3VU7H

Crystal structure of rev1-rev7-rev3 ternary complex
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
94
structure length
94
Chain Sequence
PNLAGAVEFNDVKTLLREWITTISDPMEEDILQVVKYCTDLIEEKDLEKLDLVIKYMKRLMQQSVESVWNMAFDFILDNVQVVLQQTYGSTLKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Replication
molecule keywords DNA repair protein REV1
publication title Structural basis of recruitment of DNA polymerase [zeta] by interaction between REV1 and REV7 proteins
pubmed doi rcsb
source organism Homo sapiens
total genus 31
structure length 94
sequence length 94
ec nomenclature
pdb deposition date 2012-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF16727 REV1_C DNA repair protein REV1 C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1280 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3vu7H00
3VU7H 2N1GA 2LSJA 2LSIA 2LSGA 2LSYA 4FJOA 4GK0E 4BA9A 2LSKA 4EXTA 4GK5E
chains in the Genus database with same CATH superfamily
2CHNA 3KBTA 3PU3A 5C3JA 5AQLB 4LFBT 3ZMTB 1IZNB 2DLRA 3P4RA 2XQ9A 3U3IA 3FZFB 2FJAA 4U7YA 2KLQA 1WYBA 2D0TA 4KI0F 2KWHA 3MACA 2ZLYA 2V7JA 4U74A 2K3WA 3OYXA 4PJJA 2KSRA 2LOPA 2ZM0A 2J1DG 2EHOC 2LKGA 3C64A 2N2NA 5JTGA 2XQAA 2PJQA 5FVLA 4H9OC 2CA5A 2J47A 5LBMA 2X9HA 4UV9B 3M3ZB 1GQEA 3EHZA 2YDRA 2Q9QC 4COFA 4HWCA 2WY2A 3OJAA 1LRZA 1KNPA 4DV1T 5DJQC 1XZYA 4YY3T 2XUEA 2JQ9A 3KVBA 3QB5K 4QH5A 3C51A 3CX6B 3LSVA 4EEBA 1IJ6A 1MIWA 3RQWA 5AQNB 4WYVA 2QRXA 3BQLA 5DABA 1ZV4X 1US7B 4I50E 5KDMC 2D2SA 4YTNA 3RIUA 3RHWA 4UEMA 3I9YA 3TLVA 2LSGA 3RYFE 3VHLA 3U78A 3P4SA 4IE6A 4JI7T 1VRBA 4V1Av 2YU1A 5LGTB 3Q5XA 2NW9A 2L9QA 2WQYA 3T1YT 2DCFA 4EZ4A 1D1AA 2V6XA 4OFZA 3O9XA 4X66T 2LM2A 2WAUA 2CWOA 4TN7B 4P1NA 2DWGA 5IYZE 4JI3T 4HFIA 3CQXC 2V5CA 3P50A 1WYCA 1MIYA 4JI4T 4XBFB 4LFCT 1YKEB 4GYSA 2E9XB 2BVMA 3RRCA 4JLEA 3IF8B 1W09A 3H3AA 4IT4A 1WCRA 2NP9A 3T8OA 2CLYC 1G73A 4OHFA 4EGWA 1R8IA 5EK3A 2A72A 4ADZA 3VKHA 1L0VA 4AKLA 4AKIA 3G06A 3E0ZA 4H9SE 3V5UA 3KBUA 2WB5A 1OEDA 2FJEA 1UUSA 5HEOA 1YKHB 3L09A 2VKOA 2DI4A 2W2UA 4WZXA 3KV5A 2L3LA 4DR2T 3A8YC 4H63V 3R84B 5FL0A 1KNRA 1XMQT 2ZM6T 3AE4A 3N9NA 3B5MA 3P4WA 1SA0E 4E7ZA 5LMNT 5JREA 5L4EA 2UUAT 1MMNA 5LHIB 3ONXA 4HTEA 5LA6E 2I6HA 4MBQA 1O3XA 4JBWF 4NPPA 1QSDA 3RI5A 4ZI3D 4DNDA 2MAWA 2QA7A 2LSYA 2H7OA 3KVAA 2M67A 4Z8XA 2OA5A 4E7SA 1XNQT 1YD8G 3JADA 1YW0A 1XNRT 2XQ4A 4F8HA 1E7PA 2XJ7A 3AEFA 5J2UE 3UU5A 1JNZA 4IDOA 2VWAA 5AQOB 3ZJ1A 3N9LA 3I1AA 2XQ5A 5FVKA 3ZMZB 1W0AA 3PUVF 3WAJA 3QC9A 3AEGA 5FL1A 1JNRA 3GMIA 3AA0B 3O1IA 4NIQA 4TX5A 4DV0T 4G2AA 3PJAJ 3Q9DA 4O8SA 3WI3A 2NW8A 4FJOA 1XDOA 4WBNE 2WBLA 4LF7T 4U72A 2F4VT 5CGMA 4U7IA 2D0UA 2VQFT 5JDGA 4IE4A 3AVRA 5AQUB 2FBWA 3C98B 4ERRA 4B3RT 4DR4T 5HEGA 2H7VC 3PURA 2WZHA 2X0YA 2VB6A 2D5UA 1KEYA 3UU4A 4UVAB 5ABHA 4TWFA 1Z0PA 2NR4A 3UFGA 4FI5A 2LT3A 1FMWA 4QX7B 4HGAA 2ES0A 2WCAA 4UF0A 2H88A 3VRBA 3AE5A 3ETUA 4YSYA 2W4XA 3ZKRA 5JDHA 5ABFB 4B3MT 3EAMA 3RIUC 3PUXF 3SS1A 4HFDA 4A98A 3KDSE 3LG7A 2A2FX 2CMRA 4GK0E 5JQGE 3I0OA 1NAFA 3H3MA 2FJBA 4J2CA 2UXNB 2YOEA 4AKRB 2JRKA 2V7LA 1HFAA 2N1GA 1OXZA 2VL0A 2LHRA 3FXDB 4JEHB 4DR7T 3ONJA 3B57A 2BDEA 2V6YB 5GONE 2OV9A 1BR0A 2CHOA 5EK2A 3O1JA 2VURA 3IHRA 2UXBT 1D1BA 5FXVA 2H89A 3O1HA 4DMVA 2VKHA 1UURA 2C0SA 2W0GA 4KBMB 2LKHA 4X62T 2V1DB 2BBJA 2DHRA 5LNKA 3ZC1A 3RYHE 3RH3A 1QLBA 3FHNA 1MMDA 4P0AA 3SRZA 1HG5A 2HPJA 4DUZT 4HWFA 2XQYA 3PUGA 3NZQA 1WR6A 3JC6C 5J0ZA 4EYYR 5HEUA 3R6NA 3FB2A 3K3QC 3UUXB 4AQYT 1KF6A 1OEDC 2XAHB 5KXJA 5HCJA 1FEWA 5EZYE 3N9MA 1OWAA 4UXNB 4U2YA 4TWDA 4A97A 2LSKA 1HCIA 4PJNA 1X9BA 3UULA 3AE7A 3TKLB 2SPCA 4B6XA 4ILCA 4ISSA 2NOXA 4X1IE 4ILBA 1E2AA 2V7IA 4KHZF 3I0QA 2XM2A 4OYJA 4ZI3C 3N9OA 3JAFA 4X20E 4U3CA 1NENA 3DTOA 2WDVA 4MLKA 3LFMA 4IHJE 3F57A 5ABEA 4GK5E 1ZEEA 4X64T 3OVUA 3CK6A 4I4TE 1WLXA 4ZZBA 4KHPT 5F5WA 2CEAA 4YSZA 4TWHA 1KNZA 2XQ7A 3SFDA 3QNUA 3C50A 1IBKT 3KV9A 2BS2A 3ZT7A 4CXXA 5JRCA 4QKNA 3OBVE 2AXDS 2RA1A 2V26A 3RGLA 1N34T 2PFVA 5HWYA 5HXRA 1MIVA 1HNXT 2NTYA 5LCYA 4IE0A 4AI6A 4JI1T 2D9DA 3CX8B 4IL9A 4QXCB 4ILAA 1SHZC 2E9XA 1UCUA 3FZHB 3GA8A 4OYKA 2YN6A 1D1CA 2BG9B 3PU8A 2I59A 4H9NC 2V7KA 2E9XD 3JCFA 2VVNA 3F31A 4PFPA 1BR1A 5LYJE 4KMCA 2IHR1 3GN5A 2BZBA 5CA1E 2V7MA 2K24A 3N2OA 2K9AA 4IREA 5L4HA 4CXWA 2WM9A 2B1EA 3DP7A 5H6RB 2LSJA 2XHEB 3ZYMA 4PFOA 4CN6A 5ABGA 2IC9A 3CQCB 2UU9T 2VQET 3N2GE 3C4ZA 4ZS3A 2ZM8A 2HN2A 3PV0F 4HFCA 4EOZB 3KFWX 4ISTA 4IDNA 4F6RC 1DU2A 3VKGA 4UVCB 2J4GA 3ZSSA 5JRCB 2WDQA 1SUMB 4X65T 3AA1B 3AE9A 2XPKA 4DBRA 3V5SA 1W9RA 3ZMVB 5AQKB 4QWNB 4JI2T 4I43B 5L3EB 3MA9A 4LMJA 2XSAA 3HR0A 2KWIB 2QGSA 2CXLA 2V5DA 2HPLA 2E5VA 3K1SA 3RF1A 3ZT6A 2W62A 4WNKA 4IE5A 2Y48B 3HKEE 3Q5DA 4JEUB 3AEAA 1X79A 1KFYA 3UUNA 2WU5A 5HYAA 1MNEA 3RKOA 1IAPA 4AQFA 5AQGB 2KNDA 4PW8A 4XAXB 2ODUA 4DV7T 2CXFA 4JUYA 2JQKA 3GN5B 3L39A 2A9UA 4AXPA 3GWHA 2M6IA 3ONLC 2BVLA 2Y6XA 3NRXA 4P09A 1IBLT 5FXXA 1WR0A 1HX1B 2XQ6A 2ACZA 2IIUA 5HXEA 4PK6A 3KV6A 3PUWF 3EI0A 5J2TE 2ZMAA 2UUBT 3UFEA 3C4XA 4QH4A 3HKCE 4DR3T 4HE8A 2CBJA 3UU8A 2MPKA 4YJ2E 3IEEA 1FJGT 5L47A 4EZHA 4HWDA 5LGNB 4LMKA 4X1YE 4EEDA 2C5JA 4QXHB 3AE3A 5LP6E 4NXMT 5KX5E 5AQHB 2W61A 3ZCJA 3PDYA 3P4PA 2LM9A 3ANWB 4MALA 3TLTA 5JDNA 4YHJA 5TAOA 1I6ZA 3P4QA 3J9X1 1XWMA 5HAXA 5JR9B 4HN9A 4CN4A 5IWAT 4YHHT 5LGUB 2YKSA 3UT5E 4OK0A 3ETVA 4ZEYA 4L9IA 4CZZB 5ABFA 2BG9E 2XAGB 4ZS2A 2EHOA 4GOUA 1D0XA 1J5WA 5HXHA 4AKGA 3PUYF 3CMLA 2KINB 3B13A 4H9QC 1CUNA 2EHOD 3X1DA 4YJ3E 1FIOA 1I94T 2DL1A 4YTPA 1KK7A 4O2AE 4QX8B 3CIRA 4IE7A 2IAKA 3OKQA 2V6YA 3MK7C 4YSXA 4Q25A 3DJBA 5FY1A 2R6GF 2BKNA 5HXCA 2JMHA 4IDZA 3FZKB 1HS7A 2VKJA 2RPAA 3MXZA 5L2LA 4O4JE 4LF8T 2WU2A 5LJNA 4HFHA 2LLYA 3UUBA 3ZJ2A 2IC6A 3N9QA 4EXTA 4EAHA 2YDSA 3IA3A 2KT9A 2BS4A 2YINA 2E9XC 5FNVE 4DUYT 3AEEA 4MHCA 4PNIA 2G0UA 4JI8T 3O4XE 3RPUA 2K5BB 3RYIE 3SWHA 3ZN1B 3KV4A 4B3TT 4UIGA 5F3JA 4DVDA 3CX7B 2EHOB 1T8BA 2LSIA 3A5XA 2WMOA 2RP4A 3AEDA 4BA9A 3EDVA 3VRAA 1BR2A 3LJCA 2PTFA 3LBXB 3PUAA 4ZXLA 4EYUA 1EZ3A 1S94A 1HR0T 2YDQA 4DV2T 2KZ7B 4ILUA 3A7MA 5CJ5A 3PUQA 2YEVC 2MTQA 2XQ8A 3OTOT 4HFEA 1YXRA 3AE8A 2W00A 5AQFB 4CI1B 1AJ3A 4BJNA 4TUYE 3RLFF 3RQUA 1M62A 3TLWA 3RRWA 1HTJF 5LB7B 2WWUA 3W15B 4JV5T 1S35A 5DQVA 3ZMUB 1UK5A 4LF4T 1NWMX 2E8IA 4JI5T 4HKAA 2IUBA 3E08A 4XZCA 3PUSA 4JI0T 5E0OA 4P0BA 2JMKA 3QUJA 4ANJA 3EDUA 5FMNA 3J7Yq 4QH1A 5AQJB 3ZCIA 2VK9A 2XSBA 1T98A 2LRKA 1ZOYA 3L8RA 1WRDA 3BQIA 2NTXA 2X51A 4DV5T 5AFUL 4PK5A 1V9DA 3MKDA 2WZIA 2CXDA 5AQSB 4JI6T 1N33T 3LDQB 4PJLA 4U2ZA 4ZI2D 2XY8B 2BG9A 4IIJE 2XZEA 2VASA 3FBLA 2CM0A 4X1KE 4NUUA 2JJ9A 2IDOB 4TNVA 3CWZB 4ZOLE 3Q5WA 3QK6A 2CE7A 3TLSA 3JAEA 1YQ4A 2X66A 3ZN0B 2JPFA 5L3DB 2WMNA 2CLYB 1T7SA 4UR9A 2V8SV 3HKBE 1LVKA 5EK4A 2E5LT 3PUZF 2XTLA 1XDPA 1ZP0A 2J62A 1D0YA 3K8PC 5AQVB 5JDFA 4UVBB 4KUMB 3MZKB 5BMVE 4O4LE 1XMOT 4ZZCA 5J1GA 2K48A 2MBGA 4TZ4C 2PG8A 2CBIA 5H6QB 2CCQA 2X0LB 4LF5T 2XASB 3PTRB 2N9DA 2NWBA 5LMUT 2LRLA 2W66A 5IUXA 1WFDA 2C5KT 4GIWA 2JIWA 5HXSA 1HNWT 3ZMSB 5KMGP 4IGUA 1BR4A 5LOVE 4I55E 2LHNA 3CPZA 3WAKA 3ZYKA 4IL4A 3K3OA 3KINB 5FYMA 4BAYB 4ZI7E 4EV6A 3CKDA 3BQKA 2X0HA 1YQ3A 3M65A 4G63A 5LHGB 3EUHA 3VU7H 3AE2A 2VVSA 3ESLA 2ZM2A 3AAEB 1CHUA 1J1JA 3F2EA 3RKGA 3SFEA 5CB4E 3EVYA 3ZLIA 3MJXA 3HL6A 5L3BB 1SE7A 3TLUA 4HFBA 4UELA 2HHHT 1IJ5A 4GYRA 2H3RA 3N2KE 3ANWA 4TNWA 2X9WA 2AE9A 3AEBA 5LXTE 2HH7A 3Q2MA 2XAFB 4ZHQE 3FZMB 4DR5T 4YFSA 4LF6T 2WDRA 5JR9A 2B76A 3AXJA 3P8CD 2E2AA 2ODVA 4WBOA 2WS3A 4A5XA 4PJMA 1HG2A 2FJDA 3RIFA 3AB3B 3UU6A 2X67A 5DQWA 3Q5EA 2I0MA 3CQGB 1Z8UA 1ZKEA 3T1HT 2BS3A 1HF8A 2MOZA 4H63H 5HWXA 1U5PA 3AE1A 2UXDT 2CWYA 2QYWA 4YT0A 2UXCT 3AE6A 2ACXA 3NRYA 2JQQA 3IBPA 4HWHA 1ZHCA 1VCTA 5LG3A 4YLHA 5FKYA 5A1LA 3RX6A 3UTKA 2MYSA 4IDQA 4CQIA 4DIDB 3JC6D 4LF9T 3LK3B 5ADXL 3ZEFB 1M7KA 5FP3A 2X9XA 2NW7A 2X9YA 3UU3A 4U33A 1D0ZA 1UX4A 4EB6E 3PE0A 5HCMA 5HEJA 2CRBA 4KX6A 4LFAT 4ZI2C 4ASKA 5JDMA 4DV6T 3QB5A 2PBIA 5L3CB 2IW5B 3E22E 3AXJB 4U31A 4AIUA 4BJMA 2BG9C 2W67A 5AQTB 4M1PA 4HEAA 4C90A 5JH7E 2UXXB 3EABA 4NUVA 5L3FB 4DV3T 5FY0A 5CA0E 5C2TA 4AKHA 2WP9A 2OLTA 1MMGA 4K0KT 1HX8A 3LK2B 4AISA 4DR6T 4O4HE 4DMWA 2BKPA 3LBXA 2W63A 2DNXA 4UV8B 3OPCA 3ZC0A 3NZPA 2FUPA 1G8XA 2VKDA 2YK0A 2Q9QA 5JDLA 3VR9A 2P9BA 3FBZA 3AVSA 3AA7B 2Q9QD 3NKZA 3HKDE 5IHYA 1J5ET 2GK9A 1OEDB 3RYCE 4HFVA 2LOSA 3AAIA 1H7CA 2DWKA 4L0RA 4DO0A 4QHOA 4KP3C 1FMVA 4DR1T 4O2BE 4O4IE 4C91A 1LVFA 1Y01A 2XM1A 3ZYLA 2LEHA 5AQQB 3RIAA 5CFBA 2UUCT 1U4QA 3N9PA 4I0UA 2BBHA 2JQHA 1T72A 2Z6EA 5F8PA 3HI2A 3AAAB 4DV4T 3ZT5A 4TV8E 2HN1A 5C8YE 2KXPB 2XQ3A 3K3NA 4AQGA 5LHHB 5JDQA 4YTMA 4CXYA 2C5IT 1B7TA 4CI2B 1LKXA 2QVAA 5JVDE 4HWIB 2Y8DA 4CI3B 5LJMA 4IDPA 1HNZT 4Z91A 2M6BA 3I9WA 2Q9QB 2XAJB 3ABVA 2BKOA 2KMFA 4QXBB 2LE8A 4L5GA 4H9RC 2IMLA 1UX5A 4JYAT 3RC8A 3LK42 3ZPOA 3NBXX 4YXDA 1N32T 4NXNT 1N36T 2LJLA 4N78D 4OX9T 3N5LA 1UGOA 5BR8T 3VR8A 4Z90A 3ZSTA 5HEHA 1MMAA 1QUUA 1NEKA 3S4UA 3NVOA 3P7IA 3FXEB 5JR9C 4MFRA 3H37A 4GKKT 2X68A 3PJAA 4X5TA 4DBQA 3BK9A 4AQFC 3SOLA 3L3PA 5AQIB 1VOMA 1VCSA 1Y64B 5AQMB 3AA6B 5FY7A 3OYZA 4CN1A 4H9PC 3C4WA 4GKJT 2A3DA 2WWVA 1E1HB 4PAGA 4PK4A 5M4YA 4UF0B 2CPTA 3AECA 2VL8A 4B3ST 5ETWA 4K0UA 1W0BA 5AQPB 5AQRB 3UQ4A 3CVRA 5LBQB 3NWIA 3RC3A 4EIWA 2L8KA 2XAQB 4WW0A 4TV9E 3D0TA 1MNDA 2WSSV 4A56A 3HA4A 5L3GB 3FZLB 1IBMT 3QOFA 3UQ7A 2YU2A 3UUMA 1OEDE 4LMLA 5FXZA 5LG4A 5FXWA
chains in the Genus database with same CATH topology
3VU7H 3KDSE 3LG7A 2A2FX 2CMRA 3KBTA 3PU3A 4GK0E 5JQGE 5HAXA 3I0OA 1NAFA 3ZMTB 3ESLA 1IZNB 2DLRA 2ZM2A 3AAEB 4J2CA 5JR9B 4HN9A 3F2EA 2UXNB 4AKRB 2JRKA 2V7LA 1HFAA 2N1GA 3U3IA 1OXZA 5CB4E 3EVYA 3ZLIA 3MJXA 5LGUB 2LHRA 3HL6A 5L3BB 3FXDB 4JEHB 2KLQA 4UELA 1WYBA 2D0TA 2KWHA 3UT5E 3B57A 1IJ5A 4OK0A 2BDEA 2H3RA 4GYRA 3N2KE 3ANWA 3ETVA 2X9WA 4L9IA 4CZZB 5GONE 1BR0A 3MACA 2ZLYA 5LXTE 2HH7A 2V7JA 5EK2A 2XAGB 4U74A 3O1JA 4ZS2A 3Q2MA 2EHOA 3OYXA 4PJJA 2LOPA 2XAFB 4GOUA 4ZHQE 2ZM0A 2J1DG 3IHRA 2EHOC 1D0XA 5HXHA 4AKGA 3C64A 2N2NA 3CMLA 2KINB 4YFSA 3B13A 4H9QC 2PJQA 4H9OC 1CUNA 1D1BA 2EHOD 2CA5A 5FXVA 5JR9A 4YJ3E 1FIOA 3O1HA 5LBMA 4DMVA 2VKHA 2X9HA 2C0SA 3P8CD 1KK7A 2ODVA 2W0GA 4O2AE 4QX8B 4WBOA 4KBMB 4UV9B 4IE7A 4PJMA 2V1DB 2IAKA 2Q9QC 3OKQA 1HG2A 3MK7C 3OJAA 1LRZA 3AB3B 5FY1A 3DJBA 2DHRA 5LNKA 3ZC1A 2X67A 5DQWA 5HXCA 2JMHA 3RYHE 4IDZA 1HS7A 5DJQC 3RH3A 2VKJA 1ZKEA 3CQGB 3J9X1 1HF8A 3MXZA 2MOZA 2XUEA 3FHNA 1MMDA 4H63H 5L2LA 5HWXA 4P0AA 3SRZA 1U5PA 4O4JE 1HG5A 3KVBA 2HPJA 2CWYA 5LJNA 3C51A 2ACXA 3NRYA 2JQQA 2IC6A 3ZJ2A 2XQYA 3IBPA 3N9QA 3PUGA 4EAHA 4EXTA 3CX6B 1ZHCA 3NZQA 4YLHA 2KT9A 1WR6A 5A1LA 3RX6A 3UTKA 3JC6C 1IJ6A 2MYSA 1MIWA 4EYYR 3R6NA 2YINA 3FB2A 3K3QC 2E9XC 4CQIA 5FNVE 3JC6D 3LK3B 4MHCA 3BQLA 5ADXL 3UUXB 3ZEFB 4PNIA 2G0UA 2XAHB 5DABA 5FP3A 1FEWA 5EZYE 2X9XA 3O4XE 1ZV4X 2NW7A 1US7B 3N9MA 1OWAA 2X9YA 3RPUA 4UXNB 4I50E 2K5BB 3RYIE 5KDMC 3SWHA 1D0ZA 2D2SA 2LSKA 1HCIA 3ZN1B 3KV4A 1UX4A 4PJNA 4EB6E 4UIGA 3UULA 3PE0A 3TKLB 5F3JA 4DVDA 2SPCA 3CX7B 4UEMA 2EHOB 2LSIA 3A5XA 4B6XA 2WMOA 3I9YA 2RP4A 4ISSA 4ZI2C 4ASKA 4BA9A 3EDVA 5JDMA 2NOXA 1BR2A 2LSGA 3LJCA 3RYFE 3VHLA 3LBXB 2PBIA 4X1IE 5L3CB 3PUAA 2IW5B 3E22E 3U78A 4EYUA 2V7IA 4BJMA 4IE6A 3I0QA 4OYJA 4ZI3C 4M1PA 1EZ3A 1S94A 1VRBA 4HEAA 4V1Av 4C90A 5JH7E 2YU1A 3N9OA 2UXXB 4X20E 5LGTB 2KZ7B 4ILUA 3Q5XA 4NUVA 2NW9A 3DTOA 5L3FB 2L9QA 3PUQA 5FY0A 2DCFA 2YEVC 4MLKA 2MTQA 5CA0E 4AKHA 3LFMA 4IHJE 1MMGA 3F57A 4EZ4A 1HX8A 1D1AA 4OFZA 3LK2B 4GK5E 1ZEEA 2W00A 3O9XA 4I4TE 1WLXA 4CI1B 4O4HE 4DMWA 1AJ3A 2WAUA 4BJNA 4TUYE 2CWOA 4TN7B 3LBXA 2W63A 2DNXA 2DWGA 4UV8B 3RRWA 1HTJF 5IYZE 3ZC0A 3CQXC 2CEAA 3NZPA 1KNZA 1G8XA 2VKDA 2WWUA 2YK0A 2Q9QA 3W15B 5JDLA 1WYCA 1S35A 2P9BA 5DQVA 1MIYA 3C50A 4XBFB 3FBZA 3KV9A 3ZMUB 1YKEB 1NWMX 3AVSA 4GYSA 3AA7B 2E9XB 4CXXA 5JRCA 4QKNA 2E8IA 2Q9QD 2BVMA 3HKDE 3RRCA 5IHYA 3OBVE 2GK9A 3RYCE 4HFVA 2RA1A 2V26A 4JLEA 2LOSA 3AAIA 3IF8B 1H7CA 2PFVA 3H3AA 5HWYA 5HXRA 2NP9A 4HKAA 3T8OA 2DWKA 1MIVA 4L0RA 3E08A 2CLYC 1G73A 4OHFA 4DO0A 5EK3A 4XZCA 3PUSA 2NTYA 5LCYA 5E0OA 4QHOA 2A72A 4P0BA 4KP3C 4IE0A 1FMVA 4AI6A 4ADZA 3VKHA 4AKLA 4AKIA 4O2BE 3E0ZA 2JMKA 3QUJA 4ANJA 4O4IE 4H9SE 3EDUA 3CX8B 4C91A 4QXCB 5FMNA 3J7Yq 3V5UA 1LVFA 1SHZC 3KBUA 2E9XA 1UCUA 3GA8A 3ZYLA 2LEHA 4OYKA 3ZCIA 2VK9A 1T98A 1D1CA 3PU8A 1WRDA 2I59A 4H9NC 1U4QA 2V7KA 2E9XD 3N9PA 1YKHB 3F31A 1BR1A 3BQIA 2VKOA 3L09A 4PFPA 2NTXA 5LYJE 2DI4A 2X51A 2Z6EA 5F8PA 5AFUL 3HI2A 3KV5A 4KMCA 3AAAB 2L3LA 4PK5A 3GN5A 2BZBA 4H63V 5CA1E 2V7MA 1V9DA 3R84B 3MKDA 4TV8E 2K24A 3N2OA 5C8YE 2CXDA 2KXPB 3N9NA 3K3NA 4AQGA 5LHHB 2K9AA 5JDQA 1SA0E 4E7ZA 4PJLA 4CXYA 2C5IT 4CXWA 1B7TA 2WM9A 2B1EA 3DP7A 5H6RB 4CI2B 2LSJA 1LKXA 2XHEB 5JVDE 5JREA 3ZYMA 4PFOA 1MMNA 2IC9A 2Y8DA 4CI3B 3ONXA 4HTEA 4ZI2D 5LHIB 5LJMA 4IIJE 3CQCB 5LA6E 2VASA 3FBLA 4MBQA 2CM0A 3N2GE 1O3XA 3C4ZA 4X1KE 4NUUA 4ZS3A 2JJ9A 2ZM8A 3I9WA 1QSDA 2Q9QB 2XAJB 2KMFA 4QXBB 4ZI3D 4EOZB 3KFWX 3CWZB 4DNDA 4ZOLE 3Q5WA 2LE8A 4ISTA 4L5GA 4F6RC 3VKGA 3QK6A 2CE7A 4UVCB 5JRCB 4H9RC 2QA7A 2X66A 2LSYA 3ZN0B 1UX5A 3AA1B 2H7OA 3KVAA 3RC8A 2JPFA 3LK42 3ZPOA 5L3DB 2M67A 2WMNA 3NBXX 4Z8XA 2OA5A 4DBRA 4E7SA 3V5SA 2CLYB 3ZMVB 1YD8G 4QWNB 1YW0A 4I43B 2LJLA 5L3EB 4N78D 3HKBE 3MA9A 1LVKA 5EK4A 3HR0A 2KWIB 3N5LA 2XTLA 5J2UE 2QGSA 2CXLA 1D0YA 3K8PC 2VWAA 2HPLA 3ZJ1A 3N9LA 5JDFA 4UVBB 2W62A 3I1AA 4WNKA 4KUMB 4IE5A 1MMAA 1QUUA 2Y48B 3MZKB 3ZMZB 3HKEE 3WAJA 3QC9A 3S4UA 5BMVE 4JEUB 4O4LE 3P7IA 3GMIA 3AA0B 3O1IA 4TX5A 3FXEB 1X79A 3UUNA 5J1GA 4MFRA 5JR9C 3H37A 4G2AA 2K48A 2MBGA 3Q9DA 5HYAA 1MNEA 2X68A 3RKOA 1IAPA 4TZ4C 4AQFA 4DBQA 2PG8A 2KNDA 4PW8A 4O8SA 4XAXB 3WI3A 3BK9A 2ODUA 4AQFC 5H6QB 2CXFA 2CCQA 2NW8A 4JUYA 3SOLA 3GN5B 3L3PA 4FJOA 4AXPA 2X0LB 4WBNE 1VOMA 1Y64B 2WBLA 3GWHA 4U72A 3AA6B 5FY7A 2BVLA 2XASB 3OYZA 2Y6XA 3NRXA 3PTRB 4H9PC 4P09A 2N9DA 2NWBA 3C4WA 5FXXA 2A3DA 2D0UA 1E1HB 4PAGA 4PK4A 5JDGA 5M4YA 4UF0B 4IE4A 3AVRA 2VL8A 4PK6A 5HXEA 3KV6A 3C98B 4ERRA 2C5KT 4GIWA 5HXSA 5J2TE 2ZMAA 5ETWA 2H7VC 4K0UA 3PURA 3ZMSB 5KMGP 4IGUA 1BR4A 3CVRA 5LBQB 2VB6A 3UFEA 3C4XA 4I55E 5LOVE 2D5UA 2LHNA 4UVAB 3CPZA 3HKCE 3WAKA 4HE8A 1Z0PA 4YJ2E 3ZYKA 3RC3A 3IEEA 4EIWA 2L8KA 4FI5A 2XAQB 4WW0A 4EZHA 4TV9E 2LT3A 1FMWA 5LGNB 3K3OA 4QX7B 3D0TA 3KINB 4HGAA 4X1YE 5FYMA 1MNDA 2ES0A 4BAYB 4ZI7E 2C5JA 3CKDA 4QXHB 2WSSV 4A56A 5LP6E 3BQKA 5KX5E 4UF0A 3HA4A 2W61A 3ZCJA 5L3GB 3PDYA 2LM9A 3ANWB 3ETUA 4MALA 5JDNA 4YHJA 5TAOA 5JDHA 3M65A 4G63A 2YU2A 3UUMA 5FXZA 5LG4A 5LHGB 3SS1A 5FXWA 3EUHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VU7 H;  2N1G A;  2LSJ A;  2LSI A;  2LSG A;  2LSY A;  4FJO A;  4GK0 E;  4BA9 A;  2LSK A;  4EXT A;  4GK5 E; 
#chains in the Genus database with same CATH topology
 2CHN A;  3KBT A;  3PU3 A;  5C3J A;  5AQL B;  4LFB T;  3ZMT B;  1IZN B;  2DLR A;  3P4R A;  2XQ9 A;  3U3I A;  3FZF B;  2FJA A;  4U7Y A;  2KLQ A;  1WYB A;  2D0T A;  4KI0 F;  2KWH A;  3MAC A;  2ZLY A;  2V7J A;  4U74 A;  2K3W A;  3OYX A;  4PJJ A;  2KSR A;  2LOP A;  2ZM0 A;  2J1D G;  2EHO C;  2LKG A;  3C64 A;  2N2N A;  5JTG A;  2XQA A;  2PJQ A;  5FVL A;  4H9O C;  2CA5 A;  2J47 A;  5LBM A;  2X9H A;  4UV9 B;  3M3Z B;  1GQE A;  3EHZ A;  2YDR A;  2Q9Q C;  4COF A;  4HWC A;  2WY2 A;  3OJA A;  1LRZ A;  1KNP A;  4DV1 T;  5DJQ C;  1XZY A;  4YY3 T;  2XUE A;  2JQ9 A;  3KVB A;  3QB5 K;  4QH5 A;  3C51 A;  3CX6 B;  3LSV A;  4EEB A;  1IJ6 A;  1MIW A;  3RQW A;  5AQN B;  4WYV A;  2QRX A;  3BQL A;  5DAB A;  1ZV4 X;  1US7 B;  4I50 E;  5KDM C;  2D2S A;  4YTN A;  3RIU A;  3RHW A;  4UEM A;  3I9Y A;  3TLV A;  2LSG A;  3RYF E;  3VHL A;  3U78 A;  3P4S A;  4IE6 A;  4JI7 T;  1VRB A;  4V1A v;  2YU1 A;  5LGT B;  3Q5X A;  2NW9 A;  2L9Q A;  2WQY A;  3T1Y T;  2DCF A;  4EZ4 A;  1D1A A;  2V6X A;  4OFZ A;  3O9X A;  4X66 T;  2LM2 A;  2WAU A;  2CWO A;  4TN7 B;  4P1N A;  2DWG A;  5IYZ E;  4JI3 T;  4HFI A;  3CQX C;  2V5C A;  3P50 A;  1WYC A;  1MIY A;  4JI4 T;  4XBF B;  4LFC T;  1YKE B;  4GYS A;  2E9X B;  2BVM A;  3RRC A;  4JLE A;  3IF8 B;  1W09 A;  3H3A A;  4IT4 A;  1WCR A;  2NP9 A;  3T8O A;  2CLY C;  1G73 A;  4OHF A;  4EGW A;  1R8I A;  5EK3 A;  2A72 A;  4ADZ A;  3VKH A;  1L0V A;  4AKL A;  4AKI A;  3G06 A;  3E0Z A;  4H9S E;  3V5U A;  3KBU A;  2WB5 A;  1OED A;  2FJE A;  1UUS A;  5HEO A;  1YKH B;  3L09 A;  2VKO A;  2DI4 A;  2W2U A;  4WZX A;  3KV5 A;  2L3L A;  4DR2 T;  3A8Y C;  4H63 V;  3R84 B;  5FL0 A;  1KNR A;  1XMQ T;  2ZM6 T;  3AE4 A;  3N9N A;  3B5M A;  3P4W A;  1SA0 E;  4E7Z A;  5LMN T;  5JRE A;  5L4E A;  2UUA T;  1MMN A;  5LHI B;  3ONX A;  4HTE A;  5LA6 E;  2I6H A;  4MBQ A;  1O3X A;  4JBW F;  4NPP A;  1QSD A;  3RI5 A;  4ZI3 D;  4DND A;  2MAW A;  2QA7 A;  2LSY A;  2H7O A;  3KVA A;  2M67 A;  4Z8X A;  2OA5 A;  4E7S A;  1XNQ T;  1YD8 G;  3JAD A;  1YW0 A;  1XNR T;  2XQ4 A;  4F8H A;  1E7P A;  2XJ7 A;  3AEF A;  5J2U E;  3UU5 A;  1JNZ A;  4IDO A;  2VWA A;  5AQO B;  3ZJ1 A;  3N9L A;  3I1A A;  2XQ5 A;  5FVK A;  3ZMZ B;  1W0A A;  3PUV F;  3WAJ A;  3QC9 A;  3AEG A;  5FL1 A;  1JNR A;  3GMI A;  3AA0 B;  3O1I A;  4NIQ A;  4TX5 A;  4DV0 T;  4G2A A;  3PJA J;  3Q9D A;  4O8S A;  3WI3 A;  2NW8 A;  4FJO A;  1XDO A;  4WBN E;  2WBL A;  4LF7 T;  4U72 A;  2F4V T;  5CGM A;  4U7I A;  2D0U A;  2VQF T;  5JDG A;  4IE4 A;  3AVR A;  5AQU B;  2FBW A;  3C98 B;  4ERR A;  4B3R T;  4DR4 T;  5HEG A;  2H7V C;  3PUR A;  2WZH A;  2X0Y A;  2VB6 A;  2D5U A;  1KEY A;  3UU4 A;  4UVA B;  5ABH A;  4TWF A;  1Z0P A;  2NR4 A;  3UFG A;  4FI5 A;  2LT3 A;  1FMW A;  4QX7 B;  4HGA A;  2ES0 A;  2WCA A;  4UF0 A;  2H88 A;  3VRB A;  3AE5 A;  3ETU A;  4YSY A;  2W4X A;  3ZKR A;  5JDH A;  5ABF B;  4B3M T;  3EAM A;  3RIU C;  3PUX F;  3SS1 A;  4HFD A;  4A98 A;  3KDS E;  3LG7 A;  2A2F X;  2CMR A;  4GK0 E;  5JQG E;  3I0O A;  1NAF A;  3H3M A;  2FJB A;  4J2C A;  2UXN B;  2YOE A;  4AKR B;  2JRK A;  2V7L A;  1HFA A;  2N1G A;  1OXZ A;  2VL0 A;  2LHR A;  3FXD B;  4JEH B;  4DR7 T;  3ONJ A;  3B57 A;  2BDE A;  2V6Y B;  5GON E;  2OV9 A;  1BR0 A;  2CHO A;  5EK2 A;  3O1J A;  2VUR A;  3IHR A;  2UXB T;  1D1B A;  5FXV A;  2H89 A;  3O1H A;  4DMV A;  2VKH A;  1UUR A;  2C0S A;  2W0G A;  4KBM B;  2LKH A;  4X62 T;  2V1D B;  2BBJ A;  2DHR A;  5LNK A;  3ZC1 A;  3RYH E;  3RH3 A;  1QLB A;  3FHN A;  1MMD A;  4P0A A;  3SRZ A;  1HG5 A;  2HPJ A;  4DUZ T;  4HWF A;  2XQY A;  3PUG A;  3NZQ A;  1WR6 A;  3JC6 C;  5J0Z A;  4EYY R;  5HEU A;  3R6N A;  3FB2 A;  3K3Q C;  3UUX B;  4AQY T;  1KF6 A;  1OED C;  2XAH B;  5KXJ A;  5HCJ A;  1FEW A;  5EZY E;  3N9M A;  1OWA A;  4UXN B;  4U2Y A;  4TWD A;  4A97 A;  2LSK A;  1HCI A;  4PJN A;  1X9B A;  3UUL A;  3AE7 A;  3TKL B;  2SPC A;  4B6X A;  4ILC A;  4ISS A;  2NOX A;  4X1I E;  4ILB A;  1E2A A;  2V7I A;  4KHZ F;  3I0Q A;  2XM2 A;  4OYJ A;  4ZI3 C;  3N9O A;  3JAF A;  4X20 E;  4U3C A;  1NEN A;  3DTO A;  2WDV A;  4MLK A;  3LFM A;  4IHJ E;  3F57 A;  5ABE A;  4GK5 E;  1ZEE A;  4X64 T;  3OVU A;  3CK6 A;  4I4T E;  1WLX A;  4ZZB A;  4KHP T;  5F5W A;  2CEA A;  4YSZ A;  4TWH A;  1KNZ A;  2XQ7 A;  3SFD A;  3QNU A;  3C50 A;  1IBK T;  3KV9 A;  2BS2 A;  3ZT7 A;  4CXX A;  5JRC A;  4QKN A;  3OBV E;  2AXD S;  2RA1 A;  2V26 A;  3RGL A;  1N34 T;  2PFV A;  5HWY A;  5HXR A;  1MIV A;  1HNX T;  2NTY A;  5LCY A;  4IE0 A;  4AI6 A;  4JI1 T;  2D9D A;  3CX8 B;  4IL9 A;  4QXC B;  4ILA A;  1SHZ C;  2E9X A;  1UCU A;  3FZH B;  3GA8 A;  4OYK A;  2YN6 A;  1D1C A;  2BG9 B;  3PU8 A;  2I59 A;  4H9N C;  2V7K A;  2E9X D;  3JCF A;  2VVN A;  3F31 A;  4PFP A;  1BR1 A;  5LYJ E;  4KMC A;  2IHR 1;  3GN5 A;  2BZB A;  5CA1 E;  2V7M A;  2K24 A;  3N2O A;  2K9A A;  4IRE A;  5L4H A;  4CXW A;  2WM9 A;  2B1E A;  3DP7 A;  5H6R B;  2LSJ A;  2XHE B;  3ZYM A;  4PFO A;  4CN6 A;  5ABG A;  2IC9 A;  3CQC B;  2UU9 T;  2VQE T;  3N2G E;  3C4Z A;  4ZS3 A;  2ZM8 A;  2HN2 A;  3PV0 F;  4HFC A;  4EOZ B;  3KFW X;  4IST A;  4IDN A;  4F6R C;  1DU2 A;  3VKG A;  4UVC B;  2J4G A;  3ZSS A;  5JRC B;  2WDQ A;  1SUM B;  4X65 T;  3AA1 B;  3AE9 A;  2XPK A;  4DBR A;  3V5S A;  1W9R A;  3ZMV B;  5AQK B;  4QWN B;  4JI2 T;  4I43 B;  5L3E B;  3MA9 A;  4LMJ A;  2XSA A;  3HR0 A;  2KWI B;  2QGS A;  2CXL A;  2V5D A;  2HPL A;  2E5V A;  3K1S A;  3RF1 A;  3ZT6 A;  2W62 A;  4WNK A;  4IE5 A;  2Y48 B;  3HKE E;  3Q5D A;  4JEU B;  3AEA A;  1X79 A;  1KFY A;  3UUN A;  2WU5 A;  5HYA A;  1MNE A;  3RKO A;  1IAP A;  4AQF A;  5AQG B;  2KND A;  4PW8 A;  4XAX B;  2ODU A;  4DV7 T;  2CXF A;  4JUY A;  2JQK A;  3GN5 B;  3L39 A;  2A9U A;  4AXP A;  3GWH A;  2M6I A;  3ONL C;  2BVL A;  2Y6X A;  3NRX A;  4P09 A;  1IBL T;  5FXX A;  1WR0 A;  1HX1 B;  2XQ6 A;  2ACZ A;  2IIU A;  5HXE A;  4PK6 A;  3KV6 A;  3PUW F;  3EI0 A;  5J2T E;  2ZMA A;  2UUB T;  3UFE A;  3C4X A;  4QH4 A;  3HKC E;  4DR3 T;  4HE8 A;  2CBJ A;  3UU8 A;  2MPK A;  4YJ2 E;  3IEE A;  1FJG T;  5L47 A;  4EZH A;  4HWD A;  5LGN B;  4LMK A;  4X1Y E;  4EED A;  2C5J A;  4QXH B;  3AE3 A;  5LP6 E;  4NXM T;  5KX5 E;  5AQH B;  2W61 A;  3ZCJ A;  3PDY A;  3P4P A;  2LM9 A;  3ANW B;  4MAL A;  3TLT A;  5JDN A;  4YHJ A;  5TAO A;  1I6Z A;  3P4Q A;  3J9X 1;  1XWM A;  5HAX A;  5JR9 B;  4HN9 A;  4CN4 A;  5IWA T;  4YHH T;  5LGU B;  2YKS A;  3UT5 E;  4OK0 A;  3ETV A;  4ZEY A;  4L9I A;  4CZZ B;  5ABF A;  2BG9 E;  2XAG B;  4ZS2 A;  2EHO A;  4GOU A;  1D0X A;  1J5W A;  5HXH A;  4AKG A;  3PUY F;  3CML A;  2KIN B;  3B13 A;  4H9Q C;  1CUN A;  2EHO D;  3X1D A;  4YJ3 E;  1FIO A;  1I94 T;  2DL1 A;  4YTP A;  1KK7 A;  4O2A E;  4QX8 B;  3CIR A;  4IE7 A;  2IAK A;  3OKQ A;  2V6Y A;  3MK7 C;  4YSX A;  4Q25 A;  3DJB A;  5FY1 A;  2R6G F;  2BKN A;  5HXC A;  2JMH A;  4IDZ A;  3FZK B;  1HS7 A;  2VKJ A;  2RPA A;  3MXZ A;  5L2L A;  4O4J E;  4LF8 T;  2WU2 A;  5LJN A;  4HFH A;  2LLY A;  3UUB A;  3ZJ2 A;  2IC6 A;  3N9Q A;  4EXT A;  4EAH A;  2YDS A;  3IA3 A;  2KT9 A;  2BS4 A;  2YIN A;  2E9X C;  5FNV E;  4DUY T;  3AEE A;  4MHC A;  4PNI A;  2G0U A;  4JI8 T;  3O4X E;  3RPU A;  2K5B B;  3RYI E;  3SWH A;  3ZN1 B;  3KV4 A;  4B3T T;  4UIG A;  5F3J A;  4DVD A;  3CX7 B;  2EHO B;  1T8B A;  2LSI A;  3A5X A;  2WMO A;  2RP4 A;  3AED A;  4BA9 A;  3EDV A;  3VRA A;  1BR2 A;  3LJC A;  2PTF A;  3LBX B;  3PUA A;  4ZXL A;  4EYU A;  1EZ3 A;  1S94 A;  1HR0 T;  2YDQ A;  4DV2 T;  2KZ7 B;  4ILU A;  3A7M A;  5CJ5 A;  3PUQ A;  2YEV C;  2MTQ A;  2XQ8 A;  3OTO T;  4HFE A;  1YXR A;  3AE8 A;  2W00 A;  5AQF B;  4CI1 B;  1AJ3 A;  4BJN A;  4TUY E;  3RLF F;  3RQU A;  1M62 A;  3TLW A;  3RRW A;  1HTJ F;  5LB7 B;  2WWU A;  3W15 B;  4JV5 T;  1S35 A;  5DQV A;  3ZMU B;  1UK5 A;  4LF4 T;  1NWM X;  2E8I A;  4JI5 T;  4HKA A;  2IUB A;  3E08 A;  4XZC A;  3PUS A;  4JI0 T;  5E0O A;  4P0B A;  2JMK A;  3QUJ A;  4ANJ A;  3EDU A;  5FMN A;  3J7Y q;  4QH1 A;  5AQJ B;  3ZCI A;  2VK9 A;  2XSB A;  1T98 A;  2LRK A;  1ZOY A;  3L8R A;  1WRD A;  3BQI A;  2NTX A;  2X51 A;  4DV5 T;  5AFU L;  4PK5 A;  1V9D A;  3MKD A;  2WZI A;  2CXD A;  5AQS B;  4JI6 T;  1N33 T;  3LDQ B;  4PJL A;  4U2Z A;  4ZI2 D;  2XY8 B;  2BG9 A;  4IIJ E;  2XZE A;  2VAS A;  3FBL A;  2CM0 A;  4X1K E;  4NUU A;  2JJ9 A;  2IDO B;  4TNV A;  3CWZ B;  4ZOL E;  3Q5W A;  3QK6 A;  2CE7 A;  3TLS A;  3JAE A;  1YQ4 A;  2X66 A;  3ZN0 B;  2JPF A;  5L3D B;  2WMN A;  2CLY B;  1T7S A;  4UR9 A;  2V8S V;  3HKB E;  1LVK A;  5EK4 A;  2E5L T;  3PUZ F;  2XTL A;  1XDP A;  1ZP0 A;  2J62 A;  1D0Y A;  3K8P C;  5AQV B;  5JDF A;  4UVB B;  4KUM B;  3MZK B;  5BMV E;  4O4L E;  1XMO T;  4ZZC A;  5J1G A;  2K48 A;  2MBG A;  4TZ4 C;  2PG8 A;  2CBI A;  5H6Q B;  2CCQ A;  2X0L B;  4LF5 T;  2XAS B;  3PTR B;  2N9D A;  2NWB A;  5LMU T;  2LRL A;  2W66 A;  5IUX A;  1WFD A;  2C5K T;  4GIW A;  2JIW A;  5HXS A;  1HNW T;  3ZMS B;  5KMG P;  4IGU A;  1BR4 A;  5LOV E;  4I55 E;  2LHN A;  3CPZ A;  3WAK A;  3ZYK A;  4IL4 A;  3K3O A;  3KIN B;  5FYM A;  4BAY B;  4ZI7 E;  4EV6 A;  3CKD A;  3BQK A;  2X0H A;  1YQ3 A;  3M65 A;  4G63 A;  5LHG B;  3EUH A;  3VU7 H;  3AE2 A;  2VVS A;  3ESL A;  2ZM2 A;  3AAE B;  1CHU A;  1J1J A;  3F2E A;  3RKG A;  3SFE A;  5CB4 E;  3EVY A;  3ZLI A;  3MJX A;  3HL6 A;  5L3B B;  1SE7 A;  3TLU A;  4HFB A;  4UEL A;  2HHH T;  1IJ5 A;  4GYR A;  2H3R A;  3N2K E;  3ANW A;  4TNW A;  2X9W A;  2AE9 A;  3AEB A;  5LXT E;  2HH7 A;  3Q2M A;  2XAF B;  4ZHQ E;  3FZM B;  4DR5 T;  4YFS A;  4LF6 T;  2WDR A;  5JR9 A;  2B76 A;  3AXJ A;  3P8C D;  2E2A A;  2ODV A;  4WBO A;  2WS3 A;  4A5X A;  4PJM A;  1HG2 A;  2FJD A;  3RIF A;  3AB3 B;  3UU6 A;  2X67 A;  5DQW A;  3Q5E A;  2I0M A;  3CQG B;  1Z8U A;  1ZKE A;  3T1H T;  2BS3 A;  1HF8 A;  2MOZ A;  4H63 H;  5HWX A;  1U5P A;  3AE1 A;  2UXD T;  2CWY A;  2QYW A;  4YT0 A;  2UXC T;  3AE6 A;  2ACX A;  3NRY A;  2JQQ A;  3IBP A;  4HWH A;  1ZHC A;  1VCT A;  5LG3 A;  4YLH A;  5FKY A;  5A1L A;  3RX6 A;  3UTK A;  2MYS A;  4IDQ A;  4CQI A;  4DID B;  3JC6 D;  4LF9 T;  3LK3 B;  5ADX L;  3ZEF B;  1M7K A;  5FP3 A;  2X9X A;  2NW7 A;  2X9Y A;  3UU3 A;  4U33 A;  1D0Z A;  1UX4 A;  4EB6 E;  3PE0 A;  5HCM A;  5HEJ A;  2CRB A;  4KX6 A;  4LFA T;  4ZI2 C;  4ASK A;  5JDM A;  4DV6 T;  3QB5 A;  2PBI A;  5L3C B;  2IW5 B;  3E22 E;  3AXJ B;  4U31 A;  4AIU A;  4BJM A;  2BG9 C;  2W67 A;  5AQT B;  4M1P A;  4HEA A;  4C90 A;  5JH7 E;  2UXX B;  3EAB A;  4NUV A;  5L3F B;  4DV3 T;  5FY0 A;  5CA0 E;  5C2T A;  4AKH A;  2WP9 A;  2OLT A;  1MMG A;  4K0K T;  1HX8 A;  3LK2 B;  4AIS A;  4DR6 T;  4O4H E;  4DMW A;  2BKP A;  3LBX A;  2W63 A;  2DNX A;  4UV8 B;  3OPC A;  3ZC0 A;  3NZP A;  2FUP A;  1G8X A;  2VKD A;  2YK0 A;  2Q9Q A;  5JDL A;  3VR9 A;  2P9B A;  3FBZ A;  3AVS A;  3AA7 B;  2Q9Q D;  3NKZ A;  3HKD E;  5IHY A;  1J5E T;  2GK9 A;  1OED B;  3RYC E;  4HFV A;  2LOS A;  3AAI A;  1H7C A;  2DWK A;  4L0R A;  4DO0 A;  4QHO A;  4KP3 C;  1FMV A;  4DR1 T;  4O2B E;  4O4I E;  4C91 A;  1LVF A;  1Y01 A;  2XM1 A;  3ZYL A;  2LEH A;  5AQQ B;  3RIA A;  5CFB A;  2UUC T;  1U4Q A;  3N9P A;  4I0U A;  2BBH A;  2JQH A;  1T72 A;  2Z6E A;  5F8P A;  3HI2 A;  3AAA B;  4DV4 T;  3ZT5 A;  4TV8 E;  2HN1 A;  5C8Y E;  2KXP B;  2XQ3 A;  3K3N A;  4AQG A;  5LHH B;  5JDQ A;  4YTM A;  4CXY A;  2C5I T;  1B7T A;  4CI2 B;  1LKX A;  2QVA A;  5JVD E;  4HWI B;  2Y8D A;  4CI3 B;  5LJM A;  4IDP A;  1HNZ T;  4Z91 A;  2M6B A;  3I9W A;  2Q9Q B;  2XAJ B;  3ABV A;  2BKO A;  2KMF A;  4QXB B;  2LE8 A;  4L5G A;  4H9R C;  2IML A;  1UX5 A;  4JYA T;  3RC8 A;  3LK4 2;  3ZPO A;  3NBX X;  4YXD A;  1N32 T;  4NXN T;  1N36 T;  2LJL A;  4N78 D;  4OX9 T;  3N5L A;  1UGO A;  5BR8 T;  3VR8 A;  4Z90 A;  3ZST A;  5HEH A;  1MMA A;  1QUU A;  1NEK A;  3S4U A;  3NVO A;  3P7I A;  3FXE B;  5JR9 C;  4MFR A;  3H37 A;  4GKK T;  2X68 A;  3PJA A;  4X5T A;  4DBQ A;  3BK9 A;  4AQF C;  3SOL A;  3L3P A;  5AQI B;  1VOM A;  1VCS A;  1Y64 B;  5AQM B;  3AA6 B;  5FY7 A;  3OYZ A;  4CN1 A;  4H9P C;  3C4W A;  4GKJ T;  2A3D A;  2WWV A;  1E1H B;  4PAG A;  4PK4 A;  5M4Y A;  4UF0 B;  2CPT A;  3AEC A;  2VL8 A;  4B3S T;  5ETW A;  4K0U A;  1W0B A;  5AQP B;  5AQR B;  3UQ4 A;  3CVR A;  5LBQ B;  3NWI A;  3RC3 A;  4EIW A;  2L8K A;  2XAQ B;  4WW0 A;  4TV9 E;  3D0T A;  1MND A;  2WSS V;  4A56 A;  3HA4 A;  5L3G B;  3FZL B;  1IBM T;  3QOF A;  3UQ7 A;  2YU2 A;  3UUM A;  1OED E;  4LML A;  5FXZ A;  5LG4 A;  5FXW A; 
#chains in the Genus database with same CATH homology
 3VU7 H;  3KDS E;  3LG7 A;  2A2F X;  2CMR A;  3KBT A;  3PU3 A;  4GK0 E;  5JQG E;  5HAX A;  3I0O A;  1NAF A;  3ZMT B;  3ESL A;  1IZN B;  2DLR A;  2ZM2 A;  3AAE B;  4J2C A;  5JR9 B;  4HN9 A;  3F2E A;  2UXN B;  4AKR B;  2JRK A;  2V7L A;  1HFA A;  2N1G A;  3U3I A;  1OXZ A;  5CB4 E;  3EVY A;  3ZLI A;  3MJX A;  5LGU B;  2LHR A;  3HL6 A;  5L3B B;  3FXD B;  4JEH B;  2KLQ A;  4UEL A;  1WYB A;  2D0T A;  2KWH A;  3UT5 E;  3B57 A;  1IJ5 A;  4OK0 A;  2BDE A;  2H3R A;  4GYR A;  3N2K E;  3ANW A;  3ETV A;  2X9W A;  4L9I A;  4CZZ B;  5GON E;  1BR0 A;  3MAC A;  2ZLY A;  5LXT E;  2HH7 A;  2V7J A;  5EK2 A;  2XAG B;  4U74 A;  3O1J A;  4ZS2 A;  3Q2M A;  2EHO A;  3OYX A;  4PJJ A;  2LOP A;  2XAF B;  4GOU A;  4ZHQ E;  2ZM0 A;  2J1D G;  3IHR A;  2EHO C;  1D0X A;  5HXH A;  4AKG A;  3C64 A;  2N2N A;  3CML A;  2KIN B;  4YFS A;  3B13 A;  4H9Q C;  2PJQ A;  4H9O C;  1CUN A;  1D1B A;  2EHO D;  2CA5 A;  5FXV A;  5JR9 A;  4YJ3 E;  1FIO A;  3O1H A;  5LBM A;  4DMV A;  2VKH A;  2X9H A;  2C0S A;  3P8C D;  1KK7 A;  2ODV A;  2W0G A;  4O2A E;  4QX8 B;  4WBO A;  4KBM B;  4UV9 B;  4IE7 A;  4PJM A;  2V1D B;  2IAK A;  2Q9Q C;  3OKQ A;  1HG2 A;  3MK7 C;  3OJA A;  1LRZ A;  3AB3 B;  5FY1 A;  3DJB A;  2DHR A;  5LNK A;  3ZC1 A;  2X67 A;  5DQW A;  5HXC A;  2JMH A;  3RYH E;  4IDZ A;  1HS7 A;  5DJQ C;  3RH3 A;  2VKJ A;  1ZKE A;  3CQG B;  3J9X 1;  1HF8 A;  3MXZ A;  2MOZ A;  2XUE A;  3FHN A;  1MMD A;  4H63 H;  5L2L A;  5HWX A;  4P0A A;  3SRZ A;  1U5P A;  4O4J E;  1HG5 A;  3KVB A;  2HPJ A;  2CWY A;  5LJN A;  3C51 A;  2ACX A;  3NRY A;  2JQQ A;  2IC6 A;  3ZJ2 A;  2XQY A;  3IBP A;  3N9Q A;  3PUG A;  4EAH A;  4EXT A;  3CX6 B;  1ZHC A;  3NZQ A;  4YLH A;  2KT9 A;  1WR6 A;  5A1L A;  3RX6 A;  3UTK A;  3JC6 C;  1IJ6 A;  2MYS A;  1MIW A;  4EYY R;  3R6N A;  2YIN A;  3FB2 A;  3K3Q C;  2E9X C;  4CQI A;  5FNV E;  3JC6 D;  3LK3 B;  4MHC A;  3BQL A;  5ADX L;  3UUX B;  3ZEF B;  4PNI A;  2G0U A;  2XAH B;  5DAB A;  5FP3 A;  1FEW A;  5EZY E;  2X9X A;  3O4X E;  1ZV4 X;  2NW7 A;  1US7 B;  3N9M A;  1OWA A;  2X9Y A;  3RPU A;  4UXN B;  4I50 E;  2K5B B;  3RYI E;  5KDM C;  3SWH A;  1D0Z A;  2D2S A;  2LSK A;  1HCI A;  3ZN1 B;  3KV4 A;  1UX4 A;  4PJN A;  4EB6 E;  4UIG A;  3UUL A;  3PE0 A;  3TKL B;  5F3J A;  4DVD A;  2SPC A;  3CX7 B;  4UEM A;  2EHO B;  2LSI A;  3A5X A;  4B6X A;  2WMO A;  3I9Y A;  2RP4 A;  4ISS A;  4ZI2 C;  4ASK A;  4BA9 A;  3EDV A;  5JDM A;  2NOX A;  1BR2 A;  2LSG A;  3LJC A;  3RYF E;  3VHL A;  3LBX B;  2PBI A;  4X1I E;  5L3C B;  3PUA A;  2IW5 B;  3E22 E;  3U78 A;  4EYU A;  2V7I A;  4BJM A;  4IE6 A;  3I0Q A;  4OYJ A;  4ZI3 C;  4M1P A;  1EZ3 A;  1S94 A;  1VRB A;  4HEA A;  4V1A v;  4C90 A;  5JH7 E;  2YU1 A;  3N9O A;  2UXX B;  4X20 E;  5LGT B;  2KZ7 B;  4ILU A;  3Q5X A;  4NUV A;  2NW9 A;  3DTO A;  5L3F B;  2L9Q A;  3PUQ A;  5FY0 A;  2DCF A;  2YEV C;  4MLK A;  2MTQ A;  5CA0 E;  4AKH A;  3LFM A;  4IHJ E;  1MMG A;  3F57 A;  4EZ4 A;  1HX8 A;  1D1A A;  4OFZ A;  3LK2 B;  4GK5 E;  1ZEE A;  2W00 A;  3O9X A;  4I4T E;  1WLX A;  4CI1 B;  4O4H E;  4DMW A;  1AJ3 A;  2WAU A;  4BJN A;  4TUY E;  2CWO A;  4TN7 B;  3LBX A;  2W63 A;  2DNX A;  2DWG A;  4UV8 B;  3RRW A;  1HTJ F;  5IYZ E;  3ZC0 A;  3CQX C;  2CEA A;  3NZP A;  1KNZ A;  1G8X A;  2VKD A;  2WWU A;  2YK0 A;  2Q9Q A;  3W15 B;  5JDL A;  1WYC A;  1S35 A;  2P9B A;  5DQV A;  1MIY A;  3C50 A;  4XBF B;  3FBZ A;  3KV9 A;  3ZMU B;  1YKE B;  1NWM X;  3AVS A;  4GYS A;  3AA7 B;  2E9X B;  4CXX A;  5JRC A;  4QKN A;  2E8I A;  2Q9Q D;  2BVM A;  3HKD E;  3RRC A;  5IHY A;  3OBV E;  2GK9 A;  3RYC E;  4HFV A;  2RA1 A;  2V26 A;  4JLE A;  2LOS A;  3AAI A;  3IF8 B;  1H7C A;  2PFV A;  3H3A A;  5HWY A;  5HXR A;  2NP9 A;  4HKA A;  3T8O A;  2DWK A;  1MIV A;  4L0R A;  3E08 A;  2CLY C;  1G73 A;  4OHF A;  4DO0 A;  5EK3 A;  4XZC A;  3PUS A;  2NTY A;  5LCY A;  5E0O A;  4QHO A;  2A72 A;  4P0B A;  4KP3 C;  4IE0 A;  1FMV A;  4AI6 A;  4ADZ A;  3VKH A;  4AKL A;  4AKI A;  4O2B E;  3E0Z A;  2JMK A;  3QUJ A;  4ANJ A;  4O4I E;  4H9S E;  3EDU A;  3CX8 B;  4C91 A;  4QXC B;  5FMN A;  3J7Y q;  3V5U A;  1LVF A;  1SHZ C;  3KBU A;  2E9X A;  1UCU A;  3GA8 A;  3ZYL A;  2LEH A;  4OYK A;  3ZCI A;  2VK9 A;  1T98 A;  1D1C A;  3PU8 A;  1WRD A;  2I59 A;  4H9N C;  1U4Q A;  2V7K A;  2E9X D;  3N9P A;  1YKH B;  3F31 A;  1BR1 A;  3BQI A;  2VKO A;  3L09 A;  4PFP A;  2NTX A;  5LYJ E;  2DI4 A;  2X51 A;  2Z6E A;  5F8P A;  5AFU L;  3HI2 A;  3KV5 A;  4KMC A;  3AAA B;  2L3L A;  4PK5 A;  3GN5 A;  2BZB A;  4H63 V;  5CA1 E;  2V7M A;  1V9D A;  3R84 B;  3MKD A;  4TV8 E;  2K24 A;  3N2O A;  5C8Y E;  2CXD A;  2KXP B;  3N9N A;  3K3N A;  4AQG A;  5LHH B;  2K9A A;  5JDQ A;  1SA0 E;  4E7Z A;  4PJL A;  4CXY A;  2C5I T;  4CXW A;  1B7T A;  2WM9 A;  2B1E A;  3DP7 A;  5H6R B;  4CI2 B;  2LSJ A;  1LKX A;  2XHE B;  5JVD E;  5JRE A;  3ZYM A;  4PFO A;  1MMN A;  2IC9 A;  2Y8D A;  4CI3 B;  3ONX A;  4HTE A;  4ZI2 D;  5LHI B;  5LJM A;  4IIJ E;  3CQC B;  5LA6 E;  2VAS A;  3FBL A;  4MBQ A;  2CM0 A;  3N2G E;  1O3X A;  3C4Z A;  4X1K E;  4NUU A;  4ZS3 A;  2JJ9 A;  2ZM8 A;  3I9W A;  1QSD A;  2Q9Q B;  2XAJ B;  2KMF A;  4QXB B;  4ZI3 D;  4EOZ B;  3KFW X;  3CWZ B;  4DND A;  4ZOL E;  3Q5W A;  2LE8 A;  4IST A;  4L5G A;  4F6R C;  3VKG A;  3QK6 A;  2CE7 A;  4UVC B;  5JRC B;  4H9R C;  2QA7 A;  2X66 A;  2LSY A;  3ZN0 B;  1UX5 A;  3AA1 B;  2H7O A;  3KVA A;  3RC8 A;  2JPF A;  3LK4 2;  3ZPO A;  5L3D B;  2M67 A;  2WMN A;  3NBX X;  4Z8X A;  2OA5 A;  4DBR A;  4E7S A;  3V5S A;  2CLY B;  3ZMV B;  1YD8 G;  4QWN B;  1YW0 A;  4I43 B;  2LJL A;  5L3E B;  4N78 D;  3HKB E;  3MA9 A;  1LVK A;  5EK4 A;  3HR0 A;  2KWI B;  3N5L A;  2XTL A;  5J2U E;  2QGS A;  2CXL A;  1D0Y A;  3K8P C;  2VWA A;  2HPL A;  3ZJ1 A;  3N9L A;  5JDF A;  4UVB B;  2W62 A;  3I1A A;  4WNK A;  4KUM B;  4IE5 A;  1MMA A;  1QUU A;  2Y48 B;  3MZK B;  3ZMZ B;  3HKE E;  3WAJ A;  3QC9 A;  3S4U A;  5BMV E;  4JEU B;  4O4L E;  3P7I A;  3GMI A;  3AA0 B;  3O1I A;  4TX5 A;  3FXE B;  1X79 A;  3UUN A;  5J1G A;  4MFR A;  5JR9 C;  3H37 A;  4G2A A;  2K48 A;  2MBG A;  3Q9D A;  5HYA A;  1MNE A;  2X68 A;  3RKO A;  1IAP A;  4TZ4 C;  4AQF A;  4DBQ A;  2PG8 A;  2KND A;  4PW8 A;  4O8S A;  4XAX B;  3WI3 A;  3BK9 A;  2ODU A;  4AQF C;  5H6Q B;  2CXF A;  2CCQ A;  2NW8 A;  4JUY A;  3SOL A;  3GN5 B;  3L3P A;  4FJO A;  4AXP A;  2X0L B;  4WBN E;  1VOM A;  1Y64 B;  2WBL A;  3GWH A;  4U72 A;  3AA6 B;  5FY7 A;  2BVL A;  2XAS B;  3OYZ A;  2Y6X A;  3NRX A;  3PTR B;  4H9P C;  4P09 A;  2N9D A;  2NWB A;  3C4W A;  5FXX A;  2A3D A;  2D0U A;  1E1H B;  4PAG A;  4PK4 A;  5JDG A;  5M4Y A;  4UF0 B;  4IE4 A;  3AVR A;  2VL8 A;  4PK6 A;  5HXE A;  3KV6 A;  3C98 B;  4ERR A;  2C5K T;  4GIW A;  5HXS A;  5J2T E;  2ZMA A;  5ETW A;  2H7V C;  4K0U A;  3PUR A;  3ZMS B;  5KMG P;  4IGU A;  1BR4 A;  3CVR A;  5LBQ B;  2VB6 A;  3UFE A;  3C4X A;  4I55 E;  5LOV E;  2D5U A;  2LHN A;  4UVA B;  3CPZ A;  3HKC E;  3WAK A;  4HE8 A;  1Z0P A;  4YJ2 E;  3ZYK A;  3RC3 A;  3IEE A;  4EIW A;  2L8K A;  4FI5 A;  2XAQ B;  4WW0 A;  4EZH A;  4TV9 E;  2LT3 A;  1FMW A;  5LGN B;  3K3O A;  4QX7 B;  3D0T A;  3KIN B;  4HGA A;  4X1Y E;  5FYM A;  1MND A;  2ES0 A;  4BAY B;  4ZI7 E;  2C5J A;  3CKD A;  4QXH B;  2WSS V;  4A56 A;  5LP6 E;  3BQK A;  5KX5 E;  4UF0 A;  3HA4 A;  2W61 A;  3ZCJ A;  5L3G B;  3PDY A;  2LM9 A;  3ANW B;  3ETU A;  4MAL A;  5JDN A;  4YHJ A;  5TAO A;  5JDH A;  3M65 A;  4G63 A;  2YU2 A;  3UUM A;  5FXZ A;  5LG4 A;  5LHG B;  3SS1 A;  5FXW A;  3EUH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...