3VU7H

Crystal structure of rev1-rev7-rev3 ternary complex
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
94
structure length
94
Chain Sequence
PNLAGAVEFNDVKTLLREWITTISDPMEEDILQVVKYCTDLIEEKDLEKLDLVIKYMKRLMQQSVESVWNMAFDFILDNVQVVLQQTYGSTLKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA repair protein REV1
publication title Structural basis of recruitment of DNA polymerase [zeta] by interaction between REV1 and REV7 proteins
pubmed doi rcsb
source organism Homo sapiens
molecule tags Replication
total genus 31
structure length 94
sequence length 94
ec nomenclature
pdb deposition date 2012-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF16727 REV1_C DNA repair protein REV1 C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1280 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3vu7H00
2LSJA 2LSIA 2LSYA 2N1GA 4EXTA 2LSGA 4GK0E 2LSKA 3VU7H 4FJOA 4BA9A 4GK5E
chains in the Genus database with same CATH superfamily
4MFRA 4EYYR 4JI8T 5LHIB 5HCJA 4JI7T 3O1HA 4IDOA 3KINB 5HXHA 3ZN1B 2Q9QA 2V1DB 4HWHA 2YOEA 3N9PA 1HF8A 3ZC1A 3BQIA 5L47A 4MALA 3H37A 4U2ZA 4X64T 2R6GF 3M3ZB 4HFBA 1YQ3A 5JDHA 4LF4T 4DMWA 4DR2T 2HN1A 3HL6A 1G73A 2XQ3A 4YTNA 3UUMA 3PU3A 2XUEA 2LSGA 5HCMA 1IBLT 2IC6A 3GMIA 3OVUA 3KV4A 2BVLA 4Z90A 4ZI7E 3AE6A 4IL4A 4YY3T 3QUJA 2V5CA 2VQFT 4QHOA 5E0OA 4PJNA 2XQ8A 2NW8A 3KBUA 3R84B 1WR6A 2A2FX 3QNUA 3SWHA 3F57A 2WZHA 3FXEB 2NOXA 4O8SA 1H7CA 2LM9A 2Y8DA 1IAPA 2D2SA 5LMUT 3FZLB 3N2KE 4ZOLE 4U7IA 3KDSE 2IHR1 3H3AA 2K9AA 4QX7B 4F8HA 4HFIA 5LG3A 3Q2MA 1UUSA 1FJGT 4AKHA 2LHNA 3N9NA 1ZHCA 4IDQA 1VCSA 4H9RC 2VB6A 5AQPB 1UGOA 4UELA 3M65A 1ZKEA 4Q25A 3RI5A 2UUAT 1BR0A 5C3JA 1KNPA 2UUCT 3B5MA 4ASKA 2IDOB 5AQFB 1D0ZA 5DJQC 4NXMT 1O3XA 1OXZA 2VL8A 1IZNB 2YKSA 5HYAA 4U72A 4HFCA 1SA0E 5JR9B 4LF8T 5LGNB 2YDSA 5LHHB 3I9YA 3RLFF 4O2AE 3L8RA 1JNRA 2VVSA 2C5JA 3LBXA 3JC6D 4JI2T 3AA7B 4TX5A 2B1EA 1WLXA 3FZFB 2V26A 4L5GA 1X9BA 4X5TA 4DBQA 1M62A 2F4VT 2VKDA 2QGSA 2BBHA 1FEWA 3RQUA 3N2GE 3I0QA 4X65T 3BQKA 5LXTE 3UT5E 4GKKT 3MXZA 5AQLB 5AQOB 1IJ6A 2D0UA 2H7VC 5L3GB 4HFEA 3EHZA 3TLTA 2P9BA 4AKGA 2JIWA 2YDQA 4YT0A 4NUUA 3ZMSB 4U74A 4WBNE 4ISSA 1W0AA 2JRKA 2V6YB 1WCRA 1FIOA 2XHEB 3NRYA 2C0SA 3CKDA 4ZI2C 4HKAA 4A97A 2MTQA 4TZ4C 2WDVA 4EV6A 2XQ4A 4DBRA 2LRKA 4HFVA 2BDEA 2DLRA 2VK9A 3CMLA 1SHZC 5FVKA 2C5IT 1G8XA 5HEOA 1SUMB 4HEAA 4O2BE 2Q9QC 3UU5A 4IE5A 3N9LA 4BJMA 4QH1A 1LKXA 3AE5A 2WZIA 3CVRA 2JQKA 3NWIA 2X51A 1D0XA 3IA3A 2JMHA 2X66A 4GIWA 4GOUA 4EAHA 4EYUA 3ZMVB 2WAUA 2QRXA 2A72A 4ZI3C 2VQET 5FL1A 5HEJA 3DJBA 5FYMA 1XDPA 3ZN0B 1W09A 1HS7A 5J0ZA 5LCYA 1XMOT 5JR9A 1T7SA 3EABA 4BAYB 1VOMA 3RRCA 4FJOA 5H6QB 2V8SV 3B13A 4AKIA 3I9WA 2X9XA 2J1DG 3HKDE 2IMLA 2W66A 1YXRA 4P09A 5J1GA 1W9RA 2L3LA 2UXCT 3OJAA 1BR4A 3VHLA 3JC6C 3HI2A 3TLVA 1HNWT 2LOPA 2Q9QB 3K3OA 4PK5A 4HTEA 5FVLA 1WYCA 3PE0A 5HWYA 2BKOA 3AEGA 5LOVE 2CMRA 4F6RC 2BKNA 1QSDA 5FXWA 4YHJA 4DR1T 5LP6E 3RC3A 5J2TE 1QLBA 2ZLYA 5EK2A 3J7Yq 2OLTA 4AQYT 3RIUA 3GN5A 2CXFA 2XASB 2XZEA 2KWIB 2D9DA 5HEGA 2IAKA 3PUWF 3UU4A 2QVAA 3K1SA 3NBXX 3C50A 4QWNB 3N9QA 2X0YA 2ZM0A 3MK7C 3AE9A 2DL1A 2W67A 4DUZT 2WCAA 3NKZA 5CA1E 1S35A 5JDNA 5FKYA 5BR8T 5LA6E 3CIRA 2CXLA 1CHUA 2XQYA 4IGUA 3AA1B 4KP3C 5L3CB 1KNZA 1E7PA 2VVNA 1KEYA 4IDZA 2K5BB 4U31A 1NAFA 2C5KT 3UUNA 4H9SE 2VKHA 3R6NA 4A98A 2XAJB 1HG5A 4JEUB 5F3JA 2BBJA 3ZPOA 4DV4T 1E2AA 4WW0A 5JREA 4PW8A 3LK42 4PJMA 2WP9A 3EI0A 1BR2A 1SE7A 2J62A 3P8CD 2W62A 2XAQB 3H3MA 2FBWA 5IWAT 4LF6T 4TWDA 5LJNA 4AISA 2HPJA 4JI1T 3ZSSA 3P4PA 2W61A 2CPTA 4DO0A 4WYVA 1YKEB 3VKHA 4B6XA 3LBXB 3KFWX 4OK0A 1JNZA 3AB3B 4E7ZA 4P1NA 3U3IA 2E2AA 4O4HE 5FY7A 3RYFE 4G63A 3ONJA 3Q5EA 4WNKA 2W63A 5LG4A 2VKJA 1FMVA 2IC9A 4ILBA 2H3RA 2UUBT 3ETVA 3ZLIA 4GKJT 4BJNA 1N34T 5JH7E 1Y01A 5L2LA 3SOLA 2CBIA 5JDFA 4ZZBA 1EZ3A 3PTRB 4DR6T 2I59A 5AQHB 4OX9T 2BS2A 3N2OA 3QOFA 4EB6E 2N1GA 3OKQA 5DQWA 3UUBA 4PK6A 4DR5T 5DABA 2H7OA 4H63H 4XAXB 3PV0F 1D1BA 2QYWA 3AE7A 4LF5T 2EHOA 4GYRA 5FMNA 5AQJB 2V7LA 4K0KT 4PJLA 1HTJF 4ANJA 3AVRA 5CJ5A 3ONLC 5JR9C 4L0RA 3TKLB 2G0UA 3MJXA 4QX8B 2LEHA 4LMJA 2A3DA 5L4HA 3K3QC 2NW9A 2OV9A 3L3PA 3VR9A 3N5LA 2XJ7A 2X9YA 4H63V 3AAEB 3U78A 2X0LB 4I0UA 1MMGA 4UF0B 5ABEA 2LSJA 4YFSA 2CWOA 4IE0A 2FUPA 1Z8UA 2YINA 3AEFA 3DP7A 4IE6A 2V7KA 4TNWA 2XQ6A 1D1CA 2D5UA 2KZ7B 2WDQA 3A8YC 3FXDB 4IDPA 3S4UA 4YSXA 2BKPA 3RKGA 2BG9A 4LFBT 1KK7A 4BA9A 4CI1B 3RIUC 2CA5A 4UVCB 2W4XA 3A5XA 2NR4A 1I94T 5ABGA 4ADZA 2WBLA 2WSSV 2VL0A 2M6BA 2LSYA 4EEDA 1OEDE 4LMKA 3BQLA 3QB5K 2YDRA 2AE9A 4A5XA 2LRLA 4PFPA 3ZYKA 3LJCA 2PG8A 5AQTB 5LYJE 2V7IA 2FJBA 2HHHT 5AQNB 4DR7T 2EHOD 2DHRA 2KINB 3L09A 5IUXA 4HE8A 2DWGA 1HG2A 2KMFA 4LFAT 1UK5A 3P4RA 3G06A 1CUNA 2FJAA 2CBJA 4DNDA 3HR0A 1KF6A 5JDLA 4GK0E 3ZMTB 1MMNA 3P4WA 4ERRA 4QXHB 5FY1A 3C4WA 4X1YE 3PJAA 3MKDA 5L3DB 4XZCA 2E9XD 3GN5B 3PUQA 5TAOA 5JRCB 4H9QC 1J1JA 5HWXA 4EIWA 3RHWA 3WAKA 2UXDT 4IREA 4HWIB 2XY8B 3ZCJA 3EAMA 3MZKB 2BS3A 2WWUA 1D0YA 4IHJE 4UR9A 3C4ZA 3D0TA 3LG7A 3TLSA 2WU5A 2XQ5A 2LLYA 2WU2A 3UQ4A 5AQSB 3AE2A 3O1JA 1U4QA 2LKGA 4AKRB 3I0OA 4IIJE 4EGWA 2ZM6T 3Q5DA 1XNQT 4PAGA 1U5PA 4CZZB 2K24A 2XPKA 3E08A 4UF0A 4OYKA 2CCQA 1J5ET 2ODVA 1B7TA 2XM1A 2BS4A 4PK4A 3C98B 3AECA 3RX6A 2N9DA 3B57A 4KUMB 2KWHA 4UVAB 2MBGA 4CN6A 2DCFA 4G2AA 3FBZA 1N32T 3CX7B 3FB2A 3VKGA 4DV5T 2WS3A 3RGLA 4YLHA 4E7SA 2YN6A 3KV6A 4L9IA 2BG9E 4MLKA 5JQGE 1Z0PA 3V5UA 3KV5A 4PFOA 4WBOA 3GA8A 3P50A 1HR0T 1OEDB 5HXRA 2YU2A 2XQ9A 5KX5E 1ZOYA 4NIQA 3IF8B 4CI2B 4X66T 4CQIA 3ZJ1A 3UUXB 5DQVA 2H89A 3UULA 3AE8A 4XBFB 3P7IA 1NENA 3CQCB 2X9WA 4DVDA 4DV7T 5H6RB 3SRZA 4AQFA 5JDMA 3PUZF 3QB5A 3AVSA 2V7JA 4P0AA 5J2UE 4O4LE 3OYXA 3ZC0A 2XAFB 4O4JE 3AEDA 1MIYA 3CPZA 2ZMAA 4YXDA 2M6IA 2W2UA 2K3WA 5LGTB 5JRCA 3AE3A 1HNZT 1R8IA 3K8PC 4KMCA 3J9X1 1S94A 3AA0B 4TUYE 5CGMA 2X68A 5CFBA 3FZMB 2CXDA 2VKOA 2WY2A 3KVAA 2BG9C 3PDYA 2KLQA 5L3BB 2EHOB 4HFDA 5AFUL 4C91A 4DV2T 2J47A 3L39A 5LB7B 1UCUA 4TNVA 2XAGB 2OA5A 5HXEA 4IE7A 1N36T 4LF7T 5LJMA 5HXSA 5LNKA 1Y64B 2VASA 4OHFA 5FL0A 3SFEA 4CN4A 5HXCA 3ZMZB 1N33T 2E9XB 4QXCB 5ETWA 4X1IE 5FY0A 5KXJA 2W00A 5FNVE 2Y48B 4P0BA 3ZYMA 1XDOA 4ZHQE 2LSIA 3ZCIA 4HWFA 4PNIA 4JBWF 3RH3A 2CLYB 2BG9B 4UXNB 3PUVF 2NWBA 1T8BA 2E5LT 1OEDA 3GWHA 5HEUA 4TWHA 2JQHA 4KBMB 2VWAA 1VCTA 4J2CA 4AXPA 3PURA 1J5WA 1WR0A 3UU8A 3ZEFB 4EOZB 3ANWB 4YTPA 2LE8A 2HN2A 3AEBA 3PUAA 2HH7A 2KSRA 1E1HB 3OYZA 2JQQA 2I6HA 2XAHB 3CX8B 3ABVA 3NZPA 2BZBA 2XQAA 4CXWA 4IE4A 5LBMA 2UXXB 2DWKA 1MMDA 3RKOA 5HAXA 3QC9A 5BMVE 3VRAA 2KNDA 4MHCA 5L4EA 2CWYA 2X67A 4C90A 5ADXL 1HFAA 2VURA 2ZM2A 3HKBE 5GONE 4JI0T 2CEAA 4CN1A 3RRWA 1W0BA 1DU2A 1KFYA 3FZKB 3ZSTA 2V6XA 4H9NC 3VRBA 3PJAJ 3WAJA 4IT4A 4JI3T 3TLWA 4M1PA 5FP3A 4EZHA 3ZYLA 3P4QA 3C64A 4HN9A 2ACZA 5ABFA 1MIVA 5FXVA 2LKHA 3Q5XA 4JV5T 4X20E 1LVKA 2XM2A 4PJJA 1X79A 1XNRT 2NP9A 4Z8XA 3AEAA 4ZI2D 3CX6B 2ODUA 5AQRB 1MNDA 1WYBA 5EZYE 3OPCA 2NTXA 2XSBA 3MACA 4OFZA 2DI4A 3CWZB 5LGUB 2E9XA 2CE7A 4JYAT 4ILCA 4MBQA 2JQ9A 3RYHE 3E0ZA 3UU3A 4DIDB 4AQFC 3A7MA 2Q9QD 1LRZA 3VU7H 1MIWA 3RIFA 4U7YA 4IL9A 4OYJA 5F8PA 2JPFA 3UTKA 1M7KA 3JCFA 4YHHT 4KHZF 4DMVA 3T1HT 3ONXA 1HX1B 1V9DA 3Q5WA 4QH5A 4ZI3D 5AQMB 2FJEA 4H9PC 2XQ7A 1BR1A 4YSZA 3X1DA 1ZEEA 3LFMA 2W0GA 4B3TT 3AXJA 3ZT5A 4KHPT 3TLUA 2RP4A 4NXNT 3HA4A 3AAIA 5AQIB 3SFDA 3ANWA 1HNXT 1YKHB 2BVMA 3P4SA 4DUYT 2ACXA 4B3ST 5ABHA 1YD8G 2FJDA 1YQ4A 4DV0T 3PU8A 3PUYF 3C4XA 3CQGB 4UVBB 3KVBA 3EUHA 2CRBA 2N2NA 2UU9T 1XWMA 2B76A 2Z6EA 2V5DA 3LK3B 2NW7A 2LSKA 5HEHA 4ISTA 5LHGB 4I50E 2XTLA 1WFDA 5CA0E 3NRXA 2HPLA 3F31A 2RPAA 4ZZCA 2WMOA 5LBQB 2I0MA 4DV1T 5EK4A 1GQEA 4KI0F 5KDMC 5AQGB 3O9XA 3FZHB 2E8IA 3SS1A 5AQUB 3O1IA 5AQQB 2XSAA 3N9OA 2LHRA 4U3CA 1KNRA 3HKCE 2JMKA 4QH4A 2QA7A 4UV8B 2L9QA 3LSVA 2PJQA 2ES0A 1I6ZA 1ZP0A 3EDUA 1OEDC 2NTYA 1HX8A 4X62T 1FMWA 4QKNA 2LOSA 4O4IE 5FXXA 4UV9B 3RPUA 1ZV4X 1UURA 4DR3T 3AE4A 4KX6A 3VR8A 3BK9A 1VRBA 5CB4E 4U2YA 2MPKA 2WDRA 2YEVC 3MA9A 4UEMA 4DV6T 5LMNT 4ZS2A 2ZM8A 2LT3A 5AQVB 5JDQA 3T1YT 2SPCA 4HWCA 2IW5B 3EDVA 2IUBA 3FBLA 3KBTA 5L3FB 2UXBT 3PUXF 2MOZA 4AIUA 4TN7B 4AI6A 4COFA 1XZYA 1HCIA 4JI6T 2H88A 4U33A 4B3RT 4TWFA 3JAEA 3RQWA 2LM2A 3Q9DA 4B3MT 3E22E 1YW0A 5KMGP 4TV8E 2JJ9A 2YK0A 3JADA 5C2TA 3DTOA 3HKEE 3K3NA 2DNXA 2YU1A 2PTFA 4ZS3A 3W15B 2EHOC 4FI5A 1UX5A 2V7MA 2WM9A 5EK3A 4Z91A 1XMQT 4CXXA 2WB5A 3RF1A 3N9MA 3PUSA 2CM0A 3WI3A 1LVFA 4DR4T 3OBVE 2KT9A 3NVOA 4YSYA 2X9HA 2E5VA 4NUVA 3ESLA 4WZXA 1D1AA 4X1KE 2CHNA 1US7B 2E9XC 5FXZA 4NPPA 2PFVA 4DV3T 3IEEA 3JAFA 4ZXLA 5M4YA 4HGAA 4JI5T 3CQXC 5IYZE 4JUYA 3NZQA 3ZT6A 4IDNA 2LJLA 3ETUA 3F2EA 3UU6A 3ZKRA 5AQKB 4HWDA 2WQYA 4EXTA 5F5WA 4LFCT 4I55E 4AQGA 2CLYC 4H9OC 3V5SA 4EZ4A 4K0UA 3AEEA 1IBMT 2V6YA 3UFEA 4EEBA 4TV9E 2D0TA 1OWAA 2J4GA 2PBIA 5JVDE 3IBPA 5ABFB 2A9UA 4I4TE 4JI4T 5A1LA 4A56A 3QK6A 3RYCE 4N78D 2M67A 1T98A 5C8YE 4UIGA 3O4XE 5L3EB 3UQ7A 3UFGA 4JEHB 4GK5E 4LF9T 3KV9A 3ZJ2A 3OTOT 1NEKA 4ZEYA 1T72A 2AXDS 3RIAA 2GK9A 3AA6B 2RA1A 4CI3B 2X0HA 5JTGA 1UX4A 3I1AA 4I43B 3EVYA 4YTMA 2L8KA 3AE1A 4LMLA 1WRDA 3RYIE 5JDGA 1IJ5A 3ZT7A 2Y6XA 2K48A 1AJ3A 4GYSA 3C51A 2MYSA 4AKLA 3AAAB 2WMNA 4CXYA 2MAWA 4V1Av 3ZMUB 4YJ2E 3LK2B 4HFHA 4ILUA 1MMAA 4YJ3E 2KXPB 3PUGA 2WWVA 3RC8A 2CHOA 3T8OA 3LDQB 5IHYA 4JLEA 3FHNA 1L0VA 1QUUA 3AXJB 1NWMX 4QXBB 3IHRA 1MNEA 2UXNB 1IBKT 3CK6A 2IIUA 4ILAA
chains in the Genus database with same CATH topology
4MFRA 4OYJA 5F8PA 2JPFA 4EYYR 4AKRB 3UTKA 5LHIB 3I0OA 4IIJE 2KWIB 2IAKA 3O1HA 3KINB 5HXHA 3ZN1B 4PAGA 2Q9QA 1U5PA 4DMVA 3ONXA 4CZZB 2K24A 2V1DB 3E08A 1V9DA 3NBXX 3Q5WA 4ZI3D 3C50A 3N9PA 4UF0A 1HF8A 3ZC1A 4QWNB 3N9QA 4H9PC 4OYKA 2ZM0A 2CCQA 1BR1A 2ODVA 3MK7C 3BQIA 4MALA 1B7TA 1ZEEA 3LFMA 2W0GA 3H37A 4PK4A 3C98B 3RX6A 2RP4A 5CA1E 1S35A 5JDNA 2N9DA 3B57A 4KUMB 2KWHA 4UVAB 3HA4A 3AAIA 5LA6E 2MBGA 3ANWA 2CXLA 1YKHB 2DCFA 2XQYA 4G2AA 5JDHA 2BVMA 2ACXA 3FBZA 4DMWA 4IGUA 3AA1B 3CX7B 1YD8G 3FB2A 3HL6A 4KP3C 3PU8A 5L3CB 1KNZA 3VKGA 1G73A 3UUMA 3PU3A 2XUEA 4YLHA 2LSGA 4E7SA 2IC6A 3GMIA 3C4XA 3KV4A 2BVLA 3CQGB 4UVBB 4ZI7E 3KVBA 3QUJA 3EUHA 3KV6A 4QHOA 4L9IA 2N2NA 4MLKA 5JQGE 1Z0PA 5E0OA 4PJNA 3V5UA 3KV5A 4IDZA 4PFOA 2K5BB 4WBOA 3GA8A 2Z6EA 1NAFA 5HXRA 2C5KT 3LK3B 2NW8A 3KBUA 2YU2A 3R84B 3UUNA 1WR6A 2NW7A 2A2FX 2LSKA 4H9SE 5KX5E 2VKHA 3R6NA 4ISTA 5LHGB 4I50E 3SWHA 2XAJB 1HG5A 3F57A 4JEUB 2XTLA 3IF8B 5CA0E 5F3JA 3FXEB 2NOXA 3NRXA 2HPLA 4O8SA 3ZPOA 4CI2B 1H7CA 3F31A 4CQIA 2WMOA 2LM9A 5LBQB 3ZJ1A 3UUXB 5DQVA 4WW0A 2Y8DA 3UULA 4XBFB 3P7IA 3CQCB 1IAPA 2D2SA 5EK4A 2X9WA 4DVDA 3N2KE 5KDMC 4ZOLE 3O9XA 2E8IA 5JREA 5H6RB 4PW8A 3LK42 3KDSE 4PJMA 3SRZA 3SS1A 4AQFA 5JDMA 3O1IA 3AVSA 3H3AA 1BR2A 2V7JA 3N9OA 4P0AA 5J2UE 2K9AA 4QX7B 4O4LE 2LHRA 3OYXA 3ZC0A 3HKCE 2XAFB 4O4JE 3P8CD 2JMKA 2W62A 1MIYA 3CPZA 2QA7A 2XAQB 4UV8B 2ZMAA 2L9QA 2PJQA 2ES0A 3Q2MA 3EDUA 5LJNA 5LGTB 2NTYA 2HPJA 5JRCA 1HX8A 4AKHA 2LHNA 3N9NA 1ZHCA 2W61A 1FMWA 4QKNA 2LOSA 4H9RC 4DO0A 3K8PC 2VB6A 4O4IE 5FXXA 4UV9B 3RPUA 1ZV4X 4UELA 1YKEB 3VKHA 3M65A 4KMCA 4B6XA 3LBXB 3J9X1 1S94A 1ZKEA 3KFWX 4OK0A 3AA0B 1BR0A 3AB3B 3BK9A 4TUYE 1VRBA 4E7ZA 2X68A 5CB4E 3U3IA 2YEVC 3MA9A 4O4HE 2CXDA 2VKOA 3KVAA 4UEMA 5FY7A 4ASKA 3RYFE 4ZS2A 2ZM8A 4G63A 1D0ZA 2LT3A 3PDYA 2KLQA 5L3BB 5DJQC 1O3XA 4WNKA 1OXZA 2VL8A 5JDQA 2W63A 2EHOB 1IZNB 5AFUL 5HYAA 2SPCA 4C91A 4U72A 2IW5B 5LG4A 2VKJA 3EDVA 1FMVA 1SA0E 5JR9B 2IC9A 3FBLA 3KBTA 5L3FB 2H3RA 5LGNB 2MOZA 5LHHB 3ETVA 3ZLIA 4TN7B 3I9YA 4AI6A 4O2AE 4BJNA 1UCUA 1HCIA 5JH7E 2XAGB 5L2LA 2OA5A 3SOLA 5JDFA 5HXEA 1EZ3A 3PTRB 2C5JA 3LBXA 3JC6D 4IE7A 2I59A 3AA7B 4TX5A 2B1EA 5LJMA 1WLXA 5HXSA 2V26A 3N2OA 1Y64B 4L5GA 5LNKA 4EB6E 3Q9DA 2N1GA 2VASA 4OHFA 3E22E 4DBQA 3OKQA 5DQWA 2VKDA 4PK6A 5DABA 1YW0A 2H7OA 4H63H 2QGSA 5HXCA 5KMGP 4XAXB 3ZMZB 2E9XB 1D1BA 4QXCB 4TV8E 1FEWA 5ETWA 2EHOA 2JJ9A 2YK0A 4GYRA 4X1IE 5FMNA 5FY0A 3N2GE 3I0QA 3DTOA 3HKEE 3K3NA 2DNXA 2YU1A 2W00A 5FNVE 2V7LA 4ZS3A 3W15B 2Y48B 3BQKA 2EHOC 4FI5A 4P0BA 4PJLA 5LXTE 1HTJF 3ZYMA 4ZHQE 4ANJA 3AVRA 1UX5A 2V7MA 3UT5E 2WM9A 5EK3A 3MXZA 2LSIA 4CXXA 5JR9C 4L0RA 1IJ6A 3TKLB 2D0UA 2G0UA 3MJXA 3ZCIA 4QX8B 2H7VC 2LEHA 4PNIA 5L3GB 2A3DA 3N9MA 3RH3A 2CLYB 3K3QC 2NW9A 3PUSA 2CM0A 2P9BA 4UXNB 3WI3A 1LVFA 3L3PA 4AKGA 3N5LA 3OBVE 2KT9A 2X9YA 2NWBA 4H63V 3GWHA 3AAEB 3U78A 4NUUA 3ZMSB 2X0LB 4U74A 1MMGA 4UF0B 4WBNE 2X9HA 4ISSA 4KBMB 4NUVA 2LSJA 2VWAA 2JRKA 4YFSA 3ESLA 1D1AA 4J2CA 2CWOA 4IE0A 1FIOA 4X1KE 4AXPA 3PURA 2YINA 1US7B 2E9XC 5FXZA 2XHEB 3DP7A 3NRYA 2C0SA 4IE6A 3CKDA 2PFVA 2V7KA 3ZEFB 4EOZB 3IEEA 4ZI2C 3ANWB 4HKAA 5M4YA 1D1CA 2D5UA 4HGAA 2MTQA 4TZ4C 2KZ7B 3CQXC 2LE8A 5IYZE 3FXDB 4DBRA 4JUYA 3NZQA 3PUAA 3S4UA 4HFVA 2HH7A 2BDEA 1E1HB 3OYZA 2LJLA 3ETUA 3F2EA 2JQQA 2DLRA 2XAHB 2VK9A 1KK7A 3CMLA 4BA9A 4CI1B 3CX8B 2CA5A 1SHZC 4UVCB 3A5XA 4EXTA 2C5IT 3NZPA 4I55E 4AQGA 2BZBA 2CLYC 1G8XA 4H9OC 4CXWA 4IE4A 4ADZA 5LBMA 2WBLA 4HEAA 3V5SA 2WSSV 4K0UA 4EZ4A 4O2BE 2Q9QC 4IE5A 2LSYA 2UXXB 3N9LA 2DWKA 3UFEA 4BJMA 1LKXA 4TV9E 2D0TA 1OWAA 1MMDA 2PBIA 5JVDE 3IBPA 3RKOA 5HAXA 3BQLA 3CVRA 3QC9A 5BMVE 2X51A 1D0XA 2JMHA 4I4TE 2KNDA 2X66A 4GIWA 5A1LA 4GOUA 4A56A 4PFPA 3QK6A 3RYCE 4MHCA 4EAHA 3ZYKA 2CWYA 2PG8A 2X67A 3LJCA 4N78D 4C90A 4EYUA 3ZMVB 1HFAA 2M67A 2V7IA 2WAUA 5LYJE 1T98A 2A72A 5C8YE 2ZM2A 4UIGA 3HKBE 3O4XE 5GONE 5L3EB 4ZI3C 4JEHB 2EHOD 4GK5E 3KV9A 2DHRA 2KINB 3ZJ2A 2CEAA 3L09A 3DJBA 5FYMA 3RRWA 3ZN0B 4HE8A 4H9NC 2DWGA 3WAJA 2GK9A 1HG2A 3AA6B 2KMFA 2RA1A 4CI3B 1HS7A 4M1PA 5FP3A 4EZHA 5ADXL 3ZYLA 1CUNA 1UX4A 3I1AA 4I43B 4DNDA 3EVYA 3C64A 3HR0A 5LCYA 4HN9A 5JDLA 4GK0E 3ZMTB 1MMNA 5JR9A 2L8KA 4ERRA 1MIVA 5FXVA 1WRDA 3Q5XA 4BAYB 3RYIE 1VOMA 4QXHB 5FY1A 3RRCA 4FJOA 3C4WA 4X1YE 5H6QB 5JDGA 1IJ5A 2Y6XA 2K48A 4X20E 4GYSA 1AJ3A 1LVKA 4PJJA 3C51A 3B13A 4AKIA 1X79A 3I9WA 2X9XA 3MKDA 5L3DB 2J1DG 3HKDE 2NP9A 4XZCA 4Z8XA 2E9XD 2MYSA 3GN5B 4AKLA 3AAAB 2WMNA 3PUQA 5TAOA 4CXYA 5JRCB 4P09A 5J1GA 4H9QC 2L3LA 3OJAA 1BR4A 4ZI2D 4V1Av 5HWXA 3CX6B 2ODUA 3VHLA 3ZMUB 1MNDA 3JC6C 3HI2A 3LK2B 1WYBA 4ILUA 5EZYE 4EIWA 1MMAA 2LOPA 2Q9QB 3WAKA 4YJ3E 3K3OA 4PK5A 4HTEA 1WYCA 2NTXA 3MACA 3PE0A 5HWYA 4OFZA 4YJ2E 2DI4A 3CWZB 3ZCJA 5LGUB 2E9XA 2CE7A 2KXPB 5LOVE 2CMRA 3PUGA 3RC8A 4F6RC 3MZKB 2WWUA 3T8OA 1D0YA 4MBQA 1QSDA 5FXWA 4IHJE 4YHJA 5IHYA 3C4ZA 4JLEA 3FHNA 3RYHE 3D0TA 1QUUA 3E0ZA 3LG7A 1NWMX 4QXBB 3IHRA 5LP6E 3RC3A 1MNEA 4AQFC 2ZLYA 5J2TE 2Q9QD 1LRZA 2UXNB 3VU7H 1MIWA 5EK2A 3J7Yq 3O1JA 1U4QA 3GN5A 2CXFA 2XASB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LSJ A;  2LSI A;  2LSY A;  2N1G A;  4EXT A;  2LSG A;  4GK0 E;  2LSK A;  3VU7 H;  4FJO A;  4BA9 A;  4GK5 E; 
#chains in the Genus database with same CATH topology
 4MFR A;  4EYY R;  4JI8 T;  5LHI B;  5HCJ A;  4JI7 T;  3O1H A;  4IDO A;  3KIN B;  5HXH A;  3ZN1 B;  2Q9Q A;  2V1D B;  4HWH A;  2YOE A;  3N9P A;  1HF8 A;  3ZC1 A;  3BQI A;  5L47 A;  4MAL A;  3H37 A;  4U2Z A;  4X64 T;  2R6G F;  3M3Z B;  4HFB A;  1YQ3 A;  5JDH A;  4LF4 T;  4DMW A;  4DR2 T;  2HN1 A;  3HL6 A;  1G73 A;  2XQ3 A;  4YTN A;  3UUM A;  3PU3 A;  2XUE A;  2LSG A;  5HCM A;  1IBL T;  2IC6 A;  3GMI A;  3OVU A;  3KV4 A;  2BVL A;  4Z90 A;  4ZI7 E;  3AE6 A;  4IL4 A;  4YY3 T;  3QUJ A;  2V5C A;  2VQF T;  4QHO A;  5E0O A;  4PJN A;  2XQ8 A;  2NW8 A;  3KBU A;  3R84 B;  1WR6 A;  2A2F X;  3QNU A;  3SWH A;  3F57 A;  2WZH A;  3FXE B;  2NOX A;  4O8S A;  1H7C A;  2LM9 A;  2Y8D A;  1IAP A;  2D2S A;  5LMU T;  3FZL B;  3N2K E;  4ZOL E;  4U7I A;  3KDS E;  2IHR 1;  3H3A A;  2K9A A;  4QX7 B;  4F8H A;  4HFI A;  5LG3 A;  3Q2M A;  1UUS A;  1FJG T;  4AKH A;  2LHN A;  3N9N A;  1ZHC A;  4IDQ A;  1VCS A;  4H9R C;  2VB6 A;  5AQP B;  1UGO A;  4UEL A;  3M65 A;  1ZKE A;  4Q25 A;  3RI5 A;  2UUA T;  1BR0 A;  5C3J A;  1KNP A;  2UUC T;  3B5M A;  4ASK A;  2IDO B;  5AQF B;  1D0Z A;  5DJQ C;  4NXM T;  1O3X A;  1OXZ A;  2VL8 A;  1IZN B;  2YKS A;  5HYA A;  4U72 A;  4HFC A;  1SA0 E;  5JR9 B;  4LF8 T;  5LGN B;  2YDS A;  5LHH B;  3I9Y A;  3RLF F;  4O2A E;  3L8R A;  1JNR A;  2VVS A;  2C5J A;  3LBX A;  3JC6 D;  4JI2 T;  3AA7 B;  4TX5 A;  2B1E A;  1WLX A;  3FZF B;  2V26 A;  4L5G A;  1X9B A;  4X5T A;  4DBQ A;  1M62 A;  2F4V T;  2VKD A;  2QGS A;  2BBH A;  1FEW A;  3RQU A;  3N2G E;  3I0Q A;  4X65 T;  3BQK A;  5LXT E;  3UT5 E;  4GKK T;  3MXZ A;  5AQL B;  5AQO B;  1IJ6 A;  2D0U A;  2H7V C;  5L3G B;  4HFE A;  3EHZ A;  3TLT A;  2P9B A;  4AKG A;  2JIW A;  2YDQ A;  4YT0 A;  4NUU A;  3ZMS B;  4U74 A;  4WBN E;  4ISS A;  1W0A A;  2JRK A;  2V6Y B;  1WCR A;  1FIO A;  2XHE B;  3NRY A;  2C0S A;  3CKD A;  4ZI2 C;  4HKA A;  4A97 A;  2MTQ A;  4TZ4 C;  2WDV A;  4EV6 A;  2XQ4 A;  4DBR A;  2LRK A;  4HFV A;  2BDE A;  2DLR A;  2VK9 A;  3CML A;  1SHZ C;  5FVK A;  2C5I T;  1G8X A;  5HEO A;  1SUM B;  4HEA A;  4O2B E;  2Q9Q C;  3UU5 A;  4IE5 A;  3N9L A;  4BJM A;  4QH1 A;  1LKX A;  3AE5 A;  2WZI A;  3CVR A;  2JQK A;  3NWI A;  2X51 A;  1D0X A;  3IA3 A;  2JMH A;  2X66 A;  4GIW A;  4GOU A;  4EAH A;  4EYU A;  3ZMV B;  2WAU A;  2QRX A;  2A72 A;  4ZI3 C;  2VQE T;  5FL1 A;  5HEJ A;  3DJB A;  5FYM A;  1XDP A;  3ZN0 B;  1W09 A;  1HS7 A;  5J0Z A;  5LCY A;  1XMO T;  5JR9 A;  1T7S A;  3EAB A;  4BAY B;  1VOM A;  3RRC A;  4FJO A;  5H6Q B;  2V8S V;  3B13 A;  4AKI A;  3I9W A;  2X9X A;  2J1D G;  3HKD E;  2IML A;  2W66 A;  1YXR A;  4P09 A;  5J1G A;  1W9R A;  2L3L A;  2UXC T;  3OJA A;  1BR4 A;  3VHL A;  3JC6 C;  3HI2 A;  3TLV A;  1HNW T;  2LOP A;  2Q9Q B;  3K3O A;  4PK5 A;  4HTE A;  5FVL A;  1WYC A;  3PE0 A;  5HWY A;  2BKO A;  3AEG A;  5LOV E;  2CMR A;  4F6R C;  2BKN A;  1QSD A;  5FXW A;  4YHJ A;  4DR1 T;  5LP6 E;  3RC3 A;  5J2T E;  1QLB A;  2ZLY A;  5EK2 A;  3J7Y q;  2OLT A;  4AQY T;  3RIU A;  3GN5 A;  2CXF A;  2XAS B;  2XZE A;  2KWI B;  2D9D A;  5HEG A;  2IAK A;  3PUW F;  3UU4 A;  2QVA A;  3K1S A;  3NBX X;  3C50 A;  4QWN B;  3N9Q A;  2X0Y A;  2ZM0 A;  3MK7 C;  3AE9 A;  2DL1 A;  2W67 A;  4DUZ T;  2WCA A;  3NKZ A;  5CA1 E;  1S35 A;  5JDN A;  5FKY A;  5BR8 T;  5LA6 E;  3CIR A;  2CXL A;  1CHU A;  2XQY A;  4IGU A;  3AA1 B;  4KP3 C;  5L3C B;  1KNZ A;  1E7P A;  2VVN A;  1KEY A;  4IDZ A;  2K5B B;  4U31 A;  1NAF A;  2C5K T;  3UUN A;  4H9S E;  2VKH A;  3R6N A;  4A98 A;  2XAJ B;  1HG5 A;  4JEU B;  5F3J A;  2BBJ A;  3ZPO A;  4DV4 T;  1E2A A;  4WW0 A;  5JRE A;  4PW8 A;  3LK4 2;  4PJM A;  2WP9 A;  3EI0 A;  1BR2 A;  1SE7 A;  2J62 A;  3P8C D;  2W62 A;  2XAQ B;  3H3M A;  2FBW A;  5IWA T;  4LF6 T;  4TWD A;  5LJN A;  4AIS A;  2HPJ A;  4JI1 T;  3ZSS A;  3P4P A;  2W61 A;  2CPT A;  4DO0 A;  4WYV A;  1YKE B;  3VKH A;  4B6X A;  3LBX B;  3KFW X;  4OK0 A;  1JNZ A;  3AB3 B;  4E7Z A;  4P1N A;  3U3I A;  2E2A A;  4O4H E;  5FY7 A;  3RYF E;  4G63 A;  3ONJ A;  3Q5E A;  4WNK A;  2W63 A;  5LG4 A;  2VKJ A;  1FMV A;  2IC9 A;  4ILB A;  2H3R A;  2UUB T;  3ETV A;  3ZLI A;  4GKJ T;  4BJN A;  1N34 T;  5JH7 E;  1Y01 A;  5L2L A;  3SOL A;  2CBI A;  5JDF A;  4ZZB A;  1EZ3 A;  3PTR B;  4DR6 T;  2I59 A;  5AQH B;  4OX9 T;  2BS2 A;  3N2O A;  3QOF A;  4EB6 E;  2N1G A;  3OKQ A;  5DQW A;  3UUB A;  4PK6 A;  4DR5 T;  5DAB A;  2H7O A;  4H63 H;  4XAX B;  3PV0 F;  1D1B A;  2QYW A;  3AE7 A;  4LF5 T;  2EHO A;  4GYR A;  5FMN A;  5AQJ B;  2V7L A;  4K0K T;  4PJL A;  1HTJ F;  4ANJ A;  3AVR A;  5CJ5 A;  3ONL C;  5JR9 C;  4L0R A;  3TKL B;  2G0U A;  3MJX A;  4QX8 B;  2LEH A;  4LMJ A;  2A3D A;  5L4H A;  3K3Q C;  2NW9 A;  2OV9 A;  3L3P A;  3VR9 A;  3N5L A;  2XJ7 A;  2X9Y A;  4H63 V;  3AAE B;  3U78 A;  2X0L B;  4I0U A;  1MMG A;  4UF0 B;  5ABE A;  2LSJ A;  4YFS A;  2CWO A;  4IE0 A;  2FUP A;  1Z8U A;  2YIN A;  3AEF A;  3DP7 A;  4IE6 A;  2V7K A;  4TNW A;  2XQ6 A;  1D1C A;  2D5U A;  2KZ7 B;  2WDQ A;  3A8Y C;  3FXD B;  4IDP A;  3S4U A;  4YSX A;  2BKP A;  3RKG A;  2BG9 A;  4LFB T;  1KK7 A;  4BA9 A;  4CI1 B;  3RIU C;  2CA5 A;  4UVC B;  2W4X A;  3A5X A;  2NR4 A;  1I94 T;  5ABG A;  4ADZ A;  2WBL A;  2WSS V;  2VL0 A;  2M6B A;  2LSY A;  4EED A;  1OED E;  4LMK A;  3BQL A;  3QB5 K;  2YDR A;  2AE9 A;  4A5X A;  2LRL A;  4PFP A;  3ZYK A;  3LJC A;  2PG8 A;  5AQT B;  5LYJ E;  2V7I A;  2FJB A;  2HHH T;  5AQN B;  4DR7 T;  2EHO D;  2DHR A;  2KIN B;  3L09 A;  5IUX A;  4HE8 A;  2DWG A;  1HG2 A;  2KMF A;  4LFA T;  1UK5 A;  3P4R A;  3G06 A;  1CUN A;  2FJA A;  2CBJ A;  4DND A;  3HR0 A;  1KF6 A;  5JDL A;  4GK0 E;  3ZMT B;  1MMN A;  3P4W A;  4ERR A;  4QXH B;  5FY1 A;  3C4W A;  4X1Y E;  3PJA A;  3MKD A;  5L3D B;  4XZC A;  2E9X D;  3GN5 B;  3PUQ A;  5TAO A;  5JRC B;  4H9Q C;  1J1J A;  5HWX A;  4EIW A;  3RHW A;  3WAK A;  2UXD T;  4IRE A;  4HWI B;  2XY8 B;  3ZCJ A;  3EAM A;  3MZK B;  2BS3 A;  2WWU A;  1D0Y A;  4IHJ E;  4UR9 A;  3C4Z A;  3D0T A;  3LG7 A;  3TLS A;  2WU5 A;  2XQ5 A;  2LLY A;  2WU2 A;  3UQ4 A;  5AQS B;  3AE2 A;  3O1J A;  1U4Q A;  2LKG A;  4AKR B;  3I0O A;  4IIJ E;  4EGW A;  2ZM6 T;  3Q5D A;  1XNQ T;  4PAG A;  1U5P A;  4CZZ B;  2K24 A;  2XPK A;  3E08 A;  4UF0 A;  4OYK A;  2CCQ A;  1J5E T;  2ODV A;  1B7T A;  2XM1 A;  2BS4 A;  4PK4 A;  3C98 B;  3AEC A;  3RX6 A;  2N9D A;  3B57 A;  4KUM B;  2KWH A;  4UVA B;  2MBG A;  4CN6 A;  2DCF A;  4G2A A;  3FBZ A;  1N32 T;  3CX7 B;  3FB2 A;  3VKG A;  4DV5 T;  2WS3 A;  3RGL A;  4YLH A;  4E7S A;  2YN6 A;  3KV6 A;  4L9I A;  2BG9 E;  4MLK A;  5JQG E;  1Z0P A;  3V5U A;  3KV5 A;  4PFO A;  4WBO A;  3GA8 A;  3P50 A;  1HR0 T;  1OED B;  5HXR A;  2YU2 A;  2XQ9 A;  5KX5 E;  1ZOY A;  4NIQ A;  3IF8 B;  4CI2 B;  4X66 T;  4CQI A;  3ZJ1 A;  3UUX B;  5DQV A;  2H89 A;  3UUL A;  3AE8 A;  4XBF B;  3P7I A;  1NEN A;  3CQC B;  2X9W A;  4DVD A;  4DV7 T;  5H6R B;  3SRZ A;  4AQF A;  5JDM A;  3PUZ F;  3QB5 A;  3AVS A;  2V7J A;  4P0A A;  5J2U E;  4O4L E;  3OYX A;  3ZC0 A;  2XAF B;  4O4J E;  3AED A;  1MIY A;  3CPZ A;  2ZMA A;  4YXD A;  2M6I A;  2W2U A;  2K3W A;  5LGT B;  5JRC A;  3AE3 A;  1HNZ T;  1R8I A;  3K8P C;  4KMC A;  3J9X 1;  1S94 A;  3AA0 B;  4TUY E;  5CGM A;  2X68 A;  5CFB A;  3FZM B;  2CXD A;  2VKO A;  2WY2 A;  3KVA A;  2BG9 C;  3PDY A;  2KLQ A;  5L3B B;  2EHO B;  4HFD A;  5AFU L;  4C91 A;  4DV2 T;  2J47 A;  3L39 A;  5LB7 B;  1UCU A;  4TNV A;  2XAG B;  2OA5 A;  5HXE A;  4IE7 A;  1N36 T;  4LF7 T;  5LJM A;  5HXS A;  5LNK A;  1Y64 B;  2VAS A;  4OHF A;  5FL0 A;  3SFE A;  4CN4 A;  5HXC A;  3ZMZ B;  1N33 T;  2E9X B;  4QXC B;  5ETW A;  4X1I E;  5FY0 A;  5KXJ A;  2W00 A;  5FNV E;  2Y48 B;  4P0B A;  3ZYM A;  1XDO A;  4ZHQ E;  2LSI A;  3ZCI A;  4HWF A;  4PNI A;  4JBW F;  3RH3 A;  2CLY B;  2BG9 B;  4UXN B;  3PUV F;  2NWB A;  1T8B A;  2E5L T;  1OED A;  3GWH A;  5HEU A;  4TWH A;  2JQH A;  4KBM B;  2VWA A;  1VCT A;  4J2C A;  4AXP A;  3PUR A;  1J5W A;  1WR0 A;  3UU8 A;  3ZEF B;  4EOZ B;  3ANW B;  4YTP A;  2LE8 A;  2HN2 A;  3AEB A;  3PUA A;  2HH7 A;  2KSR A;  1E1H B;  3OYZ A;  2JQQ A;  2I6H A;  2XAH B;  3CX8 B;  3ABV A;  3NZP A;  2BZB A;  2XQA A;  4CXW A;  4IE4 A;  5LBM A;  2UXX B;  2DWK A;  1MMD A;  3RKO A;  5HAX A;  3QC9 A;  5BMV E;  3VRA A;  2KND A;  4MHC A;  5L4E A;  2CWY A;  2X67 A;  4C90 A;  5ADX L;  1HFA A;  2VUR A;  2ZM2 A;  3HKB E;  5GON E;  4JI0 T;  2CEA A;  4CN1 A;  3RRW A;  1W0B A;  1DU2 A;  1KFY A;  3FZK B;  3ZST A;  2V6X A;  4H9N C;  3VRB A;  3PJA J;  3WAJ A;  4IT4 A;  4JI3 T;  3TLW A;  4M1P A;  5FP3 A;  4EZH A;  3ZYL A;  3P4Q A;  3C64 A;  4HN9 A;  2ACZ A;  5ABF A;  1MIV A;  5FXV A;  2LKH A;  3Q5X A;  4JV5 T;  4X20 E;  1LVK A;  2XM2 A;  4PJJ A;  1X79 A;  1XNR T;  2NP9 A;  4Z8X A;  3AEA A;  4ZI2 D;  3CX6 B;  2ODU A;  5AQR B;  1MND A;  1WYB A;  5EZY E;  3OPC A;  2NTX A;  2XSB A;  3MAC A;  4OFZ A;  2DI4 A;  3CWZ B;  5LGU B;  2E9X A;  2CE7 A;  4JYA T;  4ILC A;  4MBQ A;  2JQ9 A;  3RYH E;  3E0Z A;  3UU3 A;  4DID B;  4AQF C;  3A7M A;  2Q9Q D;  1LRZ A;  3VU7 H;  1MIW A;  3RIF A;  4U7Y A;  4IL9 A;  4OYJ A;  5F8P A;  2JPF A;  3UTK A;  1M7K A;  3JCF A;  4YHH T;  4KHZ F;  4DMV A;  3T1H T;  3ONX A;  1HX1 B;  1V9D A;  3Q5W A;  4QH5 A;  4ZI3 D;  5AQM B;  2FJE A;  4H9P C;  2XQ7 A;  1BR1 A;  4YSZ A;  3X1D A;  1ZEE A;  3LFM A;  2W0G A;  4B3T T;  3AXJ A;  3ZT5 A;  4KHP T;  3TLU A;  2RP4 A;  4NXN T;  3HA4 A;  3AAI A;  5AQI B;  3SFD A;  3ANW A;  1HNX T;  1YKH B;  2BVM A;  3P4S A;  4DUY T;  2ACX A;  4B3S T;  5ABH A;  1YD8 G;  2FJD A;  1YQ4 A;  4DV0 T;  3PU8 A;  3PUY F;  3C4X A;  3CQG B;  4UVB B;  3KVB A;  3EUH A;  2CRB A;  2N2N A;  2UU9 T;  1XWM A;  2B76 A;  2Z6E A;  2V5D A;  3LK3 B;  2NW7 A;  2LSK A;  5HEH A;  4IST A;  5LHG B;  4I50 E;  2XTL A;  1WFD A;  5CA0 E;  3NRX A;  2HPL A;  3F31 A;  2RPA A;  4ZZC A;  2WMO A;  5LBQ B;  2I0M A;  4DV1 T;  5EK4 A;  1GQE A;  4KI0 F;  5KDM C;  5AQG B;  3O9X A;  3FZH B;  2E8I A;  3SS1 A;  5AQU B;  3O1I A;  5AQQ B;  2XSA A;  3N9O A;  2LHR A;  4U3C A;  1KNR A;  3HKC E;  2JMK A;  4QH4 A;  2QA7 A;  4UV8 B;  2L9Q A;  3LSV A;  2PJQ A;  2ES0 A;  1I6Z A;  1ZP0 A;  3EDU A;  1OED C;  2NTY A;  1HX8 A;  4X62 T;  1FMW A;  4QKN A;  2LOS A;  4O4I E;  5FXX A;  4UV9 B;  3RPU A;  1ZV4 X;  1UUR A;  4DR3 T;  3AE4 A;  4KX6 A;  3VR8 A;  3BK9 A;  1VRB A;  5CB4 E;  4U2Y A;  2MPK A;  2WDR A;  2YEV C;  3MA9 A;  4UEM A;  4DV6 T;  5LMN T;  4ZS2 A;  2ZM8 A;  2LT3 A;  5AQV B;  5JDQ A;  3T1Y T;  2SPC A;  4HWC A;  2IW5 B;  3EDV A;  2IUB A;  3FBL A;  3KBT A;  5L3F B;  2UXB T;  3PUX F;  2MOZ A;  4AIU A;  4TN7 B;  4AI6 A;  4COF A;  1XZY A;  1HCI A;  4JI6 T;  2H88 A;  4U33 A;  4B3R T;  4TWF A;  3JAE A;  3RQW A;  2LM2 A;  3Q9D A;  4B3M T;  3E22 E;  1YW0 A;  5KMG P;  4TV8 E;  2JJ9 A;  2YK0 A;  3JAD A;  5C2T A;  3DTO A;  3HKE E;  3K3N A;  2DNX A;  2YU1 A;  2PTF A;  4ZS3 A;  3W15 B;  2EHO C;  4FI5 A;  1UX5 A;  2V7M A;  2WM9 A;  5EK3 A;  4Z91 A;  1XMQ T;  4CXX A;  2WB5 A;  3RF1 A;  3N9M A;  3PUS A;  2CM0 A;  3WI3 A;  1LVF A;  4DR4 T;  3OBV E;  2KT9 A;  3NVO A;  4YSY A;  2X9H A;  2E5V A;  4NUV A;  3ESL A;  4WZX A;  1D1A A;  4X1K E;  2CHN A;  1US7 B;  2E9X C;  5FXZ A;  4NPP A;  2PFV A;  4DV3 T;  3IEE A;  3JAF A;  4ZXL A;  5M4Y A;  4HGA A;  4JI5 T;  3CQX C;  5IYZ E;  4JUY A;  3NZQ A;  3ZT6 A;  4IDN A;  2LJL A;  3ETU A;  3F2E A;  3UU6 A;  3ZKR A;  5AQK B;  4HWD A;  2WQY A;  4EXT A;  5F5W A;  4LFC T;  4I55 E;  4AQG A;  2CLY C;  4H9O C;  3V5S A;  4EZ4 A;  4K0U A;  3AEE A;  1IBM T;  2V6Y A;  3UFE A;  4EEB A;  4TV9 E;  2D0T A;  1OWA A;  2J4G A;  2PBI A;  5JVD E;  3IBP A;  5ABF B;  2A9U A;  4I4T E;  4JI4 T;  5A1L A;  4A56 A;  3QK6 A;  3RYC E;  4N78 D;  2M67 A;  1T98 A;  5C8Y E;  4UIG A;  3O4X E;  5L3E B;  3UQ7 A;  3UFG A;  4JEH B;  4GK5 E;  4LF9 T;  3KV9 A;  3ZJ2 A;  3OTO T;  1NEK A;  4ZEY A;  1T72 A;  2AXD S;  3RIA A;  2GK9 A;  3AA6 B;  2RA1 A;  4CI3 B;  2X0H A;  5JTG A;  1UX4 A;  3I1A A;  4I43 B;  3EVY A;  4YTM A;  2L8K A;  3AE1 A;  4LML A;  1WRD A;  3RYI E;  5JDG A;  1IJ5 A;  3ZT7 A;  2Y6X A;  2K48 A;  1AJ3 A;  4GYS A;  3C51 A;  2MYS A;  4AKL A;  3AAA B;  2WMN A;  4CXY A;  2MAW A;  4V1A v;  3ZMU B;  4YJ2 E;  3LK2 B;  4HFH A;  4ILU A;  1MMA A;  4YJ3 E;  2KXP B;  3PUG A;  2WWV A;  3RC8 A;  2CHO A;  3T8O A;  3LDQ B;  5IHY A;  4JLE A;  3FHN A;  1L0V A;  1QUU A;  3AXJ B;  1NWM X;  4QXB B;  3IHR A;  1MNE A;  2UXN B;  1IBK T;  3CK6 A;  2IIU A;  4ILA A; 
#chains in the Genus database with same CATH homology
 4MFR A;  4OYJ A;  5F8P A;  2JPF A;  4EYY R;  4AKR B;  3UTK A;  5LHI B;  3I0O A;  4IIJ E;  2KWI B;  2IAK A;  3O1H A;  3KIN B;  5HXH A;  3ZN1 B;  4PAG A;  2Q9Q A;  1U5P A;  4DMV A;  3ONX A;  4CZZ B;  2K24 A;  2V1D B;  3E08 A;  1V9D A;  3NBX X;  3Q5W A;  4ZI3 D;  3C50 A;  3N9P A;  4UF0 A;  1HF8 A;  3ZC1 A;  4QWN B;  3N9Q A;  4H9P C;  4OYK A;  2ZM0 A;  2CCQ A;  1BR1 A;  2ODV A;  3MK7 C;  3BQI A;  4MAL A;  1B7T A;  1ZEE A;  3LFM A;  2W0G A;  3H37 A;  4PK4 A;  3C98 B;  3RX6 A;  2RP4 A;  5CA1 E;  1S35 A;  5JDN A;  2N9D A;  3B57 A;  4KUM B;  2KWH A;  4UVA B;  3HA4 A;  3AAI A;  5LA6 E;  2MBG A;  3ANW A;  2CXL A;  1YKH B;  2DCF A;  2XQY A;  4G2A A;  5JDH A;  2BVM A;  2ACX A;  3FBZ A;  4DMW A;  4IGU A;  3AA1 B;  3CX7 B;  1YD8 G;  3FB2 A;  3HL6 A;  4KP3 C;  3PU8 A;  5L3C B;  1KNZ A;  3VKG A;  1G73 A;  3UUM A;  3PU3 A;  2XUE A;  4YLH A;  2LSG A;  4E7S A;  2IC6 A;  3GMI A;  3C4X A;  3KV4 A;  2BVL A;  3CQG B;  4UVB B;  4ZI7 E;  3KVB A;  3QUJ A;  3EUH A;  3KV6 A;  4QHO A;  4L9I A;  2N2N A;  4MLK A;  5JQG E;  1Z0P A;  5E0O A;  4PJN A;  3V5U A;  3KV5 A;  4IDZ A;  4PFO A;  2K5B B;  4WBO A;  3GA8 A;  2Z6E A;  1NAF A;  5HXR A;  2C5K T;  3LK3 B;  2NW8 A;  3KBU A;  2YU2 A;  3R84 B;  3UUN A;  1WR6 A;  2NW7 A;  2A2F X;  2LSK A;  4H9S E;  5KX5 E;  2VKH A;  3R6N A;  4IST A;  5LHG B;  4I50 E;  3SWH A;  2XAJ B;  1HG5 A;  3F57 A;  4JEU B;  2XTL A;  3IF8 B;  5CA0 E;  5F3J A;  3FXE B;  2NOX A;  3NRX A;  2HPL A;  4O8S A;  3ZPO A;  4CI2 B;  1H7C A;  3F31 A;  4CQI A;  2WMO A;  2LM9 A;  5LBQ B;  3ZJ1 A;  3UUX B;  5DQV A;  4WW0 A;  2Y8D A;  3UUL A;  4XBF B;  3P7I A;  3CQC B;  1IAP A;  2D2S A;  5EK4 A;  2X9W A;  4DVD A;  3N2K E;  5KDM C;  4ZOL E;  3O9X A;  2E8I A;  5JRE A;  5H6R B;  4PW8 A;  3LK4 2;  3KDS E;  4PJM A;  3SRZ A;  3SS1 A;  4AQF A;  5JDM A;  3O1I A;  3AVS A;  3H3A A;  1BR2 A;  2V7J A;  3N9O A;  4P0A A;  5J2U E;  2K9A A;  4QX7 B;  4O4L E;  2LHR A;  3OYX A;  3ZC0 A;  3HKC E;  2XAF B;  4O4J E;  3P8C D;  2JMK A;  2W62 A;  1MIY A;  3CPZ A;  2QA7 A;  2XAQ B;  4UV8 B;  2ZMA A;  2L9Q A;  2PJQ A;  2ES0 A;  3Q2M A;  3EDU A;  5LJN A;  5LGT B;  2NTY A;  2HPJ A;  5JRC A;  1HX8 A;  4AKH A;  2LHN A;  3N9N A;  1ZHC A;  2W61 A;  1FMW A;  4QKN A;  2LOS A;  4H9R C;  4DO0 A;  3K8P C;  2VB6 A;  4O4I E;  5FXX A;  4UV9 B;  3RPU A;  1ZV4 X;  4UEL A;  1YKE B;  3VKH A;  3M65 A;  4KMC A;  4B6X A;  3LBX B;  3J9X 1;  1S94 A;  1ZKE A;  3KFW X;  4OK0 A;  3AA0 B;  1BR0 A;  3AB3 B;  3BK9 A;  4TUY E;  1VRB A;  4E7Z A;  2X68 A;  5CB4 E;  3U3I A;  2YEV C;  3MA9 A;  4O4H E;  2CXD A;  2VKO A;  3KVA A;  4UEM A;  5FY7 A;  4ASK A;  3RYF E;  4ZS2 A;  2ZM8 A;  4G63 A;  1D0Z A;  2LT3 A;  3PDY A;  2KLQ A;  5L3B B;  5DJQ C;  1O3X A;  4WNK A;  1OXZ A;  2VL8 A;  5JDQ A;  2W63 A;  2EHO B;  1IZN B;  5AFU L;  5HYA A;  2SPC A;  4C91 A;  4U72 A;  2IW5 B;  5LG4 A;  2VKJ A;  3EDV A;  1FMV A;  1SA0 E;  5JR9 B;  2IC9 A;  3FBL A;  3KBT A;  5L3F B;  2H3R A;  5LGN B;  2MOZ A;  5LHH B;  3ETV A;  3ZLI A;  4TN7 B;  3I9Y A;  4AI6 A;  4O2A E;  4BJN A;  1UCU A;  1HCI A;  5JH7 E;  2XAG B;  5L2L A;  2OA5 A;  3SOL A;  5JDF A;  5HXE A;  1EZ3 A;  3PTR B;  2C5J A;  3LBX A;  3JC6 D;  4IE7 A;  2I59 A;  3AA7 B;  4TX5 A;  2B1E A;  5LJM A;  1WLX A;  5HXS A;  2V26 A;  3N2O A;  1Y64 B;  4L5G A;  5LNK A;  4EB6 E;  3Q9D A;  2N1G A;  2VAS A;  4OHF A;  3E22 E;  4DBQ A;  3OKQ A;  5DQW A;  2VKD A;  4PK6 A;  5DAB A;  1YW0 A;  2H7O A;  4H63 H;  2QGS A;  5HXC A;  5KMG P;  4XAX B;  3ZMZ B;  2E9X B;  1D1B A;  4QXC B;  4TV8 E;  1FEW A;  5ETW A;  2EHO A;  2JJ9 A;  2YK0 A;  4GYR A;  4X1I E;  5FMN A;  5FY0 A;  3N2G E;  3I0Q A;  3DTO A;  3HKE E;  3K3N A;  2DNX A;  2YU1 A;  2W00 A;  5FNV E;  2V7L A;  4ZS3 A;  3W15 B;  2Y48 B;  3BQK A;  2EHO C;  4FI5 A;  4P0B A;  4PJL A;  5LXT E;  1HTJ F;  3ZYM A;  4ZHQ E;  4ANJ A;  3AVR A;  1UX5 A;  2V7M A;  3UT5 E;  2WM9 A;  5EK3 A;  3MXZ A;  2LSI A;  4CXX A;  5JR9 C;  4L0R A;  1IJ6 A;  3TKL B;  2D0U A;  2G0U A;  3MJX A;  3ZCI A;  4QX8 B;  2H7V C;  2LEH A;  4PNI A;  5L3G B;  2A3D A;  3N9M A;  3RH3 A;  2CLY B;  3K3Q C;  2NW9 A;  3PUS A;  2CM0 A;  2P9B A;  4UXN B;  3WI3 A;  1LVF A;  3L3P A;  4AKG A;  3N5L A;  3OBV E;  2KT9 A;  2X9Y A;  2NWB A;  4H63 V;  3GWH A;  3AAE B;  3U78 A;  4NUU A;  3ZMS B;  2X0L B;  4U74 A;  1MMG A;  4UF0 B;  4WBN E;  2X9H A;  4ISS A;  4KBM B;  4NUV A;  2LSJ A;  2VWA A;  2JRK A;  4YFS A;  3ESL A;  1D1A A;  4J2C A;  2CWO A;  4IE0 A;  1FIO A;  4X1K E;  4AXP A;  3PUR A;  2YIN A;  1US7 B;  2E9X C;  5FXZ A;  2XHE B;  3DP7 A;  3NRY A;  2C0S A;  4IE6 A;  3CKD A;  2PFV A;  2V7K A;  3ZEF B;  4EOZ B;  3IEE A;  4ZI2 C;  3ANW B;  4HKA A;  5M4Y A;  1D1C A;  2D5U A;  4HGA A;  2MTQ A;  4TZ4 C;  2KZ7 B;  3CQX C;  2LE8 A;  5IYZ E;  3FXD B;  4DBR A;  4JUY A;  3NZQ A;  3PUA A;  3S4U A;  4HFV A;  2HH7 A;  2BDE A;  1E1H B;  3OYZ A;  2LJL A;  3ETU A;  3F2E A;  2JQQ A;  2DLR A;  2XAH B;  2VK9 A;  1KK7 A;  3CML A;  4BA9 A;  4CI1 B;  3CX8 B;  2CA5 A;  1SHZ C;  4UVC B;  3A5X A;  4EXT A;  2C5I T;  3NZP A;  4I55 E;  4AQG A;  2BZB A;  2CLY C;  1G8X A;  4H9O C;  4CXW A;  4IE4 A;  4ADZ A;  5LBM A;  2WBL A;  4HEA A;  3V5S A;  2WSS V;  4K0U A;  4EZ4 A;  4O2B E;  2Q9Q C;  4IE5 A;  2LSY A;  2UXX B;  3N9L A;  2DWK A;  3UFE A;  4BJM A;  1LKX A;  4TV9 E;  2D0T A;  1OWA A;  1MMD A;  2PBI A;  5JVD E;  3IBP A;  3RKO A;  5HAX A;  3BQL A;  3CVR A;  3QC9 A;  5BMV E;  2X51 A;  1D0X A;  2JMH A;  4I4T E;  2KND A;  2X66 A;  4GIW A;  5A1L A;  4GOU A;  4A56 A;  4PFP A;  3QK6 A;  3RYC E;  4MHC A;  4EAH A;  3ZYK A;  2CWY A;  2PG8 A;  2X67 A;  3LJC A;  4N78 D;  4C90 A;  4EYU A;  3ZMV B;  1HFA A;  2M67 A;  2V7I A;  2WAU A;  5LYJ E;  1T98 A;  2A72 A;  5C8Y E;  2ZM2 A;  4UIG A;  3HKB E;  3O4X E;  5GON E;  5L3E B;  4ZI3 C;  4JEH B;  2EHO D;  4GK5 E;  3KV9 A;  2DHR A;  2KIN B;  3ZJ2 A;  2CEA A;  3L09 A;  3DJB A;  5FYM A;  3RRW A;  3ZN0 B;  4HE8 A;  4H9N C;  2DWG A;  3WAJ A;  2GK9 A;  1HG2 A;  3AA6 B;  2KMF A;  2RA1 A;  4CI3 B;  1HS7 A;  4M1P A;  5FP3 A;  4EZH A;  5ADX L;  3ZYL A;  1CUN A;  1UX4 A;  3I1A A;  4I43 B;  4DND A;  3EVY A;  3C64 A;  3HR0 A;  5LCY A;  4HN9 A;  5JDL A;  4GK0 E;  3ZMT B;  1MMN A;  5JR9 A;  2L8K A;  4ERR A;  1MIV A;  5FXV A;  1WRD A;  3Q5X A;  4BAY B;  3RYI E;  1VOM A;  4QXH B;  5FY1 A;  3RRC A;  4FJO A;  3C4W A;  4X1Y E;  5H6Q B;  5JDG A;  1IJ5 A;  2Y6X A;  2K48 A;  4X20 E;  4GYS A;  1AJ3 A;  1LVK A;  4PJJ A;  3C51 A;  3B13 A;  4AKI A;  1X79 A;  3I9W A;  2X9X A;  3MKD A;  5L3D B;  2J1D G;  3HKD E;  2NP9 A;  4XZC A;  4Z8X A;  2E9X D;  2MYS A;  3GN5 B;  4AKL A;  3AAA B;  2WMN A;  3PUQ A;  5TAO A;  4CXY A;  5JRC B;  4P09 A;  5J1G A;  4H9Q C;  2L3L A;  3OJA A;  1BR4 A;  4ZI2 D;  4V1A v;  5HWX A;  3CX6 B;  2ODU A;  3VHL A;  3ZMU B;  1MND A;  3JC6 C;  3HI2 A;  3LK2 B;  1WYB A;  4ILU A;  5EZY E;  4EIW A;  1MMA A;  2LOP A;  2Q9Q B;  3WAK A;  4YJ3 E;  3K3O A;  4PK5 A;  4HTE A;  1WYC A;  2NTX A;  3MAC A;  3PE0 A;  5HWY A;  4OFZ A;  4YJ2 E;  2DI4 A;  3CWZ B;  3ZCJ A;  5LGU B;  2E9X A;  2CE7 A;  2KXP B;  5LOV E;  2CMR A;  3PUG A;  3RC8 A;  4F6R C;  3MZK B;  2WWU A;  3T8O A;  1D0Y A;  4MBQ A;  1QSD A;  5FXW A;  4IHJ E;  4YHJ A;  5IHY A;  3C4Z A;  4JLE A;  3FHN A;  3RYH E;  3D0T A;  1QUU A;  3E0Z A;  3LG7 A;  1NWM X;  4QXB B;  3IHR A;  5LP6 E;  3RC3 A;  1MNE A;  4AQF C;  2ZLY A;  5J2T E;  2Q9Q D;  1LRZ A;  2UXN B;  3VU7 H;  1MIW A;  5EK2 A;  3J7Y q;  3O1J A;  1U4Q A;  3GN5 A;  2CXF A;  2XAS B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...