3VU7H

Crystal structure of rev1-rev7-rev3 ternary complex
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
94
structure length
94
Chain Sequence
PNLAGAVEFNDVKTLLREWITTISDPMEEDILQVVKYCTDLIEEKDLEKLDLVIKYMKRLMQQSVESVWNMAFDFILDNVQVVLQQTYGSTLKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA repair protein REV1
publication title Structural basis of recruitment of DNA polymerase [zeta] by interaction between REV1 and REV7 proteins
pubmed doi rcsb
source organism Homo sapiens
molecule tags Replication
total genus 31
structure length 94
sequence length 94
ec nomenclature
pdb deposition date 2012-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF16727 REV1_C DNA repair protein REV1 C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1280 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3vu7H00
4FJOA 2LSKA 2LSIA 2LSYA 2LSGA 4BA9A 4EXTA 2N1GA 2LSJA 4GK5E 3VU7H 4GK0E
chains in the Genus database with same CATH superfamily
3ZN0B 2FJBA 2HHHT 3ZT7A 4LMLA 3AE1A 3P4RA 4JI1T 4X20E 3FZMB 3P4QA 3PUZF 4EEDA 3ZSSA 2J4GA 4AKHA 2OV9A 4HFCA 4HEAA 2YN6A 2LM9A 5JR9B 4I50E 2KLQA 4XZCA 5LCYA 2ZM6T 3H37A 3EVYA 5AQFB 3OKQA 5HXSA 4F8HA 2KNDA 5L3CB 3UU8A 2WM9A 3ZMVB 1MNDA 4PK4A 2CHNA 5KXJA 5LOVE 3NRXA 4GK0E 3N9MA 4HE8A 5LHGB 3AAEB 3AEDA 3QC9A 4GKKT 2PJQA 1KFYA 2V5CA 2E5LT 3PUXF 1YXRA 4AXPA 3RPUA 4CI3B 5A1LA 4JI7T 3CX8B 1DU2A 4TWDA 2BS3A 2VL8A 4DUZT 4EYUA 4B3TT 4I4TE 4COFA 1WCRA 4ASKA 1LVKA 2LEHA 1FIOA 4NUVA 4QH1A 4IDOA 1HNZT 5ABHA 2XPKA 3C50A 4HWHA 2FJDA 4LFCT 4QX7B 3L8RA 4JEUB 2KMFA 3KV5A 2L3LA 2YINA 5JDHA 3U3IA 1IBMT 4PJMA 3LJCA 4KMCA 1W0AA 3C4XA 5C8YE 3AE7A 2E9XB 4MLKA 4ZZCA 2VVSA 2HN2A 3WI3A 1UGOA 3AXJA 2CWYA 3DJBA 4DMVA 3JADA 2WY2A 3LG7A 4L5GA 1J5WA 3J9X1 3P4SA 3KVAA 2IW5B 3ZKRA 5AQJB 1D1CA 2NW9A 3OTOT 4AKLA 3EUHA 4AISA 5M4YA 5LG3A 4TWHA 4N78D 1XNQT 4EYYR 3ZT5A 3UUBA 2ZM2A 5ABEA 2MAWA 2LM2A 5AQKB 3ETVA 3VKHA 4H9OC 3RKGA 4NUUA 3A7MA 1ZOYA 4UV9B 4YXDA 5JR9A 1T7SA 4XAXB 2L9QA 2K9AA 5AQUB 2JPFA 2F4VT 1LKXA 2OA5A 4DV1T 3OJAA 2NOXA 3K3NA 3AVSA 3N2OA 4H9PC 3C64A 3N5LA 4YSYA 3L39A 1SUMB 3JAEA 3R6NA 5LHHB 1MIYA 2X51A 3Q5DA 2PFVA 2X9WA 4DV5T 2A2FX 3I1AA 3EHZA 3ZMTB 1KNZA 3CQGB 3SFEA 4WYVA 3RRCA 2BDEA 3RYHE 5FXWA 3A8YC 1N33T 2V8SV 1HNXT 2WZIA 3V5UA 2YU1A 4JI5T 2AXDS 1MNEA 3T1YT 5JTGA 4TZ4C 3ZJ1A 3UUNA 2H88A 3ETUA 4UELA 2M6IA 2W63A 3CWZB 1CUNA 2QA7A 2I59A 3AAAB 2XAHB 5AQVB 4IL9A 4A98A 4JUYA 5HEUA 1FEWA 3KV9A 2E9XA 5FXXA 1HX1B 2ACXA 1L0VA 4U2YA 3PURA 1G8XA 3AA0B 4IE0A 4KUMB 3PU3A 3ZLIA 3P4WA 3LK3B 4PFPA 4OYJA 3EAMA 1YQ3A 1HNWT 4X1KE 2SPCA 3K8PC 4GKJT 3MJXA 3TLTA 4DBRA 4BJMA 2P9BA 2XQAA 4AIUA 5LYJE 1JNRA 3IBPA 2ES0A 3S4UA 2YDRA 4MBQA 4DR3T 3EABA 2HPJA 3SWHA 3HKDE 4MHCA 1W9RA 2KWIB 4DR2T 2LHNA 1S94A 4LF7T 3C98B 1V9DA 2DL1A 3FXEB 3VU7H 1YKHB 2K3WA 4QKNA 1I94T 4OHFA 3P7IA 2CA5A 3CKDA 3PU8A 2UUBT 3ABVA 4JI0T 2W67A 3UTKA 3AA1B 4B3MT 2CHOA 5F5WA 3I9WA 4H9RC 2KWHA 2J1DG 4PNIA 3I0QA 3KBTA 2BKOA 4PFOA 3ONXA 2G0UA 3LK2B 1HFAA 4HFBA 2CLYB 3GWHA 4KP3C 3PUAA 2W66A 3AEGA 4TNVA 3IF8B 4JBWF 3FXDB 2Q9QA 2WWUA 3JC6D 1H7CA 3V5SA 1U4QA 4DV2T 1ZP0A 3JCFA 2LRKA 2C5IT 5IWAT 2FBWA 5E0OA 4NXMT 4HFHA 5ETWA 1YD8G 4ZI7E 2NP9A 4B6XA 4YTNA 3OYXA 4DV0T 3NZPA 2WMNA 3ANWB 4YTMA 3BQKA 5TAOA 5FY7A 5HAXA 3MACA 4BJNA 4FJOA 2BG9C 2NTXA 3HKBE 3TLWA 5IHYA 5FNVE 4ILUA 4IE4A 3CMLA 5FY1A 3KVBA 3N2KE 3PJAJ 1US7B 1N36T 4YSXA 2LSYA 4DR4T 2KSRA 3KDSE 1KEYA 2Q9QC 4CXXA 1BR0A 5KX5E 3PUGA 3ESLA 3HA4A 2VKOA 2YDSA 4CQIA 4OX9T 2BKNA 4GOUA 4DR5T 2UXXB 4JYAT 2E2AA 4HFIA 3IA3A 5EZYE 1D0XA 1E1HB 3VHLA 3ZC0A 1VRBA 5H6RB 3RIUC 3QK6A 5AQOB 2BVLA 3UU4A 5AQPB 5FKYA 1VOMA 4P0BA 2BKPA 2C5KT 4F6RC 2N2NA 1HTJF 4WBOA 2W61A 3AE5A 1D0YA 4WBNE 4A5XA 5L3FB 3VR8A 2X68A 2UXCT 2BS4A 3KFWX 2XQ3A 4IDQA 5KMGP 2QRXA 2ZMAA 5F3JA 3HL6A 3UQ7A 5J0ZA 1UX4A 3ZC1A 3H3MA 3E08A 2EHOD 1QUUA 4UVCB 1ZKEA 5HCMA 5CGMA 5AQLB 2HN1A 4U74A 4YY3T 3RC8A 2IC6A 4U33A 3RIFA 3PE0A 5L3BB 1MMGA 5AQIB 3IHRA 4NPPA 3T8OA 1YW0A 1R8IA 1NENA 4QXHB 5DJQC 2WU2A 4IDPA 3M3ZB 5JDLA 5JDQA 4ZZBA 5LA6E 2L8KA 1D0ZA 4EOZB 3SOLA 2W62A 2BVMA 2VKHA 2X9HA 3W15B 3ZCJA 3KV6A 2X9XA 3QUJA 3ZMUB 3FZLB 3RYCE 5JH7E 5LNKA 3NVOA 2ODVA 2CLYC 3AEBA 3E0ZA 2XAFB 2PBIA 4QX8B 5CFBA 2Y8DA 1NAFA 3AB3B 4PJJA 3LDQB 3ZEFB 4QH4A 2HH7A 1D1AA 5FL1A 4LMJA 3ZCIA 2XUEA 2LSIA 5HWXA 5AQHB 1MIWA 4TV9E 3QB5A 1U5PA 2YKSA 4HTEA 4C91A 2XAGB 1QLBA 4BA9A 2CCQA 4HWCA 2X0LB 3NZQA 4DNDA 2I6HA 2UXDT 2XQ5A 5IUXA 4MALA 3LFMA 3R84B 4QHOA 4ADZA 3VRBA 4O4LE 2Q9QD 4GYRA 2CXDA 3B5MA 2JQ9A 1X79A 3AECA 3BQIA 3Q5WA 4HGAA 3AAIA 4AKRB 5AQTB 2XQ7A 3OVUA 4O4HE 4P09A 1BR2A 2V7KA 4B3RT 2GK9A 4ZS2A 3SRZA 2VKDA 4EZHA 2VWAA 2J47A 4ILAA 2UXBT 3Q2MA 5FP3A 5DQWA 2MBGA 4IREA 3UUMA 1O3XA 2WSSV 1SHZC 3RYIE 3UFGA 2LJLA 3RLFF 2JIWA 4U3CA 2VURA 3N9OA 4YT0A 4YHHT 4O2AE 4U7YA 2N1GA 1SE7A 2CEAA 4EEBA 2XY8B 2XM1A 1OEDB 5KDMC 5JR9C 2VL0A 4EGWA 5HCJA 3PUQA 3K3QC 2CWOA 4LF9T 1WLXA 2WBLA 2LHRA 5AQRB 4A97A 2UU9T 2XAQB 3EDVA 4ZI2C 3PUYF 3AEAA 3DTOA 5JDFA 5ABFB 1KNPA 4Z90A 4H9QC 3JAFA 2WU5A 4JEHB 4AI6A 5BMVE 2HPLA 3O1HA 4ISTA 4HFEA 1HX8A 4AQYT 3QOFA 2W4XA 4WZXA 3H3AA 3O9XA 1JNZA 2PG8A 2LLYA 2X0HA 1NWMX 2LRLA 4ISSA 5HWYA 3K3OA 2DCFA 1IJ5A 3FHNA 3CK6A 4DV7T 4LF6T 5CJ5A 3HKEE 3MA9A 4ZOLE 3F57A 5CA1E 3TKLB 4AQFA 2YEVC 1X9BA 2A72A 3ZN1B 4UV8B 4EB6E 3FBLA 2DWKA 5FMNA 3D0TA 3AE6A 3UU6A 5L3DB 2BZBA 3CQXC 3Q9DA 3PTRB 5LJMA 3O4XE 4V1Av 4MFRA 2JQKA 2JQHA 3FZKB 2E9XC 1ZHCA 1HF8A 4U7IA 5AQGB 4YSZA 1HS7A 2X9YA 4YJ2E 4IHJE 4K0UA 2QVAA 3L09A 4EZ4A 2XQ6A 4LF4T 2CBIA 2XQYA 2QGSA 3K1SA 5LGTB 4UXNB 2CM0A 4JI4T 4ILCA 3O1IA 3ZYMA 1Z8UA 3EI0A 4PJLA 2XAJB 5L4HA 1QSDA 1EZ3A 5HEOA 3P50A 2CPTA 5JREA 1SA0E 4DVDA 3OYZA 3N9PA 5LBQB 2H3RA 3UUXB 4CI2B 4J2CA 5JRCB 4L0RA 1B7TA 2VASA 4CN4A 3E22E 2WDVA 4K0KT 2WCAA 4ANJA 3F2EA 3TLSA 2MPKA 5L3EB 1ZEEA 5LBMA 5HXRA 1Y01A 3I0OA 3GN5B 5ABFA 1NEKA 4KHPT 3U78A 3N2GE 2V26A 4G2AA 4I43B 2CBJA 4M1PA 3OPCA 1FMWA 3PJAA 2WZHA 2CE7A 5HXCA 2WP9A 1VCSA 4HWIB 1MIVA 5HYAA 4YJ3E 4ZI3C 2B1EA 1MMDA 2VB6A 1Y64B 3PUWF 2NW8A 5L47A 1BR1A 2BS2A 1IBKT 1OEDE 2LOPA 2VQET 4QXCB 2ZLYA 2IHR1 2FJEA 1T98A 3CX6B 2LSGA 3CVRA 4E7ZA 2IDOB 2BG9E 5ABGA 3N9NA 1LVFA 5LG4A 4UEMA 5J2TE 4CN1A 5HEGA 2BBHA 2YDQA 3RH3A 3ZPOA 5FXVA 1VCTA 2VQFT 5JQGE 1HG5A 3ZYLA 4IDNA 2WS3A 1J1JA 1CHUA 4Z91A 4EAHA 4OFZA 2WDQA 2RA1A 3NKZA 5CB4E 4CXYA 3HR0A 5FL0A 2W2UA 3VRAA 2E8IA 2X0YA 4PJNA 2YK0A 5HXHA 4UVBB 1UK5A 5F8PA 3Q5XA 1UX5A 4UR9A 2RP4A 1Z0PA 4UVAB 1HR0T 2M67A 2QYWA 2NW7A 4ZXLA 4DR6T 2C5JA 3MXZA 4O2BE 3RGLA 3T1HT 4YFSA 1FMVA 4G63A 3AE4A 4ZHQE 3LSVA 2D0UA 4P0AA 1N34T 4IE7A 2IIUA 1I6ZA 4U2ZA 1XNRT 4KX6A 1LRZA 4DUYT 4YTPA 3ONLC 5EK2A 1M62A 2UUCT 2D5UA 2Z6EA 5AQQB 5LHIB 1HCIA 2KT9A 3CX7B 4IE6A 3ZSTA 4TN7B 2E9XD 2DWGA 2DNXA 5JRCA 4DBQA 3UU5A 5EK4A 3ZYKA 2H89A 3O1JA 1XMOT 4TNWA 4JI8T 5L4EA 5FY0A 2UXNB 2V6XA 2LSJA 3P4PA 2XZEA 2XASB 1OWAA 2A3DA 1IBLT 3AEFA 4AQGA 2XJ7A 4KI0F 2Y6XA 1S35A 3RIAA 3GN5A 3UU3A 4H9NC 1E7PA 4LF8T 4X62T 2K24A 1IJ6A 3ANWA 2JQQA 3UFEA 2NTYA 2K5BB 1XWMA 4X65T 4KHZF 4IGUA 1N32T 1XZYA 2V6YB 3FBZA 5DABA 2D0TA 3KV4A 4C90A 1IZNB 2IAKA 4X66T 2Y48B 2XSBA 4QXBB 4DR7T 2CXFA 5AQNB 1G73A 3AVRA 4KBMB 3HI2A 4LMKA 3DP7A 3RKOA 4UIGA 3ZT6A 2V1DB 2EHOB 2RPAA 3CIRA 2H7OA 3CPZA 2MYSA 2CMRA 2VKJA 3LBXB 4ZI3D 3PDYA 4E7SA 2WQYA 3VKGA 5C3JA 4EIWA 1UURA 2ACZA 5H6QB 4U31A 2WWVA 4H9SE 3WAKA 3RC3A 4QWNB 4X64T 3RQUA 4IDZA 4XBFB 3PUVF 2C0SA 5L2LA 4UF0B 2XQ9A 3OBVE 5LXTE 4HWFA 4DV6T 3SS1A 5CA0E 3BK9A 1D1BA 3RI5A 4NIQA 5LGUB 3AE9A 4PAGA 3J7Yq 4GIWA 3GMIA 2M6BA 3RRWA 3P8CD 2JMKA 2WMOA 3AEEA 2XQ8A 5ADXL 1MMAA 2XSAA 1YKEB 2E5VA 3B57A 3F31A 5JVDE 2V7IA 2CXLA 4TUYE 3ZMZB 4ZS3A 3AE3A 3KINB 4LFBT 2IC9A 3RYFE 2XM2A 4X1IE 2IUBA 3JC6C 3TLVA 4X1YE 5C2TA 4AKGA 2V7JA 2N9DA 4JI2T 3AA7B 2VK9A 2I0MA 2W00A 1T72A 1MMNA 4DO0A 3A5XA 3L3PA 3TLUA 1XDOA 1AJ3A 3QNUA 3N9QA 2XTLA 4O4IE 5LJNA 1IAPA 3NRYA 2WAUA 4OYKA 3FZHB 2V7LA 2JMHA 3I9YA 5HEHA 2BG9B 2V7MA 2DLRA 3MK7C 4PK6A 5JDMA 3QB5K 3CQCB 5J2UE 4LFAT 1BR4A 3C4ZA 2X66A 4CXWA 2V6YA 2KINB 2Q9QB 5AQSB 4B3ST 4H63H 4AKIA 3KBUA 1FJGT 2D2SA 2WDRA 4GK5E 3RHWA 1OXZA 4H63V 3B13A 2EHOA 3ZMSB 4CZZB 3PUSA 4YHJA 4IL4A 3GA8A 4TWFA 4DMWA 3VR9A 2YOEA 3LBXA 2BBJA 4ILBA 2W0GA 1KNRA 2LKHA 5DQVA 2IMLA 3ONJA 5AQMB 4JV5T 5IYZE 3C51A 1ZV4X 2B76A 3NBXX 5FYMA 4WW0A 3X1DA 3WAJA 1W09A 3RX6A 4X5TA 2H7VC 4UF0A 1UUSA 4EXTA 5HEJA 4P1NA 4DV4T 4JI6T 3SFDA 3PV0F 4FI5A 3LK42 1XMQT 2LE8A 4Z8XA 2UUAT 3MZKB 1GQEA 4O8SA 2EHOC 2D9DA 4U72A 5JDNA 3FB2A 2YU2A 1WYBA 3IEEA 3UULA 3N9LA 4TV8E 4NXNT 2XHEB 4AQFC 3EDUA 4YLHA 2DI4A 1YQ4A 1WFDA 3AE2A 5J1GA 4CN6A 4OK0A 2NR4A 1WR6A 4GYSA 4CI1B 4HFVA 4HKAA 2MTQA 1J5ET 4PK5A 1OEDA 1UCUA 3ZJ2A 2V5DA 4DV3T 3M65A 4WNKA 2AE9A 2K48A 2LKGA 4IE5A 3UQ4A 2BG9A 2WB5A 5FVLA 3RQWA 4ZEYA 5LP6E 4PW8A 2CRBA 1E2AA 5LGNB 4A56A 2PTFA 4LF5T 5BR8T 4O4JE 2XQ4A 3MKDA 4I0UA 5HXEA 3AE8A 4EV6A 5JDGA 1KK7A 1HG2A 3Q5EA 1W0BA 2LSKA 1M7KA 5LB7B 5EK3A 4IIJE 3RIUA 2FJAA 4DIDB 3BQLA 2MOZA 2ZM8A 2LT3A 4HFDA 4Q25A 4TX5A 1WRDA 1OEDC 2JRKA 1WR0A 2DHRA 4IT4A 3C4WA 2ODUA 4JLEA 2R6GF 5FVKA 4QH5A 4ZI2D 2NWBA 3UT5E 2X67A 3AA6B 3HKCE 1XDPA 4JI3T 4BAYB 5AFUL 5GONE 2JJ9A 4L9IA 5FXZA 3RF1A 1KF6A 2LOSA 3FZFB 2VVNA 3G06A 3NWIA 2FUPA 5L3GB 5LMUT 2J62A 4I55E 1T8BA 3AXJB 2KZ7B 2A9UA 2OLTA 4HWDA 2ZM0A 4HN9A 2KXPB 4ERRA 4DR1T 1WYCA 5LMNT
chains in the Genus database with same CATH topology
2V1DB 3ZN0B 2EHOB 2XAQB 3I9WA 4H9RC 3EDVA 2KWHA 4ZI2C 2H7OA 3CPZA 2MYSA 3DTOA 5JDFA 2J1DG 2CMRA 2VKJA 4H9QC 3LBXB 4PNIA 4ZI3D 3PDYA 3I0QA 4JEHB 3KBTA 4X20E 5BMVE 4AI6A 4PFOA 4E7SA 2HPLA 3ONXA 3VKGA 2G0UA 3LK2B 1HFAA 4EIWA 3O1HA 4ISTA 2CLYB 3GWHA 4AKHA 4KP3C 1HX8A 3PUAA 3H3AA 4HEAA 2LM9A 3O9XA 5JR9B 5H6QB 4H9SE 3IF8B 3WAKA 4I50E 3RC3A 4QWNB 2KLQA 2PG8A 4IDZA 3FXDB 4XZCA 5LCYA 4XBFB 2Q9QA 1NWMX 2C0SA 2WWUA 3JC6D 3H37A 1H7CA 3EVYA 5L2LA 4ISSA 3OKQA 5HWYA 5HXSA 2KNDA 5L3CB 3V5SA 1U4QA 4UF0B 2WM9A 3K3OA 3ZMVB 2DCFA 1IJ5A 3OBVE 2C5IT 1MNDA 4PK4A 5E0OA 5LXTE 5LOVE 3FHNA 3SS1A 5CA0E 3BK9A 1D1BA 5ETWA 3NRXA 3HKEE 3MA9A 4ZOLE 1YD8G 5LGUB 4ZI7E 2NP9A 3F57A 4GK0E 3TKLB 4B6XA 5CA1E 4PAGA 3N9MA 3J7Yq 3OYXA 4GIWA 3GMIA 4HE8A 3RRWA 4AQFA 2YEVC 3P8CD 2A72A 2WMNA 3ANWB 2JMKA 2WMOA 3AAEB 3NZPA 5LHGB 3BQKA 5TAOA 3ZN1B 4UV8B 5FY7A 5HAXA 4EB6E 5ADXL 3QC9A 1MMAA 3MACA 2PJQA 1YKEB 3FBLA 2DWKA 5FMNA 3D0TA 3B57A 3F31A 5JVDE 4BJNA 2V7IA 2CXLA 5L3DB 4TUYE 4FJOA 2BZBA 2NTXA 3HKBE 3ZMZB 4ZS3A 5IHYA 3CQXC 5FNVE 3KINB 4ILUA 4AXPA 2IC9A 4IE4A 3Q9DA 3CMLA 3RPUA 5FY1A 3RYFE 4CI3B 3PTRB 3KVBA 4X1IE 3N2KE 5A1LA 5LJMA 1US7B 3O4XE 3JC6C 2LSYA 4V1Av 3CX8B 4MFRA 4X1YE 2VL8A 3KDSE 2E9XC 2Q9QC 1ZHCA 4CXXA 1BR0A 1HF8A 4EYUA 5KX5E 3PUGA 4AKGA 2V7JA 3ESLA 2N9DA 4I4TE 3AA7B 3HA4A 2VK9A 2W00A 1HS7A 2VKOA 4ASKA 4CQIA 1MMNA 2X9YA 1LVKA 2LEHA 4DO0A 3A5XA 4YJ2E 3L3PA 4GOUA 4IHJE 1FIOA 2UXXB 4K0UA 4NUVA 3L09A 4EZ4A 1AJ3A 2XQYA 2QGSA 3N9QA 2XTLA 4O4IE 5LJNA 1IAPA 3NRYA 1D0XA 1E1HB 2WAUA 4OYKA 4UXNB 5EZYE 3VHLA 5LGTB 1VRBA 5H6RB 2CM0A 3ZC0A 2V7LA 2JMHA 3I9YA 3C50A 3O1IA 3ZYMA 3QK6A 2V7MA 2DLRA 4QX7B 3MK7C 4JEUB 4PK6A 4PJLA 2KMFA 2XAJB 2BVLA 5JDMA 3CQCB 5J2UE 3KV5A 2L3LA 2YINA 1QSDA 1BR4A 5JDHA 1EZ3A 3C4ZA 1VOMA 4P0BA 3U3IA 2X66A 4PJMA 3LJCA 4KMCA 4CXWA 3C4XA 5C8YE 5JREA 2KINB 1SA0E 4DVDA 3OYZA 2E9XB 2Q9QB 4MLKA 2C5KT 4F6RC 3N9PA 4H63H 2N2NA 1HTJF 5LBQB 4WBOA 4AKIA 2H3RA 3WI3A 3UUXB 3KBUA 4CI2B 4J2CA 5JRCB 2W61A 2CWYA 3DJBA 2D2SA 1D0YA 4L0RA 4WBNE 4DMVA 5L3FB 2X68A 1B7TA 2VASA 3LG7A 4GK5E 4L5GA 3J9X1 3E22E 3KVAA 2IW5B 3KFWX 1OXZA 4ANJA 3F2EA 1D1CA 2NW9A 5L3EB 4AKLA 5KMGP 3EUHA 1ZEEA 2ZMAA 4H63V 5LBMA 5F3JA 3HL6A 5M4YA 5HXRA 3B13A 2EHOA 3ZMSB 4CZZB 1UX4A 3PUSA 4N78D 3ZC1A 4YHJA 3GA8A 4DMWA 3E08A 3I0OA 3GN5B 2EHOD 4EYYR 3LBXA 1QUUA 3U78A 4UVCB 1ZKEA 3N2GE 2ZM2A 2V26A 4G2AA 4I43B 4M1PA 1FMWA 3ETVA 2W0GA 3VKHA 4H9OC 2CE7A 5HXCA 4NUUA 5DQVA 1MIVA 5HYAA 4U74A 4YJ3E 4UV9B 4ZI3C 5JR9A 2B1EA 5IYZE 3C51A 4XAXB 2L9QA 3RC8A 2K9AA 1MMDA 1ZV4X 2IC6A 2VB6A 1Y64B 3NBXX 5FYMA 2JPFA 1LKXA 2OA5A 4WW0A 2NW8A 3WAJA 3OJAA 3RX6A 1BR1A 2LOPA 3PE0A 2H7VC 5L3BB 1MMGA 4UF0A 4QXCB 2NOXA 3IHRA 3K3NA 2ZLYA 3AVSA 4EXTA 3T8OA 3N2OA 4H9PC 1YW0A 1T98A 3C64A 3N5LA 3CX6B 4QXHB 2LSGA 4FI5A 5DJQC 5JDLA 5JDQA 3CVRA 4E7ZA 5LA6E 3LK42 2LE8A 4Z8XA 3N9NA 1LVFA 2L8KA 3R6NA 3MZKB 5LG4A 5LHHB 4UEMA 1MIYA 2X51A 1D0ZA 5J2TE 4EOZB 4O8SA 3SOLA 2PFVA 2W62A 2BVMA 3RH3A 3ZPOA 5FXVA 2EHOC 2X9WA 2VKHA 5JQGE 4U72A 2A2FX 2X9HA 1HG5A 3I1AA 3ZYLA 3FB2A 5JDNA 2YU2A 1WYBA 3W15B 3ZCJA 3KV6A 2X9XA 3QUJA 3ZMUB 3ZMTB 3IEEA 3UULA 3N9LA 4TV8E 3RYCE 1KNZA 5JH7E 2XHEB 3CQGB 4EAHA 5LNKA 4OFZA 2ODVA 2CLYC 3E0ZA 2RA1A 3EDUA 4AQFC 5CB4E 3RRCA 4YLHA 2BDEA 2XAFB 4CXYA 3RYHE 2DI4A 3HR0A 2PBIA 5J1GA 4QX8B 5FXWA 2E8IA 4PJNA 2YK0A 4OK0A 1WR6A 4GYSA 5HXHA 4UVBB 4CI1B 2Y8DA 4HFVA 5F8PA 1NAFA 2YU1A 4HKAA 3AB3B 4PJJA 3V5UA 3ZEFB 2HH7A 3Q5XA 2MTQA 1D1AA 4PK5A 1MNEA 1UX5A 2RP4A 1Z0PA 4UVAB 1UCUA 3ZJ2A 3ZCIA 2XUEA 2LSIA 2M67A 5HWXA 3M65A 1MIWA 4WNKA 4TV9E 2NW7A 4TZ4C 2K48A 3ZJ1A 1U5PA 3UUNA 2C5JA 3MXZA 4O2BE 4HTEA 4C91A 4IE5A 3ETUA 4UELA 4YFSA 1FMVA 2W63A 4G63A 2XAGB 3CWZB 4BA9A 2CCQA 1CUNA 4ZHQE 5LP6E 2D0UA 2QA7A 2X0LB 4PW8A 4P0AA 4IE7A 2I59A 3NZQA 4DNDA 3AAAB 2XAHB 5LGNB 4A56A 1LRZA 4JUYA 5EK2A 2D5UA 1FEWA 3KV9A 4O4JE 2E9XA 5FXXA 4MALA 2Z6EA 3LFMA 3MKDA 3R84B 1HCIA 5LHIB 2KT9A 3CX7B 5HXEA 4IE6A 2ACXA 4QHOA 4ADZA 4TN7B 4O4LE 2E9XD 2Q9QD 5JDGA 4GYRA 2DWGA 2DNXA 5JRCA 1KK7A 1HG2A 3PURA 4DBQA 2CXDA 1G8XA 3AA0B 2LSKA 1X79A 4IE0A 5EK4A 3ZYKA 3BQIA 3Q5WA 4KUMB 3PU3A 3O1JA 3ZLIA 5EK3A 3LK3B 4HGAA 4PFPA 4IIJE 2UXNB 4OYJA 5FY0A 2LSJA 3BQLA 3AAIA 2MOZA 2ZM8A 2LT3A 4TX5A 4P09A 4O4HE 4AKRB 1BR2A 2XASB 1OWAA 4X1KE 2A3DA 4AQGA 1WRDA 2SPCA 3K8PC 2JRKA 2V7KA 2Y6XA 2DHRA 2GK9A 3MJXA 4DBRA 4ZS2A 3C4WA 2ODUA 3SRZA 4BJMA 1S35A 2P9BA 3GN5A 4JLEA 2VKDA 5LYJE 3IBPA 2ES0A 2VWAA 4EZHA 3S4UA 4H9NC 4MBQA 3Q2MA 5FP3A 5DQWA 2MBGA 4ZI2D 2NWBA 3UUMA 1O3XA 3UT5E 2X67A 2HPJA 2K24A 3AA6B 3HKCE 3SWHA 3HKDE 4MHCA 4BAYB 1IJ6A 2WSSV 2KWIB 1SHZC 3ANWA 2JQQA 3RYIE 2LHNA 1S94A 3UFEA 2NTYA 5AFUL 5GONE 2JJ9A 4L9IA 3C98B 2LJLA 2K5BB 5FXZA 1V9DA 2LOSA 4IGUA 3FXEB 3VU7H 1YKHB 3N9OA 3FBZA 4QKNA 4O2AE 5DABA 5L3GB 2N1GA 2CEAA 2D0TA 3KV4A 4C90A 4I55E 1IZNB 4OHFA 3P7IA 2IAKA 2CA5A 3CKDA 5KDMC 2KZ7B 3PU8A 2Y48B 5JR9C 3PUQA 4QXBB 3K3QC 2CWOA 2CXFA 1G73A 2ZM0A 3AVRA 4HN9A 3HI2A 4KBMB 3DP7A 1WLXA 2KXPB 4ERRA 2WBLA 1WYCA 3UTKA 2LHRA 3AA1B 3RKOA 4UIGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FJO A;  2LSK A;  2LSI A;  2LSY A;  2LSG A;  4BA9 A;  4EXT A;  2N1G A;  2LSJ A;  4GK5 E;  3VU7 H;  4GK0 E; 
#chains in the Genus database with same CATH topology
 3ZN0 B;  2FJB A;  2HHH T;  3ZT7 A;  4LML A;  3AE1 A;  3P4R A;  4JI1 T;  4X20 E;  3FZM B;  3P4Q A;  3PUZ F;  4EED A;  3ZSS A;  2J4G A;  4AKH A;  2OV9 A;  4HFC A;  4HEA A;  2YN6 A;  2LM9 A;  5JR9 B;  4I50 E;  2KLQ A;  4XZC A;  5LCY A;  2ZM6 T;  3H37 A;  3EVY A;  5AQF B;  3OKQ A;  5HXS A;  4F8H A;  2KND A;  5L3C B;  3UU8 A;  2WM9 A;  3ZMV B;  1MND A;  4PK4 A;  2CHN A;  5KXJ A;  5LOV E;  3NRX A;  4GK0 E;  3N9M A;  4HE8 A;  5LHG B;  3AAE B;  3AED A;  3QC9 A;  4GKK T;  2PJQ A;  1KFY A;  2V5C A;  2E5L T;  3PUX F;  1YXR A;  4AXP A;  3RPU A;  4CI3 B;  5A1L A;  4JI7 T;  3CX8 B;  1DU2 A;  4TWD A;  2BS3 A;  2VL8 A;  4DUZ T;  4EYU A;  4B3T T;  4I4T E;  4COF A;  1WCR A;  4ASK A;  1LVK A;  2LEH A;  1FIO A;  4NUV A;  4QH1 A;  4IDO A;  1HNZ T;  5ABH A;  2XPK A;  3C50 A;  4HWH A;  2FJD A;  4LFC T;  4QX7 B;  3L8R A;  4JEU B;  2KMF A;  3KV5 A;  2L3L A;  2YIN A;  5JDH A;  3U3I A;  1IBM T;  4PJM A;  3LJC A;  4KMC A;  1W0A A;  3C4X A;  5C8Y E;  3AE7 A;  2E9X B;  4MLK A;  4ZZC A;  2VVS A;  2HN2 A;  3WI3 A;  1UGO A;  3AXJ A;  2CWY A;  3DJB A;  4DMV A;  3JAD A;  2WY2 A;  3LG7 A;  4L5G A;  1J5W A;  3J9X 1;  3P4S A;  3KVA A;  2IW5 B;  3ZKR A;  5AQJ B;  1D1C A;  2NW9 A;  3OTO T;  4AKL A;  3EUH A;  4AIS A;  5M4Y A;  5LG3 A;  4TWH A;  4N78 D;  1XNQ T;  4EYY R;  3ZT5 A;  3UUB A;  2ZM2 A;  5ABE A;  2MAW A;  2LM2 A;  5AQK B;  3ETV A;  3VKH A;  4H9O C;  3RKG A;  4NUU A;  3A7M A;  1ZOY A;  4UV9 B;  4YXD A;  5JR9 A;  1T7S A;  4XAX B;  2L9Q A;  2K9A A;  5AQU B;  2JPF A;  2F4V T;  1LKX A;  2OA5 A;  4DV1 T;  3OJA A;  2NOX A;  3K3N A;  3AVS A;  3N2O A;  4H9P C;  3C64 A;  3N5L A;  4YSY A;  3L39 A;  1SUM B;  3JAE A;  3R6N A;  5LHH B;  1MIY A;  2X51 A;  3Q5D A;  2PFV A;  2X9W A;  4DV5 T;  2A2F X;  3I1A A;  3EHZ A;  3ZMT B;  1KNZ A;  3CQG B;  3SFE A;  4WYV A;  3RRC A;  2BDE A;  3RYH E;  5FXW A;  3A8Y C;  1N33 T;  2V8S V;  1HNX T;  2WZI A;  3V5U A;  2YU1 A;  4JI5 T;  2AXD S;  1MNE A;  3T1Y T;  5JTG A;  4TZ4 C;  3ZJ1 A;  3UUN A;  2H88 A;  3ETU A;  4UEL A;  2M6I A;  2W63 A;  3CWZ B;  1CUN A;  2QA7 A;  2I59 A;  3AAA B;  2XAH B;  5AQV B;  4IL9 A;  4A98 A;  4JUY A;  5HEU A;  1FEW A;  3KV9 A;  2E9X A;  5FXX A;  1HX1 B;  2ACX A;  1L0V A;  4U2Y A;  3PUR A;  1G8X A;  3AA0 B;  4IE0 A;  4KUM B;  3PU3 A;  3ZLI A;  3P4W A;  3LK3 B;  4PFP A;  4OYJ A;  3EAM A;  1YQ3 A;  1HNW T;  4X1K E;  2SPC A;  3K8P C;  4GKJ T;  3MJX A;  3TLT A;  4DBR A;  4BJM A;  2P9B A;  2XQA A;  4AIU A;  5LYJ E;  1JNR A;  3IBP A;  2ES0 A;  3S4U A;  2YDR A;  4MBQ A;  4DR3 T;  3EAB A;  2HPJ A;  3SWH A;  3HKD E;  4MHC A;  1W9R A;  2KWI B;  4DR2 T;  2LHN A;  1S94 A;  4LF7 T;  3C98 B;  1V9D A;  2DL1 A;  3FXE B;  3VU7 H;  1YKH B;  2K3W A;  4QKN A;  1I94 T;  4OHF A;  3P7I A;  2CA5 A;  3CKD A;  3PU8 A;  2UUB T;  3ABV A;  4JI0 T;  2W67 A;  3UTK A;  3AA1 B;  4B3M T;  2CHO A;  5F5W A;  3I9W A;  4H9R C;  2KWH A;  2J1D G;  4PNI A;  3I0Q A;  3KBT A;  2BKO A;  4PFO A;  3ONX A;  2G0U A;  3LK2 B;  1HFA A;  4HFB A;  2CLY B;  3GWH A;  4KP3 C;  3PUA A;  2W66 A;  3AEG A;  4TNV A;  3IF8 B;  4JBW F;  3FXD B;  2Q9Q A;  2WWU A;  3JC6 D;  1H7C A;  3V5S A;  1U4Q A;  4DV2 T;  1ZP0 A;  3JCF A;  2LRK A;  2C5I T;  5IWA T;  2FBW A;  5E0O A;  4NXM T;  4HFH A;  5ETW A;  1YD8 G;  4ZI7 E;  2NP9 A;  4B6X A;  4YTN A;  3OYX A;  4DV0 T;  3NZP A;  2WMN A;  3ANW B;  4YTM A;  3BQK A;  5TAO A;  5FY7 A;  5HAX A;  3MAC A;  4BJN A;  4FJO A;  2BG9 C;  2NTX A;  3HKB E;  3TLW A;  5IHY A;  5FNV E;  4ILU A;  4IE4 A;  3CML A;  5FY1 A;  3KVB A;  3N2K E;  3PJA J;  1US7 B;  1N36 T;  4YSX A;  2LSY A;  4DR4 T;  2KSR A;  3KDS E;  1KEY A;  2Q9Q C;  4CXX A;  1BR0 A;  5KX5 E;  3PUG A;  3ESL A;  3HA4 A;  2VKO A;  2YDS A;  4CQI A;  4OX9 T;  2BKN A;  4GOU A;  4DR5 T;  2UXX B;  4JYA T;  2E2A A;  4HFI A;  3IA3 A;  5EZY E;  1D0X A;  1E1H B;  3VHL A;  3ZC0 A;  1VRB A;  5H6R B;  3RIU C;  3QK6 A;  5AQO B;  2BVL A;  3UU4 A;  5AQP B;  5FKY A;  1VOM A;  4P0B A;  2BKP A;  2C5K T;  4F6R C;  2N2N A;  1HTJ F;  4WBO A;  2W61 A;  3AE5 A;  1D0Y A;  4WBN E;  4A5X A;  5L3F B;  3VR8 A;  2X68 A;  2UXC T;  2BS4 A;  3KFW X;  2XQ3 A;  4IDQ A;  5KMG P;  2QRX A;  2ZMA A;  5F3J A;  3HL6 A;  3UQ7 A;  5J0Z A;  1UX4 A;  3ZC1 A;  3H3M A;  3E08 A;  2EHO D;  1QUU A;  4UVC B;  1ZKE A;  5HCM A;  5CGM A;  5AQL B;  2HN1 A;  4U74 A;  4YY3 T;  3RC8 A;  2IC6 A;  4U33 A;  3RIF A;  3PE0 A;  5L3B B;  1MMG A;  5AQI B;  3IHR A;  4NPP A;  3T8O A;  1YW0 A;  1R8I A;  1NEN A;  4QXH B;  5DJQ C;  2WU2 A;  4IDP A;  3M3Z B;  5JDL A;  5JDQ A;  4ZZB A;  5LA6 E;  2L8K A;  1D0Z A;  4EOZ B;  3SOL A;  2W62 A;  2BVM A;  2VKH A;  2X9H A;  3W15 B;  3ZCJ A;  3KV6 A;  2X9X A;  3QUJ A;  3ZMU B;  3FZL B;  3RYC E;  5JH7 E;  5LNK A;  3NVO A;  2ODV A;  2CLY C;  3AEB A;  3E0Z A;  2XAF B;  2PBI A;  4QX8 B;  5CFB A;  2Y8D A;  1NAF A;  3AB3 B;  4PJJ A;  3LDQ B;  3ZEF B;  4QH4 A;  2HH7 A;  1D1A A;  5FL1 A;  4LMJ A;  3ZCI A;  2XUE A;  2LSI A;  5HWX A;  5AQH B;  1MIW A;  4TV9 E;  3QB5 A;  1U5P A;  2YKS A;  4HTE A;  4C91 A;  2XAG B;  1QLB A;  4BA9 A;  2CCQ A;  4HWC A;  2X0L B;  3NZQ A;  4DND A;  2I6H A;  2UXD T;  2XQ5 A;  5IUX A;  4MAL A;  3LFM A;  3R84 B;  4QHO A;  4ADZ A;  3VRB A;  4O4L E;  2Q9Q D;  4GYR A;  2CXD A;  3B5M A;  2JQ9 A;  1X79 A;  3AEC A;  3BQI A;  3Q5W A;  4HGA A;  3AAI A;  4AKR B;  5AQT B;  2XQ7 A;  3OVU A;  4O4H E;  4P09 A;  1BR2 A;  2V7K A;  4B3R T;  2GK9 A;  4ZS2 A;  3SRZ A;  2VKD A;  4EZH A;  2VWA A;  2J47 A;  4ILA A;  2UXB T;  3Q2M A;  5FP3 A;  5DQW A;  2MBG A;  4IRE A;  3UUM A;  1O3X A;  2WSS V;  1SHZ C;  3RYI E;  3UFG A;  2LJL A;  3RLF F;  2JIW A;  4U3C A;  2VUR A;  3N9O A;  4YT0 A;  4YHH T;  4O2A E;  4U7Y A;  2N1G A;  1SE7 A;  2CEA A;  4EEB A;  2XY8 B;  2XM1 A;  1OED B;  5KDM C;  5JR9 C;  2VL0 A;  4EGW A;  5HCJ A;  3PUQ A;  3K3Q C;  2CWO A;  4LF9 T;  1WLX A;  2WBL A;  2LHR A;  5AQR B;  4A97 A;  2UU9 T;  2XAQ B;  3EDV A;  4ZI2 C;  3PUY F;  3AEA A;  3DTO A;  5JDF A;  5ABF B;  1KNP A;  4Z90 A;  4H9Q C;  3JAF A;  2WU5 A;  4JEH B;  4AI6 A;  5BMV E;  2HPL A;  3O1H A;  4IST A;  4HFE A;  1HX8 A;  4AQY T;  3QOF A;  2W4X A;  4WZX A;  3H3A A;  3O9X A;  1JNZ A;  2PG8 A;  2LLY A;  2X0H A;  1NWM X;  2LRL A;  4ISS A;  5HWY A;  3K3O A;  2DCF A;  1IJ5 A;  3FHN A;  3CK6 A;  4DV7 T;  4LF6 T;  5CJ5 A;  3HKE E;  3MA9 A;  4ZOL E;  3F57 A;  5CA1 E;  3TKL B;  4AQF A;  2YEV C;  1X9B A;  2A72 A;  3ZN1 B;  4UV8 B;  4EB6 E;  3FBL A;  2DWK A;  5FMN A;  3D0T A;  3AE6 A;  3UU6 A;  5L3D B;  2BZB A;  3CQX C;  3Q9D A;  3PTR B;  5LJM A;  3O4X E;  4V1A v;  4MFR A;  2JQK A;  2JQH A;  3FZK B;  2E9X C;  1ZHC A;  1HF8 A;  4U7I A;  5AQG B;  4YSZ A;  1HS7 A;  2X9Y A;  4YJ2 E;  4IHJ E;  4K0U A;  2QVA A;  3L09 A;  4EZ4 A;  2XQ6 A;  4LF4 T;  2CBI A;  2XQY A;  2QGS A;  3K1S A;  5LGT B;  4UXN B;  2CM0 A;  4JI4 T;  4ILC A;  3O1I A;  3ZYM A;  1Z8U A;  3EI0 A;  4PJL A;  2XAJ B;  5L4H A;  1QSD A;  1EZ3 A;  5HEO A;  3P50 A;  2CPT A;  5JRE A;  1SA0 E;  4DVD A;  3OYZ A;  3N9P A;  5LBQ B;  2H3R A;  3UUX B;  4CI2 B;  4J2C A;  5JRC B;  4L0R A;  1B7T A;  2VAS A;  4CN4 A;  3E22 E;  2WDV A;  4K0K T;  2WCA A;  4ANJ A;  3F2E A;  3TLS A;  2MPK A;  5L3E B;  1ZEE A;  5LBM A;  5HXR A;  1Y01 A;  3I0O A;  3GN5 B;  5ABF A;  1NEK A;  4KHP T;  3U78 A;  3N2G E;  2V26 A;  4G2A A;  4I43 B;  2CBJ A;  4M1P A;  3OPC A;  1FMW A;  3PJA A;  2WZH A;  2CE7 A;  5HXC A;  2WP9 A;  1VCS A;  4HWI B;  1MIV A;  5HYA A;  4YJ3 E;  4ZI3 C;  2B1E A;  1MMD A;  2VB6 A;  1Y64 B;  3PUW F;  2NW8 A;  5L47 A;  1BR1 A;  2BS2 A;  1IBK T;  1OED E;  2LOP A;  2VQE T;  4QXC B;  2ZLY A;  2IHR 1;  2FJE A;  1T98 A;  3CX6 B;  2LSG A;  3CVR A;  4E7Z A;  2IDO B;  2BG9 E;  5ABG A;  3N9N A;  1LVF A;  5LG4 A;  4UEM A;  5J2T E;  4CN1 A;  5HEG A;  2BBH A;  2YDQ A;  3RH3 A;  3ZPO A;  5FXV A;  1VCT A;  2VQF T;  5JQG E;  1HG5 A;  3ZYL A;  4IDN A;  2WS3 A;  1J1J A;  1CHU A;  4Z91 A;  4EAH A;  4OFZ A;  2WDQ A;  2RA1 A;  3NKZ A;  5CB4 E;  4CXY A;  3HR0 A;  5FL0 A;  2W2U A;  3VRA A;  2E8I A;  2X0Y A;  4PJN A;  2YK0 A;  5HXH A;  4UVB B;  1UK5 A;  5F8P A;  3Q5X A;  1UX5 A;  4UR9 A;  2RP4 A;  1Z0P A;  4UVA B;  1HR0 T;  2M67 A;  2QYW A;  2NW7 A;  4ZXL A;  4DR6 T;  2C5J A;  3MXZ A;  4O2B E;  3RGL A;  3T1H T;  4YFS A;  1FMV A;  4G63 A;  3AE4 A;  4ZHQ E;  3LSV A;  2D0U A;  4P0A A;  1N34 T;  4IE7 A;  2IIU A;  1I6Z A;  4U2Z A;  1XNR T;  4KX6 A;  1LRZ A;  4DUY T;  4YTP A;  3ONL C;  5EK2 A;  1M62 A;  2UUC T;  2D5U A;  2Z6E A;  5AQQ B;  5LHI B;  1HCI A;  2KT9 A;  3CX7 B;  4IE6 A;  3ZST A;  4TN7 B;  2E9X D;  2DWG A;  2DNX A;  5JRC A;  4DBQ A;  3UU5 A;  5EK4 A;  3ZYK A;  2H89 A;  3O1J A;  1XMO T;  4TNW A;  4JI8 T;  5L4E A;  5FY0 A;  2UXN B;  2V6X A;  2LSJ A;  3P4P A;  2XZE A;  2XAS B;  1OWA A;  2A3D A;  1IBL T;  3AEF A;  4AQG A;  2XJ7 A;  4KI0 F;  2Y6X A;  1S35 A;  3RIA A;  3GN5 A;  3UU3 A;  4H9N C;  1E7P A;  4LF8 T;  4X62 T;  2K24 A;  1IJ6 A;  3ANW A;  2JQQ A;  3UFE A;  2NTY A;  2K5B B;  1XWM A;  4X65 T;  4KHZ F;  4IGU A;  1N32 T;  1XZY A;  2V6Y B;  3FBZ A;  5DAB A;  2D0T A;  3KV4 A;  4C90 A;  1IZN B;  2IAK A;  4X66 T;  2Y48 B;  2XSB A;  4QXB B;  4DR7 T;  2CXF A;  5AQN B;  1G73 A;  3AVR A;  4KBM B;  3HI2 A;  4LMK A;  3DP7 A;  3RKO A;  4UIG A;  3ZT6 A;  2V1D B;  2EHO B;  2RPA A;  3CIR A;  2H7O A;  3CPZ A;  2MYS A;  2CMR A;  2VKJ A;  3LBX B;  4ZI3 D;  3PDY A;  4E7S A;  2WQY A;  3VKG A;  5C3J A;  4EIW A;  1UUR A;  2ACZ A;  5H6Q B;  4U31 A;  2WWV A;  4H9S E;  3WAK A;  3RC3 A;  4QWN B;  4X64 T;  3RQU A;  4IDZ A;  4XBF B;  3PUV F;  2C0S A;  5L2L A;  4UF0 B;  2XQ9 A;  3OBV E;  5LXT E;  4HWF A;  4DV6 T;  3SS1 A;  5CA0 E;  3BK9 A;  1D1B A;  3RI5 A;  4NIQ A;  5LGU B;  3AE9 A;  4PAG A;  3J7Y q;  4GIW A;  3GMI A;  2M6B A;  3RRW A;  3P8C D;  2JMK A;  2WMO A;  3AEE A;  2XQ8 A;  5ADX L;  1MMA A;  2XSA A;  1YKE B;  2E5V A;  3B57 A;  3F31 A;  5JVD E;  2V7I A;  2CXL A;  4TUY E;  3ZMZ B;  4ZS3 A;  3AE3 A;  3KIN B;  4LFB T;  2IC9 A;  3RYF E;  2XM2 A;  4X1I E;  2IUB A;  3JC6 C;  3TLV A;  4X1Y E;  5C2T A;  4AKG A;  2V7J A;  2N9D A;  4JI2 T;  3AA7 B;  2VK9 A;  2I0M A;  2W00 A;  1T72 A;  1MMN A;  4DO0 A;  3A5X A;  3L3P A;  3TLU A;  1XDO A;  1AJ3 A;  3QNU A;  3N9Q A;  2XTL A;  4O4I E;  5LJN A;  1IAP A;  3NRY A;  2WAU A;  4OYK A;  3FZH B;  2V7L A;  2JMH A;  3I9Y A;  5HEH A;  2BG9 B;  2V7M A;  2DLR A;  3MK7 C;  4PK6 A;  5JDM A;  3QB5 K;  3CQC B;  5J2U E;  4LFA T;  1BR4 A;  3C4Z A;  2X66 A;  4CXW A;  2V6Y A;  2KIN B;  2Q9Q B;  5AQS B;  4B3S T;  4H63 H;  4AKI A;  3KBU A;  1FJG T;  2D2S A;  2WDR A;  4GK5 E;  3RHW A;  1OXZ A;  4H63 V;  3B13 A;  2EHO A;  3ZMS B;  4CZZ B;  3PUS A;  4YHJ A;  4IL4 A;  3GA8 A;  4TWF A;  4DMW A;  3VR9 A;  2YOE A;  3LBX A;  2BBJ A;  4ILB A;  2W0G A;  1KNR A;  2LKH A;  5DQV A;  2IML A;  3ONJ A;  5AQM B;  4JV5 T;  5IYZ E;  3C51 A;  1ZV4 X;  2B76 A;  3NBX X;  5FYM A;  4WW0 A;  3X1D A;  3WAJ A;  1W09 A;  3RX6 A;  4X5T A;  2H7V C;  4UF0 A;  1UUS A;  4EXT A;  5HEJ A;  4P1N A;  4DV4 T;  4JI6 T;  3SFD A;  3PV0 F;  4FI5 A;  3LK4 2;  1XMQ T;  2LE8 A;  4Z8X A;  2UUA T;  3MZK B;  1GQE A;  4O8S A;  2EHO C;  2D9D A;  4U72 A;  5JDN A;  3FB2 A;  2YU2 A;  1WYB A;  3IEE A;  3UUL A;  3N9L A;  4TV8 E;  4NXN T;  2XHE B;  4AQF C;  3EDU A;  4YLH A;  2DI4 A;  1YQ4 A;  1WFD A;  3AE2 A;  5J1G A;  4CN6 A;  4OK0 A;  2NR4 A;  1WR6 A;  4GYS A;  4CI1 B;  4HFV A;  4HKA A;  2MTQ A;  1J5E T;  4PK5 A;  1OED A;  1UCU A;  3ZJ2 A;  2V5D A;  4DV3 T;  3M65 A;  4WNK A;  2AE9 A;  2K48 A;  2LKG A;  4IE5 A;  3UQ4 A;  2BG9 A;  2WB5 A;  5FVL A;  3RQW A;  4ZEY A;  5LP6 E;  4PW8 A;  2CRB A;  1E2A A;  5LGN B;  4A56 A;  2PTF A;  4LF5 T;  5BR8 T;  4O4J E;  2XQ4 A;  3MKD A;  4I0U A;  5HXE A;  3AE8 A;  4EV6 A;  5JDG A;  1KK7 A;  1HG2 A;  3Q5E A;  1W0B A;  2LSK A;  1M7K A;  5LB7 B;  5EK3 A;  4IIJ E;  3RIU A;  2FJA A;  4DID B;  3BQL A;  2MOZ A;  2ZM8 A;  2LT3 A;  4HFD A;  4Q25 A;  4TX5 A;  1WRD A;  1OED C;  2JRK A;  1WR0 A;  2DHR A;  4IT4 A;  3C4W A;  2ODU A;  4JLE A;  2R6G F;  5FVK A;  4QH5 A;  4ZI2 D;  2NWB A;  3UT5 E;  2X67 A;  3AA6 B;  3HKC E;  1XDP A;  4JI3 T;  4BAY B;  5AFU L;  5GON E;  2JJ9 A;  4L9I A;  5FXZ A;  3RF1 A;  1KF6 A;  2LOS A;  3FZF B;  2VVN A;  3G06 A;  3NWI A;  2FUP A;  5L3G B;  5LMU T;  2J62 A;  4I55 E;  1T8B A;  3AXJ B;  2KZ7 B;  2A9U A;  2OLT A;  4HWD A;  2ZM0 A;  4HN9 A;  2KXP B;  4ERR A;  4DR1 T;  1WYC A;  5LMN T; 
#chains in the Genus database with same CATH homology
 2V1D B;  3ZN0 B;  2EHO B;  2XAQ B;  3I9W A;  4H9R C;  3EDV A;  2KWH A;  4ZI2 C;  2H7O A;  3CPZ A;  2MYS A;  3DTO A;  5JDF A;  2J1D G;  2CMR A;  2VKJ A;  4H9Q C;  3LBX B;  4PNI A;  4ZI3 D;  3PDY A;  3I0Q A;  4JEH B;  3KBT A;  4X20 E;  5BMV E;  4AI6 A;  4PFO A;  4E7S A;  2HPL A;  3ONX A;  3VKG A;  2G0U A;  3LK2 B;  1HFA A;  4EIW A;  3O1H A;  4IST A;  2CLY B;  3GWH A;  4AKH A;  4KP3 C;  1HX8 A;  3PUA A;  3H3A A;  4HEA A;  2LM9 A;  3O9X A;  5JR9 B;  5H6Q B;  4H9S E;  3IF8 B;  3WAK A;  4I50 E;  3RC3 A;  4QWN B;  2KLQ A;  2PG8 A;  4IDZ A;  3FXD B;  4XZC A;  5LCY A;  4XBF B;  2Q9Q A;  1NWM X;  2C0S A;  2WWU A;  3JC6 D;  3H37 A;  1H7C A;  3EVY A;  5L2L A;  4ISS A;  3OKQ A;  5HWY A;  5HXS A;  2KND A;  5L3C B;  3V5S A;  1U4Q A;  4UF0 B;  2WM9 A;  3K3O A;  3ZMV B;  2DCF A;  1IJ5 A;  3OBV E;  2C5I T;  1MND A;  4PK4 A;  5E0O A;  5LXT E;  5LOV E;  3FHN A;  3SS1 A;  5CA0 E;  3BK9 A;  1D1B A;  5ETW A;  3NRX A;  3HKE E;  3MA9 A;  4ZOL E;  1YD8 G;  5LGU B;  4ZI7 E;  2NP9 A;  3F57 A;  4GK0 E;  3TKL B;  4B6X A;  5CA1 E;  4PAG A;  3N9M A;  3J7Y q;  3OYX A;  4GIW A;  3GMI A;  4HE8 A;  3RRW A;  4AQF A;  2YEV C;  3P8C D;  2A72 A;  2WMN A;  3ANW B;  2JMK A;  2WMO A;  3AAE B;  3NZP A;  5LHG B;  3BQK A;  5TAO A;  3ZN1 B;  4UV8 B;  5FY7 A;  5HAX A;  4EB6 E;  5ADX L;  3QC9 A;  1MMA A;  3MAC A;  2PJQ A;  1YKE B;  3FBL A;  2DWK A;  5FMN A;  3D0T A;  3B57 A;  3F31 A;  5JVD E;  4BJN A;  2V7I A;  2CXL A;  5L3D B;  4TUY E;  4FJO A;  2BZB A;  2NTX A;  3HKB E;  3ZMZ B;  4ZS3 A;  5IHY A;  3CQX C;  5FNV E;  3KIN B;  4ILU A;  4AXP A;  2IC9 A;  4IE4 A;  3Q9D A;  3CML A;  3RPU A;  5FY1 A;  3RYF E;  4CI3 B;  3PTR B;  3KVB A;  4X1I E;  3N2K E;  5A1L A;  5LJM A;  1US7 B;  3O4X E;  3JC6 C;  2LSY A;  4V1A v;  3CX8 B;  4MFR A;  4X1Y E;  2VL8 A;  3KDS E;  2E9X C;  2Q9Q C;  1ZHC A;  4CXX A;  1BR0 A;  1HF8 A;  4EYU A;  5KX5 E;  3PUG A;  4AKG A;  2V7J A;  3ESL A;  2N9D A;  4I4T E;  3AA7 B;  3HA4 A;  2VK9 A;  2W00 A;  1HS7 A;  2VKO A;  4ASK A;  4CQI A;  1MMN A;  2X9Y A;  1LVK A;  2LEH A;  4DO0 A;  3A5X A;  4YJ2 E;  3L3P A;  4GOU A;  4IHJ E;  1FIO A;  2UXX B;  4K0U A;  4NUV A;  3L09 A;  4EZ4 A;  1AJ3 A;  2XQY A;  2QGS A;  3N9Q A;  2XTL A;  4O4I E;  5LJN A;  1IAP A;  3NRY A;  1D0X A;  1E1H B;  2WAU A;  4OYK A;  4UXN B;  5EZY E;  3VHL A;  5LGT B;  1VRB A;  5H6R B;  2CM0 A;  3ZC0 A;  2V7L A;  2JMH A;  3I9Y A;  3C50 A;  3O1I A;  3ZYM A;  3QK6 A;  2V7M A;  2DLR A;  4QX7 B;  3MK7 C;  4JEU B;  4PK6 A;  4PJL A;  2KMF A;  2XAJ B;  2BVL A;  5JDM A;  3CQC B;  5J2U E;  3KV5 A;  2L3L A;  2YIN A;  1QSD A;  1BR4 A;  5JDH A;  1EZ3 A;  3C4Z A;  1VOM A;  4P0B A;  3U3I A;  2X66 A;  4PJM A;  3LJC A;  4KMC A;  4CXW A;  3C4X A;  5C8Y E;  5JRE A;  2KIN B;  1SA0 E;  4DVD A;  3OYZ A;  2E9X B;  2Q9Q B;  4MLK A;  2C5K T;  4F6R C;  3N9P A;  4H63 H;  2N2N A;  1HTJ F;  5LBQ B;  4WBO A;  4AKI A;  2H3R A;  3WI3 A;  3UUX B;  3KBU A;  4CI2 B;  4J2C A;  5JRC B;  2W61 A;  2CWY A;  3DJB A;  2D2S A;  1D0Y A;  4L0R A;  4WBN E;  4DMV A;  5L3F B;  2X68 A;  1B7T A;  2VAS A;  3LG7 A;  4GK5 E;  4L5G A;  3J9X 1;  3E22 E;  3KVA A;  2IW5 B;  3KFW X;  1OXZ A;  4ANJ A;  3F2E A;  1D1C A;  2NW9 A;  5L3E B;  4AKL A;  5KMG P;  3EUH A;  1ZEE A;  2ZMA A;  4H63 V;  5LBM A;  5F3J A;  3HL6 A;  5M4Y A;  5HXR A;  3B13 A;  2EHO A;  3ZMS B;  4CZZ B;  1UX4 A;  3PUS A;  4N78 D;  3ZC1 A;  4YHJ A;  3GA8 A;  4DMW A;  3E08 A;  3I0O A;  3GN5 B;  2EHO D;  4EYY R;  3LBX A;  1QUU A;  3U78 A;  4UVC B;  1ZKE A;  3N2G E;  2ZM2 A;  2V26 A;  4G2A A;  4I43 B;  4M1P A;  1FMW A;  3ETV A;  2W0G A;  3VKH A;  4H9O C;  2CE7 A;  5HXC A;  4NUU A;  5DQV A;  1MIV A;  5HYA A;  4U74 A;  4YJ3 E;  4UV9 B;  4ZI3 C;  5JR9 A;  2B1E A;  5IYZ E;  3C51 A;  4XAX B;  2L9Q A;  3RC8 A;  2K9A A;  1MMD A;  1ZV4 X;  2IC6 A;  2VB6 A;  1Y64 B;  3NBX X;  5FYM A;  2JPF A;  1LKX A;  2OA5 A;  4WW0 A;  2NW8 A;  3WAJ A;  3OJA A;  3RX6 A;  1BR1 A;  2LOP A;  3PE0 A;  2H7V C;  5L3B B;  1MMG A;  4UF0 A;  4QXC B;  2NOX A;  3IHR A;  3K3N A;  2ZLY A;  3AVS A;  4EXT A;  3T8O A;  3N2O A;  4H9P C;  1YW0 A;  1T98 A;  3C64 A;  3N5L A;  3CX6 B;  4QXH B;  2LSG A;  4FI5 A;  5DJQ C;  5JDL A;  5JDQ A;  3CVR A;  4E7Z A;  5LA6 E;  3LK4 2;  2LE8 A;  4Z8X A;  3N9N A;  1LVF A;  2L8K A;  3R6N A;  3MZK B;  5LG4 A;  5LHH B;  4UEM A;  1MIY A;  2X51 A;  1D0Z A;  5J2T E;  4EOZ B;  4O8S A;  3SOL A;  2PFV A;  2W62 A;  2BVM A;  3RH3 A;  3ZPO A;  5FXV A;  2EHO C;  2X9W A;  2VKH A;  5JQG E;  4U72 A;  2A2F X;  2X9H A;  1HG5 A;  3I1A A;  3ZYL A;  3FB2 A;  5JDN A;  2YU2 A;  1WYB A;  3W15 B;  3ZCJ A;  3KV6 A;  2X9X A;  3QUJ A;  3ZMU B;  3ZMT B;  3IEE A;  3UUL A;  3N9L A;  4TV8 E;  3RYC E;  1KNZ A;  5JH7 E;  2XHE B;  3CQG B;  4EAH A;  5LNK A;  4OFZ A;  2ODV A;  2CLY C;  3E0Z A;  2RA1 A;  3EDU A;  4AQF C;  5CB4 E;  3RRC A;  4YLH A;  2BDE A;  2XAF B;  4CXY A;  3RYH E;  2DI4 A;  3HR0 A;  2PBI A;  5J1G A;  4QX8 B;  5FXW A;  2E8I A;  4PJN A;  2YK0 A;  4OK0 A;  1WR6 A;  4GYS A;  5HXH A;  4UVB B;  4CI1 B;  2Y8D A;  4HFV A;  5F8P A;  1NAF A;  2YU1 A;  4HKA A;  3AB3 B;  4PJJ A;  3V5U A;  3ZEF B;  2HH7 A;  3Q5X A;  2MTQ A;  1D1A A;  4PK5 A;  1MNE A;  1UX5 A;  2RP4 A;  1Z0P A;  4UVA B;  1UCU A;  3ZJ2 A;  3ZCI A;  2XUE A;  2LSI A;  2M67 A;  5HWX A;  3M65 A;  1MIW A;  4WNK A;  4TV9 E;  2NW7 A;  4TZ4 C;  2K48 A;  3ZJ1 A;  1U5P A;  3UUN A;  2C5J A;  3MXZ A;  4O2B E;  4HTE A;  4C91 A;  4IE5 A;  3ETU A;  4UEL A;  4YFS A;  1FMV A;  2W63 A;  4G63 A;  2XAG B;  3CWZ B;  4BA9 A;  2CCQ A;  1CUN A;  4ZHQ E;  5LP6 E;  2D0U A;  2QA7 A;  2X0L B;  4PW8 A;  4P0A A;  4IE7 A;  2I59 A;  3NZQ A;  4DND A;  3AAA B;  2XAH B;  5LGN B;  4A56 A;  1LRZ A;  4JUY A;  5EK2 A;  2D5U A;  1FEW A;  3KV9 A;  4O4J E;  2E9X A;  5FXX A;  4MAL A;  2Z6E A;  3LFM A;  3MKD A;  3R84 B;  1HCI A;  5LHI B;  2KT9 A;  3CX7 B;  5HXE A;  4IE6 A;  2ACX A;  4QHO A;  4ADZ A;  4TN7 B;  4O4L E;  2E9X D;  2Q9Q D;  5JDG A;  4GYR A;  2DWG A;  2DNX A;  5JRC A;  1KK7 A;  1HG2 A;  3PUR A;  4DBQ A;  2CXD A;  1G8X A;  3AA0 B;  2LSK A;  1X79 A;  4IE0 A;  5EK4 A;  3ZYK A;  3BQI A;  3Q5W A;  4KUM B;  3PU3 A;  3O1J A;  3ZLI A;  5EK3 A;  3LK3 B;  4HGA A;  4PFP A;  4IIJ E;  2UXN B;  4OYJ A;  5FY0 A;  2LSJ A;  3BQL A;  3AAI A;  2MOZ A;  2ZM8 A;  2LT3 A;  4TX5 A;  4P09 A;  4O4H E;  4AKR B;  1BR2 A;  2XAS B;  1OWA A;  4X1K E;  2A3D A;  4AQG A;  1WRD A;  2SPC A;  3K8P C;  2JRK A;  2V7K A;  2Y6X A;  2DHR A;  2GK9 A;  3MJX A;  4DBR A;  4ZS2 A;  3C4W A;  2ODU A;  3SRZ A;  4BJM A;  1S35 A;  2P9B A;  3GN5 A;  4JLE A;  2VKD A;  5LYJ E;  3IBP A;  2ES0 A;  2VWA A;  4EZH A;  3S4U A;  4H9N C;  4MBQ A;  3Q2M A;  5FP3 A;  5DQW A;  2MBG A;  4ZI2 D;  2NWB A;  3UUM A;  1O3X A;  3UT5 E;  2X67 A;  2HPJ A;  2K24 A;  3AA6 B;  3HKC E;  3SWH A;  3HKD E;  4MHC A;  4BAY B;  1IJ6 A;  2WSS V;  2KWI B;  1SHZ C;  3ANW A;  2JQQ A;  3RYI E;  2LHN A;  1S94 A;  3UFE A;  2NTY A;  5AFU L;  5GON E;  2JJ9 A;  4L9I A;  3C98 B;  2LJL A;  2K5B B;  5FXZ A;  1V9D A;  2LOS A;  4IGU A;  3FXE B;  3VU7 H;  1YKH B;  3N9O A;  3FBZ A;  4QKN A;  4O2A E;  5DAB A;  5L3G B;  2N1G A;  2CEA A;  2D0T A;  3KV4 A;  4C90 A;  4I55 E;  1IZN B;  4OHF A;  3P7I A;  2IAK A;  2CA5 A;  3CKD A;  5KDM C;  2KZ7 B;  3PU8 A;  2Y48 B;  5JR9 C;  3PUQ A;  4QXB B;  3K3Q C;  2CWO A;  2CXF A;  1G73 A;  2ZM0 A;  3AVR A;  4HN9 A;  3HI2 A;  4KBM B;  3DP7 A;  1WLX A;  2KXP B;  4ERR A;  2WBL A;  1WYC A;  3UTK A;  2LHR A;  3AA1 B;  3RKO A;  4UIG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...