4LFBT

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
total genus 36
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 4lfbT00
4JI6T 4LF5T 4X65T 1HNXT 1HNZT 4B3RT 4OX9T 4DUZT 2HHHT 4LFBT 1IBLT 2UUBT 4JV5T 1HR0T 1XNQT 3T1HT 4DV1T 4DV3T 4JI3T 2ZM6T 4DR3T 2UUAT 2VQET 4X64T 4NXNT 4DUYT 4DR4T 5BR8T 4DR2T 1N36T 4JI7T 1FJGT 4DR1T 4DV4T 1J5ET 5IWAT 4AQYT 4JI0T 4B3TT 4JI5T 5LMNT 4JI8T 4LF8T 4JI4T 4LFAT 2E5LT 1N33T 4LFCT 1IBMT 1XMOT 1N34T 4DR5T 4GKJT 4DR6T 2UXDT 4X66T 4DV0T 2UU9T 4DV5T 2F4VT 4LF6T 4DV7T 5LMUT 1HNWT 3OTOT 4KHPT 2UXBT 2UUCT 1XMQT 4JI1T 4YY3T 4JYAT 4DR7T 2VQFT 4B3MT 4X62T 4LF7T 1IBKT 4LF9T 1N32T 4LF4T 4DV2T 3T1YT 1XNRT 4YHHT 4GKKT 1I94T 4K0KT 4DV6T 2UXCT 4JI2T 4B3ST 4NXMT
chains in the Genus database with same CATH superfamily
3O9XA 4OK0A 1OEDC 4U7YA 5LNKA 3NZPA 3ANWB 1UURA 3LDQB 5FVKA 3K3OA 5HXEA 2DL1A 1LVKA 4BJNA 1D1BA 2XQ9A 2UUAT 3EABA 3VR9A 3AA7B 3DTOA 3K8PC 4QH4A 1M7KA 4TNVA 3NKZA 3GN5A 5JH7E 4EZ4A 4HWCA 3ZLIA 2LRLA 4TUYE 2L3LA 4UF0A 3T8OA 4LFAT 2MAWA 4LMKA 3LSVA 3MXZA 4QXCB 5ABFA 1IBMT 3VRAA 4DR5T 5L3GB 1VOMA 4U2YA 3GWHA 2WMNA 2FJBA 3ONJA 3AE5A 1ZOYA 2WM9A 5AQJB 3RKOA 3OTOT 3PUQA 3N5LA 3ZT5A 3CK6A 3RPUA 1OEDB 3AAIA 2WAUA 4AKGA 1UCUA 3W15B 3RYIE 3AA6B 4EB6E 2NW8A 2V5DA 3EUHA 5AQUB 5FP3A 3ZYKA 2ES0A 2CRBA 3IA3A 3Q2MA 5JDQA 2YN6A 3C4WA 4GYRA 2HHHT 4P0AA 3AVRA 1IBLT 3ZCIA 4GOUA 4OHFA 5JVDE 5M4YA 4P0BA 2VQET 1J1JA 3JAEA 4MHCA 4QH5A 5CJ5A 3ZKRA 5AQQB 2WY2A 1UX5A 2OA5A 4AQYT 3K1SA 3WAJA 3VR8A 4O4JE 5LYJE 2V7IA 2E5LT 4I0UA 2LT3A 3N9OA 2LEHA 4DIDB 3UU5A 4GKJT 1KFYA 3CWZB 1D0YA 2XQ3A 4ADZA 4AISA 2CWOA 3IEEA 2PFVA 3ABVA 2B76A 1CHUA 4DNDA 4B3MT 1WFDA 5ABEA 4X1IE 5FL1A 3NWIA 1W0AA 3AEBA 3VRBA 4DV6T 3PUVF 2KWIB 3MA9A 2V8SV 4NXMT 3DP7A 2XQ5A 3U3IA 2J1DG 4Z8XA 3UT5E 1KNRA 3OBVE 4G2AA 5JREA 2FJAA 2BG9A 5LGTB 1HR0T 5LGNB 3LBXA 4OFZA 2YDQA 3Q5WA 3HL6A 3RF1A 4DR2T 2M67A 3QK6A 3B5MA 3Q5DA 3P8CD 1T98A 3ZT6A 2QYWA 3E08A 3P50A 5EK3A 1W09A 3A8YC 2LHNA 4A5XA 3CX7B 4I50E 5JQGE 5LMNT 3RC8A 2WZIA 3N9QA 4X5TA 3NVOA 4YTNA 2GK9A 4PK5A 4KHPT 2UUCT 3ZCJA 2C5KT 4YY3T 3AA1B 3O1JA 5AQOB 1XWMA 5AQRB 3RLFF 3PUGA 3PU8A 1HG5A 4ZZBA 4DMWA 3TLTA 3ZYMA 3LK3B 3KDSE 4ZS2A 1KNPA 5AQKB 2FUPA 3QB5A 2OV9A 3F2EA 5HEUA 4IDNA 4AQFC 5FNVE 3AEDA 2XUEA 5HXSA 2VURA 2E9XC 5AQPB 3LG7A 1G73A 3QC9A 3PV0F 2CBJA 5L3FB 2E9XD 1QLBA 4I43B 3ETVA 4ANJA 1HFAA 1JNZA 3AAAB 2X66A 5FY7A 3VHLA 4U3CA 4AXPA 3NRXA 4FJOA 2RA1A 2WB5A 5HWYA 2CCQA 3PU3A 2QVAA 4DR4T 1N36T 4HKAA 1D1AA 5F5WA 1ZV4X 3MK7C 4AQGA 2FBWA 2A2FX 2BVMA 3ZN0B 3KV6A 2LSJA 2PBIA 1NWMX 4LF8T 1UX4A 2DLRA 4IT4A 2YKSA 3UUXB 4E7SA 3C51A 3K3NA 2BDEA 4COFA 1U5PA 1LRZA 3FB2A 4ZXLA 2V6YA 5L3DB 2J62A 2UXBT 3UU8A 4YHJA 2AXDS 3RQWA 2DI4A 1ZP0A 4QWNB 3D0TA 1D1CA 2XAHB 5EK4A 1MIVA 4YSXA 2UXCT 2LE8A 3CMLA 1B7TA 2YU1A 5ETWA 2BZBA 4P1NA 3L3PA 4EV6A 4IE0A 3X1DA 4H63H 4H9NC 5H6QB 5FXWA 2WDQA 2UXXB 3HA4A 2A3DA 5L2LA 2ACZA 2I59A 3RIUC 4LFBT 4PJMA 4DV1T 3H37A 1OXZA 3SFDA 1KNZA 2I6HA 3VKGA 4NXNT 2WDVA 5LCYA 3GMIA 2CEAA 3SS1A 2X9HA 4DR1T 5LGUB 4EEBA 4H9SE 4XBFB 2RPAA 2CMRA 3LFMA 2NW7A 2IDOB 5J0ZA 5L3EB 2LSGA 5LJMA 4TZ4C 5L3BB 5ABGA 4CI1B 3KFWX 5CFBA 1XZYA 2K48A 4JI1T 2XAFB 4A97A 4PJLA 4MFRA 1IBKT 3ONLC 3ZMTB 4UVBB 4HFEA 2CBIA 3Q5EA 4PJNA 3PUZF 5LBQB 4H9QC 4JI2T 2VKJA 5AQFB 4Z91A 4IDZA 4TV8E 4HFIA 4CN1A 3OKQA 2YK0A 4NIQA 4X65T 3NBXX 4UV8B 5L47A 2OLTA 4X20E 1SA0E 4F8HA 2EHOA 2ODVA 3CX8B 4O4HE 4PAGA 4BJMA 4HFHA 4YFSA 5J2TE 3AXJA 4QHOA 3ETUA 3QNUA 1GQEA 1WLXA 1V9DA 3E22E 4DV4T 4L9IA 2K5BB 2KNDA 3LK42 5LJNA 2X9XA 3IBPA 2XZEA 2ZM0A 3U78A 4ZS3A 1XMOT 2V5CA 4DR6T 4HFDA 4AKLA 2M6BA 2W4XA 2NTYA 4UELA 3MJXA 2YOEA 3BK9A 5EK2A 2KXPB 4DV5T 2F4VT 4DV7T 4A56A 3LJCA 3FZKB 2IC6A 3AE6A 2WCAA 1M62A 4IDOA 4IHJE 2PG8A 3CQXC 5KX5E 3O1HA 2VVNA 5LHGB 3C64A 3SFEA 2IAKA 3UFGA 1CUNA 3AVSA 2IHR1 1MMNA 1OEDE 4O4LE 4DV2T 2E5VA 4V1Av 5C3JA 3N2KE 3C4ZA 3KVAA 2Q9QC 4HEAA 2V6XA 4BAYB 2Q9QD 3G06A 3PUYF 5HEOA 2YINA 3AEFA 2YU2A 5TAOA 2BKOA 2H7OA 1W9RA 5AQVB 3O4XE 1MIYA 3LK2B 4U33A 2CWYA 2L8KA 4ASKA 4YSYA 3ZMUB 4I55E 4EZHA 4YJ3E 3I9WA 2DWKA 3MACA 5JDGA 1SHZC 3KINB 2V7JA 3CPZA 5HEHA 2XPKA 3OYXA 4B3TT 3ANWA 5HAXA 3EDVA 3KV5A 4C90A 4HFBA 4UIGA 2UXDT 3QOFA 2CE7A 3A5XA 4DV0T 4X1YE 2X0YA 3FXEB 4YTMA 3ZYLA 3JAFA 2CXDA 4IDQA 4NUUA 5KMGP 3AE8A 5FY1A 2XAGB 2DCFA 2Q9QB 2XJ7A 4JLEA 4J2CA 1YQ3A 3T1YT 2XQAA 5LBMA 3UU4A 2ZM2A 1I94T 2JQHA 4K0KT 2CHNA 1UUSA 3CVRA 2G0UA 2N1GA 2X67A 3GA8A 1S94A 4ZI2C 2VKHA 5JRCB 2LRKA 4CI2B 4ZI2D 3AE3A 5FL0A 4GK5E 2D0TA 2WP9A 1HX1B 2KZ7B 2V7KA 2UUBT 3AE1A 3ZC0A 1D0ZA 1Y64B 3I9YA 3R84B 1FMWA 3TLUA 4X64T 3AE2A 5CA1E 2LKHA 3EDUA 3N2GE 1FJGT 3PUWF 4EAHA 3DJBA 2IC9A 1YQ4A 5J1GA 4UVCB 2H88A 3PJAA 3P4WA 2WDRA 2XQ7A 4KP3C 2JMKA 2H7VC 3UU3A 5LHIB 3H3AA 3PURA 2VL8A 2BKPA 4Q25A 4NUVA 2WU5A 3WAKA 3RKGA 2Y6XA 4ERRA 5CB4E 2VQFT 2E8IA 3MKDA 4UXNB 2X9WA 2DNXA 5AQGB 5A1LA 2D0UA 3A7MA 3PJAJ 3N9NA 5E0OA 1T72A 2MTQA 2X0HA 1ZHCA 5AQMB 1L0VA 3RRCA 2K3WA 3IF8B 5JTGA 5IYZE 2V6YB 3AE4A 1HNZT 2LKGA 1IZNB 5ABHA 4HFVA 5LG3A 3UTKA 4B6XA 5KXJA 4QXHB 3TLVA 2W00A 3FZMB 4KBMB 4WYVA 2C0SA 2WWUA 4LMJA 4DBQA 5L3CB 3P7IA 4JEUB 1IJ6A 3RI5A 4ISTA 3FXDB 3V5SA 5HCJA 3IHRA 2HN2A 5FYMA 4U2ZA 1KK7A 5DJQC 5JDNA 4YT0A 4JI4T 3ZMVB 1MMGA 4L0RA 4CN6A 2W61A 1YKEB 3H3MA 3HKEE 1US7B 4UR9A 4DBRA 1HNWT 5AQIB 1JNRA 4IL9A 2XTLA 2EHOC 2J47A 1HS7A 2EHOD 2JQQA 3HKDE 5JDHA 3FBZA 2D5UA 4UVAB 2VVSA 4H63V 3RC3A 4EIWA 2CA5A 1YD8G 1BR0A 3P4QA 4PK4A 2MOZA 1R8IA 4KMCA 4YXDA 2RP4A 4Z90A 2B1EA 4TWHA 4CI3B 3C4XA 1X79A 2E9XB 2JIWA 2R6GF 2JRKA 5LXTE 3KBUA 4JV5T 2IUBA 2LM9A 3T1HT 3S4UA 2XSBA 3UQ4A 5HCMA 4N78D 3ZMZB 4DR3T 2IMLA 4O2AE 4EOZB 2LSYA 2YDRA 2A72A 4JUYA 4JI0T 3RX6A 5HWXA 1XDOA 3ONXA 3AEAA 5L4EA 2Y8DA 2QA7A 3NZQA 5C8YE 1Z8UA 3L09A 4M1PA 4HTEA 2EHOB 1WR0A 3TLSA 2KT9A 3C98B 3JADA 4ZEYA 3L39A 4LF6T 3SRZA 2W66A 3AE9A 1T7SA 4G63A 3K3QC 3RRWA 2MYSA 2SPCA 4ILAA 2NOXA 1HX8A 2CXFA 3KVBA 5FKYA 4QX8B 3FBLA 3F31A 4U72A 4YJ2E 2PJQA 3RHWA 4CXXA 1YW0A 1IJ5A 3OPCA 3NRYA 4B3ST 3I0OA 4I4TE 1YKHB 2X68A 3AB3B 5JR9A 3GN5B 4MLKA 1E2AA 4P09A 4IE6A 4UF0B 4DUZT 4AQFA 4HE8A 5ABFB 5JDFA 2P9BA 4JBWF 3UQ7A 3Q5XA 2BS3A 2NR4A 5GONE 2XM1A 3JC6C 3I1AA 3CQCB 2N2NA 2MBGA 3JC6D 4GYSA 4XAXB 5IWAT 5JDMA 1QSDA 3N2OA 1ZEEA 3ZN1B 2ACXA 4GK0E 2V26A 4HN9A 1MMDA 2JMHA 4ILCA 4LFCT 2IIUA 3ZJ1A 3MZKB 1NAFA 2NWBA 5DQWA 2W2UA 4WNKA 4UV9B 5HYAA 3FZHB 4U31A 5FXVA 4AIUA 5AQSB 3AEGA 3UU6A 3QUJA 3ZSTA 1VCTA 1QUUA 3F57A 5EZYE 2VWAA 2XASB 4HFCA 4H9RC 2Y48B 3PDYA 3AA0B 4K0UA 3N9LA 2BG9C 2AE9A 2HH7A 2VK9A 1S35A 2NTXA 3RIAA 4C91A 4QH1A 3ZMSB 4NPPA 4WBOA 1XNQT 3R6NA 2L9QA 5CA0E 3HKCE 4WZXA 3VKHA 5LP6E 1EZ3A 3RIUA 4JI7T 3KV9A 4IE7A 3HKBE 3PUXF 3P4SA 4QKNA 4YSZA 5LA6E 5AQNB 4OYJA 2X51A 1AJ3A 2W62A 4O8SA 4XZCA 2KMFA 3JCFA 1FMVA 2BG9E 1MIWA 3TLWA 4PK6A 4X66T 2HPLA 1KEYA 2LLYA 2XM2A 4AI6A 3O1IA 2XSAA 2VL0A 4PJJA 3EHZA 4TWDA 1WR6A 4IE4A 2BG9B 3P4PA 1DU2A 2BS4A 1FIOA 4EYYR 3LBXB 1O3XA 4ZI3C 4BA9A 2WMOA 4GKKT 4ZI3D 5AQLB 3V5UA 5AQHB 3I0QA 2K9AA 2K24A 4A98A 2LHRA 4JI6T 2YEVC 2BVLA 3J9X1 4ILBA 1HNXT 4OYKA 2FJDA 5DABA 5LHHB 3ZT7A 1FEWA 5HEJA 3KV4A 4TN7B 1H7CA 4KX6A 3SWHA 2CLYC 2KINB 3UUBA 5BR8T 1SUMB 1J5ET 2CXLA 5FXXA 1MNDA 2BKNA 2LOSA 2CM0A 1OEDA 2XQ4A 4JI5T 2VASA 4MBQA 1NEKA 3PUSA 2V7MA 1N33T 1YXRA 1BR1A 4IIJE 3ZPOA 2ZMAA 1HTJF 5JDLA 2CHOA 5DQVA 4ZHQE 3OJAA 1MNEA 1WYCA 5HEGA 4DVDA 2QRXA 4CQIA 1XMQT 2CPTA 2PTFA 4X62T 1X9BA 3WI3A 2WZHA 5F3JA 3AECA 3BQIA 5IUXA 4GIWA 3FZLB 5BMVE 4CZZB 3PE0A 2LSKA 2LSIA 3BQLA 4TNWA 3AE7A 3CQGB 3E0ZA 3J7Yq 2X0LB 2CLYB 2BS2A 2XAJB 3ESLA 3RGLA 2Q9QA 2VKDA 4DMVA 2NP9A 4QXBB 3RYHE 2YDSA 4JI3T 1G8XA 2ZM6T 3QB5K 1BR4A 2D2SA 4H9OC 1U4QA 2IW5B 3Q9DA 5JRCA 3ZSSA 2VKOA 3BQKA 4ZOLE 1HF8A 1KF6A 1HG2A 3AAEB 3B57A 3CKDA 1WRDA 5AFUL 5H6RB 2QGSA 3CX6B 5CGMA 4CXYA 3EAMA 3HI2A 1N34T 1ZKEA 2FJEA 5L4HA 2HN1A 3SOLA 2XY8B 5JR9C 2H3RA 2MPKA 5LG4A 2UU9T 5KDMC 4PFOA 1UK5A 2WQYA 3UUNA 2BBJA 4UEMA 3N9MA 1NENA 2I0MA 3ZC1A 4DR7T 4U7IA 4LF7T 2UXNB 1I6ZA 5FMNA 5LOVE 2HPJA 2W0GA 1E1HB 3ZJ2A 4CN4A 1W0BA 3L8RA 3HR0A 4AKHA 3B13A 5HXHA 5ADXL 5C2TA 2XQ8A 4TX5A 2KWHA 5IHYA 5HXRA 1UGOA 4IE5A 4EEDA 4YTPA 2DWGA 2H89A 4IGUA 2NW9A 4TWFA 2WU2A 3EVYA 2KLQA 4DUYT 4HWFA 2V1DB 2N9DA 5AQTB 1J5WA 2DHRA 3EI0A 5FXZA 4MALA 2BBHA 4O4IE 3CIRA 4WBNE 5JR9B 1WCRA 2WS3A 4AKIA 2JQ9A 3TKLB 4F6RC 4LMLA 2M6IA 1VRBA 4HWDA 1XDPA 4EGWA 1OWAA 2XHEB 3M65A 2A9UA 5FVLA 2KSRA 3RQUA 4CXWA 4X1KE 2LM2A 2W63A 2XQ6A 2D9DA 3RIFA 2LOPA 3OVUA 4TV9E 1D0XA 4LF9T 1N32T 3VU7H 4ZZCA 2ZM8A 3AXJB 3PTRB 2WBLA 2E2AA 4HWHA 3FHNA 4EXTA 1E7PA 4LF5T 4IL4A 4FI5A 4PNIA 4L5GA 5F8PA 4B3RT 4OX9T 1MMAA 1VCSA 2LJLA 2C5JA 5LB7B 2VB6A 1LKXA 3RYFE 2WSSV 4DV3T 3PUAA 3UULA 4ILUA 5J2UE 4KHZF 5FY0A 3RYCE 3RH3A 4AKRB 4PFPA 3UUMA 2C5IT 3ZEFB 4IREA 4ZI7E 2X9YA 1Z0PA 1HCIA 2W67A 2E9XA 4KI0F 4JI8T 2JPFA 2J4GA 2Z6EA 3N9PA 5HXCA 4HWIB 1BR2A 2ODUA 2V7LA 4HGAA 1Y01A 3OYZA 4KUMB 4EYUA 1WYBA 1LVFA 2XAQB 3C50A 5LMUT 4H9PC 4IDPA 3AEEA 1IAPA 1T8BA 4JEHB 4JYAT 1SE7A 3FZFB 4U74A 3KBTA 4O2BE 4ISSA 4E7ZA 4LF4T 2JQKA 4PW8A 4YLHA 1XNRT 2JJ9A 4DO0A 4YHHT 4QX7B 3P4RA 2ZLYA 3UFEA 2XQYA 2WWVA 4WW0A 3M3ZB
chains in the Genus database with same CATH topology
4JI6T 4LF5T 4X65T 1HNXT 1HNZT 4B3RT 4OX9T 4DUZT 2HHHT 4LFBT 1IBLT 2UUBT 4JV5T 1HR0T 1XNQT 3T1HT 4DV1T 4DV3T 4JI3T 2ZM6T 4DR3T 2UUAT 2VQET 4X64T 4NXNT 4DUYT 4DR4T 5BR8T 4DR2T 1N36T 4JI7T 1FJGT 4DR1T 4DV4T 1J5ET 5IWAT 4AQYT 4JI0T 4B3TT 4JI5T 5LMNT 4JI8T 4LF8T 4JI4T 4LFAT 2E5LT 1N33T 4LFCT 1IBMT 1XMOT 1N34T 4DR5T 4GKJT 4DR6T 2UXDT 4X66T 4DV0T 2UU9T 4DV5T 2F4VT 4LF6T 4DV7T 5LMUT 1HNWT 3OTOT 4KHPT 2UXBT 2UUCT 1XMQT 4JI1T 4YY3T 4JYAT 4DR7T 2VQFT 4B3MT 4X62T 4LF7T 1IBKT 4LF9T 1N32T 4LF4T 4DV2T 3T1YT 1XNRT 4YHHT 4GKKT 1I94T 4K0KT 4DV6T 2UXCT 4JI2T 4B3ST 4NXMT
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI6 T;  4LF5 T;  4X65 T;  1HNX T;  1HNZ T;  4B3R T;  4OX9 T;  4DUZ T;  2HHH T;  4LFB T;  1IBL T;  2UUB T;  4JV5 T;  1HR0 T;  1XNQ T;  3T1H T;  4DV1 T;  4DV3 T;  4JI3 T;  2ZM6 T;  4DR3 T;  2UUA T;  2VQE T;  4X64 T;  4NXN T;  4DUY T;  4DR4 T;  5BR8 T;  4DR2 T;  1N36 T;  4JI7 T;  1FJG T;  4DR1 T;  4DV4 T;  1J5E T;  5IWA T;  4AQY T;  4JI0 T;  4B3T T;  4JI5 T;  5LMN T;  4JI8 T;  4LF8 T;  4JI4 T;  4LFA T;  2E5L T;  1N33 T;  4LFC T;  1IBM T;  1XMO T;  1N34 T;  4DR5 T;  4GKJ T;  4DR6 T;  2UXD T;  4X66 T;  4DV0 T;  2UU9 T;  4DV5 T;  2F4V T;  4LF6 T;  4DV7 T;  5LMU T;  1HNW T;  3OTO T;  4KHP T;  2UXB T;  2UUC T;  1XMQ T;  4JI1 T;  4YY3 T;  4JYA T;  4DR7 T;  2VQF T;  4B3M T;  4X62 T;  4LF7 T;  1IBK T;  4LF9 T;  1N32 T;  4LF4 T;  4DV2 T;  3T1Y T;  1XNR T;  4YHH T;  4GKK T;  1I94 T;  4K0K T;  4DV6 T;  2UXC T;  4JI2 T;  4B3S T;  4NXM T; 
#chains in the Genus database with same CATH topology
 3O9X A;  4OK0 A;  1OED C;  4U7Y A;  5LNK A;  3NZP A;  3ANW B;  1UUR A;  3LDQ B;  5FVK A;  3K3O A;  5HXE A;  2DL1 A;  1LVK A;  4BJN A;  1D1B A;  2XQ9 A;  2UUA T;  3EAB A;  3VR9 A;  3AA7 B;  3DTO A;  3K8P C;  4QH4 A;  1M7K A;  4TNV A;  3NKZ A;  3GN5 A;  5JH7 E;  4EZ4 A;  4HWC A;  3ZLI A;  2LRL A;  4TUY E;  2L3L A;  4UF0 A;  3T8O A;  4LFA T;  2MAW A;  4LMK A;  3LSV A;  3MXZ A;  4QXC B;  5ABF A;  1IBM T;  3VRA A;  4DR5 T;  5L3G B;  1VOM A;  4U2Y A;  3GWH A;  2WMN A;  2FJB A;  3ONJ A;  3AE5 A;  1ZOY A;  2WM9 A;  5AQJ B;  3RKO A;  3OTO T;  3PUQ A;  3N5L A;  3ZT5 A;  3CK6 A;  3RPU A;  1OED B;  3AAI A;  2WAU A;  4AKG A;  1UCU A;  3W15 B;  3RYI E;  3AA6 B;  4EB6 E;  2NW8 A;  2V5D A;  3EUH A;  5AQU B;  5FP3 A;  3ZYK A;  2ES0 A;  2CRB A;  3IA3 A;  3Q2M A;  5JDQ A;  2YN6 A;  3C4W A;  4GYR A;  2HHH T;  4P0A A;  3AVR A;  1IBL T;  3ZCI A;  4GOU A;  4OHF A;  5JVD E;  5M4Y A;  4P0B A;  2VQE T;  1J1J A;  3JAE A;  4MHC A;  4QH5 A;  5CJ5 A;  3ZKR A;  5AQQ B;  2WY2 A;  1UX5 A;  2OA5 A;  4AQY T;  3K1S A;  3WAJ A;  3VR8 A;  4O4J E;  5LYJ E;  2V7I A;  2E5L T;  4I0U A;  2LT3 A;  3N9O A;  2LEH A;  4DID B;  3UU5 A;  4GKJ T;  1KFY A;  3CWZ B;  1D0Y A;  2XQ3 A;  4ADZ A;  4AIS A;  2CWO A;  3IEE A;  2PFV A;  3ABV A;  2B76 A;  1CHU A;  4DND A;  4B3M T;  1WFD A;  5ABE A;  4X1I E;  5FL1 A;  3NWI A;  1W0A A;  3AEB A;  3VRB A;  4DV6 T;  3PUV F;  2KWI B;  3MA9 A;  2V8S V;  4NXM T;  3DP7 A;  2XQ5 A;  3U3I A;  2J1D G;  4Z8X A;  3UT5 E;  1KNR A;  3OBV E;  4G2A A;  5JRE A;  2FJA A;  2BG9 A;  5LGT B;  1HR0 T;  5LGN B;  3LBX A;  4OFZ A;  2YDQ A;  3Q5W A;  3HL6 A;  3RF1 A;  4DR2 T;  2M67 A;  3QK6 A;  3B5M A;  3Q5D A;  3P8C D;  1T98 A;  3ZT6 A;  2QYW A;  3E08 A;  3P50 A;  5EK3 A;  1W09 A;  3A8Y C;  2LHN A;  4A5X A;  3CX7 B;  4I50 E;  5JQG E;  5LMN T;  3RC8 A;  2WZI A;  3N9Q A;  4X5T A;  3NVO A;  4YTN A;  2GK9 A;  4PK5 A;  4KHP T;  2UUC T;  3ZCJ A;  2C5K T;  4YY3 T;  3AA1 B;  3O1J A;  5AQO B;  1XWM A;  5AQR B;  3RLF F;  3PUG A;  3PU8 A;  1HG5 A;  4ZZB A;  4DMW A;  3TLT A;  3ZYM A;  3LK3 B;  3KDS E;  4ZS2 A;  1KNP A;  5AQK B;  2FUP A;  3QB5 A;  2OV9 A;  3F2E A;  5HEU A;  4IDN A;  4AQF C;  5FNV E;  3AED A;  2XUE A;  5HXS A;  2VUR A;  2E9X C;  5AQP B;  3LG7 A;  1G73 A;  3QC9 A;  3PV0 F;  2CBJ A;  5L3F B;  2E9X D;  1QLB A;  4I43 B;  3ETV A;  4ANJ A;  1HFA A;  1JNZ A;  3AAA B;  2X66 A;  5FY7 A;  3VHL A;  4U3C A;  4AXP A;  3NRX A;  4FJO A;  2RA1 A;  2WB5 A;  5HWY A;  2CCQ A;  3PU3 A;  2QVA A;  4DR4 T;  1N36 T;  4HKA A;  1D1A A;  5F5W A;  1ZV4 X;  3MK7 C;  4AQG A;  2FBW A;  2A2F X;  2BVM A;  3ZN0 B;  3KV6 A;  2LSJ A;  2PBI A;  1NWM X;  4LF8 T;  1UX4 A;  2DLR A;  4IT4 A;  2YKS A;  3UUX B;  4E7S A;  3C51 A;  3K3N A;  2BDE A;  4COF A;  1U5P A;  1LRZ A;  3FB2 A;  4ZXL A;  2V6Y A;  5L3D B;  2J62 A;  2UXB T;  3UU8 A;  4YHJ A;  2AXD S;  3RQW A;  2DI4 A;  1ZP0 A;  4QWN B;  3D0T A;  1D1C A;  2XAH B;  5EK4 A;  1MIV A;  4YSX A;  2UXC T;  2LE8 A;  3CML A;  1B7T A;  2YU1 A;  5ETW A;  2BZB A;  4P1N A;  3L3P A;  4EV6 A;  4IE0 A;  3X1D A;  4H63 H;  4H9N C;  5H6Q B;  5FXW A;  2WDQ A;  2UXX B;  3HA4 A;  2A3D A;  5L2L A;  2ACZ A;  2I59 A;  3RIU C;  4LFB T;  4PJM A;  4DV1 T;  3H37 A;  1OXZ A;  3SFD A;  1KNZ A;  2I6H A;  3VKG A;  4NXN T;  2WDV A;  5LCY A;  3GMI A;  2CEA A;  3SS1 A;  2X9H A;  4DR1 T;  5LGU B;  4EEB A;  4H9S E;  4XBF B;  2RPA A;  2CMR A;  3LFM A;  2NW7 A;  2IDO B;  5J0Z A;  5L3E B;  2LSG A;  5LJM A;  4TZ4 C;  5L3B B;  5ABG A;  4CI1 B;  3KFW X;  5CFB A;  1XZY A;  2K48 A;  4JI1 T;  2XAF B;  4A97 A;  4PJL A;  4MFR A;  1IBK T;  3ONL C;  3ZMT B;  4UVB B;  4HFE A;  2CBI A;  3Q5E A;  4PJN A;  3PUZ F;  5LBQ B;  4H9Q C;  4JI2 T;  2VKJ A;  5AQF B;  4Z91 A;  4IDZ A;  4TV8 E;  4HFI A;  4CN1 A;  3OKQ A;  2YK0 A;  4NIQ A;  4X65 T;  3NBX X;  4UV8 B;  5L47 A;  2OLT A;  4X20 E;  1SA0 E;  4F8H A;  2EHO A;  2ODV A;  3CX8 B;  4O4H E;  4PAG A;  4BJM A;  4HFH A;  4YFS A;  5J2T E;  3AXJ A;  4QHO A;  3ETU A;  3QNU A;  1GQE A;  1WLX A;  1V9D A;  3E22 E;  4DV4 T;  4L9I A;  2K5B B;  2KND A;  3LK4 2;  5LJN A;  2X9X A;  3IBP A;  2XZE A;  2ZM0 A;  3U78 A;  4ZS3 A;  1XMO T;  2V5C A;  4DR6 T;  4HFD A;  4AKL A;  2M6B A;  2W4X A;  2NTY A;  4UEL A;  3MJX A;  2YOE A;  3BK9 A;  5EK2 A;  2KXP B;  4DV5 T;  2F4V T;  4DV7 T;  4A56 A;  3LJC A;  3FZK B;  2IC6 A;  3AE6 A;  2WCA A;  1M62 A;  4IDO A;  4IHJ E;  2PG8 A;  3CQX C;  5KX5 E;  3O1H A;  2VVN A;  5LHG B;  3C64 A;  3SFE A;  2IAK A;  3UFG A;  1CUN A;  3AVS A;  2IHR 1;  1MMN A;  1OED E;  4O4L E;  4DV2 T;  2E5V A;  4V1A v;  5C3J A;  3N2K E;  3C4Z A;  3KVA A;  2Q9Q C;  4HEA A;  2V6X A;  4BAY B;  2Q9Q D;  3G06 A;  3PUY F;  5HEO A;  2YIN A;  3AEF A;  2YU2 A;  5TAO A;  2BKO A;  2H7O A;  1W9R A;  5AQV B;  3O4X E;  1MIY A;  3LK2 B;  4U33 A;  2CWY A;  2L8K A;  4ASK A;  4YSY A;  3ZMU B;  4I55 E;  4EZH A;  4YJ3 E;  3I9W A;  2DWK A;  3MAC A;  5JDG A;  1SHZ C;  3KIN B;  2V7J A;  3CPZ A;  5HEH A;  2XPK A;  3OYX A;  4B3T T;  3ANW A;  5HAX A;  3EDV A;  3KV5 A;  4C90 A;  4HFB A;  4UIG A;  2UXD T;  3QOF A;  2CE7 A;  3A5X A;  4DV0 T;  4X1Y E;  2X0Y A;  3FXE B;  4YTM A;  3ZYL A;  3JAF A;  2CXD A;  4IDQ A;  4NUU A;  5KMG P;  3AE8 A;  5FY1 A;  2XAG B;  2DCF A;  2Q9Q B;  2XJ7 A;  4JLE A;  4J2C A;  1YQ3 A;  3T1Y T;  2XQA A;  5LBM A;  3UU4 A;  2ZM2 A;  1I94 T;  2JQH A;  4K0K T;  2CHN A;  1UUS A;  3CVR A;  2G0U A;  2N1G A;  2X67 A;  3GA8 A;  1S94 A;  4ZI2 C;  2VKH A;  5JRC B;  2LRK A;  4CI2 B;  4ZI2 D;  3AE3 A;  5FL0 A;  4GK5 E;  2D0T A;  2WP9 A;  1HX1 B;  2KZ7 B;  2V7K A;  2UUB T;  3AE1 A;  3ZC0 A;  1D0Z A;  1Y64 B;  3I9Y A;  3R84 B;  1FMW A;  3TLU A;  4X64 T;  3AE2 A;  5CA1 E;  2LKH A;  3EDU A;  3N2G E;  1FJG T;  3PUW F;  4EAH A;  3DJB A;  2IC9 A;  1YQ4 A;  5J1G A;  4UVC B;  2H88 A;  3PJA A;  3P4W A;  2WDR A;  2XQ7 A;  4KP3 C;  2JMK A;  2H7V C;  3UU3 A;  5LHI B;  3H3A A;  3PUR A;  2VL8 A;  2BKP A;  4Q25 A;  4NUV A;  2WU5 A;  3WAK A;  3RKG A;  2Y6X A;  4ERR A;  5CB4 E;  2VQF T;  2E8I A;  3MKD A;  4UXN B;  2X9W A;  2DNX A;  5AQG B;  5A1L A;  2D0U A;  3A7M A;  3PJA J;  3N9N A;  5E0O A;  1T72 A;  2MTQ A;  2X0H A;  1ZHC A;  5AQM B;  1L0V A;  3RRC A;  2K3W A;  3IF8 B;  5JTG A;  5IYZ E;  2V6Y B;  3AE4 A;  1HNZ T;  2LKG A;  1IZN B;  5ABH A;  4HFV A;  5LG3 A;  3UTK A;  4B6X A;  5KXJ A;  4QXH B;  3TLV A;  2W00 A;  3FZM B;  4KBM B;  4WYV A;  2C0S A;  2WWU A;  4LMJ A;  4DBQ A;  5L3C B;  3P7I A;  4JEU B;  1IJ6 A;  3RI5 A;  4IST A;  3FXD B;  3V5S A;  5HCJ A;  3IHR A;  2HN2 A;  5FYM A;  4U2Z A;  1KK7 A;  5DJQ C;  5JDN A;  4YT0 A;  4JI4 T;  3ZMV B;  1MMG A;  4L0R A;  4CN6 A;  2W61 A;  1YKE B;  3H3M A;  3HKE E;  1US7 B;  4UR9 A;  4DBR A;  1HNW T;  5AQI B;  1JNR A;  4IL9 A;  2XTL A;  2EHO C;  2J47 A;  1HS7 A;  2EHO D;  2JQQ A;  3HKD E;  5JDH A;  3FBZ A;  2D5U A;  4UVA B;  2VVS A;  4H63 V;  3RC3 A;  4EIW A;  2CA5 A;  1YD8 G;  1BR0 A;  3P4Q A;  4PK4 A;  2MOZ A;  1R8I A;  4KMC A;  4YXD A;  2RP4 A;  4Z90 A;  2B1E A;  4TWH A;  4CI3 B;  3C4X A;  1X79 A;  2E9X B;  2JIW A;  2R6G F;  2JRK A;  5LXT E;  3KBU A;  4JV5 T;  2IUB A;  2LM9 A;  3T1H T;  3S4U A;  2XSB A;  3UQ4 A;  5HCM A;  4N78 D;  3ZMZ B;  4DR3 T;  2IML A;  4O2A E;  4EOZ B;  2LSY A;  2YDR A;  2A72 A;  4JUY A;  4JI0 T;  3RX6 A;  5HWX A;  1XDO A;  3ONX A;  3AEA A;  5L4E A;  2Y8D A;  2QA7 A;  3NZQ A;  5C8Y E;  1Z8U A;  3L09 A;  4M1P A;  4HTE A;  2EHO B;  1WR0 A;  3TLS A;  2KT9 A;  3C98 B;  3JAD A;  4ZEY A;  3L39 A;  4LF6 T;  3SRZ A;  2W66 A;  3AE9 A;  1T7S A;  4G63 A;  3K3Q C;  3RRW A;  2MYS A;  2SPC A;  4ILA A;  2NOX A;  1HX8 A;  2CXF A;  3KVB A;  5FKY A;  4QX8 B;  3FBL A;  3F31 A;  4U72 A;  4YJ2 E;  2PJQ A;  3RHW A;  4CXX A;  1YW0 A;  1IJ5 A;  3OPC A;  3NRY A;  4B3S T;  3I0O A;  4I4T E;  1YKH B;  2X68 A;  3AB3 B;  5JR9 A;  3GN5 B;  4MLK A;  1E2A A;  4P09 A;  4IE6 A;  4UF0 B;  4DUZ T;  4AQF A;  4HE8 A;  5ABF B;  5JDF A;  2P9B A;  4JBW F;  3UQ7 A;  3Q5X A;  2BS3 A;  2NR4 A;  5GON E;  2XM1 A;  3JC6 C;  3I1A A;  3CQC B;  2N2N A;  2MBG A;  3JC6 D;  4GYS A;  4XAX B;  5IWA T;  5JDM A;  1QSD A;  3N2O A;  1ZEE A;  3ZN1 B;  2ACX A;  4GK0 E;  2V26 A;  4HN9 A;  1MMD A;  2JMH A;  4ILC A;  4LFC T;  2IIU A;  3ZJ1 A;  3MZK B;  1NAF A;  2NWB A;  5DQW A;  2W2U A;  4WNK A;  4UV9 B;  5HYA A;  3FZH B;  4U31 A;  5FXV A;  4AIU A;  5AQS B;  3AEG A;  3UU6 A;  3QUJ A;  3ZST A;  1VCT A;  1QUU A;  3F57 A;  5EZY E;  2VWA A;  2XAS B;  4HFC A;  4H9R C;  2Y48 B;  3PDY A;  3AA0 B;  4K0U A;  3N9L A;  2BG9 C;  2AE9 A;  2HH7 A;  2VK9 A;  1S35 A;  2NTX A;  3RIA A;  4C91 A;  4QH1 A;  3ZMS B;  4NPP A;  4WBO A;  1XNQ T;  3R6N A;  2L9Q A;  5CA0 E;  3HKC E;  4WZX A;  3VKH A;  5LP6 E;  1EZ3 A;  3RIU A;  4JI7 T;  3KV9 A;  4IE7 A;  3HKB E;  3PUX F;  3P4S A;  4QKN A;  4YSZ A;  5LA6 E;  5AQN B;  4OYJ A;  2X51 A;  1AJ3 A;  2W62 A;  4O8S A;  4XZC A;  2KMF A;  3JCF A;  1FMV A;  2BG9 E;  1MIW A;  3TLW A;  4PK6 A;  4X66 T;  2HPL A;  1KEY A;  2LLY A;  2XM2 A;  4AI6 A;  3O1I A;  2XSA A;  2VL0 A;  4PJJ A;  3EHZ A;  4TWD A;  1WR6 A;  4IE4 A;  2BG9 B;  3P4P A;  1DU2 A;  2BS4 A;  1FIO A;  4EYY R;  3LBX B;  1O3X A;  4ZI3 C;  4BA9 A;  2WMO A;  4GKK T;  4ZI3 D;  5AQL B;  3V5U A;  5AQH B;  3I0Q A;  2K9A A;  2K24 A;  4A98 A;  2LHR A;  4JI6 T;  2YEV C;  2BVL A;  3J9X 1;  4ILB A;  1HNX T;  4OYK A;  2FJD A;  5DAB A;  5LHH B;  3ZT7 A;  1FEW A;  5HEJ A;  3KV4 A;  4TN7 B;  1H7C A;  4KX6 A;  3SWH A;  2CLY C;  2KIN B;  3UUB A;  5BR8 T;  1SUM B;  1J5E T;  2CXL A;  5FXX A;  1MND A;  2BKN A;  2LOS A;  2CM0 A;  1OED A;  2XQ4 A;  4JI5 T;  2VAS A;  4MBQ A;  1NEK A;  3PUS A;  2V7M A;  1N33 T;  1YXR A;  1BR1 A;  4IIJ E;  3ZPO A;  2ZMA A;  1HTJ F;  5JDL A;  2CHO A;  5DQV A;  4ZHQ E;  3OJA A;  1MNE A;  1WYC A;  5HEG A;  4DVD A;  2QRX A;  4CQI A;  1XMQ T;  2CPT A;  2PTF A;  4X62 T;  1X9B A;  3WI3 A;  2WZH A;  5F3J A;  3AEC A;  3BQI A;  5IUX A;  4GIW A;  3FZL B;  5BMV E;  4CZZ B;  3PE0 A;  2LSK A;  2LSI A;  3BQL A;  4TNW A;  3AE7 A;  3CQG B;  3E0Z A;  3J7Y q;  2X0L B;  2CLY B;  2BS2 A;  2XAJ B;  3ESL A;  3RGL A;  2Q9Q A;  2VKD A;  4DMV A;  2NP9 A;  4QXB B;  3RYH E;  2YDS A;  4JI3 T;  1G8X A;  2ZM6 T;  3QB5 K;  1BR4 A;  2D2S A;  4H9O C;  1U4Q A;  2IW5 B;  3Q9D A;  5JRC A;  3ZSS A;  2VKO A;  3BQK A;  4ZOL E;  1HF8 A;  1KF6 A;  1HG2 A;  3AAE B;  3B57 A;  3CKD A;  1WRD A;  5AFU L;  5H6R B;  2QGS A;  3CX6 B;  5CGM A;  4CXY A;  3EAM A;  3HI2 A;  1N34 T;  1ZKE A;  2FJE A;  5L4H A;  2HN1 A;  3SOL A;  2XY8 B;  5JR9 C;  2H3R A;  2MPK A;  5LG4 A;  2UU9 T;  5KDM C;  4PFO A;  1UK5 A;  2WQY A;  3UUN A;  2BBJ A;  4UEM A;  3N9M A;  1NEN A;  2I0M A;  3ZC1 A;  4DR7 T;  4U7I A;  4LF7 T;  2UXN B;  1I6Z A;  5FMN A;  5LOV E;  2HPJ A;  2W0G A;  1E1H B;  3ZJ2 A;  4CN4 A;  1W0B A;  3L8R A;  3HR0 A;  4AKH A;  3B13 A;  5HXH A;  5ADX L;  5C2T A;  2XQ8 A;  4TX5 A;  2KWH A;  5IHY A;  5HXR A;  1UGO A;  4IE5 A;  4EED A;  4YTP A;  2DWG A;  2H89 A;  4IGU A;  2NW9 A;  4TWF A;  2WU2 A;  3EVY A;  2KLQ A;  4DUY T;  4HWF A;  2V1D B;  2N9D A;  5AQT B;  1J5W A;  2DHR A;  3EI0 A;  5FXZ A;  4MAL A;  2BBH A;  4O4I E;  3CIR A;  4WBN E;  5JR9 B;  1WCR A;  2WS3 A;  4AKI A;  2JQ9 A;  3TKL B;  4F6R C;  4LML A;  2M6I A;  1VRB A;  4HWD A;  1XDP A;  4EGW A;  1OWA A;  2XHE B;  3M65 A;  2A9U A;  5FVL A;  2KSR A;  3RQU A;  4CXW A;  4X1K E;  2LM2 A;  2W63 A;  2XQ6 A;  2D9D A;  3RIF A;  2LOP A;  3OVU A;  4TV9 E;  1D0X A;  4LF9 T;  1N32 T;  3VU7 H;  4ZZC A;  2ZM8 A;  3AXJ B;  3PTR B;  2WBL A;  2E2A A;  4HWH A;  3FHN A;  4EXT A;  1E7P A;  4LF5 T;  4IL4 A;  4FI5 A;  4PNI A;  4L5G A;  5F8P A;  4B3R T;  4OX9 T;  1MMA A;  1VCS A;  2LJL A;  2C5J A;  5LB7 B;  2VB6 A;  1LKX A;  3RYF E;  2WSS V;  4DV3 T;  3PUA A;  3UUL A;  4ILU A;  5J2U E;  4KHZ F;  5FY0 A;  3RYC E;  3RH3 A;  4AKR B;  4PFP A;  3UUM A;  2C5I T;  3ZEF B;  4IRE A;  4ZI7 E;  2X9Y A;  1Z0P A;  1HCI A;  2W67 A;  2E9X A;  4KI0 F;  4JI8 T;  2JPF A;  2J4G A;  2Z6E A;  3N9P A;  5HXC A;  4HWI B;  1BR2 A;  2ODU A;  2V7L A;  4HGA A;  1Y01 A;  3OYZ A;  4KUM B;  4EYU A;  1WYB A;  1LVF A;  2XAQ B;  3C50 A;  5LMU T;  4H9P C;  4IDP A;  3AEE A;  1IAP A;  1T8B A;  4JEH B;  4JYA T;  1SE7 A;  3FZF B;  4U74 A;  3KBT A;  4O2B E;  4ISS A;  4E7Z A;  4LF4 T;  2JQK A;  4PW8 A;  4YLH A;  1XNR T;  2JJ9 A;  4DO0 A;  4YHH T;  4QX7 B;  3P4R A;  2ZLY A;  3UFE A;  2XQY A;  2WWV A;  4WW0 A;  3M3Z B; 
#chains in the Genus database with same CATH homology
 4JI6 T;  4LF5 T;  4X65 T;  1HNX T;  1HNZ T;  4B3R T;  4OX9 T;  4DUZ T;  2HHH T;  4LFB T;  1IBL T;  2UUB T;  4JV5 T;  1HR0 T;  1XNQ T;  3T1H T;  4DV1 T;  4DV3 T;  4JI3 T;  2ZM6 T;  4DR3 T;  2UUA T;  2VQE T;  4X64 T;  4NXN T;  4DUY T;  4DR4 T;  5BR8 T;  4DR2 T;  1N36 T;  4JI7 T;  1FJG T;  4DR1 T;  4DV4 T;  1J5E T;  5IWA T;  4AQY T;  4JI0 T;  4B3T T;  4JI5 T;  5LMN T;  4JI8 T;  4LF8 T;  4JI4 T;  4LFA T;  2E5L T;  1N33 T;  4LFC T;  1IBM T;  1XMO T;  1N34 T;  4DR5 T;  4GKJ T;  4DR6 T;  2UXD T;  4X66 T;  4DV0 T;  2UU9 T;  4DV5 T;  2F4V T;  4LF6 T;  4DV7 T;  5LMU T;  1HNW T;  3OTO T;  4KHP T;  2UXB T;  2UUC T;  1XMQ T;  4JI1 T;  4YY3 T;  4JYA T;  4DR7 T;  2VQF T;  4B3M T;  4X62 T;  4LF7 T;  1IBK T;  4LF9 T;  1N32 T;  4LF4 T;  4DV2 T;  3T1Y T;  1XNR T;  4YHH T;  4GKK T;  1I94 T;  4K0K T;  4DV6 T;  2UXC T;  4JI2 T;  4B3S T;  4NXM T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...