA 4QXBB 4TV9E 5LHHB 4H9QC 5HAXA 4ANJA 4KBMB 3K3NA 3VRAA 5JDMA 4DV7T 4DR2T 3KFWX 4IDOA 4QXHB 1YXRA 1UCUA 3WAKA 3PUSA 4KX6A 3N9LA 4FJOA 4K0KT 4ERRA 1D1BA 4HWFA 4ZI2D 3P4SA 1D0ZA 3RKGA 5EZYE 4PK4A 1SUMB 3CQXC 4HFHA 5CA0E 2IDOB 3LG7A 3M3ZB 2YEVC 2OLTA 3N9MA 1QUUA 4PFPA 3RC8A 1NEKA 3HKEE 2I0MA 4ISTA 4Z8XA 1MIYA 3DJBA 2VQET 4WNKA 1UURA 5HWXA 3RQUA 5ABGA 4DUYT 4QX7B 3ZSSA 4WYVA 4JLEA 2WB5A 4HWDA 3K1SA 3HR0A 5JR9A 4DIDB 4P1NA 2CA5A 2KWIB 3IEEA 3KVAA 3OYXA 4QXCB 5LHIB 3EAMA 4DV2T 4BJMA 3PU3A 2V7MA 1AJ3A 5FL0A 3ONJA 4X20E 2WMNA 2YN6A 3NRYA 3WI3A 3KDSE 3NWIA 3QB5K 2WU2A 2NTXA 2LSIA 2V6XA 5ADXL 2J47A 3UUXB 2IHR1 2V6YA 2YDRA 5EK3A 3PJAA 2VL8A 2JQQA 3BK9A 3CQCB 2JMHA 3E08A 2D2SA 3KV9A 3PE0A 4IL9A 2BKNA 2IC9A 2X68A 2W00A 4EV6A 1FJGT 3RIUC 3LJCA 3K3OA 2IMLA 3F57A 4IGUA 3KV6A 4NUUA 4TUYE 3SOLA 4ASKA 5L3BB 1BR2A 1ZOYA 3C4XA 4U2YA 4X62T 5IHYA 3W15B 4X65T 2YOEA 1ZKEA 2XAJB 2IIUA 5AQQB 3UUBA 1HX8A 2KXPB 2WDRA 3KV4A 3OKQA 4UIGA 1N34T 2HHHT 2WU5A 2A72A 1HFAA 3CQGB 4DR4T 1H7CA 3BQKA 1LVKA 3ZC0A 1IZNB 4O2AE 4CN4A 3ZJ1A 5AQLB 4J2CA 2LM9A 4ZZCA 2CMRA 2JMKA 1KNRA 2NWBA 4HFEA 3ZEFB 5M4YA 3OYZA 2X9XA 2W67A 4EEBA 3RRWA 3ZYLA 4YSXA 4LMKA 2ACXA 2XPKA 3P4PA 1NAFA 2NTYA 3P8CD 4P09A 3AEGA 1LRZA 5FKYA 4O8SA 2KZ7B 4ISSA 4UELA 1YQ3A 3AXJA 4IE6A 4JI5T 4DMWA 3ZN0B 5FXXA 5AQSB 5J0ZA 2Q9QA 2RA1A 3RYHE 4AIUA 1B7TA 4ZS2A 1XDPA 3O1HA 5LB7B 1NENA 5DQWA 2NW8A 1IAPA 1ZP0A 1XWMA 4HN9A 2LM2A 4P0AA 2VKJA 4DR7T 5KMGP 4ZHQE 5FXZA 3SS1A 2JQKA 3FB2A 3ZJ2A 3RQWA 4CI2B 1WFDA 2YU2A 3IF8B 2LOSA 5H6QB 2MOZA 3JAFA 3PTRB 4OYJA 2LSJA 1L0VA 3FHNA 4IE4A 4DR1T 4DR6T 2XQ5A 1UX4A 1HS7A 3ESLA 4DR5T 3UULA 3CX8B 2DWKA 3MKDA 1XZYA 2CXDA 3O1IA 3OVUA 2KLQA 4DMVA 1J1JA 2ZLYA 4X1YE 4X1KE 2QVAA 5L4HA 2FJAA 4HTEA 3ABVA 3LK42 2ZMAA 4O4HE 3VR9A 1I94T 3JC6D 2KSRA 4X66T 5FY1A 1I6ZA 2XQ6A 3RKOA 4GYSA 2LSGA 2VKHA 2YINA 4P0BA 4B6XA 4HEAA 4CN6A 4HWCA 2W4XA 2J1DG 4YTPA 5JDNA 3KVBA 4GKKT 4H9SE 5LHGB 2ODUA 2FBWA 3ANWB 4AISA 3NVOA 1IJ5A 2M6BA 3V5UA 2J4GA 5J2TE 2V8SV 3VRBA 2XAHB 4E7SA 1XMOT 2LOPA 3MACA 4YTNA 1E2AA 2QA7A 2ZM6T 2MYSA 4Z91A 2Y48B 4PJLA 4LF4T 4ILCA 2XTLA 3AXJB 2A2FX 5AQUB
chains in the Genus database with same CATH topology
4DV7T 4DR2T 1HNWT 3T1HT 4K0KT 3OTOT 4JYAT 5BR8T 2VQET 4DUYT 4B3MT 4JI7T 1N36T 4NXMT 1IBKT 4DV2T 4B3ST 4GKJT 5LMNT 2UUAT 4DV0T 1J5ET 4JI6T 4LFAT 1XNRT 2F4VT 4JI2T 1FJGT 2UXCT 4DUZT 2UUBT 4JV5T 4B3TT 2UXBT 4X62T 4DR3T 4DV5T 2UUCT 4B3RT 4X65T 1N33T 4JI4T 4JI1T 4YHHT 1N34T 2HHHT 1IBLT 4DR4T 4LFBT 5IWAT 4X64T 4KHPT 4JI0T 4DV6T 4JI5T 1HNXT 4DV3T 2VQFT 4OX9T 1HNZT 4DV1T 4DR7T 5LMUT 4JI8T 4LF8T 1XNQT 1HR0T 4DR6T 4DV4T 4DR1T 4YY3T 4DR5T 4LF6T 1XMQT 4LF9T 2UXDT 1N32T 1I94T 4LF5T 4X66T 1IBMT 4JI3T 4GKKT 4LF7T 2UU9T 3T1YT 4LFCT 1XMOT 2E5LT 4AQYT 2ZM6T 4NXNT 4LF4T
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV7 T;  4DR2 T;  1HNW T;  3T1H T;  4K0K T;  3OTO T;  4JYA T;  5BR8 T;  2VQE T;  4DUY T;  4B3M T;  4JI7 T;  1N36 T;  4NXM T;  1IBK T;  4DV2 T;  4B3S T;  4GKJ T;  5LMN T;  2UUA T;  4DV0 T;  1J5E T;  4JI6 T;  4LFA T;  1XNR T;  2F4V T;  4JI2 T;  1FJG T;  2UXC T;  4DUZ T;  2UUB T;  4JV5 T;  4B3T T;  2UXB T;  4X62 T;  4DR3 T;  4DV5 T;  2UUC T;  4B3R T;  4X65 T;  1N33 T;  4JI4 T;  4JI1 T;  4YHH T;  1N34 T;  2HHH T;  1IBL T;  4DR4 T;  4LFB T;  5IWA T;  4X64 T;  4KHP T;  4JI0 T;  4DV6 T;  4JI5 T;  1HNX T;  4DV3 T;  2VQF T;  4OX9 T;  1HNZ T;  4DV1 T;  4DR7 T;  5LMU T;  4JI8 T;  4LF8 T;  1XNQ T;  1HR0 T;  4DR6 T;  4DV4 T;  4DR1 T;  4YY3 T;  4DR5 T;  4LF6 T;  1XMQ T;  4LF9 T;  2UXD T;  1N32 T;  1I94 T;  4LF5 T;  4X66 T;  1IBM T;  4JI3 T;  4GKK T;  4LF7 T;  2UU9 T;  3T1Y T;  4LFC T;  1XMO T;  2E5L T;  4AQY T;  2ZM6 T;  4NXN T;  4LF4 T; 
#chains in the Genus database with same CATH topology
 3MJX A;  1WRD A;  3AE3 A;  3LDQ B;  5E0O A;  3MZK B;  2B1E A;  4UXN B;  1WLX A;  3OTO T;  2BG9 B;  4C91 A;  2BS3 A;  4PW8 A;  2Y8D A;  2LKH A;  4I0U A;  2J62 A;  2LLY A;  2WDV A;  2X67 A;  1HTJ F;  4I4T E;  1MMA A;  2AE9 A;  2E9X B;  4EB6 E;  4IRE A;  1D0X A;  1UX5 A;  2CRB A;  2X0H A;  4B3M T;  5HXH A;  3JAE A;  5DQV A;  4DBR A;  1WR0 A;  4YTM A;  4UV8 B;  3UU5 A;  4ZI7 E;  1OED C;  2VKO A;  1N36 T;  3I1A A;  5H6R B;  4CQI A;  3L39 A;  5FL1 A;  3UU4 A;  3FXD B;  3R84 B;  3AVS A;  5LMN T;  3AE2 A;  3HA4 A;  4UVB B;  3LSV A;  3NBX X;  2K48 A;  4LMJ A;  2H7O A;  2BS2 A;  5LA6 E;  2H3R A;  4G2A A;  2XQ4 A;  5KX5 E;  2WMO A;  4JI6 T;  2CE7 A;  4YFS A;  1XNR T;  2CWO A;  2W66 A;  3UUM A;  3VHL A;  5L2L A;  2BS4 A;  5AQP B;  1N32 T;  5LGU B;  3BQI A;  3EUH A;  4K0U A;  4U31 A;  5HEU A;  3R6N A;  3CX7 B;  4ZZB A;  1IJ6 A;  3FZK B;  4EAH A;  5LXT E;  3AEE A;  3N2G E;  3OPC A;  4DUZ T;  3FZH B;  1HF8 A;  1KNP A;  2WBL A;  4H63 V;  1XDO A;  2XZE A;  2LT3 A;  3I0Q A;  4HGA A;  2WCA A;  3ZMS B;  2UUB T;  4JV5 T;  3Q9D A;  3Q2M A;  4DR3 T;  3KV5 A;  3P50 A;  5HXS A;  3K3Q C;  2D0U A;  2IUB A;  2K9A A;  4GYR A;  4TNV A;  3VU7 H;  3J7Y q;  3I0O A;  3K8P C;  5LBQ B;  4YHH T;  2E2A A;  2UXN B;  3FZF B;  3PUZ F;  3H3M A;  1DU2 A;  3PUA A;  4A56 A;  3NRX A;  2WS3 A;  3U78 A;  5IUX A;  5JDL A;  4TWH A;  4LFB T;  4NIQ A;  3RX6 A;  3MA9 A;  4MHC A;  4EXT A;  4AXP A;  4WBO A;  4AQF A;  2I6H A;  2N2N A;  2BDE A;  4PFO A;  5JDF A;  4MLK A;  4EGW A;  3ZT7 A;  1FIO A;  1U5P A;  3EHZ A;  4HFV A;  5L3D B;  3CK6 A;  3LK3 B;  3A7M A;  1WYC A;  2W0G A;  4TN7 B;  4KHP T;  2FUP A;  2XSA A;  5FY0 A;  1SHZ C;  5C3J A;  2JIW A;  2X66 A;  2RP4 A;  5AQM B;  2CBI A;  4X1I E;  2EHO C;  3UFE A;  3O9X A;  4IHJ E;  2UXX B;  3AE4 A;  1E1H B;  1JNZ A;  2PJQ A;  3EI0 A;  4EYU A;  4DV3 T;  4OX9 T;  3RYC E;  2E9X C;  1MMN A;  2XM1 A;  4DV1 T;  1KFY A;  2BBH A;  4JUY A;  2V7K A;  2YK0 A;  1MND A;  1KNZ A;  4HFD A;  4QHO A;  3O4X E;  4TX5 A;  2VKD A;  2FJB A;  3AEA A;  2E8I A;  4OYK A;  5LMU T;  3TLT A;  3UQ4 A;  3C98 B;  4X5T A;  4JI8 T;  4LF8 T;  3C4Z A;  1FEW A;  2W62 A;  5C2T A;  1HR0 T;  1MIW A;  3C64 A;  4H9P C;  3UU3 A;  5CGM A;  3UTK A;  2ACZ A;  2V7I A;  2JPF A;  4TV8 E;  2LKG A;  3L8R A;  4F6R C;  4YY3 T;  2XQ8 A;  5ABE A;  2D5U A;  2X51 A;  5JDH A;  3ZT6 A;  2DWG A;  4U2Z A;  5FVK A;  2PTF A;  1VOM A;  1XMQ T;  2R6G F;  2MBG A;  2NOX A;  2AXD S;  4LF9 T;  4ILU A;  1KF6 A;  3LBX A;  3PJA J;  1BR4 A;  2DHR A;  2XJ7 A;  4JEH B;  4CN1 A;  2WY2 A;  2QRX A;  5F8P A;  2BBJ A;  4E7Z A;  3MK7 C;  4WBN E;  3ZMU B;  4U3C A;  1M62 A;  1YW0 A;  1OXZ A;  2G0U A;  4CZZ B;  3A8Y C;  1IBM T;  2XAQ B;  4TNW A;  1W0B A;  3PV0 F;  1QLB A;  2ODV A;  3EDU A;  4U74 A;  5A1L A;  2CHN A;  1OED E;  1OWA A;  5AFU L;  3I9W A;  5L3F B;  3NZQ A;  2WSS V;  3Q5D A;  3RHW A;  2UU9 T;  3T1Y T;  2XQ3 A;  3GMI A;  1HG2 A;  2X9W A;  2YU1 A;  3VR8 A;  3CML A;  3RLF F;  2BZB A;  2V26 A;  1UK5 A;  4AQY T;  5FVL A;  4O4I E;  5HEH A;  4ZI3 D;  4UEM A;  5HCM A;  5J1G A;  1HNW T;  3RGL A;  3ONX A;  3GN5 B;  2WWU A;  2IW5 B;  2A3D A;  5F3J A;  1YKH B;  4Q25 A;  2KWH A;  2XUE A;  2HPJ A;  4UV9 B;  1Z0P A;  5ABH A;  5HEJ A;  1W9R A;  2D0T A;  2X9Y A;  3Q5W A;  3DTO A;  4IT4 A;  3M65 A;  1JNR A;  1MIV A;  3QUJ A;  4ZXL A;  5LP6 E;  3AVR A;  4YLH A;  5J2U E;  3WAJ A;  5BR8 T;  5AQR B;  5FP3 A;  4G63 A;  2P9B A;  4IE7 A;  1ZEE A;  2JJ9 A;  2BVL A;  4EED A;  3AA6 B;  3FXE B;  3JC6 C;  3P7I A;  5HEG A;  3FBZ A;  3OJA A;  2XAF B;  4JI7 T;  5JDG A;  1OED A;  2C5J A;  2W2U A;  3GA8 A;  1IBK T;  1T98 A;  3AE6 A;  3TLV A;  3FZL B;  4AKR B;  2H89 A;  3AAA B;  3UFG A;  3CKD A;  4CXW A;  4BA9 A;  5HXE A;  5AQN B;  2Z6E A;  1VCT A;  2UUA T;  3CX6 B;  5GON E;  2KMF A;  4PJJ A;  5AQG B;  3HKD E;  2ES0 A;  2XQ9 A;  4AKL A;  4UR9 A;  1W09 A;  4QH1 A;  3RYF E;  5CB4 E;  3UT5 E;  3N9O A;  2LHN A;  4M1P A;  4A5X A;  5FYM A;  4LML A;  3EAB A;  3H37 A;  2WQY A;  2L9Q A;  4Z90 A;  5EK4 A;  1KEY A;  2OA5 A;  4PK5 A;  1MMD A;  2CWY A;  4C90 A;  2UXC T;  3AE1 A;  4IDP A;  3BQL A;  3C50 A;  2CEA A;  2LJL A;  3FBL A;  3T8O A;  1BR0 A;  5LNK A;  2LRK A;  2V7J A;  3ZST A;  4F8H A;  1MNE A;  4B3T T;  2UXB T;  2UUC T;  4DV5 T;  5CFB A;  1HX1 B;  4FI5 A;  4N78 D;  4IDQ A;  3ZN1 B;  4MBQ A;  3ZYM A;  2XSB A;  4ZI2 C;  3DP7 A;  1NWM X;  1X9B A;  3C4W A;  3N2O A;  5BMV E;  4UVA B;  2E5V A;  3VKG A;  4MFR A;  1ZV4 X;  1IBL T;  1QSD A;  3B5M A;  2ZM2 A;  4H9O C;  2KND A;  5L3G B;  4DND A;  4U33 A;  4I43 B;  3ONL C;  3CPZ A;  2XY8 B;  4U7Y A;  5L4E A;  2YDQ A;  4PK6 A;  2NP9 A;  5FMN A;  4GK0 E;  3P4R A;  2LSY A;  2CM0 A;  1M7K A;  2EHO B;  2VVS A;  3AB3 B;  4QKN A;  4HWI B;  5JR9 C;  1G8X A;  3KBT A;  1FMV A;  2CXF A;  2VVN A;  4KUM B;  2IAK A;  3IBP A;  4NPP A;  4CXX A;  2RPA A;  5HEO A;  4PJM A;  2KIN B;  2V6Y B;  5ABF A;  2WZI A;  2VB6 A;  3TKL B;  4H9R C;  1LKX A;  1SA0 E;  3ZC1 A;  1BR1 A;  2DI4 A;  3OBV E;  2VQF T;  1HNZ T;  5LG3 A;  5AQJ B;  1KK7 A;  2QGS A;  3RH3 A;  2FJE A;  3EVY A;  2BKP A;  4MAL A;  2WP9 A;  2PG8 A;  1OED B;  4XAX B;  3HI2 A;  5EK2 A;  1N33 T;  4ZI3 C;  2BG9 A;  5AQK B;  2XQY A;  3V5S A;  4IDN A;  3SWH A;  1YQ4 A;  1J5W A;  4EZH A;  4DV4 T;  3PUX F;  2WDQ A;  1GQE A;  1O3X A;  3JCF A;  4PNI A;  4ZOL E;  4L0R A;  2LE8 A;  4YXD A;  1Z8U A;  2FJD A;  5AQO B;  3AEF A;  3B13 A;  4TZ4 C;  5AQH B;  4A98 A;  3UUN A;  5LGN B;  3ZMV B;  3SFD A;  2UXD T;  2OV9 A;  4PAG A;  5AQI B;  3EDV A;  2CBJ A;  3IA3 A;  3AA1 B;  4JI4 T;  3SRZ A;  4LF5 T;  1VRB A;  2Q9Q C;  2VWA A;  2VK9 A;  2XM2 A;  4JI3 T;  3HKB E;  2H7V C;  5HWY A;  2E9X D;  1D1C A;  3I9Y A;  1UGO A;  2HH7 A;  2L3L A;  2L8K A;  2LHR A;  2YDS A;  3D0T A;  3L09 A;  3AE7 A;  3MXZ A;  5DJQ C;  5IYZ E;  3TLW A;  3ZPO A;  3QNU A;  4YT0 A;  4O4J E;  3B57 A;  1WR6 A;  5TAO A;  3CWZ B;  4H63 H;  4ADZ A;  2E5L T;  2BG9 C;  3L3P A;  3AAE B;  2WWV A;  1UUS A;  2DNX A;  2Q9Q B;  4NXN T;  3AEB A;  3Q5X A;  4O4L E;  3U3I A;  4AKI A;  3HKC E;  4U7I A;  2LEH A;  5ABF B;  3T1H T;  1S35 A;  5FXW A;  1LVF A;  2M67 A;  4A97 A;  1YD8 G;  2QYW A;  3PUW F;  2WM9 A;  3QK6 A;  4EIW A;  4QWN B;  1FMW A;  2CLY C;  2MTQ A;  2LSK A;  2CLY B;  2ZM8 A;  3ZLI A;  4JYA T;  3TLU A;  5FY7 A;  3RRC A;  2EHO A;  5FXV A;  2YKS A;  4CXY A;  3IHR A;  5LBM A;  3N5L A;  3HL6 A;  5LCY A;  3RI5 A;  2IC6 A;  4TWD A;  3G06 A;  3J9X 1;  4BAY B;  5KXJ A;  4ILB A;  4AQG A;  3H3A A;  2MPK A;  4GIW A;  4KMC A;  2CXL A;  1YKE B;  2XQA A;  1ZHC A;  4WW0 A;  1CUN A;  5HCJ A;  4L5G A;  3ZMT B;  5C8Y E;  5CA1 E;  4NXM T;  2WZH A;  3N9P A;  3RIU A;  4YSY A;  4B3S T;  5AQV B;  4GKJ T;  4OFZ A;  2PBI A;  3N9Q A;  3O1J A;  5DAB A;  3UU6 A;  4UF0 A;  4YSZ A;  4OK0 A;  4V1A v;  2KT9 A;  5HXR A;  3S4U A;  2JQ9 A;  5L3C B;  4DV0 T;  2Q9Q D;  3ZCJ A;  1J5E T;  4IE0 A;  3E0Z A;  1SE7 A;  2VAS A;  4DO0 A;  4LFA T;  2NW9 A;  3QOF A;  4GOU A;  2V7L A;  3F31 A;  1W0A A;  3AEC A;  4O2B E;  2C5I T;  1MMG A;  3C51 A;  3Q5E A;  4QH4 A;  2WAU A;  2ZM0 A;  2JQH A;  4UF0 B;  4JI2 T;  4EYY R;  5HYA A;  2F4V T;  2X0Y A;  2DLR A;  3FZM B;  3PDY A;  1T72 A;  2BG9 E;  3KBU A;  5HXC A;  4CI3 B;  1T8B A;  4JEU B;  4DBQ A;  3PUG A;  4JBW F;  5KDM C;  4LF7 T;  4AI6 A;  4B3R T;  2X9H A;  5FNV E;  3ZMZ B;  5AQF B;  4I55 E;  4JI1 T;  2M6I A;  2E9X A;  4HFI A;  2V1D B;  2NW7 A;  4AKH A;  2LRL A;  2N9D A;  5L47 A;  3AE9 A;  1D0Y A;  4IE5 A;  3AE8 A;  4QX8 B;  2W63 A;  3PUQ A;  5JH7 E;  3UQ7 A;  3RIF A;  4H9N C;  4YHJ A;  3GWH A;  4YJ2 E;  3PU8 A;  5LG4 A;  5IWA T;  3SFE A;  2V5D A;  2BVM A;  2VUR A;  4X64 T;  5LJM A;  3N2K E;  1D1A A;  3PUR A;  3AED A;  3P4W A;  4UVC B;  2C0S A;  4NUV A;  3AE5 A;  4WZX A;  3X1D A;  4DVD A;  4OHF A;  5JQG E;  2XAG B;  2HPL A;  1HG5 A;  4JI0 T;  3N9N A;  2H88 A;  3TLS A;  4DV6 T;  2DL1 A;  3F2E A;  3ZCI A;  3RIA A;  2HN2 A;  3AA0 B;  1U4Q A;  4IIJ E;  4YJ3 E;  2JRK A;  3NKZ A;  4I50 E;  5LOV E;  5JR9 B;  2K3W A;  2XAS B;  5F5W A;  2MAW A;  4L9I A;  3RF1 A;  1HNX T;  3LFM A;  4HKA A;  3ETU A;  3CIR A;  3KIN B;  4AKG A;  4ZEY A;  5CJ5 A;  2HN1 A;  2NR4 A;  3CVR A;  1S94 A;  3PUV F;  3AAI A;  2I59 A;  5JVD E;  1US7 B;  4ZS3 A;  3P4Q A;  2Y6X A;  3JAD A;  3A5X A;  4EOZ B;  3ZKR A;  5L3E B;  5JRC A;  3RC3 A;  4EZ4 A;  1XNQ T;  1T7S A;  2B76 A;  2DCF A;  5LYJ E;  4AQF C;  4COF A;  3RYI E;  4IDZ A;  4GK5 E;  3GN5 A;  2K24 A;  5JDQ A;  4XZC A;  3UU8 A;  3NZP A;  4LF6 T;  4XBF B;  2PFV A;  2V5C A;  3QC9 A;  4HE8 A;  4BJN A;  2XQ7 A;  4KHZ F;  2CPT A;  2CHO A;  2SPC A;  4HFC A;  3ZT5 A;  1G73 A;  2GK9 A;  5AQT B;  1HCI A;  2A9U A;  5JTG A;  1E7P A;  3E22 E;  2D9D A;  3QB5 A;  4HWH A;  3PUY F;  2X0L B;  1Y01 A;  4TWF A;  4KI0 F;  5LGT B;  1WYB A;  2C5K T;  4U72 A;  4CI1 B;  1R8I A;  2K5B B;  3VKH A;  5JRE A;  1VCS A;  5JRC B;  4QH5 A;  3ZYK A;  3AA7 B;  1EZ3 A;  4HFB A;  4PJN A;  5LJN A;  3ANW A;  1CHU A;  3LK2 B;  2CCQ A;  3ETV A;  2VL0 A;  3LBX B;  4IL4 A;  1V9D A;  1Y64 B;  1WCR A;  2N1G A;  2W61 A;  3RPU A;  5ETW A;  4LFC T;  1X79 A;  2XHE B;  2EHO D;  4KP3 C;  2BKO A;  4ILA A;  4QXB B;  4TV9 E;  5LHH B;  4H9Q C;  5HAX A;  4ANJ A;  4KBM B;  3K3N A;  3VRA A;  5JDM A;  4DV7 T;  4DR2 T;  3KFW X;  4IDO A;  4QXH B;  1YXR A;  1UCU A;  3WAK A;  3PUS A;  4KX6 A;  3N9L A;  4FJO A;  4K0K T;  4ERR A;  1D1B A;  4HWF A;  4ZI2 D;  3P4S A;  1D0Z A;  3RKG A;  5EZY E;  4PK4 A;  1SUM B;  3CQX C;  4HFH A;  5CA0 E;  2IDO B;  3LG7 A;  3M3Z B;  2YEV C;  2OLT A;  3N9M A;  1QUU A;  4PFP A;  3RC8 A;  1NEK A;  3HKE E;  2I0M A;  4IST A;  4Z8X A;  1MIY A;  3DJB A;  2VQE T;  4WNK A;  1UUR A;  5HWX A;  3RQU A;  5ABG A;  4DUY T;  4QX7 B;  3ZSS A;  4WYV A;  4JLE A;  2WB5 A;  4HWD A;  3K1S A;  3HR0 A;  5JR9 A;  4DID B;  4P1N A;  2CA5 A;  2KWI B;  3IEE A;  3KVA A;  3OYX A;  4QXC B;  5LHI B;  3EAM A;  4DV2 T;  4BJM A;  3PU3 A;  2V7M A;  1AJ3 A;  5FL0 A;  3ONJ A;  4X20 E;  2WMN A;  2YN6 A;  3NRY A;  3WI3 A;  3KDS E;  3NWI A;  3QB5 K;  2WU2 A;  2NTX A;  2LSI A;  2V6X A;  5ADX L;  2J47 A;  3UUX B;  2IHR 1;  2V6Y A;  2YDR A;  5EK3 A;  3PJA A;  2VL8 A;  2JQQ A;  3BK9 A;  3CQC B;  2JMH A;  3E08 A;  2D2S A;  3KV9 A;  3PE0 A;  4IL9 A;  2BKN A;  2IC9 A;  2X68 A;  2W00 A;  4EV6 A;  1FJG T;  3RIU C;  3LJC A;  3K3O A;  2IML A;  3F57 A;  4IGU A;  3KV6 A;  4NUU A;  4TUY E;  3SOL A;  4ASK A;  5L3B B;  1BR2 A;  1ZOY A;  3C4X A;  4U2Y A;  4X62 T;  5IHY A;  3W15 B;  4X65 T;  2YOE A;  1ZKE A;  2XAJ B;  2IIU A;  5AQQ B;  3UUB A;  1HX8 A;  2KXP B;  2WDR A;  3KV4 A;  3OKQ A;  4UIG A;  1N34 T;  2HHH T;  2WU5 A;  2A72 A;  1HFA A;  3CQG B;  4DR4 T;  1H7C A;  3BQK A;  1LVK A;  3ZC0 A;  1IZN B;  4O2A E;  4CN4 A;  3ZJ1 A;  5AQL B;  4J2C A;  2LM9 A;  4ZZC A;  2CMR A;  2JMK A;  1KNR A;  2NWB A;  4HFE A;  3ZEF B;  5M4Y A;  3OYZ A;  2X9X A;  2W67 A;  4EEB A;  3RRW A;  3ZYL A;  4YSX A;  4LMK A;  2ACX A;  2XPK A;  3P4P A;  1NAF A;  2NTY A;  3P8C D;  4P09 A;  3AEG A;  1LRZ A;  5FKY A;  4O8S A;  2KZ7 B;  4ISS A;  4UEL A;  1YQ3 A;  3AXJ A;  4IE6 A;  4JI5 T;  4DMW A;  3ZN0 B;  5FXX A;  5AQS B;  5J0Z A;  2Q9Q A;  2RA1 A;  3RYH E;  4AIU A;  1B7T A;  4ZS2 A;  1XDP A;  3O1H A;  5LB7 B;  1NEN A;  5DQW A;  2NW8 A;  1IAP A;  1ZP0 A;  1XWM A;  4HN9 A;  2LM2 A;  4P0A A;  2VKJ A;  4DR7 T;  5KMG P;  4ZHQ E;  5FXZ A;  3SS1 A;  2JQK A;  3FB2 A;  3ZJ2 A;  3RQW A;  4CI2 B;  1WFD A;  2YU2 A;  3IF8 B;  2LOS A;  5H6Q B;  2MOZ A;  3JAF A;  3PTR B;  4OYJ A;  2LSJ A;  1L0V A;  3FHN A;  4IE4 A;  4DR1 T;  4DR6 T;  2XQ5 A;  1UX4 A;  1HS7 A;  3ESL A;  4DR5 T;  3UUL A;  3CX8 B;  2DWK A;  3MKD A;  1XZY A;  2CXD A;  3O1I A;  3OVU A;  2KLQ A;  4DMV A;  1J1J A;  2ZLY A;  4X1Y E;  4X1K E;  2QVA A;  5L4H A;  2FJA A;  4HTE A;  3ABV A;  3LK4 2;  2ZMA A;  4O4H E;  3VR9 A;  1I94 T;  3JC6 D;  2KSR A;  4X66 T;  5FY1 A;  1I6Z A;  2XQ6 A;  3RKO A;  4GYS A;  2LSG A;  2VKH A;  2YIN A;  4P0B A;  4B6X A;  4HEA A;  4CN6 A;  4HWC A;  2W4X A;  2J1D G;  4YTP A;  5JDN A;  3KVB A;  4GKK T;  4H9S E;  5LHG B;  2ODU A;  2FBW A;  3ANW B;  4AIS A;  3NVO A;  1IJ5 A;  2M6B A;  3V5U A;  2J4G A;  5J2T E;  2V8S V;  3VRB A;  2XAH B;  4E7S A;  1XMO T;  2LOP A;  3MAC A;  4YTN A;  1E2A A;  2QA7 A;  2ZM6 T;  2MYS A;  4Z91 A;  2Y48 B;  4PJL A;  4LF4 T;  4ILC A;  2XTL A;  3AXJ B;  2A2F X;  5AQU B; 
#chains in the Genus database with same CATH homology
 4DV7 T;  4DR2 T;  1HNW T;  3T1H T;  4K0K T;  3OTO T;  4JYA T;  5BR8 T;  2VQE T;  4DUY T;  4B3M T;  4JI7 T;  1N36 T;  4NXM T;  1IBK T;  4DV2 T;  4B3S T;  4GKJ T;  5LMN T;  2UUA T;  4DV0 T;  1J5E T;  4JI6 T;  4LFA T;  1XNR T;  2F4V T;  4JI2 T;  1FJG T;  2UXC T;  4DUZ T;  2UUB T;  4JV5 T;  4B3T T;  2UXB T;  4X62 T;  4DR3 T;  4DV5 T;  2UUC T;  4B3R T;  4X65 T;  1N33 T;  4JI4 T;  4JI1 T;  4YHH T;  1N34 T;  2HHH T;  1IBL T;  4DR4 T;  4LFB T;  5IWA T;  4X64 T;  4KHP T;  4JI0 T;  4DV6 T;  4JI5 T;  1HNX T;  4DV3 T;  2VQF T;  4OX9 T;  1HNZ T;  4DV1 T;  4DR7 T;  5LMU T;  4JI8 T;  4LF8 T;  1XNQ T;  1HR0 T;  4DR6 T;  4DV4 T;  4DR1 T;  4YY3 T;  4DR5 T;  4LF6 T;  1XMQ T;  4LF9 T;  2UXD T;  1N32 T;  1I94 T;  4LF5 T;  4X66 T;  1IBM T;  4JI3 T;  4GKK T;  4LF7 T;  2UU9 T;  3T1Y T;  4LFC T;  1XMO T;  2E5L T;  4AQY T;  2ZM6 T;  4NXN T;  4LF4 T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...