4DV2T

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, c912a
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome
total genus 33
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 4dv2T00
4DV0T 5LMUT 4B3MT 1XMOT 2ZM6T 1J5ET 5BR8T 1XNQT 2UUCT 4DR4T 4LF5T 4KHPT 4JI0T 4GKJT 4LF6T 1N34T 4JV5T 2VQFT 1N36T 1N33T 2UU9T 4K0KT 4DV1T 2F4VT 4DR1T 1HR0T 4LF9T 4LF4T 5LMNT 1IBLT 4NXNT 1I94T 2UXDT 2VQET 4DV6T 4X64T 1HNZT 4DR3T 2HHHT 4LFAT 1XNRT 4OX9T 4JI2T 4LF8T 1IBMT 4NXMT 4JI3T 4DUYT 4DR7T 4X62T 4LF7T 4JI7T 4GKKT 1HNWT 4LFCT 4JYAT 4DV2T 3T1YT 1XMQT 4DR6T 2UXBT 4DV7T 4YY3T 2E5LT 1N32T 2UUBT 4DV4T 4X65T 4YHHT 1HNXT 4DR5T 4JI6T 2UUAT 3OTOT 1FJGT 4JI5T 2UXCT 3T1HT 4LFBT 4B3RT 4AQYT 4DUZT 4DV3T 5IWAT 4JI4T 4X66T 4JI8T 1IBKT 4B3TT 4JI1T 4DV5T 4B3ST 4DR2T
chains in the Genus database with same CATH superfamily
1HFAA 1HX1B 3CQXC 3GMIA 2CBIA 4O2BE 3ZKRA 2FJEA 5FY7A 3C50A 2WZIA 2KSRA 3KBTA 1LVFA 4AKIA 4OFZA 2BDEA 1MMGA 2KT9A 3AXJA 2P9BA 2XSBA 2H7VC 2E5VA 4IE4A 2OA5A 3B57A 5JDNA 5JDHA 1XDPA 3EDVA 2V6YB 3GA8A 4KUMB 4OX9T 4PFOA 4HFHA 2VVSA 2ZM8A 5ADXL 1YKEB 3VU7H 1MNDA 1YXRA 4GK0E 2X67A 4DV4T 1VOMA 4NPPA 2YU2A 2HN1A 4YLHA 3NZQA 1D1AA 5JQGE 5JDMA 5EK2A 1US7B 5AQGB 4PAGA 2VKOA 4HFEA 2C5KT 5AQSB 4ZZBA 1IBKT 1T8BA 4ZS2A 2K24A 5F8PA 3RHWA 2G0UA 4BA9A 2ZMAA 1NWMX 3ESLA 1J5ET 1XNQT 3H37A 4QX8B 4E7SA 2KINB 4F6RC 2GK9A 4UR9A 3OPCA 4ILAA 3MZKB 4AIUA 5M4YA 3F2EA 3AECA 4QKNA 4DV1T 2BZBA 4OK0A 1UUSA 3KINB 3N9PA 2QVAA 3OYZA 4U2YA 1MMAA 2LSJA 3HKBE 2NW9A 5JR9C 3DTOA 4YSZA 4KBMB 3IBPA 1CUNA 5H6RB 3AEDA 3QC9A 4X62T 3MXZA 4I55E 4P09A 3TLVA 3FZKB 3R84B 4QH1A 1UX5A 2D9DA 1N32T 3P4PA 5CJ5A 5FXWA 3PU8A 3L09A 5LXTE 3PURA 4AI6A 2IIUA 3OTOT 3OYXA 5IUXA 4JEHB 5L3BB 3MA9A 5E0OA 3ONLC 4L9IA 5L4EA 3SS1A 3FBLA 4UVCB 5AQHB 5FP3A 4O8SA 1XZYA 1VRBA 2YDRA 2WDQA 4ZS3A 3B13A 1N34T 1W09A 4COFA 2R6GF 1G8XA 3AE7A 2JQKA 1BR2A 2XY8B 3VKGA 2L9QA 4IDOA 2W2UA 4JEUB 2QYWA 3ZEFB 1ZOYA 3C4XA 1KNRA 3TLSA 2HPJA 3L8RA 4EGWA 3E0ZA 5LP6E 4O4JE 4YJ3E 4JI3T 2VURA 4I0UA 1T72A 2ODUA 2OLTA 4NIQA 5C3JA 5IHYA 1LVKA 4AKLA 2XQ4A 2JQHA 2WSSV 4GIWA 2V6YA 3HI2A 1HCIA 5FNVE 4EYUA 4A98A 4PK6A 3CK6A 1KEYA 2XTLA 1MIYA 2LOPA 3ETVA 1FJGT 2X66A 3KVAA 3A7MA 4AXPA 4O4HE 5LJNA 1QLBA 4U74A 3P50A 2CMRA 4B3TT 4DR2T 4YSYA 3CWZB 3UUNA 1D0ZA 3CQGB 3TLUA 4YJ2E 5GONE 1D0YA 4TNWA 2RP4A 3TLWA 3PU3A 4YXDA 5LHIB 3AEBA 4JI0T 2EHOC 3AE5A 2D0UA 5L2LA 3JCFA 4NUUA 2IDOB 3WAJA 3AAEB 3EDUA 1OWAA 4UEMA 2V7MA 4ISSA 4K0KT 5AQPB 2JMKA 5AQLB 2WM9A 2E2AA 3CVRA 5F5WA 3ONXA 2JJ9A 1W9RA 2PG8A 4Z8XA 3PUSA 2XSAA 3IA3A 3RGLA 4NXNT 4IE0A 4DV6T 2W63A 2LSIA 3TKLB 2VKJA 2AXDS 4LF8T 3SFDA 5L4HA 3HKCE 4DVDA 4IDPA 3QB5A 1LRZA 4HGAA 3JC6C 4A5XA 4I4TE 4Z90A 4DV7T 4YY3T 2BKPA 4JBWF 2A3DA 3RQWA 2X0LB 4YHHT 1HNXT 3T8OA 2CCQA 3AEAA 3BQLA 2LSYA 4GK5E 2CXLA 5LA6E 3QOFA 3W15B 4IGUA 2LKHA 3ZT5A 2FJAA 3AA6B 5F3JA 3CKDA 1UCUA 3N9NA 3FXEB 4OHFA 5IWAT 3IEEA 2NWBA 3MKDA 2HPLA 1D0XA 1HG2A 2JRKA 5LGTB 2V7IA 3OJAA 4KHPT 4H9SE 4LF6T 2X68A 2CXFA 4IIJE 4YHJA 2NR4A 2VQFT 4O4LE 5LG4A 4Z91A 3AE2A 4EIWA 4ILUA 1UK5A 4I50E 1NAFA 4EZHA 4LMLA 4EEDA 3RX6A 2ACXA 2XQ7A 3O1HA 3UQ4A 3ZYLA 5FVLA 2J47A 3AA1B 2WU2A 2E9XD 5CA1E 3P8CD 1NEKA 3WAKA 4AKHA 2I6HA 3EABA 2XQYA 4JUYA 3F57A 4KI0F 4EOZB 2WWUA 4TX5A 2EHOD 1WR0A 1FIOA 4HEAA 2VL8A 1CHUA 2J62A 5ETWA 1FMWA 3SOLA 5CA0E 3NKZA 1M7KA 3LK3B 3EUHA 2DWKA 1L0VA 5LG3A 4XBFB 5C8YE 3B5MA 5L3GB 4DV5T 3UFGA 4CXXA 4UELA 4H63H 3O1IA 2D0TA 1NENA 2WWVA 5HXCA 4IE6A 2CLYC 5BR8T 4IL9A 2A9UA 3RQUA 1W0BA 2H3RA 4B6XA 4TWHA 3JC6D 5AQNB 1JNRA 2VK9A 3K3QC 2K5BB 3ABVA 2E8IA 5C2TA 4BJNA 4UIGA 4X64T 2JMHA 2CWYA 2W0GA 2LM9A 2C0SA 3PUZF 4ZOLE 3CIRA 4U33A 2LKGA 3N5LA 3ZYMA 3ZPOA 4PJJA 1XMQT 2NTYA 4WBNE 2UUBT 2BBHA 4JI6T 1E1HB 2DLRA 4DMWA 3RKGA 3HKEE 3T1HT 3LK2B 4LFBT 4B3RT 5AQVB 3O4XE 4IDQA 3HL6A 4HFDA 4EB6E 3JAEA 2IC9A 5HEGA 4DBRA 3PJAJ 3LK42 3Q2MA 5JDGA 4YSXA 5HCJA 1M62A 5HEUA 4PJNA 2DCFA 4LF5T 1WRDA 2W67A 4U3CA 2NW8A 3UUXB 1YD8G 4JV5T 5FY1A 4CI3B 3C4WA 5HAXA 3RYHE 1S35A 5JR9B 3PJAA 2LSKA 2MPKA 2W4XA 2W00A 4BJMA 4KX6A 1IBLT 4QX7B 1WR6A 2XHEB 2MOZA 2VQET 5JTGA 4HTEA 4DR3T 1U5PA 2PFVA 1BR0A 1E2AA 2CHOA 3M65A 3ONJA 2X0HA 2WQYA 2XPKA 3AE6A 2H89A 4P0BA 2ODVA 3RF1A 4G2AA 2XAJB 4TV9E 3FZLB 1ZP0A 4QH4A 3ZYKA 4ANJA 4I43B 3ZMTB 3AA7B 5ABFA 5HEHA 3PUGA 4HE8A 1FMVA 2CHNA 3BK9A 3PDYA 1LKXA 3DJBA 4ERRA 3FZFB 3KV6A 5LOVE 3PE0A 3RYIE 2LHNA 5HXEA 4ZI2C 2D2SA 3IF8B 1BR4A 1UX4A 4EAHA 2VB6A 3AB3B 1MIWA 3Q5EA 2VASA 3RRWA 2B1EA 1W0AA 4IE5A 3N2GE 5JREA 4G63A 5AQOB 3RIUC 3ZJ2A 4QXBB 2XQ6A 1KFYA 3Q5WA 3ETUA 3ZC0A 1I94T 3QK6A 1O3XA 2YDQA 5J0ZA 2PTFA 3PUAA 4JI2T 1IAPA 3M3ZB 2NP9A 3ZN1B 4DUYT 4DR7T 4JYAT 5HWYA 3UT5E 2BBJA 3T1YT 1HS7A 3AE9A 3RYCE 3I1AA 1S94A 3I9YA 2E9XB 4X65T 1UGOA 4XZCA 4N78D 2CEAA 4HWDA 3CX7B 4NUVA 3MJXA 2ZM0A 2EHOB 2V5CA 3K1SA 4X5TA 3TLTA 3EAMA 4ZHQE 4TWFA 2UUCT 2FUPA 4GKJT 3L39A 2E9XC 2DNXA 4DIDB 1SUMB 3WI3A 3H3AA 1ZV4X 4QXHB 4EEBA 2MBGA 2ACZA 3VHLA 4H9NC 5TAOA 3I9WA 4H9QC 3AVRA 2KXPB 5LMNT 2YINA 2N9DA 4TN7B 5FMNA 3UULA 3S4UA 2XAHB 5JR9A 5ABHA 3VRAA 4QH5A 4K0UA 2LOSA 4DV2T 5HWXA 4YTMA 1HG5A 4ZI2D 1KNZA 3SFEA 2NOXA 3LFMA 2Z6EA 4ZI3D 3EHZA 4DR6T 4ZEYA 3LBXB 3N9MA 2FBWA 2ZM2A 2Q9QC 1X9BA 2LRKA 4HFVA 4PJMA 3SRZA 2K9AA 3E08A 5HEJA 4HWCA 4DNDA 2XM1A 2YOEA 3GWHA 4DV3T 3AE8A 3AE4A 2V26A 4EXTA 3HA4A 2N2NA 3P4RA 5IYZE 3F31A 3N2OA 2VKDA 4B3MT 5AQUB 3RIUA 2CXDA 4KMCA 2CE7A 5EK3A 4AISA 4YTPA 3PUWF 2KWIB 3N9LA 2D5UA 2M6IA 3HKDE 1Z8UA 4A56A 3VKHA 2JIWA 2BG9B 2F4VT 4U2ZA 3SWHA 2XM2A 4DBQA 2L3LA 2FJBA 5KXJA 2XQ3A 2KNDA 5KX5E 5EZYE 1SHZC 4PJLA 5DQVA 1Z0PA 4CI1B 3NBXX 4NXMT 3AA0B 5LJMA 5FKYA 4WBOA 3Q5XA 5FY0A 5H6QB 2XAGB 2KZ7B 3JAFA 2IMLA 3PUQA 2XQ9A 3VR9A 4KP3C 2BG9C 3O1JA 5FXXA 1JNZA 2NTXA 3AEGA 5LYJE 5LHGB 2DWGA 3ZCIA 2UUAT 2A2FX 2UXXB 3FB2A 5AQIB 2CLYB 2E9XA 3ZSTA 4WW0A 2BVLA 5ABFB 3H3MA 3OVUA 4IHJE 4HWFA 4UVBB 1XMOT 1QSDA 2YK0A 4LMJA 4JLEA 4AQFC 4EV6A 4HFBA 4TUYE 4U7IA 5A1LA 2EHOA 2IW5B 4ZZCA 3PUVF 3KBUA 2ES0A 1I6ZA 3ZC1A 5LGUB 2UU9T 3C51A 3I0QA 4IL4A 2HN2A 4V1Av 5LGNB 2Q9QD 4WNKA 2L8KA 5BMVE 3LDQB 1T98A 4LF9T 2LRLA 4EZ4A 2IHR1 4DO0A 1MNEA 4MBQA 4OYKA 2WY2A 5JH7E 2BS3A 2PJQA 4UF0B 4C90A 5L3EB 3Q9DA 2MYSA 2CBJA 3CMLA 1HX8A 3A8YC 3JADA 4ADZA 3BQKA 2YU1A 3KV5A 3GN5B 4PK5A 4Q25A 3A5XA 1U4QA 1MMNA 1V9DA 5KDMC 1IJ5A 3N9OA 4PNIA 4LMKA 3LBXA 1OEDC 4JI5T 2MTQA 2V7JA 5KMGP 2OV9A 1WFDA 3LSVA 3N2KE 2XJ7A 4TZ4C 2KWHA 3HR0A 3NRXA 1VCTA 2IAKA 3I0OA 4JI8T 1YW0A 2Y48B 4CXWA 2QA7A 4B3ST 1D1CA 2BS4A 3RC8A 4XAXB 4H9RC 4DR4T 4J2CA 3U3IA 2M6BA 1KF6A 2PBIA 2LLYA 3P4SA 3K8PC 5LHHB 4PW8A 3P4QA 2VVNA 3MACA 4PK4A 4F8HA 1HR0T 2M67A 2I59A 2W62A 2VWAA 4ZXLA 5FL1A 1KNPA 2IC6A 2WU5A 1FEWA 2HHHT 2BG9A 4HWIB 4U72A 2H88A 5HEOA 4U31A 1J1JA 2V1DB 4CXYA 5L3DB 3C4ZA 4AQGA 1UURA 2WAUA 2UXBT 4AKGA 4YFSA 3PUYF 3FBZA 1AJ3A 4QHOA 3ZCJA 1XDOA 5FXZA 5LBMA 3L3PA 2C5JA 3IHRA 3KVBA 2VKHA 2WS3A 2BVMA 5AQQB 2RPAA 5LNKA 3X1DA 2KMFA 2V7KA 4AQFA 4JI4T 3ZMVB 4C91A 4FJOA 3FHNA 2X9WA 5JVDE 5JRCB 4GYRA 5JDQA 5LMUT 4CQIA 1X79A 3ANWA 2ZM6T 2BKNA 1YQ4A 1IZNB 3E22E 3P7IA 3ZMZB 4EYYR 3AVSA 4X1IE 3ZMSB 1HTJF 1VCSA 2QRXA 3UTKA 2A72A 2BG9E 2X9YA 3KV4A 5FVKA 3R6NA 1XWMA 5JDLA 2XUEA 5LCYA 3RIFA 2X0YA 4CN1A 3CX8B 4ZI3C 5J2TE 3G06A 4KHZF 2LEHA 4MHCA 2WB5A 4L5GA 2X9XA 4MFRA 4M1PA 3ZLIA 1IBMT 3KV9A 5HXRA 5AQFB 5L47A 3UU3A 3RIAA 1DU2A 2NW7A 2IUBA 5LB7B 4O2AE 2CRBA 2I0MA 1OEDA 4PFPA 4QXCB 4UF0A 2WMOA 4H9OC 3NZPA 3O9XA 1HF8A 5DABA 2UXNB 3NWIA 2SPCA 2DHRA 2DI4A 2KLQA 2LM2A 2ZLYA 3CQCB 2XZEA 2FJDA 3RKOA 5J1GA 1MIVA 2Y6XA 3GN5A 3K3OA 3QUJA 4DUZT 2LHRA 1H7CA 4HFIA 4GYSA 3UUMA 4X66T 4WYVA 1WCRA 2YDSA 5AQJB 4X1KE 4HN9A 4IDZA 3P4WA 3RYFE 4L0RA 2JQ9A 2DL1A 2XAQB 3UFEA 3PUXF 3RRCA 2XASB 4YTNA 3FZHB 3ZT7A 5HYAA 3NVOA 1KK7A 2C5IT 4HKAA 3EI0A 2LT3A 1GQEA 4DMVA 2QGSA 3RC3A 5EK4A 3ZSSA 4X20E 4DR1T 3V5SA 4UXNB 3V5UA 3VR8A 3LJCA 4H9PC 1OXZA 2BS2A 1OEDE 4ILCA 5CB4E 1E7PA 4P1NA 2J1DG 1XNRT 3UU8A 1SA0E 4TNVA 1YKHB 2Y8DA 4OYJA 2WZHA 2WCAA 5L3CB 5AQKB 4UV8B 2Q9QB 5HXHA 5L3FB 4O4IE 3LG7A 4E7ZA 1T7SA 4WZXA 3FZMB 2XQAA 2V5DA 4A97A 3J9X1 4QWNB 2CM0A 2JQQA 4P0AA 2YKSA 4GOUA 4HWHA 1EZ3A 3D0TA 4MALA 4U7YA 5J2UE 1WLXA 1ZEEA 5AQTB 4IE7A 3AEFA 3BQIA 3VRBA 4TWDA 2N1GA 3AEEA 1MMDA 4CN4A 3AXJB 2X51A 2B76A 4BAYB 5HXSA 3CPZA 5JRCA 3ZJ1A 1WYBA 4UV9B 3UU5A 1B7TA 2MAWA 4ZI7E 3N9QA 2J4GA 4CI2B 3PTRB 4LF4T 1D1BA 2AE9A 2YN6A 3RH3A 3FXDB 5AQRB 3MK7C 3C64A 2UXDT 5AQMB 4LFAT 2CPTA 2K3WA 5JDFA 1J5WA 2XAFB 4IT4A 3OKQA 2VL0A 3RPUA 4LF7T 4JI7T 5DJQC 2WBLA 3PV0F 2CA5A 3ZN0B 4ILBA 1WYCA 2V8SV 4FI5A 2LJLA 1YQ3A 1IJ6A 3CX6B 4MLKA 4H63V 5CGMA 2BKOA 2UXCT 2WP9A 5ABGA 1ZHCA 4ASKA 3KFWX 3NRYA 4YT0A 1Y01A 5ABEA 3QB5K 1G73A 5AFUL 4DV0T 5FXVA 3EVYA 1SE7A 3UUBA 2V6XA 2LSGA 3ANWB 2K48A 2WDVA 1N36T 4TV8E 4HFCA 4IREA 3QNUA 1N33T 5HCMA 2X9HA 4CZZB 5FYMA 3AAIA 3AAAB 2V7LA 1Y64B 3AE1A 2HH7A 2LE8A 5FL0A 2WMNA 2WDRA 3AE3A 3U78A 3UQ7A 1HNZT 3K3NA 1BR1A 2RA1A 4CN6A 4AKRB 3OBVE 1ZKEA 2W66A 4GKKT 1HNWT 4LFCT 2JPFA 3RI5A 2YEVC 4UVAB 4X1YE 3Q5DA 5DQWA 5CFBA 2XQ5A 4ISTA 1QUUA 3RLFF 2E5LT 1OEDB 3C98B 5LBQB 2Q9QA 3J7Yq 4DR5T 2CWOA 2W61A 3UU6A 3UU4A 2H7OA 3ZT6A 4AQYT 3ZMUB 2XQ8A 3KDSE 4JI1T 1R8IA 3DP7A 4IDNA
chains in the Genus database with same CATH topology
4DV0T 5LMUT 4B3MT 1XMOT 2ZM6T 1J5ET 5BR8T 1XNQT 2UUCT 4DR4T 4LF5T 4KHPT 4JI0T 4GKJT 4LF6T 1N34T 4JV5T 2VQFT 1N36T 1N33T 2UU9T 4K0KT 4DV1T 2F4VT 4DR1T 1HR0T 4LF9T 4LF4T 5LMNT 1IBLT 4NXNT 1I94T 2UXDT 2VQET 4DV6T 4X64T 1HNZT 4DR3T 2HHHT 4LFAT 1XNRT 4OX9T 4JI2T 4LF8T 1IBMT 4NXMT 4JI3T 4DUYT 4DR7T 4X62T 4LF7T 4JI7T 4GKKT 1HNWT 4LFCT 4JYAT 4DV2T 3T1YT 1XMQT 4DR6T 2UXBT 4DV7T 4YY3T 2E5LT 1N32T 2UUBT 4DV4T 4X65T 4YHHT 1HNXT 4DR5T 4JI6T 2UUAT 3OTOT 1FJGT 4JI5T 2UXCT 3T1HT 4LFBT 4B3RT 4AQYT 4DUZT 4DV3T 5IWAT 4JI4T 4X66T 4JI8T 1IBKT 4B3TT 4JI1T 4DV5T 4B3ST 4DR2T
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV0 T;  5LMU T;  4B3M T;  1XMO T;  2ZM6 T;  1J5E T;  5BR8 T;  1XNQ T;  2UUC T;  4DR4 T;  4LF5 T;  4KHP T;  4JI0 T;  4GKJ T;  4LF6 T;  1N34 T;  4JV5 T;  2VQF T;  1N36 T;  1N33 T;  2UU9 T;  4K0K T;  4DV1 T;  2F4V T;  4DR1 T;  1HR0 T;  4LF9 T;  4LF4 T;  5LMN T;  1IBL T;  4NXN T;  1I94 T;  2UXD T;  2VQE T;  4DV6 T;  4X64 T;  1HNZ T;  4DR3 T;  2HHH T;  4LFA T;  1XNR T;  4OX9 T;  4JI2 T;  4LF8 T;  1IBM T;  4NXM T;  4JI3 T;  4DUY T;  4DR7 T;  4X62 T;  4LF7 T;  4JI7 T;  4GKK T;  1HNW T;  4LFC T;  4JYA T;  4DV2 T;  3T1Y T;  1XMQ T;  4DR6 T;  2UXB T;  4DV7 T;  4YY3 T;  2E5L T;  1N32 T;  2UUB T;  4DV4 T;  4X65 T;  4YHH T;  1HNX T;  4DR5 T;  4JI6 T;  2UUA T;  3OTO T;  1FJG T;  4JI5 T;  2UXC T;  3T1H T;  4LFB T;  4B3R T;  4AQY T;  4DUZ T;  4DV3 T;  5IWA T;  4JI4 T;  4X66 T;  4JI8 T;  1IBK T;  4B3T T;  4JI1 T;  4DV5 T;  4B3S T;  4DR2 T; 
#chains in the Genus database with same CATH topology
 1HFA A;  1HX1 B;  3CQX C;  3GMI A;  2CBI A;  4O2B E;  3ZKR A;  2FJE A;  5FY7 A;  3C50 A;  2WZI A;  2KSR A;  3KBT A;  1LVF A;  4AKI A;  4OFZ A;  2BDE A;  1MMG A;  2KT9 A;  3AXJ A;  2P9B A;  2XSB A;  2H7V C;  2E5V A;  4IE4 A;  2OA5 A;  3B57 A;  5JDN A;  5JDH A;  1XDP A;  3EDV A;  2V6Y B;  3GA8 A;  4KUM B;  4OX9 T;  4PFO A;  4HFH A;  2VVS A;  2ZM8 A;  5ADX L;  1YKE B;  3VU7 H;  1MND A;  1YXR A;  4GK0 E;  2X67 A;  4DV4 T;  1VOM A;  4NPP A;  2YU2 A;  2HN1 A;  4YLH A;  3NZQ A;  1D1A A;  5JQG E;  5JDM A;  5EK2 A;  1US7 B;  5AQG B;  4PAG A;  2VKO A;  4HFE A;  2C5K T;  5AQS B;  4ZZB A;  1IBK T;  1T8B A;  4ZS2 A;  2K24 A;  5F8P A;  3RHW A;  2G0U A;  4BA9 A;  2ZMA A;  1NWM X;  3ESL A;  1J5E T;  1XNQ T;  3H37 A;  4QX8 B;  4E7S A;  2KIN B;  4F6R C;  2GK9 A;  4UR9 A;  3OPC A;  4ILA A;  3MZK B;  4AIU A;  5M4Y A;  3F2E A;  3AEC A;  4QKN A;  4DV1 T;  2BZB A;  4OK0 A;  1UUS A;  3KIN B;  3N9P A;  2QVA A;  3OYZ A;  4U2Y A;  1MMA A;  2LSJ A;  3HKB E;  2NW9 A;  5JR9 C;  3DTO A;  4YSZ A;  4KBM B;  3IBP A;  1CUN A;  5H6R B;  3AED A;  3QC9 A;  4X62 T;  3MXZ A;  4I55 E;  4P09 A;  3TLV A;  3FZK B;  3R84 B;  4QH1 A;  1UX5 A;  2D9D A;  1N32 T;  3P4P A;  5CJ5 A;  5FXW A;  3PU8 A;  3L09 A;  5LXT E;  3PUR A;  4AI6 A;  2IIU A;  3OTO T;  3OYX A;  5IUX A;  4JEH B;  5L3B B;  3MA9 A;  5E0O A;  3ONL C;  4L9I A;  5L4E A;  3SS1 A;  3FBL A;  4UVC B;  5AQH B;  5FP3 A;  4O8S A;  1XZY A;  1VRB A;  2YDR A;  2WDQ A;  4ZS3 A;  3B13 A;  1N34 T;  1W09 A;  4COF A;  2R6G F;  1G8X A;  3AE7 A;  2JQK A;  1BR2 A;  2XY8 B;  3VKG A;  2L9Q A;  4IDO A;  2W2U A;  4JEU B;  2QYW A;  3ZEF B;  1ZOY A;  3C4X A;  1KNR A;  3TLS A;  2HPJ A;  3L8R A;  4EGW A;  3E0Z A;  5LP6 E;  4O4J E;  4YJ3 E;  4JI3 T;  2VUR A;  4I0U A;  1T72 A;  2ODU A;  2OLT A;  4NIQ A;  5C3J A;  5IHY A;  1LVK A;  4AKL A;  2XQ4 A;  2JQH A;  2WSS V;  4GIW A;  2V6Y A;  3HI2 A;  1HCI A;  5FNV E;  4EYU A;  4A98 A;  4PK6 A;  3CK6 A;  1KEY A;  2XTL A;  1MIY A;  2LOP A;  3ETV A;  1FJG T;  2X66 A;  3KVA A;  3A7M A;  4AXP A;  4O4H E;  5LJN A;  1QLB A;  4U74 A;  3P50 A;  2CMR A;  4B3T T;  4DR2 T;  4YSY A;  3CWZ B;  3UUN A;  1D0Z A;  3CQG B;  3TLU A;  4YJ2 E;  5GON E;  1D0Y A;  4TNW A;  2RP4 A;  3TLW A;  3PU3 A;  4YXD A;  5LHI B;  3AEB A;  4JI0 T;  2EHO C;  3AE5 A;  2D0U A;  5L2L A;  3JCF A;  4NUU A;  2IDO B;  3WAJ A;  3AAE B;  3EDU A;  1OWA A;  4UEM A;  2V7M A;  4ISS A;  4K0K T;  5AQP B;  2JMK A;  5AQL B;  2WM9 A;  2E2A A;  3CVR A;  5F5W A;  3ONX A;  2JJ9 A;  1W9R A;  2PG8 A;  4Z8X A;  3PUS A;  2XSA A;  3IA3 A;  3RGL A;  4NXN T;  4IE0 A;  4DV6 T;  2W63 A;  2LSI A;  3TKL B;  2VKJ A;  2AXD S;  4LF8 T;  3SFD A;  5L4H A;  3HKC E;  4DVD A;  4IDP A;  3QB5 A;  1LRZ A;  4HGA A;  3JC6 C;  4A5X A;  4I4T E;  4Z90 A;  4DV7 T;  4YY3 T;  2BKP A;  4JBW F;  2A3D A;  3RQW A;  2X0L B;  4YHH T;  1HNX T;  3T8O A;  2CCQ A;  3AEA A;  3BQL A;  2LSY A;  4GK5 E;  2CXL A;  5LA6 E;  3QOF A;  3W15 B;  4IGU A;  2LKH A;  3ZT5 A;  2FJA A;  3AA6 B;  5F3J A;  3CKD A;  1UCU A;  3N9N A;  3FXE B;  4OHF A;  5IWA T;  3IEE A;  2NWB A;  3MKD A;  2HPL A;  1D0X A;  1HG2 A;  2JRK A;  5LGT B;  2V7I A;  3OJA A;  4KHP T;  4H9S E;  4LF6 T;  2X68 A;  2CXF A;  4IIJ E;  4YHJ A;  2NR4 A;  2VQF T;  4O4L E;  5LG4 A;  4Z91 A;  3AE2 A;  4EIW A;  4ILU A;  1UK5 A;  4I50 E;  1NAF A;  4EZH A;  4LML A;  4EED A;  3RX6 A;  2ACX A;  2XQ7 A;  3O1H A;  3UQ4 A;  3ZYL A;  5FVL A;  2J47 A;  3AA1 B;  2WU2 A;  2E9X D;  5CA1 E;  3P8C D;  1NEK A;  3WAK A;  4AKH A;  2I6H A;  3EAB A;  2XQY A;  4JUY A;  3F57 A;  4KI0 F;  4EOZ B;  2WWU A;  4TX5 A;  2EHO D;  1WR0 A;  1FIO A;  4HEA A;  2VL8 A;  1CHU A;  2J62 A;  5ETW A;  1FMW A;  3SOL A;  5CA0 E;  3NKZ A;  1M7K A;  3LK3 B;  3EUH A;  2DWK A;  1L0V A;  5LG3 A;  4XBF B;  5C8Y E;  3B5M A;  5L3G B;  4DV5 T;  3UFG A;  4CXX A;  4UEL A;  4H63 H;  3O1I A;  2D0T A;  1NEN A;  2WWV A;  5HXC A;  4IE6 A;  2CLY C;  5BR8 T;  4IL9 A;  2A9U A;  3RQU A;  1W0B A;  2H3R A;  4B6X A;  4TWH A;  3JC6 D;  5AQN B;  1JNR A;  2VK9 A;  3K3Q C;  2K5B B;  3ABV A;  2E8I A;  5C2T A;  4BJN A;  4UIG A;  4X64 T;  2JMH A;  2CWY A;  2W0G A;  2LM9 A;  2C0S A;  3PUZ F;  4ZOL E;  3CIR A;  4U33 A;  2LKG A;  3N5L A;  3ZYM A;  3ZPO A;  4PJJ A;  1XMQ T;  2NTY A;  4WBN E;  2UUB T;  2BBH A;  4JI6 T;  1E1H B;  2DLR A;  4DMW A;  3RKG A;  3HKE E;  3T1H T;  3LK2 B;  4LFB T;  4B3R T;  5AQV B;  3O4X E;  4IDQ A;  3HL6 A;  4HFD A;  4EB6 E;  3JAE A;  2IC9 A;  5HEG A;  4DBR A;  3PJA J;  3LK4 2;  3Q2M A;  5JDG A;  4YSX A;  5HCJ A;  1M62 A;  5HEU A;  4PJN A;  2DCF A;  4LF5 T;  1WRD A;  2W67 A;  4U3C A;  2NW8 A;  3UUX B;  1YD8 G;  4JV5 T;  5FY1 A;  4CI3 B;  3C4W A;  5HAX A;  3RYH E;  1S35 A;  5JR9 B;  3PJA A;  2LSK A;  2MPK A;  2W4X A;  2W00 A;  4BJM A;  4KX6 A;  1IBL T;  4QX7 B;  1WR6 A;  2XHE B;  2MOZ A;  2VQE T;  5JTG A;  4HTE A;  4DR3 T;  1U5P A;  2PFV A;  1BR0 A;  1E2A A;  2CHO A;  3M65 A;  3ONJ A;  2X0H A;  2WQY A;  2XPK A;  3AE6 A;  2H89 A;  4P0B A;  2ODV A;  3RF1 A;  4G2A A;  2XAJ B;  4TV9 E;  3FZL B;  1ZP0 A;  4QH4 A;  3ZYK A;  4ANJ A;  4I43 B;  3ZMT B;  3AA7 B;  5ABF A;  5HEH A;  3PUG A;  4HE8 A;  1FMV A;  2CHN A;  3BK9 A;  3PDY A;  1LKX A;  3DJB A;  4ERR A;  3FZF B;  3KV6 A;  5LOV E;  3PE0 A;  3RYI E;  2LHN A;  5HXE A;  4ZI2 C;  2D2S A;  3IF8 B;  1BR4 A;  1UX4 A;  4EAH A;  2VB6 A;  3AB3 B;  1MIW A;  3Q5E A;  2VAS A;  3RRW A;  2B1E A;  1W0A A;  4IE5 A;  3N2G E;  5JRE A;  4G63 A;  5AQO B;  3RIU C;  3ZJ2 A;  4QXB B;  2XQ6 A;  1KFY A;  3Q5W A;  3ETU A;  3ZC0 A;  1I94 T;  3QK6 A;  1O3X A;  2YDQ A;  5J0Z A;  2PTF A;  3PUA A;  4JI2 T;  1IAP A;  3M3Z B;  2NP9 A;  3ZN1 B;  4DUY T;  4DR7 T;  4JYA T;  5HWY A;  3UT5 E;  2BBJ A;  3T1Y T;  1HS7 A;  3AE9 A;  3RYC E;  3I1A A;  1S94 A;  3I9Y A;  2E9X B;  4X65 T;  1UGO A;  4XZC A;  4N78 D;  2CEA A;  4HWD A;  3CX7 B;  4NUV A;  3MJX A;  2ZM0 A;  2EHO B;  2V5C A;  3K1S A;  4X5T A;  3TLT A;  3EAM A;  4ZHQ E;  4TWF A;  2UUC T;  2FUP A;  4GKJ T;  3L39 A;  2E9X C;  2DNX A;  4DID B;  1SUM B;  3WI3 A;  3H3A A;  1ZV4 X;  4QXH B;  4EEB A;  2MBG A;  2ACZ A;  3VHL A;  4H9N C;  5TAO A;  3I9W A;  4H9Q C;  3AVR A;  2KXP B;  5LMN T;  2YIN A;  2N9D A;  4TN7 B;  5FMN A;  3UUL A;  3S4U A;  2XAH B;  5JR9 A;  5ABH A;  3VRA A;  4QH5 A;  4K0U A;  2LOS A;  4DV2 T;  5HWX A;  4YTM A;  1HG5 A;  4ZI2 D;  1KNZ A;  3SFE A;  2NOX A;  3LFM A;  2Z6E A;  4ZI3 D;  3EHZ A;  4DR6 T;  4ZEY A;  3LBX B;  3N9M A;  2FBW A;  2ZM2 A;  2Q9Q C;  1X9B A;  2LRK A;  4HFV A;  4PJM A;  3SRZ A;  2K9A A;  3E08 A;  5HEJ A;  4HWC A;  4DND A;  2XM1 A;  2YOE A;  3GWH A;  4DV3 T;  3AE8 A;  3AE4 A;  2V26 A;  4EXT A;  3HA4 A;  2N2N A;  3P4R A;  5IYZ E;  3F31 A;  3N2O A;  2VKD A;  4B3M T;  5AQU B;  3RIU A;  2CXD A;  4KMC A;  2CE7 A;  5EK3 A;  4AIS A;  4YTP A;  3PUW F;  2KWI B;  3N9L A;  2D5U A;  2M6I A;  3HKD E;  1Z8U A;  4A56 A;  3VKH A;  2JIW A;  2BG9 B;  2F4V T;  4U2Z A;  3SWH A;  2XM2 A;  4DBQ A;  2L3L A;  2FJB A;  5KXJ A;  2XQ3 A;  2KND A;  5KX5 E;  5EZY E;  1SHZ C;  4PJL A;  5DQV A;  1Z0P A;  4CI1 B;  3NBX X;  4NXM T;  3AA0 B;  5LJM A;  5FKY A;  4WBO A;  3Q5X A;  5FY0 A;  5H6Q B;  2XAG B;  2KZ7 B;  3JAF A;  2IML A;  3PUQ A;  2XQ9 A;  3VR9 A;  4KP3 C;  2BG9 C;  3O1J A;  5FXX A;  1JNZ A;  2NTX A;  3AEG A;  5LYJ E;  5LHG B;  2DWG A;  3ZCI A;  2UUA T;  2A2F X;  2UXX B;  3FB2 A;  5AQI B;  2CLY B;  2E9X A;  3ZST A;  4WW0 A;  2BVL A;  5ABF B;  3H3M A;  3OVU A;  4IHJ E;  4HWF A;  4UVB B;  1XMO T;  1QSD A;  2YK0 A;  4LMJ A;  4JLE A;  4AQF C;  4EV6 A;  4HFB A;  4TUY E;  4U7I A;  5A1L A;  2EHO A;  2IW5 B;  4ZZC A;  3PUV F;  3KBU A;  2ES0 A;  1I6Z A;  3ZC1 A;  5LGU B;  2UU9 T;  3C51 A;  3I0Q A;  4IL4 A;  2HN2 A;  4V1A v;  5LGN B;  2Q9Q D;  4WNK A;  2L8K A;  5BMV E;  3LDQ B;  1T98 A;  4LF9 T;  2LRL A;  4EZ4 A;  2IHR 1;  4DO0 A;  1MNE A;  4MBQ A;  4OYK A;  2WY2 A;  5JH7 E;  2BS3 A;  2PJQ A;  4UF0 B;  4C90 A;  5L3E B;  3Q9D A;  2MYS A;  2CBJ A;  3CML A;  1HX8 A;  3A8Y C;  3JAD A;  4ADZ A;  3BQK A;  2YU1 A;  3KV5 A;  3GN5 B;  4PK5 A;  4Q25 A;  3A5X A;  1U4Q A;  1MMN A;  1V9D A;  5KDM C;  1IJ5 A;  3N9O A;  4PNI A;  4LMK A;  3LBX A;  1OED C;  4JI5 T;  2MTQ A;  2V7J A;  5KMG P;  2OV9 A;  1WFD A;  3LSV A;  3N2K E;  2XJ7 A;  4TZ4 C;  2KWH A;  3HR0 A;  3NRX A;  1VCT A;  2IAK A;  3I0O A;  4JI8 T;  1YW0 A;  2Y48 B;  4CXW A;  2QA7 A;  4B3S T;  1D1C A;  2BS4 A;  3RC8 A;  4XAX B;  4H9R C;  4DR4 T;  4J2C A;  3U3I A;  2M6B A;  1KF6 A;  2PBI A;  2LLY A;  3P4S A;  3K8P C;  5LHH B;  4PW8 A;  3P4Q A;  2VVN A;  3MAC A;  4PK4 A;  4F8H A;  1HR0 T;  2M67 A;  2I59 A;  2W62 A;  2VWA A;  4ZXL A;  5FL1 A;  1KNP A;  2IC6 A;  2WU5 A;  1FEW A;  2HHH T;  2BG9 A;  4HWI B;  4U72 A;  2H88 A;  5HEO A;  4U31 A;  1J1J A;  2V1D B;  4CXY A;  5L3D B;  3C4Z A;  4AQG A;  1UUR A;  2WAU A;  2UXB T;  4AKG A;  4YFS A;  3PUY F;  3FBZ A;  1AJ3 A;  4QHO A;  3ZCJ A;  1XDO A;  5FXZ A;  5LBM A;  3L3P A;  2C5J A;  3IHR A;  3KVB A;  2VKH A;  2WS3 A;  2BVM A;  5AQQ B;  2RPA A;  5LNK A;  3X1D A;  2KMF A;  2V7K A;  4AQF A;  4JI4 T;  3ZMV B;  4C91 A;  4FJO A;  3FHN A;  2X9W A;  5JVD E;  5JRC B;  4GYR A;  5JDQ A;  5LMU T;  4CQI A;  1X79 A;  3ANW A;  2ZM6 T;  2BKN A;  1YQ4 A;  1IZN B;  3E22 E;  3P7I A;  3ZMZ B;  4EYY R;  3AVS A;  4X1I E;  3ZMS B;  1HTJ F;  1VCS A;  2QRX A;  3UTK A;  2A72 A;  2BG9 E;  2X9Y A;  3KV4 A;  5FVK A;  3R6N A;  1XWM A;  5JDL A;  2XUE A;  5LCY A;  3RIF A;  2X0Y A;  4CN1 A;  3CX8 B;  4ZI3 C;  5J2T E;  3G06 A;  4KHZ F;  2LEH A;  4MHC A;  2WB5 A;  4L5G A;  2X9X A;  4MFR A;  4M1P A;  3ZLI A;  1IBM T;  3KV9 A;  5HXR A;  5AQF B;  5L47 A;  3UU3 A;  3RIA A;  1DU2 A;  2NW7 A;  2IUB A;  5LB7 B;  4O2A E;  2CRB A;  2I0M A;  1OED A;  4PFP A;  4QXC B;  4UF0 A;  2WMO A;  4H9O C;  3NZP A;  3O9X A;  1HF8 A;  5DAB A;  2UXN B;  3NWI A;  2SPC A;  2DHR A;  2DI4 A;  2KLQ A;  2LM2 A;  2ZLY A;  3CQC B;  2XZE A;  2FJD A;  3RKO A;  5J1G A;  1MIV A;  2Y6X A;  3GN5 A;  3K3O A;  3QUJ A;  4DUZ T;  2LHR A;  1H7C A;  4HFI A;  4GYS A;  3UUM A;  4X66 T;  4WYV A;  1WCR A;  2YDS A;  5AQJ B;  4X1K E;  4HN9 A;  4IDZ A;  3P4W A;  3RYF E;  4L0R A;  2JQ9 A;  2DL1 A;  2XAQ B;  3UFE A;  3PUX F;  3RRC A;  2XAS B;  4YTN A;  3FZH B;  3ZT7 A;  5HYA A;  3NVO A;  1KK7 A;  2C5I T;  4HKA A;  3EI0 A;  2LT3 A;  1GQE A;  4DMV A;  2QGS A;  3RC3 A;  5EK4 A;  3ZSS A;  4X20 E;  4DR1 T;  3V5S A;  4UXN B;  3V5U A;  3VR8 A;  3LJC A;  4H9P C;  1OXZ A;  2BS2 A;  1OED E;  4ILC A;  5CB4 E;  1E7P A;  4P1N A;  2J1D G;  1XNR T;  3UU8 A;  1SA0 E;  4TNV A;  1YKH B;  2Y8D A;  4OYJ A;  2WZH A;  2WCA A;  5L3C B;  5AQK B;  4UV8 B;  2Q9Q B;  5HXH A;  5L3F B;  4O4I E;  3LG7 A;  4E7Z A;  1T7S A;  4WZX A;  3FZM B;  2XQA A;  2V5D A;  4A97 A;  3J9X 1;  4QWN B;  2CM0 A;  2JQQ A;  4P0A A;  2YKS A;  4GOU A;  4HWH A;  1EZ3 A;  3D0T A;  4MAL A;  4U7Y A;  5J2U E;  1WLX A;  1ZEE A;  5AQT B;  4IE7 A;  3AEF A;  3BQI A;  3VRB A;  4TWD A;  2N1G A;  3AEE A;  1MMD A;  4CN4 A;  3AXJ B;  2X51 A;  2B76 A;  4BAY B;  5HXS A;  3CPZ A;  5JRC A;  3ZJ1 A;  1WYB A;  4UV9 B;  3UU5 A;  1B7T A;  2MAW A;  4ZI7 E;  3N9Q A;  2J4G A;  4CI2 B;  3PTR B;  4LF4 T;  1D1B A;  2AE9 A;  2YN6 A;  3RH3 A;  3FXD B;  5AQR B;  3MK7 C;  3C64 A;  2UXD T;  5AQM B;  4LFA T;  2CPT A;  2K3W A;  5JDF A;  1J5W A;  2XAF B;  4IT4 A;  3OKQ A;  2VL0 A;  3RPU A;  4LF7 T;  4JI7 T;  5DJQ C;  2WBL A;  3PV0 F;  2CA5 A;  3ZN0 B;  4ILB A;  1WYC A;  2V8S V;  4FI5 A;  2LJL A;  1YQ3 A;  1IJ6 A;  3CX6 B;  4MLK A;  4H63 V;  5CGM A;  2BKO A;  2UXC T;  2WP9 A;  5ABG A;  1ZHC A;  4ASK A;  3KFW X;  3NRY A;  4YT0 A;  1Y01 A;  5ABE A;  3QB5 K;  1G73 A;  5AFU L;  4DV0 T;  5FXV A;  3EVY A;  1SE7 A;  3UUB A;  2V6X A;  2LSG A;  3ANW B;  2K48 A;  2WDV A;  1N36 T;  4TV8 E;  4HFC A;  4IRE A;  3QNU A;  1N33 T;  5HCM A;  2X9H A;  4CZZ B;  5FYM A;  3AAI A;  3AAA B;  2V7L A;  1Y64 B;  3AE1 A;  2HH7 A;  2LE8 A;  5FL0 A;  2WMN A;  2WDR A;  3AE3 A;  3U78 A;  3UQ7 A;  1HNZ T;  3K3N A;  1BR1 A;  2RA1 A;  4CN6 A;  4AKR B;  3OBV E;  1ZKE A;  2W66 A;  4GKK T;  1HNW T;  4LFC T;  2JPF A;  3RI5 A;  2YEV C;  4UVA B;  4X1Y E;  3Q5D A;  5DQW A;  5CFB A;  2XQ5 A;  4IST A;  1QUU A;  3RLF F;  2E5L T;  1OED B;  3C98 B;  5LBQ B;  2Q9Q A;  3J7Y q;  4DR5 T;  2CWO A;  2W61 A;  3UU6 A;  3UU4 A;  2H7O A;  3ZT6 A;  4AQY T;  3ZMU B;  2XQ8 A;  3KDS E;  4JI1 T;  1R8I A;  3DP7 A;  4IDN A; 
#chains in the Genus database with same CATH homology
 4DV0 T;  5LMU T;  4B3M T;  1XMO T;  2ZM6 T;  1J5E T;  5BR8 T;  1XNQ T;  2UUC T;  4DR4 T;  4LF5 T;  4KHP T;  4JI0 T;  4GKJ T;  4LF6 T;  1N34 T;  4JV5 T;  2VQF T;  1N36 T;  1N33 T;  2UU9 T;  4K0K T;  4DV1 T;  2F4V T;  4DR1 T;  1HR0 T;  4LF9 T;  4LF4 T;  5LMN T;  1IBL T;  4NXN T;  1I94 T;  2UXD T;  2VQE T;  4DV6 T;  4X64 T;  1HNZ T;  4DR3 T;  2HHH T;  4LFA T;  1XNR T;  4OX9 T;  4JI2 T;  4LF8 T;  1IBM T;  4NXM T;  4JI3 T;  4DUY T;  4DR7 T;  4X62 T;  4LF7 T;  4JI7 T;  4GKK T;  1HNW T;  4LFC T;  4JYA T;  4DV2 T;  3T1Y T;  1XMQ T;  4DR6 T;  2UXB T;  4DV7 T;  4YY3 T;  2E5L T;  1N32 T;  2UUB T;  4DV4 T;  4X65 T;  4YHH T;  1HNX T;  4DR5 T;  4JI6 T;  2UUA T;  3OTO T;  1FJG T;  4JI5 T;  2UXC T;  3T1H T;  4LFB T;  4B3R T;  4AQY T;  4DUZ T;  4DV3 T;  5IWA T;  4JI4 T;  4X66 T;  4JI8 T;  1IBK T;  4B3T T;  4JI1 T;  4DV5 T;  4B3S T;  4DR2 T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...