4LFBT

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
total genus 36
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 4lfbT00
4JI3T 4B3MT 4K0KT 1XNRT 4LF8T 4JI6T 4OX9T 4DV0T 1HNZT 3T1HT 4JI7T 1I94T 4JI4T 4YY3T 4LF6T 4B3ST 2UUCT 4JYAT 4DV1T 1HR0T 4LF9T 4NXNT 4GKKT 3T1YT 4LF4T 5LMUT 4LFCT 4X66T 4DR3T 4X65T 1N33T 2UXCT 4DV3T 2E5LT 4LFAT 2UUAT 4JI8T 4DR7T 2ZM6T 2UXBT 4DUZT 5IWAT 1XMQT 3OTOT 1N36T 1J5ET 4DV2T 4JI5T 2HHHT 1IBMT 1IBKT 4DV6T 4LFBT 4DR5T 4JI0T 4DV7T 2UU9T 1N32T 5BR8T 4DV5T 4DR2T 1HNWT 2UUBT 2VQFT 4LF7T 1N34T 1IBLT 4B3RT 4JI1T 4DUYT 4X64T 4JI2T 4DR6T 4NXMT 4X62T 4DR1T 4LF5T 4DR4T 1FJGT 1XNQT 2UXDT 4JV5T 4YHHT 2F4VT 4B3TT 1HNXT 1XMOT 4AQYT 2VQET 4GKJT 5LMNT 4DV4T 4KHPT
chains in the Genus database with same CATH superfamily
4CN1A 2E9XA 2N2NA 4WBOA 5ABFA 3DJBA 4QWNB 2DHRA 4ANJA 2LSGA 4U7YA 5AQSB 3AE9A 1KEYA 3JAEA 3AAAB 4IE4A 3F2EA 3VR9A 4EYYR 3ZT6A 4LF9T 4IDZA 4YSYA 3ZMVB 5BMVE 4QX8B 1E7PA 4QH5A 2KZ7B 4IE5A 3RKGA 1MMAA 1MNDA 4AKGA 4KMCA 2WQYA 3JCFA 5FL0A 4H9QC 2VKDA 5LBQB 3L3PA 3AEDA 3VR8A 3UUXB 2W67A 2UUBT 2BG9B 2H88A 2YKSA 5JDGA 2KINB 2IW5B 4DMWA 3T8OA 5AQIB 3PURA 3LFMA 3G06A 2HH7A 3D0TA 2X67A 4AXPA 1WYCA 1KNRA 1IAPA 3PV0F 3P4SA 3AEEA 5J0ZA 3H3MA 4UF0A 2K5BB 3SFEA 4TWFA 1BR4A 2V5DA 4EZHA 1OEDB 1NENA 4YSXA 3RI5A 4ILCA 3RIUC 3ETVA 2IAKA 2XQ7A 5FVKA 4HFCA 4OK0A 1KNPA 4JI6T 2DNXA 2XSBA 3P8CD 4ZS3A 3CIRA 3RH3A 5F5WA 3ZT5A 1O3XA 4EB6E 2LHNA 4QHOA 2D2SA 3PUSA 5FNVE 2IIUA 2RP4A 4YHJA 5LYJE 3ZC1A 1R8IA 1I6ZA 4TUYE 4C91A 4JUYA 2K9AA 2W66A 4DIDB 2DWKA 3TKLB 4QXBB 3I9WA 2ZM8A 2NW9A 2ZM2A 1W9RA 4DV6T 5JR9B 3UFEA 3VKHA 1DU2A 1ZHCA 5BR8T 4IDOA 3ZKRA 1WR0A 4ZS2A 2H89A 2ZM0A 3FXEB 4JI1T 4U74A 2E8IA 2VL0A 1VCSA 5JVDE 2CHNA 2E9XB 1JNRA 5AQKB 1OEDC 4O4HE 5ABFB 3FBLA 5IHYA 2BBJA 2BS4A 5LGUB 2B1EA 4UR9A 5FVLA 1KNZA 4PK5A 2LSJA 3NRYA 4QX7B 2JMHA 3SOLA 2A2FX 2MYSA 4DV4T 4LMLA 4ILAA 2L8KA 3MZKB 3OYXA 3AEBA 2NWBA 3A8YC 4FI5A 3AECA 2BKNA 4U3CA 3PJAJ 4COFA 3GN5A 1V9DA 4JI4T 3J7Yq 4YSZA 4CXXA 3N9OA 5LNKA 4AKRB 1D1AA 2PFVA 4IHJE 5JR9C 4LFCT 5KDMC 2XUEA 3IHRA 2IHR1 2VVNA 5L4HA 1QUUA 1WLXA 3ZPOA 2FJAA 4YTMA 3OTOT 3K8PC 1MMNA 3NVOA 2XAGB 3QNUA 4ISTA 3H3AA 4DR2T 2V1DB 1X79A 3EABA 4U33A 4UF0B 3LBXB 2VKJA 3HKBE 5HAXA 3A5XA 2LOSA 3L09A 2EHOA 3P4WA 5LG3A 5FXXA 4DR6T 3KINB 3ONJA 2N9DA 2KMFA 4WW0A 4U72A 4CZZB 3C64A 5LMNT 4BAYB 4TNVA 4PFOA 1G73A 4C90A 4JI3T 3I9YA 3JADA 4LF8T 4CI2B 2LOPA 5JDMA 5AQRB 5JRCA 4F6RC 2A72A 5CJ5A 4JEUB 4EOZB 4H9NC 4KI0F 3V5UA 1HX1B 4MBQA 4QXCB 5F3JA 4IL9A 4IREA 2CA5A 2YEVC 4IDNA 2UUAT 2LEHA 5FL1A 2AE9A 4TWDA 2HN2A 1XMQT 5AQJB 2CXFA 4OFZA 4QKNA 2JPFA 3PUGA 3PE0A 3ZCJA 3K3OA 1N34T 5L3FB 2JQHA 3AE3A 2XTLA 3AAEB 1H7CA 2MOZA 4UVCB 2N1GA 2XQ3A 4U2ZA 3Q5DA 4IL4A 1D0YA 4EV6A 4YHHT 2V6XA 2F4VT 4O4LE 2VQET 3JC6D 2YN6A 5H6QB 1UK5A 2J4GA 3C4ZA 4DBQA 2LM9A 2DL1A 4B3MT 4H63H 2JIWA 1WR6A 1T72A 3O1HA 5LBMA 3VKGA 4UXNB 3Q5XA 2KNDA 3LJCA 3PUVF 1UX4A 3KV5A 1D1CA 3TLVA 3H37A 3SRZA 4YJ2E 2QA7A 2XSAA 2FJBA 3CKDA 5HXCA 4EXTA 2E5LT 1ZOYA 3B13A 1MNEA 2EHOB 3KVBA 2CBIA 1XZYA 2IDOB 5JDQA 4KUMB 2XZEA 1OEDA 5L2LA 3DTOA 4DVDA 5C2TA 2BDEA 1WFDA 2W62A 5AQHB 5AQMB 1N32T 1FEWA 3FXDB 1UURA 5ADXL 1S94A 4IDPA 5HWXA 4H9OC 2WSSV 2LE8A 3FZMB 4ERRA 3ZMSB 1M7KA 5ABEA 2XQ5A 4X62T 2NOXA 5HYAA 1LRZA 1QSDA 2ZMAA 4ZOLE 3VRAA 3AE1A 2PTFA 3QK6A 2BG9E 3FB2A 4ISSA 3PUYF 5H6RB 3C50A 4HGAA 2VURA 5JR9A 5LG4A 3O1JA 2HPJA 2ODVA 3BQIA 2X9XA 4PFPA 2BBHA 1VOMA 2J62A 2FUPA 1MIYA 4EYUA 4Z91A 5KXJA 1LKXA 2IMLA 3Q5WA 3CX6B 3ZJ2A 3TLUA 2X9YA 5LMUT 5HEGA 2CPTA 2JMKA 5C3JA 2W00A 1SHZC 1LVKA 4DV2T 2VVSA 3U3IA 2ODUA 2YDSA 3FZLB 4XBFB 2X0LB 3ZSSA 3LG7A 5A1LA 4DV5T 1YXRA 5JDHA 2XQ8A 4P0BA 2JQ9A 2WY2A 2XQYA 2NR4A 4KP3C 4H9SE 2XQ6A 2OLTA 3ZYLA 4ZZCA 1D1BA 2WZIA 2NTXA 3P50A 3WAKA 4CI1B 5JDNA 4B3TT 3LSVA 3JC6C 4YFSA 5AQOB 1CHUA 1MMGA 4ZI2D 1MMDA 2VKHA 1XDPA 5EK2A 3NRXA 3RKOA 4HFDA 2X66A 2YOEA 4DV0T 5KX5E 5HXRA 2BZBA 4HWHA 5JDLA 3OVUA 2XHEB 4TV9E 3LBXA 4MLKA 2UUCT 2QVAA 2LRLA 1HR0T 3PUQA 2Y48B 4BJMA 1U5PA 1VRBA 4DV3T 3RIAA 2ACXA 2XASB 4AI6A 2V7IA 2MBGA 1HG2A 2CWYA 2KWIB 3ABVA 5CA0E 4IIJE 3IBPA 2NW7A 2D0TA 3UULA 2BKOA 4DV7T 4EIWA 5IYZE 4JBWF 3MACA 2XQ9A 2XPKA 3N2OA 1IBLT 3LK2B 1SE7A 1XWMA 4TV8E 1VCTA 2XQ4A 3HKEE 5L4EA 5LHHB 3RRCA 4H9PC 1B7TA 3RHWA 3MKDA 2V7LA 3GWHA 2CCQA 3TLWA 1FMWA 5HEUA 3HA4A 1HNXT 2Y6XA 4V1Av 1Y01A 4K0UA 3QB5K 1BR0A 3ESLA 3U78A 2WAUA 1OXZA 4EAHA 4H63V 5ABHA 3CQCB 3GA8A 3CPZA 3PU8A 5DQWA 2M6BA 1LVFA 5DABA 3ZC0A 3P4QA 3UTKA 2R6GF 2W61A 3O9XA 4M1PA 3P4RA 1US7B 3N9LA 4O8SA 3UQ7A 2H3RA 5GONE 2XAFB 4I55E 5ABGA 4NXNT 2ZLYA 1T7SA 2H7VC 3RLFF 2M6IA 4E7ZA 2ACZA 3N9NA 2PBIA 3L39A 3AE7A 2ZM6T 2UXBT 1HF8A 2GK9A 5AFUL 3RYFE 1EZ3A 1YQ4A 1YQ3A 4A56A 3C4XA 3UU3A 3HKCE 4AISA 5FY0A 5LJMA 2VQFT 2RA1A 5L47A 1D0XA 4A98A 4JI2T 4IDQA 2WZHA 3C98B 4HTEA 4GK0E 5LHIB 3E08A 5FXWA 4LF5T 3AVSA 4YT0A 4I43B 3CWZB 4MALA 2UXNB 4Z90A 3AA1B 5F8PA 2OA5A 1G8XA 1Z8UA 3RIFA 2YINA 4P09A 4WYVA 4Q25A 2K3WA 3RX6A 3FBZA 5HEJA 2OV9A 3AE6A 4OX9T 2V7MA 2XQAA 1W09A 4HWFA 2VB6A 1X9BA 4PJNA 2W63A 4LF6T 3CQXC 2WDQA 2MAWA 4G63A 4JYAT 2FJEA 1CUNA 3I1AA 3VRBA 3OJAA 1N33T 5AQUB 3MXZA 2WMOA 5LOVE 1IJ5A 2ES0A 3CQGB 2X9WA 1NEKA 1J5ET 2VK9A 2X9HA 4ADZA 5FMNA 3KDSE 3V5SA 5LP6E 4O2BE 2LKHA 1Y64B 2LSYA 1HNWT 3MK7C 5M4YA 3ZEFB 2VL8A 2KSRA 3UUBA 4PJMA 2CBJA 3AE8A 3O4XE 4HFHA 3KVAA 3LDQB 5LXTE 3OYZA 3SFDA 2IC9A 2AXDS 2X51A 2L9QA 3FZKB 4QXHB 1E2AA 3ZYKA 4U2YA 4I50E 3HL6A 4PAGA 2XAHB 3I0OA 2YK0A 3GMIA 4FJOA 4HFEA 3CX7B 3UU6A 2D5UA 2LKGA 4OHFA 5LA6E 3QC9A 5CFBA 4AKHA 2XM2A 1HG5A 5CA1E 4ZEYA 3WAJA 2CWOA 1Z0PA 4LF4T 4X66T 2VKOA 1KF6A 4O2AE 4X65T 1JNZA 3P7IA 3N2GE 4DO0A 4LFAT 1ZP0A 3N9QA 4ZI3D 4QH4A 4NPPA 4O4IE 5IWAT 4L0RA 1YW0A 4JI5T 2CXDA 2D9DA 1MIWA 2QYWA 4PW8A 1T8BA 4IE0A 4LF7T 2NTYA 2X68A 4KX6A 2PJQA 5J2UE 3NZQA 4J2CA 1E1HB 2WB5A 1YKHB 2WCAA 5AQFB 4UVAB 4GOUA 3K1SA 4TZ4C 2WWVA 5TAOA 2WDRA 1S35A 4PK6A 3AA7B 5FY7A 1KFYA 5AQQB 3UU5A 3CVRA 3N5LA 3PUWF 4CXYA 5FYMA 4KHPT 3N2KE 2LLYA 2E5VA 4O4JE 4K0KT 2A3DA 3UT5E 3RYCE 4WZXA 2JQKA 3R6NA 3B5MA 1UGOA 3RC3A 2MPKA 2VWAA 5L3BB 4YLHA 3RQWA 3ZJ1A 4CI3B 4IGUA 3AEFA 4MHCA 2NW8A 2CHOA 3KBTA 4MFRA 2V8SV 4X1KE 3ONLC 2CEAA 3L8RA 3WI3A 4DR7T 2BS2A 4HFBA 5JQGE 4GYSA 5FP3A 2BVLA 1OEDE 2VASA 5EK3A 3W15B 3ZN1B 2LSKA 3KBUA 3VU7H 3ONXA 2V7KA 3EHZA 5CB4E 3M65A 3M3ZB 1W0AA 4BJNA 3AEGA 3DP7A 4HWIB 1J1JA 5LHGB 2SPCA 3JAFA 1IZNB 2BKPA 4DR4T 2BVMA 3HR0A 4JEHB 1XMOT 2PG8A 5CGMA 2Q9QD 5L3CB 4GKJT 2IC6A 2XAQB 3IA3A 5LGTB 4XAXB 2BS3A 4XZCA 4CQIA 4GIWA 3AE4A 3O1IA 4HE8A 3ZMTB 3T1HT 4AQFC 5AQPB 2W4XA 1BR2A 2WWUA 4QH1A 1IJ6A 4HFIA 3UFGA 4HKAA 2E9XD 4UV8B 1UUSA 2I6HA 2CM0A 2DWGA 4F8HA 2RPAA 4EEDA 2UXCT 5LJNA 4ZI3C 5AQNB 4UVBB 1HCIA 4ASKA 2LRKA 3RRWA 1IBMT 2XM1A 4ILUA 2XJ7A 2LT3A 2V6YB 2JQQA 3PU3A 2YU1A 5AQVB 3KFWX 2MTQA 2J1DG 4B3RT 4PJLA 3SS1A 4DUYT 3X1DA 1WYBA 4ZXLA 3MA9A 4ZZBA 2FBWA 1HFAA 2NP9A 3EUHA 4HEAA 3OPCA 2HN1A 4IE7A 3BQLA 4TX5A 3NWIA 1W0BA 3Q2MA 2DI4A 3PTRB 2M67A 2CLYB 3OKQA 2WS3A 1J5WA 2C0SA 3CMLA 4NUVA 5HEOA 2L3LA 5LGNB 3HI2A 3AXJB 2KT9A 2CRBA 2Q9QB 5JH7E 3TLTA 1QLBA 1SUMB 3EDUA 2BG9C 2YDRA 4X5TA 3UUMA 3K3NA 4NIQA 5LCYA 2I59A 4YJ3E 1NWMX 5KMGP 2FJDA 2HPLA 4UELA 4YTNA 5L3GB 3VHLA 3PJAA 3PUZF 5JTGA 3MJXA 4BA9A 2XY8B 5FXVA 3UU8A 4P0AA 3AA6B 2V26A 3FZHB 4I0UA 3RYIE 1NAFA 1U4QA 2K48A 3NKZA 3UU4A 1YKEB 5HXSA 5IUXA 4DR1T 5HXEA 2CLYC 4CN6A 3RYHE 3CK6A 1XNQT 4NUUA 1GQEA 3S4UA 1KK7A 3QOFA 2XAJB 2Q9QC 2QRXA 3ZLIA 4PK4A 4B6XA 4TWHA 4PJJA 2KLQA 2K24A 2X0YA 3ANWA 2YDQA 4OYKA 1HNZT 4IT4A 2Z6EA 4I4TE 4AKIA 3EVYA 4H9RC 2WM9A 4B3ST 4ZI2C 3ZMZB 2E9XC 3BK9A 1OWAA 3OBVE 4WNKA 5FXZA 1FMVA 1AJ3A 1UX5A 3T1YT 4X1YE 2QGSA 4ILBA 1BR1A 1HS7A 2V5CA 5EK4A 2CMRA 2CXLA 5AQLB 5DQVA 2HHHT 1IBKT 2DLRA 2H7OA 3KV4A 4A5XA 3ETUA 4DMVA 4DR5T 4JLEA 4DBRA 4JI0T 1WCRA 2YU2A 2V7JA 2W0GA 5EZYE 3RPUA 5JDFA 3HKDE 4X1IE 3UUNA 5JREA 3B57A 1FIOA 5ETWA 5LB7B 1XDOA 3AEAA 3NBXX 4JV5T 4L5GA 4E7SA 4AQFA 4KBMB 5HCJA 1YD8G 4AQYT 1ZEEA 3ZCIA 3QB5A 4HFVA 4YTPA 3F31A 2EHOD 5C8YE 3QUJA 1MIVA 2WBLA 3E22E 4CN4A 4JI7T 1I94T 4YY3T 5E0OA 2Y8DA 3A7MA 3RC8A 2X0HA 2D0UA 5FKYA 3EAMA 3RGLA 4DV1T 4IE6A 3SWHA 5HWYA 3P4PA 4AIUA 4GKKT 2KXPB 4DNDA 3AAIA 5FY1A 3LK3B 2IUBA 2J47A 2WDVA 4OYJA 4EZ4A 4JI8T 4P1NA 3FHNA 1N36T 4HN9A 3RIUA 3F57A 5J1GA 4LFBT 3N9MA 2I0MA 4U7IA 3TLSA 4UV9B 5L3EB 5AQTB 4TNWA 2E2AA 4N78D 3GN5B 3IEEA 2C5KT 2LHRA 4X64T 3PDYA 3R84B 3AE2A 3ANWB 4KHZF 4UIGA 2C5JA 1L0VA 1D0ZA 2BG9A 4TN7B 2WU2A 3EDVA 1T98A 3RQUA 3K3QC 5AQGB 1ZKEA 4X20E 4UEMA 4AQGA 1XNRT 3CX8B 1WRDA 3C4WA 2V6YA 3AB3B 3AA0B 2JJ9A 3J9X1 1HX8A 3ZSTA 3AVRA 2CE7A 2W2UA 3E0ZA 2JRKA 4EEBA 4L9IA 3ZMUB 2C5IT 1M62A 5L3DB 4PNIA 5DJQC 4CXWA 3PUAA 4Z8XA 2KWHA 1ZV4X 3KV6A 4HWCA 5J2TE 4GYRA 4DR3T 2WMNA 4A97A 4ZI7E 3IF8B 4ZHQE 1UCUA 2LJLA 4U31A 4DUZT 2B76A 2P9BA 4G2AA 4LMJA 2LSIA 2UU9T 1HTJF 3ZN0B 5HCMA 4GK5E 3Q9DA 3NZPA 2WP9A 4LMKA 3AXJA 3FZFB 2Q9QA 3LK42 5JRCB 5HXHA 4YXDA 3EI0A 2UXXB 3AE5A 2LM2A 3I0QA 4AKLA 3ZYMA 4NXMT 3Q5EA 3BQKA 5HEHA 2G0UA 2WU5A 3UQ4A 3PUXF 1FJGT 3C51A 4WBNE 2UXDT 3N9PA 2DCFA 4EGWA 2A9UA 1SA0E 3KV9A 3ZT7A 4HWDA 2EHOC 3RF1A
chains in the Genus database with same CATH topology
4JI3T 4B3MT 4K0KT 1XNRT 4LF8T 4JI6T 4OX9T 4DV0T 1HNZT 3T1HT 4JI7T 1I94T 4JI4T 4YY3T 4LF6T 4B3ST 2UUCT 4JYAT 4DV1T 1HR0T 4LF9T 4NXNT 4GKKT 3T1YT 4LF4T 5LMUT 4LFCT 4X66T 4DR3T 4X65T 1N33T 2UXCT 4DV3T 2E5LT 4LFAT 2UUAT 4JI8T 4DR7T 2ZM6T 2UXBT 4DUZT 5IWAT 1XMQT 3OTOT 1N36T 1J5ET 4DV2T 4JI5T 2HHHT 1IBMT 1IBKT 4DV6T 4LFBT 4DR5T 4JI0T 4DV7T 2UU9T 1N32T 5BR8T 4DV5T 4DR2T 1HNWT 2UUBT 2VQFT 4LF7T 1N34T 1IBLT 4B3RT 4JI1T 4DUYT 4X64T 4JI2T 4DR6T 4NXMT 4X62T 4DR1T 4LF5T 4DR4T 1FJGT 1XNQT 2UXDT 4JV5T 4YHHT 2F4VT 4B3TT 1HNXT 1XMOT 4AQYT 2VQET 4GKJT 5LMNT 4DV4T 4KHPT
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI3 T;  4B3M T;  4K0K T;  1XNR T;  4LF8 T;  4JI6 T;  4OX9 T;  4DV0 T;  1HNZ T;  3T1H T;  4JI7 T;  1I94 T;  4JI4 T;  4YY3 T;  4LF6 T;  4B3S T;  2UUC T;  4JYA T;  4DV1 T;  1HR0 T;  4LF9 T;  4NXN T;  4GKK T;  3T1Y T;  4LF4 T;  5LMU T;  4LFC T;  4X66 T;  4DR3 T;  4X65 T;  1N33 T;  2UXC T;  4DV3 T;  2E5L T;  4LFA T;  2UUA T;  4JI8 T;  4DR7 T;  2ZM6 T;  2UXB T;  4DUZ T;  5IWA T;  1XMQ T;  3OTO T;  1N36 T;  1J5E T;  4DV2 T;  4JI5 T;  2HHH T;  1IBM T;  1IBK T;  4DV6 T;  4LFB T;  4DR5 T;  4JI0 T;  4DV7 T;  2UU9 T;  1N32 T;  5BR8 T;  4DV5 T;  4DR2 T;  1HNW T;  2UUB T;  2VQF T;  4LF7 T;  1N34 T;  1IBL T;  4B3R T;  4JI1 T;  4DUY T;  4X64 T;  4JI2 T;  4DR6 T;  4NXM T;  4X62 T;  4DR1 T;  4LF5 T;  4DR4 T;  1FJG T;  1XNQ T;  2UXD T;  4JV5 T;  4YHH T;  2F4V T;  4B3T T;  1HNX T;  1XMO T;  4AQY T;  2VQE T;  4GKJ T;  5LMN T;  4DV4 T;  4KHP T; 
#chains in the Genus database with same CATH topology
 4CN1 A;  2E9X A;  2N2N A;  4WBO A;  5ABF A;  3DJB A;  4QWN B;  2DHR A;  4ANJ A;  2LSG A;  4U7Y A;  5AQS B;  3AE9 A;  1KEY A;  3JAE A;  3AAA B;  4IE4 A;  3F2E A;  3VR9 A;  4EYY R;  3ZT6 A;  4LF9 T;  4IDZ A;  4YSY A;  3ZMV B;  5BMV E;  4QX8 B;  1E7P A;  4QH5 A;  2KZ7 B;  4IE5 A;  3RKG A;  1MMA A;  1MND A;  4AKG A;  4KMC A;  2WQY A;  3JCF A;  5FL0 A;  4H9Q C;  2VKD A;  5LBQ B;  3L3P A;  3AED A;  3VR8 A;  3UUX B;  2W67 A;  2UUB T;  2BG9 B;  2H88 A;  2YKS A;  5JDG A;  2KIN B;  2IW5 B;  4DMW A;  3T8O A;  5AQI B;  3PUR A;  3LFM A;  3G06 A;  2HH7 A;  3D0T A;  2X67 A;  4AXP A;  1WYC A;  1KNR A;  1IAP A;  3PV0 F;  3P4S A;  3AEE A;  5J0Z A;  3H3M A;  4UF0 A;  2K5B B;  3SFE A;  4TWF A;  1BR4 A;  2V5D A;  4EZH A;  1OED B;  1NEN A;  4YSX A;  3RI5 A;  4ILC A;  3RIU C;  3ETV A;  2IAK A;  2XQ7 A;  5FVK A;  4HFC A;  4OK0 A;  1KNP A;  4JI6 T;  2DNX A;  2XSB A;  3P8C D;  4ZS3 A;  3CIR A;  3RH3 A;  5F5W A;  3ZT5 A;  1O3X A;  4EB6 E;  2LHN A;  4QHO A;  2D2S A;  3PUS A;  5FNV E;  2IIU A;  2RP4 A;  4YHJ A;  5LYJ E;  3ZC1 A;  1R8I A;  1I6Z A;  4TUY E;  4C91 A;  4JUY A;  2K9A A;  2W66 A;  4DID B;  2DWK A;  3TKL B;  4QXB B;  3I9W A;  2ZM8 A;  2NW9 A;  2ZM2 A;  1W9R A;  4DV6 T;  5JR9 B;  3UFE A;  3VKH A;  1DU2 A;  1ZHC A;  5BR8 T;  4IDO A;  3ZKR A;  1WR0 A;  4ZS2 A;  2H89 A;  2ZM0 A;  3FXE B;  4JI1 T;  4U74 A;  2E8I A;  2VL0 A;  1VCS A;  5JVD E;  2CHN A;  2E9X B;  1JNR A;  5AQK B;  1OED C;  4O4H E;  5ABF B;  3FBL A;  5IHY A;  2BBJ A;  2BS4 A;  5LGU B;  2B1E A;  4UR9 A;  5FVL A;  1KNZ A;  4PK5 A;  2LSJ A;  3NRY A;  4QX7 B;  2JMH A;  3SOL A;  2A2F X;  2MYS A;  4DV4 T;  4LML A;  4ILA A;  2L8K A;  3MZK B;  3OYX A;  3AEB A;  2NWB A;  3A8Y C;  4FI5 A;  3AEC A;  2BKN A;  4U3C A;  3PJA J;  4COF A;  3GN5 A;  1V9D A;  4JI4 T;  3J7Y q;  4YSZ A;  4CXX A;  3N9O A;  5LNK A;  4AKR B;  1D1A A;  2PFV A;  4IHJ E;  5JR9 C;  4LFC T;  5KDM C;  2XUE A;  3IHR A;  2IHR 1;  2VVN A;  5L4H A;  1QUU A;  1WLX A;  3ZPO A;  2FJA A;  4YTM A;  3OTO T;  3K8P C;  1MMN A;  3NVO A;  2XAG B;  3QNU A;  4IST A;  3H3A A;  4DR2 T;  2V1D B;  1X79 A;  3EAB A;  4U33 A;  4UF0 B;  3LBX B;  2VKJ A;  3HKB E;  5HAX A;  3A5X A;  2LOS A;  3L09 A;  2EHO A;  3P4W A;  5LG3 A;  5FXX A;  4DR6 T;  3KIN B;  3ONJ A;  2N9D A;  2KMF A;  4WW0 A;  4U72 A;  4CZZ B;  3C64 A;  5LMN T;  4BAY B;  4TNV A;  4PFO A;  1G73 A;  4C90 A;  4JI3 T;  3I9Y A;  3JAD A;  4LF8 T;  4CI2 B;  2LOP A;  5JDM A;  5AQR B;  5JRC A;  4F6R C;  2A72 A;  5CJ5 A;  4JEU B;  4EOZ B;  4H9N C;  4KI0 F;  3V5U A;  1HX1 B;  4MBQ A;  4QXC B;  5F3J A;  4IL9 A;  4IRE A;  2CA5 A;  2YEV C;  4IDN A;  2UUA T;  2LEH A;  5FL1 A;  2AE9 A;  4TWD A;  2HN2 A;  1XMQ T;  5AQJ B;  2CXF A;  4OFZ A;  4QKN A;  2JPF A;  3PUG A;  3PE0 A;  3ZCJ A;  3K3O A;  1N34 T;  5L3F B;  2JQH A;  3AE3 A;  2XTL A;  3AAE B;  1H7C A;  2MOZ A;  4UVC B;  2N1G A;  2XQ3 A;  4U2Z A;  3Q5D A;  4IL4 A;  1D0Y A;  4EV6 A;  4YHH T;  2V6X A;  2F4V T;  4O4L E;  2VQE T;  3JC6 D;  2YN6 A;  5H6Q B;  1UK5 A;  2J4G A;  3C4Z A;  4DBQ A;  2LM9 A;  2DL1 A;  4B3M T;  4H63 H;  2JIW A;  1WR6 A;  1T72 A;  3O1H A;  5LBM A;  3VKG A;  4UXN B;  3Q5X A;  2KND A;  3LJC A;  3PUV F;  1UX4 A;  3KV5 A;  1D1C A;  3TLV A;  3H37 A;  3SRZ A;  4YJ2 E;  2QA7 A;  2XSA A;  2FJB A;  3CKD A;  5HXC A;  4EXT A;  2E5L T;  1ZOY A;  3B13 A;  1MNE A;  2EHO B;  3KVB A;  2CBI A;  1XZY A;  2IDO B;  5JDQ A;  4KUM B;  2XZE A;  1OED A;  5L2L A;  3DTO A;  4DVD A;  5C2T A;  2BDE A;  1WFD A;  2W62 A;  5AQH B;  5AQM B;  1N32 T;  1FEW A;  3FXD B;  1UUR A;  5ADX L;  1S94 A;  4IDP A;  5HWX A;  4H9O C;  2WSS V;  2LE8 A;  3FZM B;  4ERR A;  3ZMS B;  1M7K A;  5ABE A;  2XQ5 A;  4X62 T;  2NOX A;  5HYA A;  1LRZ A;  1QSD A;  2ZMA A;  4ZOL E;  3VRA A;  3AE1 A;  2PTF A;  3QK6 A;  2BG9 E;  3FB2 A;  4ISS A;  3PUY F;  5H6R B;  3C50 A;  4HGA A;  2VUR A;  5JR9 A;  5LG4 A;  3O1J A;  2HPJ A;  2ODV A;  3BQI A;  2X9X A;  4PFP A;  2BBH A;  1VOM A;  2J62 A;  2FUP A;  1MIY A;  4EYU A;  4Z91 A;  5KXJ A;  1LKX A;  2IML A;  3Q5W A;  3CX6 B;  3ZJ2 A;  3TLU A;  2X9Y A;  5LMU T;  5HEG A;  2CPT A;  2JMK A;  5C3J A;  2W00 A;  1SHZ C;  1LVK A;  4DV2 T;  2VVS A;  3U3I A;  2ODU A;  2YDS A;  3FZL B;  4XBF B;  2X0L B;  3ZSS A;  3LG7 A;  5A1L A;  4DV5 T;  1YXR A;  5JDH A;  2XQ8 A;  4P0B A;  2JQ9 A;  2WY2 A;  2XQY A;  2NR4 A;  4KP3 C;  4H9S E;  2XQ6 A;  2OLT A;  3ZYL A;  4ZZC A;  1D1B A;  2WZI A;  2NTX A;  3P50 A;  3WAK A;  4CI1 B;  5JDN A;  4B3T T;  3LSV A;  3JC6 C;  4YFS A;  5AQO B;  1CHU A;  1MMG A;  4ZI2 D;  1MMD A;  2VKH A;  1XDP A;  5EK2 A;  3NRX A;  3RKO A;  4HFD A;  2X66 A;  2YOE A;  4DV0 T;  5KX5 E;  5HXR A;  2BZB A;  4HWH A;  5JDL A;  3OVU A;  2XHE B;  4TV9 E;  3LBX A;  4MLK A;  2UUC T;  2QVA A;  2LRL A;  1HR0 T;  3PUQ A;  2Y48 B;  4BJM A;  1U5P A;  1VRB A;  4DV3 T;  3RIA A;  2ACX A;  2XAS B;  4AI6 A;  2V7I A;  2MBG A;  1HG2 A;  2CWY A;  2KWI B;  3ABV A;  5CA0 E;  4IIJ E;  3IBP A;  2NW7 A;  2D0T A;  3UUL A;  2BKO A;  4DV7 T;  4EIW A;  5IYZ E;  4JBW F;  3MAC A;  2XQ9 A;  2XPK A;  3N2O A;  1IBL T;  3LK2 B;  1SE7 A;  1XWM A;  4TV8 E;  1VCT A;  2XQ4 A;  3HKE E;  5L4E A;  5LHH B;  3RRC A;  4H9P C;  1B7T A;  3RHW A;  3MKD A;  2V7L A;  3GWH A;  2CCQ A;  3TLW A;  1FMW A;  5HEU A;  3HA4 A;  1HNX T;  2Y6X A;  4V1A v;  1Y01 A;  4K0U A;  3QB5 K;  1BR0 A;  3ESL A;  3U78 A;  2WAU A;  1OXZ A;  4EAH A;  4H63 V;  5ABH A;  3CQC B;  3GA8 A;  3CPZ A;  3PU8 A;  5DQW A;  2M6B A;  1LVF A;  5DAB A;  3ZC0 A;  3P4Q A;  3UTK A;  2R6G F;  2W61 A;  3O9X A;  4M1P A;  3P4R A;  1US7 B;  3N9L A;  4O8S A;  3UQ7 A;  2H3R A;  5GON E;  2XAF B;  4I55 E;  5ABG A;  4NXN T;  2ZLY A;  1T7S A;  2H7V C;  3RLF F;  2M6I A;  4E7Z A;  2ACZ A;  3N9N A;  2PBI A;  3L39 A;  3AE7 A;  2ZM6 T;  2UXB T;  1HF8 A;  2GK9 A;  5AFU L;  3RYF E;  1EZ3 A;  1YQ4 A;  1YQ3 A;  4A56 A;  3C4X A;  3UU3 A;  3HKC E;  4AIS A;  5FY0 A;  5LJM A;  2VQF T;  2RA1 A;  5L47 A;  1D0X A;  4A98 A;  4JI2 T;  4IDQ A;  2WZH A;  3C98 B;  4HTE A;  4GK0 E;  5LHI B;  3E08 A;  5FXW A;  4LF5 T;  3AVS A;  4YT0 A;  4I43 B;  3CWZ B;  4MAL A;  2UXN B;  4Z90 A;  3AA1 B;  5F8P A;  2OA5 A;  1G8X A;  1Z8U A;  3RIF A;  2YIN A;  4P09 A;  4WYV A;  4Q25 A;  2K3W A;  3RX6 A;  3FBZ A;  5HEJ A;  2OV9 A;  3AE6 A;  4OX9 T;  2V7M A;  2XQA A;  1W09 A;  4HWF A;  2VB6 A;  1X9B A;  4PJN A;  2W63 A;  4LF6 T;  3CQX C;  2WDQ A;  2MAW A;  4G63 A;  4JYA T;  2FJE A;  1CUN A;  3I1A A;  3VRB A;  3OJA A;  1N33 T;  5AQU B;  3MXZ A;  2WMO A;  5LOV E;  1IJ5 A;  2ES0 A;  3CQG B;  2X9W A;  1NEK A;  1J5E T;  2VK9 A;  2X9H A;  4ADZ A;  5FMN A;  3KDS E;  3V5S A;  5LP6 E;  4O2B E;  2LKH A;  1Y64 B;  2LSY A;  1HNW T;  3MK7 C;  5M4Y A;  3ZEF B;  2VL8 A;  2KSR A;  3UUB A;  4PJM A;  2CBJ A;  3AE8 A;  3O4X E;  4HFH A;  3KVA A;  3LDQ B;  5LXT E;  3OYZ A;  3SFD A;  2IC9 A;  2AXD S;  2X51 A;  2L9Q A;  3FZK B;  4QXH B;  1E2A A;  3ZYK A;  4U2Y A;  4I50 E;  3HL6 A;  4PAG A;  2XAH B;  3I0O A;  2YK0 A;  3GMI A;  4FJO A;  4HFE A;  3CX7 B;  3UU6 A;  2D5U A;  2LKG A;  4OHF A;  5LA6 E;  3QC9 A;  5CFB A;  4AKH A;  2XM2 A;  1HG5 A;  5CA1 E;  4ZEY A;  3WAJ A;  2CWO A;  1Z0P A;  4LF4 T;  4X66 T;  2VKO A;  1KF6 A;  4O2A E;  4X65 T;  1JNZ A;  3P7I A;  3N2G E;  4DO0 A;  4LFA T;  1ZP0 A;  3N9Q A;  4ZI3 D;  4QH4 A;  4NPP A;  4O4I E;  5IWA T;  4L0R A;  1YW0 A;  4JI5 T;  2CXD A;  2D9D A;  1MIW A;  2QYW A;  4PW8 A;  1T8B A;  4IE0 A;  4LF7 T;  2NTY A;  2X68 A;  4KX6 A;  2PJQ A;  5J2U E;  3NZQ A;  4J2C A;  1E1H B;  2WB5 A;  1YKH B;  2WCA A;  5AQF B;  4UVA B;  4GOU A;  3K1S A;  4TZ4 C;  2WWV A;  5TAO A;  2WDR A;  1S35 A;  4PK6 A;  3AA7 B;  5FY7 A;  1KFY A;  5AQQ B;  3UU5 A;  3CVR A;  3N5L A;  3PUW F;  4CXY A;  5FYM A;  4KHP T;  3N2K E;  2LLY A;  2E5V A;  4O4J E;  4K0K T;  2A3D A;  3UT5 E;  3RYC E;  4WZX A;  2JQK A;  3R6N A;  3B5M A;  1UGO A;  3RC3 A;  2MPK A;  2VWA A;  5L3B B;  4YLH A;  3RQW A;  3ZJ1 A;  4CI3 B;  4IGU A;  3AEF A;  4MHC A;  2NW8 A;  2CHO A;  3KBT A;  4MFR A;  2V8S V;  4X1K E;  3ONL C;  2CEA A;  3L8R A;  3WI3 A;  4DR7 T;  2BS2 A;  4HFB A;  5JQG E;  4GYS A;  5FP3 A;  2BVL A;  1OED E;  2VAS A;  5EK3 A;  3W15 B;  3ZN1 B;  2LSK A;  3KBU A;  3VU7 H;  3ONX A;  2V7K A;  3EHZ A;  5CB4 E;  3M65 A;  3M3Z B;  1W0A A;  4BJN A;  3AEG A;  3DP7 A;  4HWI B;  1J1J A;  5LHG B;  2SPC A;  3JAF A;  1IZN B;  2BKP A;  4DR4 T;  2BVM A;  3HR0 A;  4JEH B;  1XMO T;  2PG8 A;  5CGM A;  2Q9Q D;  5L3C B;  4GKJ T;  2IC6 A;  2XAQ B;  3IA3 A;  5LGT B;  4XAX B;  2BS3 A;  4XZC A;  4CQI A;  4GIW A;  3AE4 A;  3O1I A;  4HE8 A;  3ZMT B;  3T1H T;  4AQF C;  5AQP B;  2W4X A;  1BR2 A;  2WWU A;  4QH1 A;  1IJ6 A;  4HFI A;  3UFG A;  4HKA A;  2E9X D;  4UV8 B;  1UUS A;  2I6H A;  2CM0 A;  2DWG A;  4F8H A;  2RPA A;  4EED A;  2UXC T;  5LJN A;  4ZI3 C;  5AQN B;  4UVB B;  1HCI A;  4ASK A;  2LRK A;  3RRW A;  1IBM T;  2XM1 A;  4ILU A;  2XJ7 A;  2LT3 A;  2V6Y B;  2JQQ A;  3PU3 A;  2YU1 A;  5AQV B;  3KFW X;  2MTQ A;  2J1D G;  4B3R T;  4PJL A;  3SS1 A;  4DUY T;  3X1D A;  1WYB A;  4ZXL A;  3MA9 A;  4ZZB A;  2FBW A;  1HFA A;  2NP9 A;  3EUH A;  4HEA A;  3OPC A;  2HN1 A;  4IE7 A;  3BQL A;  4TX5 A;  3NWI A;  1W0B A;  3Q2M A;  2DI4 A;  3PTR B;  2M67 A;  2CLY B;  3OKQ A;  2WS3 A;  1J5W A;  2C0S A;  3CML A;  4NUV A;  5HEO A;  2L3L A;  5LGN B;  3HI2 A;  3AXJ B;  2KT9 A;  2CRB A;  2Q9Q B;  5JH7 E;  3TLT A;  1QLB A;  1SUM B;  3EDU A;  2BG9 C;  2YDR A;  4X5T A;  3UUM A;  3K3N A;  4NIQ A;  5LCY A;  2I59 A;  4YJ3 E;  1NWM X;  5KMG P;  2FJD A;  2HPL A;  4UEL A;  4YTN A;  5L3G B;  3VHL A;  3PJA A;  3PUZ F;  5JTG A;  3MJX A;  4BA9 A;  2XY8 B;  5FXV A;  3UU8 A;  4P0A A;  3AA6 B;  2V26 A;  3FZH B;  4I0U A;  3RYI E;  1NAF A;  1U4Q A;  2K48 A;  3NKZ A;  3UU4 A;  1YKE B;  5HXS A;  5IUX A;  4DR1 T;  5HXE A;  2CLY C;  4CN6 A;  3RYH E;  3CK6 A;  1XNQ T;  4NUU A;  1GQE A;  3S4U A;  1KK7 A;  3QOF A;  2XAJ B;  2Q9Q C;  2QRX A;  3ZLI A;  4PK4 A;  4B6X A;  4TWH A;  4PJJ A;  2KLQ A;  2K24 A;  2X0Y A;  3ANW A;  2YDQ A;  4OYK A;  1HNZ T;  4IT4 A;  2Z6E A;  4I4T E;  4AKI A;  3EVY A;  4H9R C;  2WM9 A;  4B3S T;  4ZI2 C;  3ZMZ B;  2E9X C;  3BK9 A;  1OWA A;  3OBV E;  4WNK A;  5FXZ A;  1FMV A;  1AJ3 A;  1UX5 A;  3T1Y T;  4X1Y E;  2QGS A;  4ILB A;  1BR1 A;  1HS7 A;  2V5C A;  5EK4 A;  2CMR A;  2CXL A;  5AQL B;  5DQV A;  2HHH T;  1IBK T;  2DLR A;  2H7O A;  3KV4 A;  4A5X A;  3ETU A;  4DMV A;  4DR5 T;  4JLE A;  4DBR A;  4JI0 T;  1WCR A;  2YU2 A;  2V7J A;  2W0G A;  5EZY E;  3RPU A;  5JDF A;  3HKD E;  4X1I E;  3UUN A;  5JRE A;  3B57 A;  1FIO A;  5ETW A;  5LB7 B;  1XDO A;  3AEA A;  3NBX X;  4JV5 T;  4L5G A;  4E7S A;  4AQF A;  4KBM B;  5HCJ A;  1YD8 G;  4AQY T;  1ZEE A;  3ZCI A;  3QB5 A;  4HFV A;  4YTP A;  3F31 A;  2EHO D;  5C8Y E;  3QUJ A;  1MIV A;  2WBL A;  3E22 E;  4CN4 A;  4JI7 T;  1I94 T;  4YY3 T;  5E0O A;  2Y8D A;  3A7M A;  3RC8 A;  2X0H A;  2D0U A;  5FKY A;  3EAM A;  3RGL A;  4DV1 T;  4IE6 A;  3SWH A;  5HWY A;  3P4P A;  4AIU A;  4GKK T;  2KXP B;  4DND A;  3AAI A;  5FY1 A;  3LK3 B;  2IUB A;  2J47 A;  2WDV A;  4OYJ A;  4EZ4 A;  4JI8 T;  4P1N A;  3FHN A;  1N36 T;  4HN9 A;  3RIU A;  3F57 A;  5J1G A;  4LFB T;  3N9M A;  2I0M A;  4U7I A;  3TLS A;  4UV9 B;  5L3E B;  5AQT B;  4TNW A;  2E2A A;  4N78 D;  3GN5 B;  3IEE A;  2C5K T;  2LHR A;  4X64 T;  3PDY A;  3R84 B;  3AE2 A;  3ANW B;  4KHZ F;  4UIG A;  2C5J A;  1L0V A;  1D0Z A;  2BG9 A;  4TN7 B;  2WU2 A;  3EDV A;  1T98 A;  3RQU A;  3K3Q C;  5AQG B;  1ZKE A;  4X20 E;  4UEM A;  4AQG A;  1XNR T;  3CX8 B;  1WRD A;  3C4W A;  2V6Y A;  3AB3 B;  3AA0 B;  2JJ9 A;  3J9X 1;  1HX8 A;  3ZST A;  3AVR A;  2CE7 A;  2W2U A;  3E0Z A;  2JRK A;  4EEB A;  4L9I A;  3ZMU B;  2C5I T;  1M62 A;  5L3D B;  4PNI A;  5DJQ C;  4CXW A;  3PUA A;  4Z8X A;  2KWH A;  1ZV4 X;  3KV6 A;  4HWC A;  5J2T E;  4GYR A;  4DR3 T;  2WMN A;  4A97 A;  4ZI7 E;  3IF8 B;  4ZHQ E;  1UCU A;  2LJL A;  4U31 A;  4DUZ T;  2B76 A;  2P9B A;  4G2A A;  4LMJ A;  2LSI A;  2UU9 T;  1HTJ F;  3ZN0 B;  5HCM A;  4GK5 E;  3Q9D A;  3NZP A;  2WP9 A;  4LMK A;  3AXJ A;  3FZF B;  2Q9Q A;  3LK4 2;  5JRC B;  5HXH A;  4YXD A;  3EI0 A;  2UXX B;  3AE5 A;  2LM2 A;  3I0Q A;  4AKL A;  3ZYM A;  4NXM T;  3Q5E A;  3BQK A;  5HEH A;  2G0U A;  2WU5 A;  3UQ4 A;  3PUX F;  1FJG T;  3C51 A;  4WBN E;  2UXD T;  3N9P A;  2DCF A;  4EGW A;  2A9U A;  1SA0 E;  3KV9 A;  3ZT7 A;  4HWD A;  2EHO C;  3RF1 A; 
#chains in the Genus database with same CATH homology
 4JI3 T;  4B3M T;  4K0K T;  1XNR T;  4LF8 T;  4JI6 T;  4OX9 T;  4DV0 T;  1HNZ T;  3T1H T;  4JI7 T;  1I94 T;  4JI4 T;  4YY3 T;  4LF6 T;  4B3S T;  2UUC T;  4JYA T;  4DV1 T;  1HR0 T;  4LF9 T;  4NXN T;  4GKK T;  3T1Y T;  4LF4 T;  5LMU T;  4LFC T;  4X66 T;  4DR3 T;  4X65 T;  1N33 T;  2UXC T;  4DV3 T;  2E5L T;  4LFA T;  2UUA T;  4JI8 T;  4DR7 T;  2ZM6 T;  2UXB T;  4DUZ T;  5IWA T;  1XMQ T;  3OTO T;  1N36 T;  1J5E T;  4DV2 T;  4JI5 T;  2HHH T;  1IBM T;  1IBK T;  4DV6 T;  4LFB T;  4DR5 T;  4JI0 T;  4DV7 T;  2UU9 T;  1N32 T;  5BR8 T;  4DV5 T;  4DR2 T;  1HNW T;  2UUB T;  2VQF T;  4LF7 T;  1N34 T;  1IBL T;  4B3R T;  4JI1 T;  4DUY T;  4X64 T;  4JI2 T;  4DR6 T;  4NXM T;  4X62 T;  4DR1 T;  4LF5 T;  4DR4 T;  1FJG T;  1XNQ T;  2UXD T;  4JV5 T;  4YHH T;  2F4V T;  4B3T T;  1HNX T;  1XMO T;  4AQY T;  2VQE T;  4GKJ T;  5LMN T;  4DV4 T;  4KHP T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...