4LFBT

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S rRNA
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
total genus 36
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 4lfbT00
4DV4T 4LFCT 2UXDT 4DR3T 4JI3T 2UU9T 2E5LT 4LFAT 4NXNT 1N32T 2UXCT 4DR4T 1IBLT 5LMNT 2F4VT 1I94T 3T1YT 4JI0T 4NXMT 5BR8T 1XMOT 4YHHT 2UUAT 4YY3T 4DR1T 4DV1T 4KHPT 4JI7T 1XNRT 4DR7T 4DV5T 4B3MT 2UXBT 4K0KT 3T1HT 1HR0T 2ZM6T 4DR5T 1HNZT 4LF4T 1FJGT 1N33T 4B3RT 4DUYT 4JI2T 4GKJT 4X62T 4JYAT 4X66T 1IBKT 4LF7T 1IBMT 4OX9T 1HNWT 2UUBT 4JI4T 4LFBT 2HHHT 4AQYT 1HNXT 4DV7T 5IWAT 5LMUT 1N34T 2VQFT 2UUCT 4DR6T 4B3ST 4JI1T 4DV6T 4JI5T 4DV3T 1XMQT 4JI6T 2VQET 4DUZT 1J5ET 4DR2T 4LF5T 4B3TT 4DV0T 3OTOT 4X64T 1N36T 4GKKT 4X65T 4JV5T 4LF9T 4DV2T 4LF6T 1XNQT 4JI8T 4LF8T
chains in the Genus database with same CATH superfamily
3ZSTA 2CBJA 4CN1A 3R6NA 2KZ7B 1HF8A 2QRXA 5J1GA 3UU8A 2YU1A 1T7SA 4UEMA 1JNRA 2WWUA 3TLSA 4COFA 3MKDA 4P0AA 3ZMTB 4U7IA 2K5BB 2XAJB 4EIWA 2V7LA 2DWKA 5AQKB 2X66A 5HEHA 5EK4A 5AQMB 1AJ3A 3RHWA 5J2UE 1FJGT 1KFYA 4GKJT 5FXWA 3QK6A 4X5TA 3UT5E 3ZT6A 2L9QA 1M7KA 1E2AA 4AKIA 4LF7T 3EUHA 4JI4T 3AB3B 3ZKRA 2LSJA 4O8SA 3UULA 2WZIA 4PFOA 4AQYT 3RI5A 5DQVA 4WNKA 5LA6E 5AQVB 1NENA 3P50A 2VASA 2D5UA 5FY1A 3ZJ2A 1W09A 5AQRB 2NW9A 2B76A 4UF0A 2WU5A 2XQ8A 3PTRB 2LKGA 2LLYA 5JR9A 4JUYA 5F5WA 3AAIA 4CN6A 4JEHB 2VKJA 3OKQA 2CXLA 1B7TA 4PJMA 5AQGB 1HTJF 4QHOA 2CBIA 1I94T 2J4GA 3GWHA 1Y64B 4OFZA 1XMOT 1U5PA 5M4YA 3RC3A 4ZHQE 3FZKB 5L2LA 3FBZA 2ZM6T 1HNZT 4PK4A 2WSSV 5AQTB 3RRCA 4AISA 4BA9A 3ZSSA 2VVSA 3K8PC 4HWFA 4X62T 3PUAA 3QC9A 5TAOA 1IBKT 2PBIA 4JBWF 1UURA 3DTOA 1FMVA 4G2AA 4LFBT 3A8YC 3FZHB 1YXRA 3EVYA 3ETVA 3ESLA 5L3EB 4CI2B 3ZYLA 2IHR1 2DI4A 3AE6A 2Q9QA 1UX4A 2BS4A 4ILAA 4DR6T 4ADZA 1UGOA 3DP7A 1V9DA 4JI5T 1ZKEA 5FP3A 4NIQA 4JI6T 1E7PA 4B3TT 3NRYA 5JDLA 4EXTA 5L3GB 1MIVA 4DV4T 3IA3A 2XUEA 2XQYA 2BVMA 2FJAA 1N32T 4HFHA 1E1HB 2HN2A 5IYZE 4AI6A 5LG3A 2ZMAA 5A1LA 2H88A 4KP3C 3E08A 3AVRA 3SFDA 2JPFA 2UXNB 3T8OA 4DR1T 5LHGB 3WAJA 4DV1T 3PE0A 2Y6XA 2LRKA 5JREA 3BK9A 4YHJA 3HKEE 3ZT7A 4X1IE 5KX5E 5HEOA 1MMDA 2X0LB 4OK0A 1SHZC 4DR5T 2IMLA 1YD8G 3P4WA 4H9SE 2HN1A 5FVLA 2Q9QC 5JTGA 2MBGA 3UUNA 4IDZA 4U7YA 4XAXB 2X51A 3LBXB 1X9BA 1W9RA 3IF8B 3ANWA 3RQUA 2LRLA 3KBUA 3Q9DA 2ZM0A 4H9OC 5HCJA 5J2TE 1I6ZA 1ZOYA 3TLTA 2RP4A 2V7KA 4L0RA 3ZEFB 1KNZA 1XWMA 4UIGA 4HEAA 5LBQB 3V5SA 3K3QC 4XBFB 3QNUA 3OVUA 2A2FX 4H9NC 3PU8A 2H89A 2C5JA 2JIWA 2J62A 3J7Yq 3RPUA 3ONJA 3GMIA 4WW0A 5ABFB 1GQEA 4MBQA 4ASKA 3GN5B 2UXCT 2LT3A 4AKLA 4HKAA 4O4LE 2K24A 2M6BA 4ZS3A 3QOFA 4A98A 3CPZA 3S4UA 4Q25A 4KHPT 2W61A 4DR7T 4GYRA 4G63A 4GK0E 3Q2MA 5FMNA 2L8KA 2JMHA 5LHIB 1NAFA 3CWZB 2BBHA 3N2KE 4UV9B 2CLYC 3AE5A 2V6YA 2YDRA 3N2GE 1IAPA 2I6HA 2MOZA 4IE4A 3EABA 4H9QC 3B5MA 1Z8UA 2VKHA 2BZBA 3F31A 5IWAT 4PK5A 1R8IA 2XJ7A 3UUBA 2XQ4A 2MAWA 4GYSA 4TWHA 2WZHA 2BBJA 3IBPA 4YTNA 1YQ4A 3WI3A 4X65T 2W4XA 5FYMA 5FXXA 3N9LA 3O1JA 3AEBA 3R84B 3K3NA 1QLBA 5LG4A 1WCRA 5AQLB 3C98B 5DABA 3HKDE 2XM2A 3ZLIA 3MK7C 4IHJE 4F8HA 5HWYA 5LGNB 4X20E 2V1DB 2XTLA 2G0UA 4IE0A 2UUAT 3F57A 2CCQA 5J0ZA 4LMJA 5HXSA 3P4SA 1US7B 3RLFF 3ZN0B 1SE7A 1NWMX 4K0KT 5L3CB 3T1HT 5CA0E 3L39A 3CQXC 4TV9E 4DUYT 2CA5A 2X68A 2JRKA 2A72A 2W2UA 2MTQA 2CM0A 2IIUA 4U31A 4OHFA 1VCSA 4QXHB 3RYCE 1FEWA 3KVBA 3I0OA 4DV7T 2IC9A 4U3CA 4X1YE 4X1KE 3UU5A 1D1CA 1KK7A 3ZYKA 5L4HA 2VL8A 4B3ST 2LKHA 4ZI3D 4QX7B 4U74A 2WBLA 1D0YA 2NR4A 1DU2A 2WDRA 5JQGE 4TNVA 1BR2A 2BG9B 4EYYR 2QA7A 3AXJA 3OYXA 3AE9A 2BDEA 4CXWA 2XASB 2VVNA 3RYIE 3I9WA 3RIUC 5LBMA 2C5KT 2JQHA 3LFMA 3B13A 2W67A 2NW8A 4HFVA 4MHCA 1ZP0A 4YJ3E 3JC6C 5HEUA 4K0UA 3KDSE 3Q5DA 2WMNA 5JDQA 4TNWA 2LOSA 5KDMC 1SUMB 5AQFB 3CKDA 2Y48B 4AXPA 4HWCA 4OX9T 4CI3B 4ILUA 3PJAJ 3LK2B 4IL9A 4PJLA 2LEHA 4ISTA 5LMUT 5LB7B 1N34T 2EHOB 4AQFC 4ILCA 3PUYF 3LSVA 5L3BB 1MIYA 2E9XD 4WBNE 1UX5A 5AQIB 4A97A 2CMRA 3AE1A 1XNQT 3RGLA 4LF8T 4IDOA 3VKHA 2UXDT 4FJOA 5ABEA 4OYKA 4E7SA 3G06A 2UXXB 3UU4A 5L4EA 4TV8E 1BR1A 2Z6EA 4GIWA 1T8BA 1KEYA 3KV9A 2XY8B 3T1YT 3ZCJA 1HX1B 2CHNA 2NOXA 5FY0A 1J5WA 4P0BA 2DHRA 3L3PA 2V26A 4YSYA 2DL1A 4HTEA 5JDHA 1IZNB 1WFDA 1D1AA 4CZZB 2I59A 3L8RA 2V7JA 3AEAA 3EI0A 5LGTB 2YINA 3VKGA 2LHNA 4TZ4C 2IUBA 4P09A 2D2SA 3Q5WA 5LNKA 5FL0A 2XAGB 3A7MA 3UU3A 3D0TA 4QH1A 3N9QA 3VHLA 1OXZA 3QB5K 1XDPA 4A5XA 4ZS2A 3NKZA 3PJAA 4HWHA 3AE3A 3CX8B 1XMQT 5LGUB 5BMVE 3PUWF 3HA4A 4BJNA 1N36T 2V8SV 2HPJA 2VWAA 1ZEEA 2YK0A 4TX5A 3KV6A 3KFWX 3KV4A 4LFAT 2E9XB 5LMNT 5HXCA 3IHRA 3PUVF 2XQ6A 2AE9A 3RH3A 3HKBE 4KMCA 3RIAA 4HFCA 4HN9A 4C91A 4CXXA 3FZLB 2LSIA 5JVDE 3JAEA 3PDYA 3KV5A 2BS2A 1OEDB 1S94A 2KMFA 4B3RT 4YSXA 5FNVE 3P4QA 5FXVA 1VRBA 1HCIA 2WMOA 2ZM2A 4KX6A 3FZFB 2PJQA 5AQUB 1BR4A 3JAFA 5HYAA 3PURA 2KXPB 5FKYA 1T98A 4GK5E 5ABGA 1KNPA 3ZMZB 2YDSA 3E22E 3FBLA 1ZHCA 2W62A 5HEJA 2E8IA 5HXRA 2VQFT 3AEEA 2UUCT 4FI5A 1CHUA 5FVKA 3VRAA 2DLRA 5F3JA 2J1DG 4BAYB 4DV6T 2WY2A 3PUXF 5JRCA 2E5VA 4EYUA 2XHEB 4ISSA 3ONXA 2WM9A 4LFCT 2XSAA 5AQQB 3C4XA 3FB2A 4HFBA 4HFDA 5JDNA 4DR4T 1UK5A 2K3WA 2K48A 4JI0T 3P8CD 3PU3A 3ZMVB 2XZEA 3RC8A 2NTYA 4JI7T 4I4TE 4DBQA 4PAGA 4B3MT 4TWFA 4B6XA 1HR0T 2YKSA 2X67A 4JEUB 2D9DA 1WYBA 2XAQB 3PUGA 4YTPA 4PFPA 1O3XA 2LHRA 2Q9QD 2BG9C 4HWIB 4DMVA 1X79A 5AQJB 2IC6A 3MJXA 3ZMUB 4JLEA 2MPKA 3OBVE 4Z90A 2H3RA 4QWNB 4UF0B 3EHZA 5HCMA 3FXDB 3QUJA 5H6RB 3Q5XA 2ACZA 4E7ZA 5JR9B 4JV5T 4DIDB 2X9YA 4DV2T 3RKGA 2IDOB 2LM2A 3UUXB 4KI0F 2KWIB 1YW0A 4I55E 4PJJA 2NTXA 4YLHA 5L3DB 2E5LT 5L47A 2WP9A 2W63A 3M3ZB 1UUSA 4ZI2D 2ODVA 3WAKA 2F4VT 3AEGA 4PNIA 1M62A 5EK3A 2A9UA 2EHOC 4PK6A 3UQ4A 3NBXX 2HPLA 1HX8A 4QX8B 1LRZA 5C3JA 2OV9A 4IE5A 5ETWA 4IL4A 2LOPA 2XAFB 4BJMA 2C0SA 5HXEA 4U72A 4PJNA 4UVCB 2B1EA 4QH5A 4YXDA 4EGWA 3NZQA 3SWHA 4ZOLE 3PUZF 2LM9A 3UFEA 4ZI3C 2CEAA 3KVAA 2M67A 4HWDA 4HGAA 5GONE 2X9XA 2L3LA 3RIUA 2Q9QB 5LOVE 1MNEA 1HG2A 5LYJE 3CMLA 4IDQA 3OPCA 1LVKA 4DUZT 4CI1B 4LF5T 1LVFA 2JJ9A 4EV6A 4H9PC 4EEDA 1LKXA 3UQ7A 3TKLB 2JQ9A 5KMGP 2V5CA 1FMWA 2XQ9A 4XZCA 3P4PA 3NZPA 1HS7A 3N5LA 3U3IA 2CWYA 1IBLT 3VR8A 4O2BE 4HFEA 2BKNA 2IW5B 4NXMT 4O4HE 3O1IA 4O4JE 3AA7B 3FZMB 1D0ZA 3W15B 2NP9A 4AQFA 1MMGA 3TLWA 3ZMSB 2LSGA 2X9WA 4L9IA 4H63V 2ZLYA 2CRBA 2CXFA 4JYAT 2YDQA 2XQ3A 2YEVC 1HNWT 2UUBT 3LBXA 3VR9A 2XM1A 3ANWB 2HHHT 2E9XC 3CQGB 2WDVA 5AQHB 3I9YA 2I0MA 1W0BA 1MNDA 1OWAA 3M65A 2CLYB 3ZN1B 2LSKA 5EK2A 2CWOA 4DV3T 2PFVA 3RKOA 1D0XA 3QB5A 4WZXA 2VQET 1YKEB 4UR9A 1OEDC 4QXBB 4X64T 4GKKT 2WB5A 4IIJE 5F8PA 4O2AE 4LF6T 4ILBA 5FXZA 2W66A 4ANJA 5CGMA 3CK6A 2JQQA 2N2NA 4H9RC 4AKGA 2FUPA 3H3MA 2V6XA 2M6IA 1KF6A 4JI3T 5ABFA 2UU9T 2KLQA 3ETUA 5KXJA 4Z91A 3GN5A 2BKPA 4IREA 4ZZCA 3DJBA 1Z0PA 2WCAA 4EOZB 4ZI7E 3AE7A 1T72A 5DQWA 1XNRT 3RX6A 3EAMA 4DV5T 2BG9E 2SPCA 3JC6D 4LF4T 2NWBA 4NUVA 2CHOA 2VKDA 5JH7E 2V6YB 4DVDA 4NUUA 4X66T 4NPPA 2RA1A 1IBMT 4LMLA 4ZZBA 2X9HA 2A3DA 2X0HA 3C50A 3N9OA 2VKOA 1UCUA 4M1PA 3BQLA 3PUQA 1Y01A 5CFBA 3ABVA 3B57A 3AE8A 2DWGA 1ZV4X 3AEDA 2FJEA 3CVRA 1J5ET 2RPAA 3AVSA 4DR2T 2XSBA 4QH4A 3OTOT 3UU6A 2BVLA 1MMNA 3NVOA 4LF9T 3AAAB 3FHNA 1S35A 2KNDA 2D0UA 3O9XA 3RF1A 4YSZA 2W00A 3RQWA 4DBRA 5AFUL 5LHHB 3RYHE 3ZC1A 3HL6A 5AQPB 1XZYA 3V5UA 2V5DA 3F2EA 5BR8T 4C90A 1KNRA 4YTMA 3O1HA 3MXZA 3IEEA 2XQ5A 4TWDA 1N33T 3OYZA 5JR9C 2NW7A 4JI2T 5AQOB 2BS3A 4DNDA 3N9MA 2V7MA 3J9X1 3SRZA 1J1JA 2BKOA 3K3OA 1MMAA 4IT4A 3ZT5A 2VURA 2CE7A 3TLUA 4WYVA 2XQ7A 4UELA 4AQGA 4YJ2E 1WYCA 5HXHA 3KBTA 3A5XA 3K1SA 2KSRA 3VU7H 3SS1A 4JI1T 2YU2A 4IE6A 3OJAA 4N78D 2H7VC 3GA8A 2D0TA 1VOMA 4DV0T 4L5GA 1HFAA 5ADXL 1WR6A 1QUUA 5LJNA 3RYFE 3AXJB 3AE2A 3LJCA 2BG9A 2OLTA 4ZEYA 2KINB 2JMKA 1EZ3A 4YFSA 4TUYE 3JADA 5IUXA 3MACA 2JQKA 2ACXA 5EZYE 1FIOA 3LG7A 1JNZA 4AKRB 3AA1B 4AIUA 2ZM8A 3N9PA 3BQKA 3AEFA 2MYSA 5H6QB 1MIWA 3AA6B 1D1BA 3O4XE 2CXDA 2VB6A 3KINB 5JDMA 2FJBA 2PG8A 3C4WA 3AECA 1XDOA 5LXTE 4YT0A 3C51A 2W0GA 3TLVA 1YQ3A 5L3FB 1WRDA 4A56A 2PTFA 3LK42 3MZKB 4IDNA 2KT9A 3UTKA 1OEDE 2EHOA 4ZXLA 3SOLA 5CA1E 2XQAA 1WLXA 4OYJA 4UV8B 4LMKA 4I43B 2AXDS 4ZI2C 2WAUA 2QYWA 5C8YE 3LK3B 1W0AA 2DNXA 3ZYMA 4TN7B 1BR0A 3AAEB 3P7IA 3U78A 4DR3T 3PUSA 4CQIA 4P1NA 4KUMB 2ES0A 4QXCB 4NXNT 2WQYA 3LDQB 1U4QA 3AE4A 4UVBB 2E2AA 3HR0A 3RRWA 4U2YA 3EDVA 4I0UA 4IE7A 1L0VA 3I1AA 2IAKA 3HKCE 5LP6E 4YY3T 2CPTA 1CUNA 2XAHB 3UUMA 4EZ4A 3ZJ1A 5HWXA 5C2TA 3C4ZA 2GK9A 2FJDA 4H63H 2FBWA 3CQCB 4I50E 2P9BA 2V7IA 3CX7B 2WU2A 4Z8XA 3NRXA 5AQNB 2QGSA 4J2CA 3JCFA 4GOUA 5LCYA 3MA9A 1WR0A 2H7OA 4DMWA 3EDUA 3X1DA 3E0ZA 4MALA 4UXNB 3SFEA 1VCTA 3L09A 5FY7A 2WS3A 4IDPA 4EAHA 2ODUA 1SA0E 4HFIA 2C5IT 3NWIA 4KHZF 4HE8A 4DO0A 3H3AA 3CX6B 3H37A 4MLKA 4EZHA 2DCFA 4JI8T 2LE8A 5HEGA 5HAXA 5DJQC 4IGUA 4F6RC 2WDQA 3N2OA 2VK9A 1IJ5A 4U33A 2VL0A 5AQSB 2K9AA 4KBMB 3PV0F 5ABHA 4EEBA 3ONLC 1QSDA 2E9XA 5FL1A 2EHOD 2HH7A 4PW8A 4YHHT 4V1Av 3AA0B 4CXYA 5JDGA 3ZC0A 3VRBA 2R6GF 5IHYA 2UXBT 3ZCIA 1OEDA 3N9NA 4EB6E 5CB4E 2N1GA 4U2ZA 2LSYA 2LJLA 1G8XA 4CN4A 5JDFA 3C64A 5LJMA 4WBOA 4ERRA 3P4RA 2Y8DA 2XPKA 2N9DA 3ZPOA 1HNXT 1YKHB 3RIFA 3I0QA 2X0YA 4QKNA 5E0OA 3Q5EA 2J47A 2QVAA 1H7CA 3FXEB 4MFRA 1G73A 4AKHA 2YN6A 1HG5A 1IJ6A 3HI2A 5JRCB 4O4IE 3CIRA 2YOEA 1NEKA 3UFGA 4UVAB 5CJ5A 2OA5A 3BQIA 2WWVA 2KWHA
chains in the Genus database with same CATH topology
4DV4T 4LFCT 2UXDT 4DR3T 4JI3T 2UU9T 2E5LT 4LFAT 4NXNT 1N32T 2UXCT 4DR4T 1IBLT 5LMNT 2F4VT 1I94T 3T1YT 4JI0T 4NXMT 5BR8T 1XMOT 4YHHT 2UUAT 4YY3T 4DR1T 4DV1T 4KHPT 4JI7T 1XNRT 4DR7T 4DV5T 4B3MT 2UXBT 4K0KT 3T1HT 1HR0T 2ZM6T 4DR5T 1HNZT 4LF4T 1FJGT 1N33T 4B3RT 4DUYT 4JI2T 4GKJT 4X62T 4JYAT 4X66T 1IBKT 4LF7T 1IBMT 4OX9T 1HNWT 2UUBT 4JI4T 4LFBT 2HHHT 4AQYT 1HNXT 4DV7T 5IWAT 5LMUT 1N34T 2VQFT 2UUCT 4DR6T 4B3ST 4JI1T 4DV6T 4JI5T 4DV3T 1XMQT 4JI6T 2VQET 4DUZT 1J5ET 4DR2T 4LF5T 4B3TT 4DV0T 3OTOT 4X64T 1N36T 4GKKT 4X65T 4JV5T 4LF9T 4DV2T 4LF6T 1XNQT 4JI8T 4LF8T
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV4 T;  4LFC T;  2UXD T;  4DR3 T;  4JI3 T;  2UU9 T;  2E5L T;  4LFA T;  4NXN T;  1N32 T;  2UXC T;  4DR4 T;  1IBL T;  5LMN T;  2F4V T;  1I94 T;  3T1Y T;  4JI0 T;  4NXM T;  5BR8 T;  1XMO T;  4YHH T;  2UUA T;  4YY3 T;  4DR1 T;  4DV1 T;  4KHP T;  4JI7 T;  1XNR T;  4DR7 T;  4DV5 T;  4B3M T;  2UXB T;  4K0K T;  3T1H T;  1HR0 T;  2ZM6 T;  4DR5 T;  1HNZ T;  4LF4 T;  1FJG T;  1N33 T;  4B3R T;  4DUY T;  4JI2 T;  4GKJ T;  4X62 T;  4JYA T;  4X66 T;  1IBK T;  4LF7 T;  1IBM T;  4OX9 T;  1HNW T;  2UUB T;  4JI4 T;  4LFB T;  2HHH T;  4AQY T;  1HNX T;  4DV7 T;  5IWA T;  5LMU T;  1N34 T;  2VQF T;  2UUC T;  4DR6 T;  4B3S T;  4JI1 T;  4DV6 T;  4JI5 T;  4DV3 T;  1XMQ T;  4JI6 T;  2VQE T;  4DUZ T;  1J5E T;  4DR2 T;  4LF5 T;  4B3T T;  4DV0 T;  3OTO T;  4X64 T;  1N36 T;  4GKK T;  4X65 T;  4JV5 T;  4LF9 T;  4DV2 T;  4LF6 T;  1XNQ T;  4JI8 T;  4LF8 T; 
#chains in the Genus database with same CATH topology
 3ZST A;  2CBJ A;  4CN1 A;  3R6N A;  2KZ7 B;  1HF8 A;  2QRX A;  5J1G A;  3UU8 A;  2YU1 A;  1T7S A;  4UEM A;  1JNR A;  2WWU A;  3TLS A;  4COF A;  3MKD A;  4P0A A;  3ZMT B;  4U7I A;  2K5B B;  2XAJ B;  4EIW A;  2V7L A;  2DWK A;  5AQK B;  2X66 A;  5HEH A;  5EK4 A;  5AQM B;  1AJ3 A;  3RHW A;  5J2U E;  1FJG T;  1KFY A;  4GKJ T;  5FXW A;  3QK6 A;  4X5T A;  3UT5 E;  3ZT6 A;  2L9Q A;  1M7K A;  1E2A A;  4AKI A;  4LF7 T;  3EUH A;  4JI4 T;  3AB3 B;  3ZKR A;  2LSJ A;  4O8S A;  3UUL A;  2WZI A;  4PFO A;  4AQY T;  3RI5 A;  5DQV A;  4WNK A;  5LA6 E;  5AQV B;  1NEN A;  3P50 A;  2VAS A;  2D5U A;  5FY1 A;  3ZJ2 A;  1W09 A;  5AQR B;  2NW9 A;  2B76 A;  4UF0 A;  2WU5 A;  2XQ8 A;  3PTR B;  2LKG A;  2LLY A;  5JR9 A;  4JUY A;  5F5W A;  3AAI A;  4CN6 A;  4JEH B;  2VKJ A;  3OKQ A;  2CXL A;  1B7T A;  4PJM A;  5AQG B;  1HTJ F;  4QHO A;  2CBI A;  1I94 T;  2J4G A;  3GWH A;  1Y64 B;  4OFZ A;  1XMO T;  1U5P A;  5M4Y A;  3RC3 A;  4ZHQ E;  3FZK B;  5L2L A;  3FBZ A;  2ZM6 T;  1HNZ T;  4PK4 A;  2WSS V;  5AQT B;  3RRC A;  4AIS A;  4BA9 A;  3ZSS A;  2VVS A;  3K8P C;  4HWF A;  4X62 T;  3PUA A;  3QC9 A;  5TAO A;  1IBK T;  2PBI A;  4JBW F;  1UUR A;  3DTO A;  1FMV A;  4G2A A;  4LFB T;  3A8Y C;  3FZH B;  1YXR A;  3EVY A;  3ETV A;  3ESL A;  5L3E B;  4CI2 B;  3ZYL A;  2IHR 1;  2DI4 A;  3AE6 A;  2Q9Q A;  1UX4 A;  2BS4 A;  4ILA A;  4DR6 T;  4ADZ A;  1UGO A;  3DP7 A;  1V9D A;  4JI5 T;  1ZKE A;  5FP3 A;  4NIQ A;  4JI6 T;  1E7P A;  4B3T T;  3NRY A;  5JDL A;  4EXT A;  5L3G B;  1MIV A;  4DV4 T;  3IA3 A;  2XUE A;  2XQY A;  2BVM A;  2FJA A;  1N32 T;  4HFH A;  1E1H B;  2HN2 A;  5IYZ E;  4AI6 A;  5LG3 A;  2ZMA A;  5A1L A;  2H88 A;  4KP3 C;  3E08 A;  3AVR A;  3SFD A;  2JPF A;  2UXN B;  3T8O A;  4DR1 T;  5LHG B;  3WAJ A;  4DV1 T;  3PE0 A;  2Y6X A;  2LRK A;  5JRE A;  3BK9 A;  4YHJ A;  3HKE E;  3ZT7 A;  4X1I E;  5KX5 E;  5HEO A;  1MMD A;  2X0L B;  4OK0 A;  1SHZ C;  4DR5 T;  2IML A;  1YD8 G;  3P4W A;  4H9S E;  2HN1 A;  5FVL A;  2Q9Q C;  5JTG A;  2MBG A;  3UUN A;  4IDZ A;  4U7Y A;  4XAX B;  2X51 A;  3LBX B;  1X9B A;  1W9R A;  3IF8 B;  3ANW A;  3RQU A;  2LRL A;  3KBU A;  3Q9D A;  2ZM0 A;  4H9O C;  5HCJ A;  5J2T E;  1I6Z A;  1ZOY A;  3TLT A;  2RP4 A;  2V7K A;  4L0R A;  3ZEF B;  1KNZ A;  1XWM A;  4UIG A;  4HEA A;  5LBQ B;  3V5S A;  3K3Q C;  4XBF B;  3QNU A;  3OVU A;  2A2F X;  4H9N C;  3PU8 A;  2H89 A;  2C5J A;  2JIW A;  2J62 A;  3J7Y q;  3RPU A;  3ONJ A;  3GMI A;  4WW0 A;  5ABF B;  1GQE A;  4MBQ A;  4ASK A;  3GN5 B;  2UXC T;  2LT3 A;  4AKL A;  4HKA A;  4O4L E;  2K24 A;  2M6B A;  4ZS3 A;  3QOF A;  4A98 A;  3CPZ A;  3S4U A;  4Q25 A;  4KHP T;  2W61 A;  4DR7 T;  4GYR A;  4G63 A;  4GK0 E;  3Q2M A;  5FMN A;  2L8K A;  2JMH A;  5LHI B;  1NAF A;  3CWZ B;  2BBH A;  3N2K E;  4UV9 B;  2CLY C;  3AE5 A;  2V6Y A;  2YDR A;  3N2G E;  1IAP A;  2I6H A;  2MOZ A;  4IE4 A;  3EAB A;  4H9Q C;  3B5M A;  1Z8U A;  2VKH A;  2BZB A;  3F31 A;  5IWA T;  4PK5 A;  1R8I A;  2XJ7 A;  3UUB A;  2XQ4 A;  2MAW A;  4GYS A;  4TWH A;  2WZH A;  2BBJ A;  3IBP A;  4YTN A;  1YQ4 A;  3WI3 A;  4X65 T;  2W4X A;  5FYM A;  5FXX A;  3N9L A;  3O1J A;  3AEB A;  3R84 B;  3K3N A;  1QLB A;  5LG4 A;  1WCR A;  5AQL B;  3C98 B;  5DAB A;  3HKD E;  2XM2 A;  3ZLI A;  3MK7 C;  4IHJ E;  4F8H A;  5HWY A;  5LGN B;  4X20 E;  2V1D B;  2XTL A;  2G0U A;  4IE0 A;  2UUA T;  3F57 A;  2CCQ A;  5J0Z A;  4LMJ A;  5HXS A;  3P4S A;  1US7 B;  3RLF F;  3ZN0 B;  1SE7 A;  1NWM X;  4K0K T;  5L3C B;  3T1H T;  5CA0 E;  3L39 A;  3CQX C;  4TV9 E;  4DUY T;  2CA5 A;  2X68 A;  2JRK A;  2A72 A;  2W2U A;  2MTQ A;  2CM0 A;  2IIU A;  4U31 A;  4OHF A;  1VCS A;  4QXH B;  3RYC E;  1FEW A;  3KVB A;  3I0O A;  4DV7 T;  2IC9 A;  4U3C A;  4X1Y E;  4X1K E;  3UU5 A;  1D1C A;  1KK7 A;  3ZYK A;  5L4H A;  2VL8 A;  4B3S T;  2LKH A;  4ZI3 D;  4QX7 B;  4U74 A;  2WBL A;  1D0Y A;  2NR4 A;  1DU2 A;  2WDR A;  5JQG E;  4TNV A;  1BR2 A;  2BG9 B;  4EYY R;  2QA7 A;  3AXJ A;  3OYX A;  3AE9 A;  2BDE A;  4CXW A;  2XAS B;  2VVN A;  3RYI E;  3I9W A;  3RIU C;  5LBM A;  2C5K T;  2JQH A;  3LFM A;  3B13 A;  2W67 A;  2NW8 A;  4HFV A;  4MHC A;  1ZP0 A;  4YJ3 E;  3JC6 C;  5HEU A;  4K0U A;  3KDS E;  3Q5D A;  2WMN A;  5JDQ A;  4TNW A;  2LOS A;  5KDM C;  1SUM B;  5AQF B;  3CKD A;  2Y48 B;  4AXP A;  4HWC A;  4OX9 T;  4CI3 B;  4ILU A;  3PJA J;  3LK2 B;  4IL9 A;  4PJL A;  2LEH A;  4IST A;  5LMU T;  5LB7 B;  1N34 T;  2EHO B;  4AQF C;  4ILC A;  3PUY F;  3LSV A;  5L3B B;  1MIY A;  2E9X D;  4WBN E;  1UX5 A;  5AQI B;  4A97 A;  2CMR A;  3AE1 A;  1XNQ T;  3RGL A;  4LF8 T;  4IDO A;  3VKH A;  2UXD T;  4FJO A;  5ABE A;  4OYK A;  4E7S A;  3G06 A;  2UXX B;  3UU4 A;  5L4E A;  4TV8 E;  1BR1 A;  2Z6E A;  4GIW A;  1T8B A;  1KEY A;  3KV9 A;  2XY8 B;  3T1Y T;  3ZCJ A;  1HX1 B;  2CHN A;  2NOX A;  5FY0 A;  1J5W A;  4P0B A;  2DHR A;  3L3P A;  2V26 A;  4YSY A;  2DL1 A;  4HTE A;  5JDH A;  1IZN B;  1WFD A;  1D1A A;  4CZZ B;  2I59 A;  3L8R A;  2V7J A;  3AEA A;  3EI0 A;  5LGT B;  2YIN A;  3VKG A;  2LHN A;  4TZ4 C;  2IUB A;  4P09 A;  2D2S A;  3Q5W A;  5LNK A;  5FL0 A;  2XAG B;  3A7M A;  3UU3 A;  3D0T A;  4QH1 A;  3N9Q A;  3VHL A;  1OXZ A;  3QB5 K;  1XDP A;  4A5X A;  4ZS2 A;  3NKZ A;  3PJA A;  4HWH A;  3AE3 A;  3CX8 B;  1XMQ T;  5LGU B;  5BMV E;  3PUW F;  3HA4 A;  4BJN A;  1N36 T;  2V8S V;  2HPJ A;  2VWA A;  1ZEE A;  2YK0 A;  4TX5 A;  3KV6 A;  3KFW X;  3KV4 A;  4LFA T;  2E9X B;  5LMN T;  5HXC A;  3IHR A;  3PUV F;  2XQ6 A;  2AE9 A;  3RH3 A;  3HKB E;  4KMC A;  3RIA A;  4HFC A;  4HN9 A;  4C91 A;  4CXX A;  3FZL B;  2LSI A;  5JVD E;  3JAE A;  3PDY A;  3KV5 A;  2BS2 A;  1OED B;  1S94 A;  2KMF A;  4B3R T;  4YSX A;  5FNV E;  3P4Q A;  5FXV A;  1VRB A;  1HCI A;  2WMO A;  2ZM2 A;  4KX6 A;  3FZF B;  2PJQ A;  5AQU B;  1BR4 A;  3JAF A;  5HYA A;  3PUR A;  2KXP B;  5FKY A;  1T98 A;  4GK5 E;  5ABG A;  1KNP A;  3ZMZ B;  2YDS A;  3E22 E;  3FBL A;  1ZHC A;  2W62 A;  5HEJ A;  2E8I A;  5HXR A;  2VQF T;  3AEE A;  2UUC T;  4FI5 A;  1CHU A;  5FVK A;  3VRA A;  2DLR A;  5F3J A;  2J1D G;  4BAY B;  4DV6 T;  2WY2 A;  3PUX F;  5JRC A;  2E5V A;  4EYU A;  2XHE B;  4ISS A;  3ONX A;  2WM9 A;  4LFC T;  2XSA A;  5AQQ B;  3C4X A;  3FB2 A;  4HFB A;  4HFD A;  5JDN A;  4DR4 T;  1UK5 A;  2K3W A;  2K48 A;  4JI0 T;  3P8C D;  3PU3 A;  3ZMV B;  2XZE A;  3RC8 A;  2NTY A;  4JI7 T;  4I4T E;  4DBQ A;  4PAG A;  4B3M T;  4TWF A;  4B6X A;  1HR0 T;  2YKS A;  2X67 A;  4JEU B;  2D9D A;  1WYB A;  2XAQ B;  3PUG A;  4YTP A;  4PFP A;  1O3X A;  2LHR A;  2Q9Q D;  2BG9 C;  4HWI B;  4DMV A;  1X79 A;  5AQJ B;  2IC6 A;  3MJX A;  3ZMU B;  4JLE A;  2MPK A;  3OBV E;  4Z90 A;  2H3R A;  4QWN B;  4UF0 B;  3EHZ A;  5HCM A;  3FXD B;  3QUJ A;  5H6R B;  3Q5X A;  2ACZ A;  4E7Z A;  5JR9 B;  4JV5 T;  4DID B;  2X9Y A;  4DV2 T;  3RKG A;  2IDO B;  2LM2 A;  3UUX B;  4KI0 F;  2KWI B;  1YW0 A;  4I55 E;  4PJJ A;  2NTX A;  4YLH A;  5L3D B;  2E5L T;  5L47 A;  2WP9 A;  2W63 A;  3M3Z B;  1UUS A;  4ZI2 D;  2ODV A;  3WAK A;  2F4V T;  3AEG A;  4PNI A;  1M62 A;  5EK3 A;  2A9U A;  2EHO C;  4PK6 A;  3UQ4 A;  3NBX X;  2HPL A;  1HX8 A;  4QX8 B;  1LRZ A;  5C3J A;  2OV9 A;  4IE5 A;  5ETW A;  4IL4 A;  2LOP A;  2XAF B;  4BJM A;  2C0S A;  5HXE A;  4U72 A;  4PJN A;  4UVC B;  2B1E A;  4QH5 A;  4YXD A;  4EGW A;  3NZQ A;  3SWH A;  4ZOL E;  3PUZ F;  2LM9 A;  3UFE A;  4ZI3 C;  2CEA A;  3KVA A;  2M67 A;  4HWD A;  4HGA A;  5GON E;  2X9X A;  2L3L A;  3RIU A;  2Q9Q B;  5LOV E;  1MNE A;  1HG2 A;  5LYJ E;  3CML A;  4IDQ A;  3OPC A;  1LVK A;  4DUZ T;  4CI1 B;  4LF5 T;  1LVF A;  2JJ9 A;  4EV6 A;  4H9P C;  4EED A;  1LKX A;  3UQ7 A;  3TKL B;  2JQ9 A;  5KMG P;  2V5C A;  1FMW A;  2XQ9 A;  4XZC A;  3P4P A;  3NZP A;  1HS7 A;  3N5L A;  3U3I A;  2CWY A;  1IBL T;  3VR8 A;  4O2B E;  4HFE A;  2BKN A;  2IW5 B;  4NXM T;  4O4H E;  3O1I A;  4O4J E;  3AA7 B;  3FZM B;  1D0Z A;  3W15 B;  2NP9 A;  4AQF A;  1MMG A;  3TLW A;  3ZMS B;  2LSG A;  2X9W A;  4L9I A;  4H63 V;  2ZLY A;  2CRB A;  2CXF A;  4JYA T;  2YDQ A;  2XQ3 A;  2YEV C;  1HNW T;  2UUB T;  3LBX A;  3VR9 A;  2XM1 A;  3ANW B;  2HHH T;  2E9X C;  3CQG B;  2WDV A;  5AQH B;  3I9Y A;  2I0M A;  1W0B A;  1MND A;  1OWA A;  3M65 A;  2CLY B;  3ZN1 B;  2LSK A;  5EK2 A;  2CWO A;  4DV3 T;  2PFV A;  3RKO A;  1D0X A;  3QB5 A;  4WZX A;  2VQE T;  1YKE B;  4UR9 A;  1OED C;  4QXB B;  4X64 T;  4GKK T;  2WB5 A;  4IIJ E;  5F8P A;  4O2A E;  4LF6 T;  4ILB A;  5FXZ A;  2W66 A;  4ANJ A;  5CGM A;  3CK6 A;  2JQQ A;  2N2N A;  4H9R C;  4AKG A;  2FUP A;  3H3M A;  2V6X A;  2M6I A;  1KF6 A;  4JI3 T;  5ABF A;  2UU9 T;  2KLQ A;  3ETU A;  5KXJ A;  4Z91 A;  3GN5 A;  2BKP A;  4IRE A;  4ZZC A;  3DJB A;  1Z0P A;  2WCA A;  4EOZ B;  4ZI7 E;  3AE7 A;  1T72 A;  5DQW A;  1XNR T;  3RX6 A;  3EAM A;  4DV5 T;  2BG9 E;  2SPC A;  3JC6 D;  4LF4 T;  2NWB A;  4NUV A;  2CHO A;  2VKD A;  5JH7 E;  2V6Y B;  4DVD A;  4NUU A;  4X66 T;  4NPP A;  2RA1 A;  1IBM T;  4LML A;  4ZZB A;  2X9H A;  2A3D A;  2X0H A;  3C50 A;  3N9O A;  2VKO A;  1UCU A;  4M1P A;  3BQL A;  3PUQ A;  1Y01 A;  5CFB A;  3ABV A;  3B57 A;  3AE8 A;  2DWG A;  1ZV4 X;  3AED A;  2FJE A;  3CVR A;  1J5E T;  2RPA A;  3AVS A;  4DR2 T;  2XSB A;  4QH4 A;  3OTO T;  3UU6 A;  2BVL A;  1MMN A;  3NVO A;  4LF9 T;  3AAA B;  3FHN A;  1S35 A;  2KND A;  2D0U A;  3O9X A;  3RF1 A;  4YSZ A;  2W00 A;  3RQW A;  4DBR A;  5AFU L;  5LHH B;  3RYH E;  3ZC1 A;  3HL6 A;  5AQP B;  1XZY A;  3V5U A;  2V5D A;  3F2E A;  5BR8 T;  4C90 A;  1KNR A;  4YTM A;  3O1H A;  3MXZ A;  3IEE A;  2XQ5 A;  4TWD A;  1N33 T;  3OYZ A;  5JR9 C;  2NW7 A;  4JI2 T;  5AQO B;  2BS3 A;  4DND A;  3N9M A;  2V7M A;  3J9X 1;  3SRZ A;  1J1J A;  2BKO A;  3K3O A;  1MMA A;  4IT4 A;  3ZT5 A;  2VUR A;  2CE7 A;  3TLU A;  4WYV A;  2XQ7 A;  4UEL A;  4AQG A;  4YJ2 E;  1WYC A;  5HXH A;  3KBT A;  3A5X A;  3K1S A;  2KSR A;  3VU7 H;  3SS1 A;  4JI1 T;  2YU2 A;  4IE6 A;  3OJA A;  4N78 D;  2H7V C;  3GA8 A;  2D0T A;  1VOM A;  4DV0 T;  4L5G A;  1HFA A;  5ADX L;  1WR6 A;  1QUU A;  5LJN A;  3RYF E;  3AXJ B;  3AE2 A;  3LJC A;  2BG9 A;  2OLT A;  4ZEY A;  2KIN B;  2JMK A;  1EZ3 A;  4YFS A;  4TUY E;  3JAD A;  5IUX A;  3MAC A;  2JQK A;  2ACX A;  5EZY E;  1FIO A;  3LG7 A;  1JNZ A;  4AKR B;  3AA1 B;  4AIU A;  2ZM8 A;  3N9P A;  3BQK A;  3AEF A;  2MYS A;  5H6Q B;  1MIW A;  3AA6 B;  1D1B A;  3O4X E;  2CXD A;  2VB6 A;  3KIN B;  5JDM A;  2FJB A;  2PG8 A;  3C4W A;  3AEC A;  1XDO A;  5LXT E;  4YT0 A;  3C51 A;  2W0G A;  3TLV A;  1YQ3 A;  5L3F B;  1WRD A;  4A56 A;  2PTF A;  3LK4 2;  3MZK B;  4IDN A;  2KT9 A;  3UTK A;  1OED E;  2EHO A;  4ZXL A;  3SOL A;  5CA1 E;  2XQA A;  1WLX A;  4OYJ A;  4UV8 B;  4LMK A;  4I43 B;  2AXD S;  4ZI2 C;  2WAU A;  2QYW A;  5C8Y E;  3LK3 B;  1W0A A;  2DNX A;  3ZYM A;  4TN7 B;  1BR0 A;  3AAE B;  3P7I A;  3U78 A;  4DR3 T;  3PUS A;  4CQI A;  4P1N A;  4KUM B;  2ES0 A;  4QXC B;  4NXN T;  2WQY A;  3LDQ B;  1U4Q A;  3AE4 A;  4UVB B;  2E2A A;  3HR0 A;  3RRW A;  4U2Y A;  3EDV A;  4I0U A;  4IE7 A;  1L0V A;  3I1A A;  2IAK A;  3HKC E;  5LP6 E;  4YY3 T;  2CPT A;  1CUN A;  2XAH B;  3UUM A;  4EZ4 A;  3ZJ1 A;  5HWX A;  5C2T A;  3C4Z A;  2GK9 A;  2FJD A;  4H63 H;  2FBW A;  3CQC B;  4I50 E;  2P9B A;  2V7I A;  3CX7 B;  2WU2 A;  4Z8X A;  3NRX A;  5AQN B;  2QGS A;  4J2C A;  3JCF A;  4GOU A;  5LCY A;  3MA9 A;  1WR0 A;  2H7O A;  4DMW A;  3EDU A;  3X1D A;  3E0Z A;  4MAL A;  4UXN B;  3SFE A;  1VCT A;  3L09 A;  5FY7 A;  2WS3 A;  4IDP A;  4EAH A;  2ODU A;  1SA0 E;  4HFI A;  2C5I T;  3NWI A;  4KHZ F;  4HE8 A;  4DO0 A;  3H3A A;  3CX6 B;  3H37 A;  4MLK A;  4EZH A;  2DCF A;  4JI8 T;  2LE8 A;  5HEG A;  5HAX A;  5DJQ C;  4IGU A;  4F6R C;  2WDQ A;  3N2O A;  2VK9 A;  1IJ5 A;  4U33 A;  2VL0 A;  5AQS B;  2K9A A;  4KBM B;  3PV0 F;  5ABH A;  4EEB A;  3ONL C;  1QSD A;  2E9X A;  5FL1 A;  2EHO D;  2HH7 A;  4PW8 A;  4YHH T;  4V1A v;  3AA0 B;  4CXY A;  5JDG A;  3ZC0 A;  3VRB A;  2R6G F;  5IHY A;  2UXB T;  3ZCI A;  1OED A;  3N9N A;  4EB6 E;  5CB4 E;  2N1G A;  4U2Z A;  2LSY A;  2LJL A;  1G8X A;  4CN4 A;  5JDF A;  3C64 A;  5LJM A;  4WBO A;  4ERR A;  3P4R A;  2Y8D A;  2XPK A;  2N9D A;  3ZPO A;  1HNX T;  1YKH B;  3RIF A;  3I0Q A;  2X0Y A;  4QKN A;  5E0O A;  3Q5E A;  2J47 A;  2QVA A;  1H7C A;  3FXE B;  4MFR A;  1G73 A;  4AKH A;  2YN6 A;  1HG5 A;  1IJ6 A;  3HI2 A;  5JRC B;  4O4I E;  3CIR A;  2YOE A;  1NEK A;  3UFG A;  4UVA B;  5CJ5 A;  2OA5 A;  3BQI A;  2WWV A;  2KWH A; 
#chains in the Genus database with same CATH homology
 4DV4 T;  4LFC T;  2UXD T;  4DR3 T;  4JI3 T;  2UU9 T;  2E5L T;  4LFA T;  4NXN T;  1N32 T;  2UXC T;  4DR4 T;  1IBL T;  5LMN T;  2F4V T;  1I94 T;  3T1Y T;  4JI0 T;  4NXM T;  5BR8 T;  1XMO T;  4YHH T;  2UUA T;  4YY3 T;  4DR1 T;  4DV1 T;  4KHP T;  4JI7 T;  1XNR T;  4DR7 T;  4DV5 T;  4B3M T;  2UXB T;  4K0K T;  3T1H T;  1HR0 T;  2ZM6 T;  4DR5 T;  1HNZ T;  4LF4 T;  1FJG T;  1N33 T;  4B3R T;  4DUY T;  4JI2 T;  4GKJ T;  4X62 T;  4JYA T;  4X66 T;  1IBK T;  4LF7 T;  1IBM T;  4OX9 T;  1HNW T;  2UUB T;  4JI4 T;  4LFB T;  2HHH T;  4AQY T;  1HNX T;  4DV7 T;  5IWA T;  5LMU T;  1N34 T;  2VQF T;  2UUC T;  4DR6 T;  4B3S T;  4JI1 T;  4DV6 T;  4JI5 T;  4DV3 T;  1XMQ T;  4JI6 T;  2VQE T;  4DUZ T;  1J5E T;  4DR2 T;  4LF5 T;  4B3T T;  4DV0 T;  3OTO T;  4X64 T;  1N36 T;  4GKK T;  4X65 T;  4JV5 T;  4LF9 T;  4DV2 T;  4LF6 T;  1XNQ T;  4JI8 T;  4LF8 T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...