3VU7H

Crystal structure of rev1-rev7-rev3 ternary complex
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
94
structure length
94
Chain Sequence
PNLAGAVEFNDVKTLLREWITTISDPMEEDILQVVKYCTDLIEEKDLEKLDLVIKYMKRLMQQSVESVWNMAFDFILDNVQVVLQQTYGSTLKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis of recruitment of DNA polymerase [zeta] by interaction between REV1 and REV7 proteins
pubmed doi rcsb
source organism Homo sapiens
molecule tags Replication
molecule keywords DNA repair protein REV1
total genus 31
structure length 94
sequence length 94
ec nomenclature
pdb deposition date 2012-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF16727 REV1_C DNA repair protein REV1 C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1280 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3vu7H00
4EXTA 4BA9A 4FJOA 2LSGA 2LSKA 2LSJA 4GK0E 3VU7H 2LSIA 2LSYA 2N1GA 4GK5E
chains in the Genus database with same CATH superfamily
1ZEEA 3O1JA 4G2AA 3E08A 4HWCA 2XZEA 5AQTB 4ZZCA 5CB4E 2BS2A 5DQVA 4X66T 2WDRA 2BG9C 2RP4A 4IDPA 2E9XB 3I9YA 4LMKA 3AEDA 2Z6EA 3AE9A 4WNKA 1YQ3A 5DJQC 5JREA 2ZLYA 2UXXB 4DIDB 3C98B 2WP9A 5FVLA 3J7Yq 4PK4A 3PDYA 3AE6A 2XUEA 2I0MA 2HPLA 1U4QA 3CIRA 1JNZA 3ONXA 4TV9E 3IBPA 4HFEA 2XAJB 4QXHB 4V1Av 2JJ9A 2MYSA 5IYZE 4EB6E 3KV5A 2XAGB 3CX6B 2IC9A 3GN5A 2BVLA 4UELA 4DV5T 1HFAA 4QX7B 3LG7A 2V7KA 2HH7A 1QLBA 4YJ3E 3UTKA 3AE4A 3AE8A 1VCSA 4TN7B 3AAAB 3ZSTA 3RPUA 5JDHA 2LM9A 4HWIB 2W66A 2JQHA 2V26A 3NBXX 3O4XE 3SWHA 1ZP0A 2IAKA 2NW8A 2E5LT 4WBOA 4CN1A 1D1AA 1UK5A 2LHNA 2Y8DA 3FZKB 4FJOA 5JDMA 4AKGA 3K3QC 1KK7A 4U72A 5HEOA 1BR2A 2WBLA 3QB5A 4HFHA 4TUYE 4UVBB 2FUPA 2K5BB 2QA7A 3KV9A 3ZJ1A 2LOPA 3B13A 3M3ZB 4UVAB 5CJ5A 3ANWA 1T7SA 4UV9B 2WSSV 4IHJE 5AQFB 5HCJA 1MIYA 2GK9A 3RIFA 4IDZA 4F6RC 4LF4T 5JH7E 5L2LA 3N5LA 2V6YB 3HKBE 5HXEA 5IWAT 5LHIB 4CI2B 4AI6A 3Q5XA 5JR9C 2L3LA 2W62A 5L3FB 4QKNA 4UF0A 2ZM2A 5A1LA 5LHGB 2VQFT 4AQYT 4O4HE 5LCYA 2WZHA 3AE2A 4EYYR 2EHOD 3ZT5A 4ZZBA 2DI4A 2NTXA 4O4IE 4PJJA 3RRCA 3JC6C 4EZHA 5ABFB 1I94T 3AEAA 4IE7A 3H3MA 3ZYKA 4ZEYA 4DR2T 4YTPA 5L3DB 5HWYA 1HG5A 1QUUA 2WM9A 4KP3C 2XQ7A 3FZFB 2J1DG 3EI0A 2WZIA 3QOFA 1AJ3A 1HG2A 1U5PA 2W0GA 4B3MT 4TX5A 1US7B 2MPKA 1HF8A 4YT0A 4DMWA 5LGNB 3O1IA 3AEGA 5ADXL 5L3BB 5LGTB 3CX8B 4DV2T 2BVMA 2AXDS 5ABGA 4LFBT 2JMHA 2LJLA 4XBFB 1QSDA 3AVRA 1J5ET 2W67A 3ETVA 4A56A 4ZS3A 4BA9A 3Q2MA 5IUXA 4NUVA 5FYMA 5JVDE 1HX8A 1OXZA 2VL8A 3AA7B 2W2UA 4ZXLA 3BQKA 4PW8A 3TLVA 4HTEA 2WMNA 2BBJA 1W0AA 4YSZA 2P9BA 3UU8A 2C5KT 3KDSE 4DUZT 3UU6A 4F8HA 1IZNB 4H9RC 3AA0B 4JUYA 3PE0A 4MHCA 4ZI7E 1SA0E 3AAEB 3N9LA 3ZN1B 5JQGE 5GONE 1WYCA 2V7JA 1KF6A 4DV3T 2C5IT 3DTOA 3PUXF 3FXDB 2MAWA 3IEEA 3HA4A 1IJ6A 2Q9QA 3AE1A 4OYJA 4YFSA 1G73A 5HXSA 2VB6A 4LMLA 1XMQT 1N33T 1HS7A 4U2YA 4AXPA 4E7ZA 5JTGA 2UXDT 4Z91A 4LF8T 3L39A 3AEBA 3DP7A 3F31A 3FBZA 2EHOC 1Y01A 3RIUC 3UQ7A 4X20E 3SS1A 1LVFA 3B57A 1CHUA 3FXEB 4ISTA 2IC6A 2WY2A 2Y6XA 4TNVA 4UIGA 2CM0A 5AQVB 5F5WA 1FEWA 2CA5A 3HKCE 2XQ8A 4HWHA 2A9UA 4HFIA 3RKGA 4B3RT 3ZC0A 3RC3A 1W9RA 4O8SA 4UV8B 4H63H 4PNIA 3PUYF 3AECA 3E0ZA 3L09A 2DL1A 1J5WA 3F2EA 4IGUA 5LG4A 4B3ST 2OA5A 3PUWF 1BR4A 4A5XA 4COFA 3I1AA 4JI5T 2D9DA 3KV6A 5AQQB 5LGUB 4JYAT 4TZ4C 4TWHA 4BAYB 5LMNT 2DLRA 1WCRA 4KI0F 5AQPB 1XMOT 5LOVE 3TLSA 3FB2A 3N2GE 3LK3B 1X9BA 3P8CD 4E7SA 3TLWA 3VR9A 3ZYLA 2CBJA 1W09A 3A5XA 5LP6E 2WU2A 5C8YE 5J2TE 1D1BA 2B1EA 3IA3A 3RYFE 2JPFA 1T98A 3P4SA 4HFDA 5IHYA 1N36T 2UUAT 4HKAA 2RPAA 3AE7A 2K3WA 5AQKB 2VVSA 4EEDA 1KNRA 2VKJA 3RI5A 3UUBA 1CUNA 4YHJA 5EK3A 4ADZA 5AFUL 5J0ZA 2QVAA 5AQJB 3FHNA 5FY0A 2VQET 2MBGA 5M4YA 5CA1E 2EHOA 5FXWA 1N34T 3AXJA 3C51A 3PU3A 2VKDA 3AEFA 3JC6D 3OBVE 1IBLT 3I0OA 2DNXA 2LEHA 3I0QA 3OKQA 3ZLIA 2DWGA 1LVKA 4DR6T 3QNUA 1NAFA 2LSIA 2LT3A 3ZN0B 5ABHA 1IBKT 3RQWA 4ZI3D 3M65A 2X0YA 5AQUB 1HNZT 5EZYE 1W0BA 2NP9A 3RQUA 4KBMB 2E2AA 3N9QA 2YDSA 4QHOA 4YTMA 3ZMUB 5HXHA 2LLYA 3P4PA 4AKLA 2CWOA 4K0UA 5E0OA 5L3GB 1VCTA 3P4QA 1R8IA 3C4ZA 4H9SE 3ZCIA 4CXXA 2K24A 2W61A 3SOLA 5LMUT 3W15B 3PUAA 4AQGA 3PJAJ 1T8BA 2V5CA 5EK4A 2ZMAA 3EHZA 1KFYA 2CCQA 3NWIA 4QX8B 5AQLB 3ZMSB 4DV6T 4JI8T 4JI1T 4OX9T 3HL6A 3KVAA 4IE6A 2PG8A 5LNKA 2LSYA 5HXCA 3P50A 2H7VC 5FMNA 3TLTA 4H9OC 4O4JE 3JADA 1FMWA 4CXWA 4PJNA 3OVUA 5AQGB 1MIWA 4PK5A 4HFVA 3N9OA 5AQSB 1WYBA 4FI5A 4JEUB 5HEGA 3UFEA 3ZJ2A 1SHZC 1T72A 2KXPB 4X1YE 3PUVF 2PFVA 3N9NA 4DV1T 2KWHA 4H9NC 3J9X1 2FBWA 3OPCA 4HEAA 1ZKEA 1XDOA 5JRCA 1MMDA 1S94A 2JQQA 3JAEA 3O1HA 4PJMA 5FVKA 1VOMA 2NR4A 2XM2A 1WRDA 2IUBA 5KX5E 4DR7T 1IBMT 1LRZA 2QYWA 3RRWA 3KV4A 4LF6T 5TAOA 5CFBA 3E22E 3NKZA 4IIJE 3SRZA 5JR9A 3GA8A 1KNZA 4AKRB 3OYXA 1ZOYA 4L0RA 2JQKA 5JDQA 2YU1A 1MNDA 4O4LE 2BKNA 4UR9A 2F4VT 3UUMA 3D0TA 4IT4A 3UFGA 4WYVA 1NENA 1WFDA 2XQ3A 4ILCA 4X65T 2LRKA 2XQAA 2WB5A 2HHHT 5LA6E 3Q9DA 5JDGA 4A98A 1J1JA 2MTQA 4OK0A 4EAHA 4MFRA 3VKHA 2ODVA 3MA9A 2E9XA 3N2KE 3IHRA 4ISSA 3LSVA 2CMRA 4HWFA 3SFDA 3ONLC 4DBRA 2ODUA 3ABVA 2BG9A 5H6QB 1WR6A 1HR0T 3TLUA 3P7IA 2NOXA 2JQ9A 3AE3A 4UXNB 4MALA 2ACXA 5JR9B 3CPZA 3LBXB 2K48A 4HFBA 4HWDA 1Z8UA 4YSYA 2ZM8A 1ZV4X 3K8PC 2D0TA 1OWAA 3CK6A 3PUZF 1UURA 5AQIB 3U78A 1FMVA 2W63A 2WDQA 4N78D 3T1YT 1N32T 5HCMA 2XQYA 3UUNA 4X64T 1ZHCA 4MLKA 2LE8A 4I55E 3EUHA 4PAGA 3RH3A 5CGMA 4C91A 3AEEA 4JBWF 4TV8E 3RYCE 5FL1A 4QXCB 4EGWA 4IDNA 4IREA 1MMNA 4EEBA 2VWAA 1I6ZA 2OV9A 4EIWA 4IDQA 4DV0T 2NW9A 2KNDA 2QRXA 1IJ5A 2UXNB 2VVNA 3KVBA 3OJAA 5ABFA 1UUSA 2D2SA 4AKHA 3SFEA 3ZYMA 3ZEFB 3WAJA 2J47A 1D0YA 3MJXA 3Q5EA 3RC8A 5FY1A 4ZI3C 3G06A 2YDQA 3PTRB 4YY3T 3UU5A 2SPCA 2BS3A 2I6HA 3FZHB 4NXNT 1MIVA 2AE9A 5FL0A 2QGSA 2XHEB 1YW0A 3CVRA 4ILUA 4IE0A 2UXCT 5L3CB 3CWZB 2UU9T 3AXJB 3ZC1A 4LFCT 4U31A 3S4UA 3LDQB 1M7KA 2B76A 1FIOA 3EDUA 4ASKA 4KUMB 2H89A 4M1PA 2IW5B 2XSBA 2G0UA 2X66A 2X68A 4NPPA 3BQLA 4Q25A 5F3JA 4HFCA 4LF9T 2C0SA 4U74A 1JNRA 1HNWT 3KFWX 5FKYA 3P4RA 1XZYA 2BDEA 4OHFA 5KDMC 3MKDA 1FJGT 3ESLA 2J62A 5HAXA 4X62T 2RA1A 1OEDC 4P0AA 1NEKA 1SUMB 1MMGA 2KWIB 4MBQA 2DWKA 3RHWA 3RIUA 5J2UE 3Q5DA 3PV0F 3ZSSA 1VRBA 2EHOB 2YU2A 5FY7A 5FXXA 5J1GA 2VK9A 3RYIE 3PURA 2LSJA 1WLXA 2WCAA 2LRLA 4DR4T 4DR5T 3MACA 4X5TA 2WDVA 5LHHB 2FJBA 5JDNA 1YXRA 2HPJA 2X51A 3AAIA 3FZLB 4I43B 2PJQA 2XPKA 4HGAA 2BG9B 2CXLA 2X67A 2BKPA 3HKEE 3MK7C 1E1HB 3PU8A 3QC9A 4X1IE 2XY8B 4KHPT 3K1SA 2XQ9A 3UUXB 2V7MA 5JDLA 1E7PA 3A8YC 2KLQA 1YQ4A 3HR0A 4ILAA 5C2TA 2YK0A 2ES0A 5ETWA 4QWNB 2HN1A 2YINA 1UX4A 4G63A 4JI2T 4DV7T 2ZM6T 4K0KT 2VKHA 5DQWA 3R6NA 3UU3A 1XNRT 1OEDE 3GWHA 1HCIA 4O2AE 1YD8G 2BKOA 2KT9A 4IL9A 3DJBA 4LF5T 3FZMB 2FJEA 4I0UA 3WI3A 2LOSA 4YXDA 4DR3T 5HEJA 4TWDA 1DU2A 5LG3A 2Q9QB 5L3EB 3AVSA 3NRXA 3RLFF 5CA0E 3OTOT 3OYZA 2JMKA 1G8XA 2VURA 3RX6A 2CRBA 3CQGB 3LK2B 3Q5WA 2JIWA 3UQ4A 2YN6A 3QK6A 4AQFA 4CI3B 4CZZB 4DUYT 2WWVA 3O9XA 4L9IA 5HEUA 3VRAA 3EVYA 4P1NA 2CLYC 1OEDB 2LKGA 3LJCA 1YKEB 4BJNA 2X9YA 4EZ4A 2UUCT 1D0XA 2LM2A 3CQXC 2DCFA 2J4GA 2PTFA 3LBXA 4HN9A 4Z90A 2UUBT 2CBIA 4JI0T 4GKJT 2NW7A 2M6BA 2KSRA 4IDOA 3JCFA 3R84B 3V5SA 3ZT6A 2X9XA 5KMGP 1O3XA 3CKDA 3HKDE 4QH4A 5LJNA 2E9XD 1XNQT 1X79A 2CPTA 3FBLA 3I9WA 3QB5K 4ZS2A 4ZHQE 4LF7T 5EK2A 2WS3A 2CE7A 4OFZA 1MMAA 2BZBA 4EV6A 3P4WA 4IE5A 4JI3T 5FP3A 2DHRA 5JRCB 1KEYA 4I4TE 2CXFA 4BJMA 4HE8A 3HI2A 4LFAT 2WMOA 4JI6T 5LYJE 1EZ3A 2LSGA 3ONJA 4DMVA 4O2BE 4GK0E 2JRKA 4U33A 2D0UA 2H88A 3H37A 4I50E 4XZCA 5AQNB 3C4XA 2M6IA 3WAKA 5L4EA 4GOUA 3ZMVB 3JAFA 4IE4A 3PUSA 5AQMB 2W4XA 3ETUA 4AISA 4U7IA 2MOZA 2A2FX 3PUQA 3QUJA 1HTJF 4ZI2C 2X9WA 3BK9A 3KINB 2A3DA 5L4HA 4U3CA 4DVDA 5BMVE 4WBNE 4DO0A 4NXMT 1YKHB 2L9QA 2C5JA 2XTLA 2XAQB 4WW0A 4ZI2D 2V6YA 4CQIA 4U7YA 2ACZA 3PUGA 3A7MA 3EDVA 2E5VA 2CXDA 1IAPA 2HN2A 3ANWB 3MZKB 4P0BA 4ZOLE 3VR8A 1Y64B 1H7CA 2W00A 1GQEA 3GMIA 4JI4T 4CN4A 1Z0PA 5DABA 2K9AA 2Q9QC 4UVCB 3ZPOA 2IMLA 2LKHA 2X0LB 1HNXT 2X0HA 1UX5A 4H63V 1UCUA 4UEMA 2XAHB 3LK42 4X1KE 1XWMA 4CI1B 1WR0A 4PK6A 2X9HA 2NWBA 5LBQB 3RGLA 3ZCJA 2VKOA 4KX6A 3RF1A 2CLYB 2E9XC 4YJ2E 4P09A 4C90A 2KZ7B 3RKOA 1BR1A 1M62A 3N2OA 2BBHA 3V5UA 2FJAA 2XSAA 2I59A 2PBIA 2XQ6A 3H3AA 5HXRA 1SE7A 2LSKA 3PJAA 2LHRA 5AQOB 5FNVE 2BG9E 3EAMA 4GKKT 4YTNA 3VKGA 1NWMX 3B5MA 4QH5A 4EXTA 4CXYA 2XQ5A 3C4WA 1HX1B 4KMCA 4UF0B 3ZKRA 4AQFC 2IHR1 3T8OA 3RIAA 2V8SV 3VU7H 2V6XA 2KMFA 2M67A 2NTYA 2ZM0A 3AB3B 2H7OA 4ANJA 3TKLB 5AQRB 5HWXA 2OLTA 3EABA 5L47A 2XASB 5HEHA 4DNDA 2IDOB 3U3IA 3AA6B 1LKXA 2V7IA 4GK5E 2UXBT 3GN5B 4DR1T 4EOZB 5FXZA 4GYRA 3NVOA 2E8IA 1E2AA 2N9DA 2H3RA 2BS4A 2XM1A 3NZPA 5F8PA 4YSXA 1BR0A 4AKIA 2WWUA 3CX7B 2IIUA 2A72A 2YDRA 3K3NA 2L8KA 4PFPA 3UU4A 3KBUA 3VHLA 2N2NA 5FXVA 4B3TT 5JDFA 3N9MA 2FJDA 1L0VA 4CN6A 1KNPA 1S35A 2WAUA 2CEAA 2YEVC 3K3OA 3MXZA 3L3PA 4TWFA 2V5DA 4XAXB 2Q9QD 4Z8XA 2XAFB 2V1DB 2YKSA 3C64A 2CWYA 3X1DA 4AIUA 4B6XA 5BR8T 1V9DA 4QXBB 2Y48B 4GYSA 4NIQA 3AE5A 2YOEA 4H9PC 3VRBA 1UGOA 5H6RB 2WU5A 3F57A 3NRYA 4GIWA 3UT5E 3ZMZB 2R6GF 3KBTA 5LJMA 3RYHE 4JV5T 4JEHB 4LMJA 3N9PA 4A97A 5ABEA 3IF8B 4ILBA 4IL4A 4U2ZA 4WZXA 2XJ7A 5LB7B 4DV4T 2WQYA 4OYKA 3BQIA 4NUUA 3T1HT 5AQHB 4YHHT 4JI7T 1MNEA 2CHNA 4YLHA 4TNWA 1OEDA 2CHOA 1D0ZA 3C50A 5LXTE 1XDPA 2VASA 4EYUA 5HYAA 5KXJA 4PFOA 2N1GA 3CMLA 3NZQA 3ZT7A 4L5GA 4DBQA 5C3JA 2V7LA 3ZMTB 3UULA 1D1CA 1B7TA 3L8RA 4KHZF 4QH1A 5LBMA 2KINB 3AA1B 2D5UA 4JLEA 4PJLA 3CQCB 2XQ4A 4J2CA 4ERRA 2VL0A 3LFMA 4H9QC
chains in the Genus database with same CATH topology
1ZEEA 3O1JA 4G2AA 3E08A 5CB4E 5DQVA 2RP4A 2E9XB 3I9YA 4WNKA 2Z6EA 5DJQC 5JREA 2ZLYA 2UXXB 3C98B 3J7Yq 4PK4A 3PDYA 2XUEA 2HPLA 1U4QA 1KNZA 3ONXA 4TV9E 3IBPA 4QXHB 2XAJB 4V1Av 2JJ9A 2MYSA 5IYZE 4EB6E 3KV5A 2XAGB 3CX6B 2IC9A 3GN5A 2BVLA 4UELA 1HFAA 4QX7B 3LG7A 2V7KA 2HH7A 4YJ3E 3UTKA 4TN7B 3AAAB 3RPUA 5JDHA 2LM9A 3NBXX 2V26A 3O4XE 3SWHA 2NW8A 2IAKA 4WBOA 1D1AA 2LHNA 2Y8DA 4FJOA 5JDMA 4AKGA 3K3QC 1KK7A 4U72A 1BR2A 2WBLA 4TUYE 4UVBB 2QA7A 2K5BB 3KV9A 3ZJ1A 2LOPA 3B13A 4UVAB 3ANWA 4UV9B 2WSSV 4IHJE 4F6RC 1MIYA 2GK9A 4IDZA 5JH7E 5L2LA 3N5LA 4AI6A 3HKBE 5HXEA 5LHIB 4CI2B 3Q5XA 5JR9C 2L3LA 2W62A 5L3FB 4QKNA 4UF0A 2ZM2A 5A1LA 5LHGB 4O4HE 5LCYA 4EYYR 2EHOD 2DI4A 2NTXA 4O4IE 4PJJA 3RRCA 3JC6C 4EZHA 4IE7A 3ZYKA 5L3DB 5HWYA 1HG5A 1QUUA 2WM9A 4KP3C 2J1DG 1AJ3A 1HG2A 1U5PA 2W0GA 4TX5A 1US7B 1HF8A 4DMWA 5LGNB 3O1IA 5ADXL 5LGTB 5L3BB 3CX8B 2BVMA 2JMHA 2LJLA 4XBFB 1QSDA 3AVRA 3ETVA 4A56A 4ZS3A 4BA9A 3Q2MA 4NUVA 5FYMA 5JVDE 1HX8A 1OXZA 2VL8A 3AA7B 3BQKA 4PW8A 4HTEA 2WMNA 2P9BA 2C5KT 3KDSE 1IZNB 4H9RC 3AA0B 4JUYA 3PE0A 4MHCA 4ZI7E 1SA0E 3AAEB 3N9LA 3ZN1B 5JQGE 5GONE 1WYCA 2V7JA 2C5IT 3DTOA 3FXDB 3IEEA 3HA4A 1IJ6A 2Q9QA 4OYJA 4YFSA 5HXSA 1G73A 1HS7A 2VB6A 4AXPA 4E7ZA 3DP7A 3F31A 3FBZA 2EHOC 4X20E 3SS1A 3FXEB 3B57A 1LVFA 4ISTA 2IC6A 2Y6XA 4UIGA 2CM0A 1FEWA 2CA5A 3HKCE 3ZC0A 3RC3A 4O8SA 4UV8B 4H63H 4PNIA 3E0ZA 3L09A 3F2EA 4IGUA 5LG4A 2OA5A 1BR4A 3I1AA 3KV6A 5LGUB 4TZ4C 4BAYB 2DLRA 5LOVE 3FB2A 3N2GE 3LK3B 3P8CD 4E7SA 3A5XA 5LP6E 5C8YE 5J2TE 1D1BA 2B1EA 3RYFE 2JPFA 1T98A 5IHYA 4HKAA 2VKJA 5AFUL 1CUNA 4YHJA 5EK3A 4ADZA 3FHNA 5FY0A 2MBGA 5M4YA 5CA1E 2EHOA 5FXWA 3C51A 3PU3A 2VKDA 3JC6D 3OBVE 3I0OA 2DNXA 2LEHA 3I0QA 3OKQA 3ZLIA 2DWGA 1LVKA 1NAFA 2LSIA 2LT3A 3ZN0B 4ZI3D 3M65A 5EZYE 2NP9A 5HXHA 4KBMB 3N9QA 4QHOA 3ZMUB 4AKLA 5L3GB 2CWOA 4K0UA 5E0OA 4CXXA 3C4ZA 4H9SE 3ZCIA 2K24A 2W61A 3SOLA 3W15B 3PUAA 5EK4A 2ZMAA 3ZMSB 2CCQA 4QX8B 3HL6A 3KVAA 4IE6A 2PG8A 5LNKA 2LSYA 5HXCA 2H7VC 5FMNA 4H9OC 4O4JE 1FMWA 4CXWA 4PJNA 3ZYLA 1MIWA 4PK5A 4HFVA 3N9OA 1WYBA 4FI5A 4JEUB 3UFEA 3ZJ2A 1SHZC 2KXPB 4X1YE 2PFVA 3N9NA 2KWHA 4H9NC 3J9X1 4HEAA 1ZKEA 5JRCA 1MMDA 1S94A 2JQQA 3O1HA 4PJMA 5KX5E 1VOMA 1WRDA 1LRZA 3RRWA 3KV4A 5TAOA 3E22E 4IIJE 3SRZA 5JR9A 3GA8A 4AKRB 3OYXA 4L0RA 5JDQA 2YU1A 1MNDA 4O4LE 3UUMA 3D0TA 5LA6E 3Q9DA 5JDGA 2MTQA 4OK0A 4EAHA 4MFRA 3VKHA 2ODVA 3MA9A 2E9XA 3N2KE 3IHRA 4ISSA 2CMRA 4DBRA 2ODUA 5H6QB 1WR6A 3P7IA 2NOXA 4UXNB 4MALA 2ACXA 5JR9B 3CPZA 3LBXB 2K48A 2ZM8A 1ZV4X 3K8PC 2D0TA 1OWAA 3U78A 1FMVA 2W63A 4N78D 2XQYA 3UUNA 1ZHCA 4MLKA 2LE8A 4I55E 3EUHA 4PAGA 3RH3A 4C91A 4TV8E 3RYCE 4QXCB 1MMNA 2VWAA 4EIWA 2NW9A 2KNDA 2UXNB 1IJ5A 3OJAA 4AKHA 3KVBA 2D2SA 3ZYMA 3ZEFB 3WAJA 3MJXA 1D0YA 3RC8A 5FY1A 4ZI3C 3PTRB 2SPCA 1MIVA 2QGSA 2XHEB 1YW0A 3CVRA 4ILUA 4IE0A 5L3CB 3CWZB 3ZC1A 3S4UA 4ASKA 1FIOA 3EDUA 4KUMB 4M1PA 2IW5B 2G0UA 2X66A 2X68A 5F3JA 3BQLA 2C0SA 4U74A 3KFWX 2BDEA 4OHFA 5KDMC 3MKDA 3ESLA 5HAXA 2RA1A 4P0AA 1MMGA 2KWIB 4MBQA 2DWKA 5J2UE 1VRBA 2EHOB 2YU2A 5FY7A 5FXXA 5J1GA 2VK9A 3RYIE 3PURA 2LSJA 1WLXA 3MACA 5LHHB 5JDNA 2HPJA 2X51A 3AAIA 4I43B 2PJQA 4HGAA 4EXTA 4X1IE 2CXLA 2X67A 3MK7C 3HKEE 3QC9A 1E1HB 3PU8A 2V7MA 5JDLA 2KLQA 3HR0A 2YK0A 2ES0A 5ETWA 4QWNB 2YINA 4G63A 1UX4A 2VKHA 5DQWA 3R6NA 3GWHA 1HCIA 4O2AE 1YD8G 2KT9A 3DJBA 3WI3A 2LOSA 2Q9QB 5L3EB 3AVSA 3NRXA 5CA0E 3OYZA 2JMKA 1G8XA 3RX6A 3CQGB 3LK2B 3Q5WA 4CI3B 4CZZB 4AQFA 3QK6A 4L9IA 3EVYA 2CLYC 3LJCA 4EZ4A 1YKEB 4BJNA 2X9YA 1D0XA 3CQXC 2DCFA 3LBXA 4HN9A 2NW7A 3R84B 3V5SA 2X9XA 5KMGP 1O3XA 3CKDA 3HKDE 5LJNA 2E9XD 1X79A 3FBLA 3I9WA 4ZS2A 4ZHQE 5EK2A 2CE7A 4OFZA 1MMAA 2BZBA 4IE5A 5FP3A 2DHRA 5JRCB 4I4TE 4BJMA 2CXFA 4HE8A 3HI2A 2WMOA 5LYJE 1EZ3A 2LSGA 4DMVA 4O2BE 4GK0E 2JRKA 4AQGA 2D0UA 3H37A 4I50E 4XZCA 3WAKA 3C4XA 4GOUA 3ZMVB 4IE4A 3PUSA 3ETUA 2MOZA 2A2FX 3PUQA 3QUJA 1HTJF 4ZI2C 2X9WA 3BK9A 3KINB 2A3DA 4DVDA 5BMVE 4WBNE 4DO0A 1YKHB 2L9QA 2C5JA 2XTLA 2XAQB 4WW0A 4ZI2D 4CQIA 3PUGA 3EDVA 3MZKB 3ANWB 2CXDA 1IAPA 4P0BA 4UEMA 4ZOLE 1Y64B 1H7CA 2W00A 3GMIA 1Z0PA 5DABA 2K9AA 2Q9QC 4UVCB 3ZPOA 2X0LB 1UX5A 4H63V 1UCUA 2XAHB 3LK42 4X1KE 4CI1B 4PK6A 2X9HA 2NWBA 5LBQB 3ZCJA 2VKOA 2CLYB 2E9XC 4YJ2E 4P09A 4C90A 2KZ7B 3RKOA 1BR1A 3N2OA 3V5UA 3H3AA 2I59A 2PBIA 5HXRA 2LSKA 2LHRA 5FNVE 3VKGA 1NWMX 4CXYA 3C4WA 4KMCA 4UF0B 4AQFC 3T8OA 3VU7H 2KMFA 2M67A 2NTYA 2ZM0A 3AB3B 2H7OA 4ANJA 3TKLB 5HWXA 2XASB 4DNDA 3U3IA 3AA6B 1LKXA 2V7IA 4GK5E 3GN5B 4EOZB 5FXZA 4GYRA 3NZPA 2E8IA 2N9DA 3UUXB 2H3RA 1BR0A 5F8PA 4AKIA 2WWUA 3CX7B 2A72A 3K3NA 2L8KA 4PFPA 3KBUA 3VHLA 2N2NA 5FXVA 5JDFA 3N9MA 1S35A 2YEVC 2WAUA 2CEAA 3K3OA 3MXZA 3L3PA 4XAXB 4Z8XA 2Q9QD 2XAFB 2V1DB 4B6XA 3C64A 2CWYA 1V9DA 4QXBB 2Y48B 4GYSA 4H9PC 5H6RB 3UT5E 3F57A 3NRYA 4GIWA 3ZMZB 3KBTA 5LJMA 3RYHE 4JEHB 3N9PA 3O9XA 3IF8B 4OYKA 3BQIA 4NUUA 1MNEA 4YLHA 3C50A 1D0ZA 5LXTE 2VASA 4EYUA 5HYAA 4PFOA 2N1GA 3CMLA 3NZQA 4L5GA 4DBQA 2V7LA 3ZMTB 3UULA 1D1CA 1B7TA 5LBMA 2KINB 3AA1B 2D5UA 4JLEA 4PJLA 3CQCB 4J2CA 4ERRA 3LFMA 4H9QC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EXT A;  4BA9 A;  4FJO A;  2LSG A;  2LSK A;  2LSJ A;  4GK0 E;  3VU7 H;  2LSI A;  2LSY A;  2N1G A;  4GK5 E; 
#chains in the Genus database with same CATH topology
 1ZEE A;  3O1J A;  4G2A A;  3E08 A;  4HWC A;  2XZE A;  5AQT B;  4ZZC A;  5CB4 E;  2BS2 A;  5DQV A;  4X66 T;  2WDR A;  2BG9 C;  2RP4 A;  4IDP A;  2E9X B;  3I9Y A;  4LMK A;  3AED A;  2Z6E A;  3AE9 A;  4WNK A;  1YQ3 A;  5DJQ C;  5JRE A;  2ZLY A;  2UXX B;  4DID B;  3C98 B;  2WP9 A;  5FVL A;  3J7Y q;  4PK4 A;  3PDY A;  3AE6 A;  2XUE A;  2I0M A;  2HPL A;  1U4Q A;  3CIR A;  1JNZ A;  3ONX A;  4TV9 E;  3IBP A;  4HFE A;  2XAJ B;  4QXH B;  4V1A v;  2JJ9 A;  2MYS A;  5IYZ E;  4EB6 E;  3KV5 A;  2XAG B;  3CX6 B;  2IC9 A;  3GN5 A;  2BVL A;  4UEL A;  4DV5 T;  1HFA A;  4QX7 B;  3LG7 A;  2V7K A;  2HH7 A;  1QLB A;  4YJ3 E;  3UTK A;  3AE4 A;  3AE8 A;  1VCS A;  4TN7 B;  3AAA B;  3ZST A;  3RPU A;  5JDH A;  2LM9 A;  4HWI B;  2W66 A;  2JQH A;  2V26 A;  3NBX X;  3O4X E;  3SWH A;  1ZP0 A;  2IAK A;  2NW8 A;  2E5L T;  4WBO A;  4CN1 A;  1D1A A;  1UK5 A;  2LHN A;  2Y8D A;  3FZK B;  4FJO A;  5JDM A;  4AKG A;  3K3Q C;  1KK7 A;  4U72 A;  5HEO A;  1BR2 A;  2WBL A;  3QB5 A;  4HFH A;  4TUY E;  4UVB B;  2FUP A;  2K5B B;  2QA7 A;  3KV9 A;  3ZJ1 A;  2LOP A;  3B13 A;  3M3Z B;  4UVA B;  5CJ5 A;  3ANW A;  1T7S A;  4UV9 B;  2WSS V;  4IHJ E;  5AQF B;  5HCJ A;  1MIY A;  2GK9 A;  3RIF A;  4IDZ A;  4F6R C;  4LF4 T;  5JH7 E;  5L2L A;  3N5L A;  2V6Y B;  3HKB E;  5HXE A;  5IWA T;  5LHI B;  4CI2 B;  4AI6 A;  3Q5X A;  5JR9 C;  2L3L A;  2W62 A;  5L3F B;  4QKN A;  4UF0 A;  2ZM2 A;  5A1L A;  5LHG B;  2VQF T;  4AQY T;  4O4H E;  5LCY A;  2WZH A;  3AE2 A;  4EYY R;  2EHO D;  3ZT5 A;  4ZZB A;  2DI4 A;  2NTX A;  4O4I E;  4PJJ A;  3RRC A;  3JC6 C;  4EZH A;  5ABF B;  1I94 T;  3AEA A;  4IE7 A;  3H3M A;  3ZYK A;  4ZEY A;  4DR2 T;  4YTP A;  5L3D B;  5HWY A;  1HG5 A;  1QUU A;  2WM9 A;  4KP3 C;  2XQ7 A;  3FZF B;  2J1D G;  3EI0 A;  2WZI A;  3QOF A;  1AJ3 A;  1HG2 A;  1U5P A;  2W0G A;  4B3M T;  4TX5 A;  1US7 B;  2MPK A;  1HF8 A;  4YT0 A;  4DMW A;  5LGN B;  3O1I A;  3AEG A;  5ADX L;  5L3B B;  5LGT B;  3CX8 B;  4DV2 T;  2BVM A;  2AXD S;  5ABG A;  4LFB T;  2JMH A;  2LJL A;  4XBF B;  1QSD A;  3AVR A;  1J5E T;  2W67 A;  3ETV A;  4A56 A;  4ZS3 A;  4BA9 A;  3Q2M A;  5IUX A;  4NUV A;  5FYM A;  5JVD E;  1HX8 A;  1OXZ A;  2VL8 A;  3AA7 B;  2W2U A;  4ZXL A;  3BQK A;  4PW8 A;  3TLV A;  4HTE A;  2WMN A;  2BBJ A;  1W0A A;  4YSZ A;  2P9B A;  3UU8 A;  2C5K T;  3KDS E;  4DUZ T;  3UU6 A;  4F8H A;  1IZN B;  4H9R C;  3AA0 B;  4JUY A;  3PE0 A;  4MHC A;  4ZI7 E;  1SA0 E;  3AAE B;  3N9L A;  3ZN1 B;  5JQG E;  5GON E;  1WYC A;  2V7J A;  1KF6 A;  4DV3 T;  2C5I T;  3DTO A;  3PUX F;  3FXD B;  2MAW A;  3IEE A;  3HA4 A;  1IJ6 A;  2Q9Q A;  3AE1 A;  4OYJ A;  4YFS A;  1G73 A;  5HXS A;  2VB6 A;  4LML A;  1XMQ T;  1N33 T;  1HS7 A;  4U2Y A;  4AXP A;  4E7Z A;  5JTG A;  2UXD T;  4Z91 A;  4LF8 T;  3L39 A;  3AEB A;  3DP7 A;  3F31 A;  3FBZ A;  2EHO C;  1Y01 A;  3RIU C;  3UQ7 A;  4X20 E;  3SS1 A;  1LVF A;  3B57 A;  1CHU A;  3FXE B;  4IST A;  2IC6 A;  2WY2 A;  2Y6X A;  4TNV A;  4UIG A;  2CM0 A;  5AQV B;  5F5W A;  1FEW A;  2CA5 A;  3HKC E;  2XQ8 A;  4HWH A;  2A9U A;  4HFI A;  3RKG A;  4B3R T;  3ZC0 A;  3RC3 A;  1W9R A;  4O8S A;  4UV8 B;  4H63 H;  4PNI A;  3PUY F;  3AEC A;  3E0Z A;  3L09 A;  2DL1 A;  1J5W A;  3F2E A;  4IGU A;  5LG4 A;  4B3S T;  2OA5 A;  3PUW F;  1BR4 A;  4A5X A;  4COF A;  3I1A A;  4JI5 T;  2D9D A;  3KV6 A;  5AQQ B;  5LGU B;  4JYA T;  4TZ4 C;  4TWH A;  4BAY B;  5LMN T;  2DLR A;  1WCR A;  4KI0 F;  5AQP B;  1XMO T;  5LOV E;  3TLS A;  3FB2 A;  3N2G E;  3LK3 B;  1X9B A;  3P8C D;  4E7S A;  3TLW A;  3VR9 A;  3ZYL A;  2CBJ A;  1W09 A;  3A5X A;  5LP6 E;  2WU2 A;  5C8Y E;  5J2T E;  1D1B A;  2B1E A;  3IA3 A;  3RYF E;  2JPF A;  1T98 A;  3P4S A;  4HFD A;  5IHY A;  1N36 T;  2UUA T;  4HKA A;  2RPA A;  3AE7 A;  2K3W A;  5AQK B;  2VVS A;  4EED A;  1KNR A;  2VKJ A;  3RI5 A;  3UUB A;  1CUN A;  4YHJ A;  5EK3 A;  4ADZ A;  5AFU L;  5J0Z A;  2QVA A;  5AQJ B;  3FHN A;  5FY0 A;  2VQE T;  2MBG A;  5M4Y A;  5CA1 E;  2EHO A;  5FXW A;  1N34 T;  3AXJ A;  3C51 A;  3PU3 A;  2VKD A;  3AEF A;  3JC6 D;  3OBV E;  1IBL T;  3I0O A;  2DNX A;  2LEH A;  3I0Q A;  3OKQ A;  3ZLI A;  2DWG A;  1LVK A;  4DR6 T;  3QNU A;  1NAF A;  2LSI A;  2LT3 A;  3ZN0 B;  5ABH A;  1IBK T;  3RQW A;  4ZI3 D;  3M65 A;  2X0Y A;  5AQU B;  1HNZ T;  5EZY E;  1W0B A;  2NP9 A;  3RQU A;  4KBM B;  2E2A A;  3N9Q A;  2YDS A;  4QHO A;  4YTM A;  3ZMU B;  5HXH A;  2LLY A;  3P4P A;  4AKL A;  2CWO A;  4K0U A;  5E0O A;  5L3G B;  1VCT A;  3P4Q A;  1R8I A;  3C4Z A;  4H9S E;  3ZCI A;  4CXX A;  2K24 A;  2W61 A;  3SOL A;  5LMU T;  3W15 B;  3PUA A;  4AQG A;  3PJA J;  1T8B A;  2V5C A;  5EK4 A;  2ZMA A;  3EHZ A;  1KFY A;  2CCQ A;  3NWI A;  4QX8 B;  5AQL B;  3ZMS B;  4DV6 T;  4JI8 T;  4JI1 T;  4OX9 T;  3HL6 A;  3KVA A;  4IE6 A;  2PG8 A;  5LNK A;  2LSY A;  5HXC A;  3P50 A;  2H7V C;  5FMN A;  3TLT A;  4H9O C;  4O4J E;  3JAD A;  1FMW A;  4CXW A;  4PJN A;  3OVU A;  5AQG B;  1MIW A;  4PK5 A;  4HFV A;  3N9O A;  5AQS B;  1WYB A;  4FI5 A;  4JEU B;  5HEG A;  3UFE A;  3ZJ2 A;  1SHZ C;  1T72 A;  2KXP B;  4X1Y E;  3PUV F;  2PFV A;  3N9N A;  4DV1 T;  2KWH A;  4H9N C;  3J9X 1;  2FBW A;  3OPC A;  4HEA A;  1ZKE A;  1XDO A;  5JRC A;  1MMD A;  1S94 A;  2JQQ A;  3JAE A;  3O1H A;  4PJM A;  5FVK A;  1VOM A;  2NR4 A;  2XM2 A;  1WRD A;  2IUB A;  5KX5 E;  4DR7 T;  1IBM T;  1LRZ A;  2QYW A;  3RRW A;  3KV4 A;  4LF6 T;  5TAO A;  5CFB A;  3E22 E;  3NKZ A;  4IIJ E;  3SRZ A;  5JR9 A;  3GA8 A;  1KNZ A;  4AKR B;  3OYX A;  1ZOY A;  4L0R A;  2JQK A;  5JDQ A;  2YU1 A;  1MND A;  4O4L E;  2BKN A;  4UR9 A;  2F4V T;  3UUM A;  3D0T A;  4IT4 A;  3UFG A;  4WYV A;  1NEN A;  1WFD A;  2XQ3 A;  4ILC A;  4X65 T;  2LRK A;  2XQA A;  2WB5 A;  2HHH T;  5LA6 E;  3Q9D A;  5JDG A;  4A98 A;  1J1J A;  2MTQ A;  4OK0 A;  4EAH A;  4MFR A;  3VKH A;  2ODV A;  3MA9 A;  2E9X A;  3N2K E;  3IHR A;  4ISS A;  3LSV A;  2CMR A;  4HWF A;  3SFD A;  3ONL C;  4DBR A;  2ODU A;  3ABV A;  2BG9 A;  5H6Q B;  1WR6 A;  1HR0 T;  3TLU A;  3P7I A;  2NOX A;  2JQ9 A;  3AE3 A;  4UXN B;  4MAL A;  2ACX A;  5JR9 B;  3CPZ A;  3LBX B;  2K48 A;  4HFB A;  4HWD A;  1Z8U A;  4YSY A;  2ZM8 A;  1ZV4 X;  3K8P C;  2D0T A;  1OWA A;  3CK6 A;  3PUZ F;  1UUR A;  5AQI B;  3U78 A;  1FMV A;  2W63 A;  2WDQ A;  4N78 D;  3T1Y T;  1N32 T;  5HCM A;  2XQY A;  3UUN A;  4X64 T;  1ZHC A;  4MLK A;  2LE8 A;  4I55 E;  3EUH A;  4PAG A;  3RH3 A;  5CGM A;  4C91 A;  3AEE A;  4JBW F;  4TV8 E;  3RYC E;  5FL1 A;  4QXC B;  4EGW A;  4IDN A;  4IRE A;  1MMN A;  4EEB A;  2VWA A;  1I6Z A;  2OV9 A;  4EIW A;  4IDQ A;  4DV0 T;  2NW9 A;  2KND A;  2QRX A;  1IJ5 A;  2UXN B;  2VVN A;  3KVB A;  3OJA A;  5ABF A;  1UUS A;  2D2S A;  4AKH A;  3SFE A;  3ZYM A;  3ZEF B;  3WAJ A;  2J47 A;  1D0Y A;  3MJX A;  3Q5E A;  3RC8 A;  5FY1 A;  4ZI3 C;  3G06 A;  2YDQ A;  3PTR B;  4YY3 T;  3UU5 A;  2SPC A;  2BS3 A;  2I6H A;  3FZH B;  4NXN T;  1MIV A;  2AE9 A;  5FL0 A;  2QGS A;  2XHE B;  1YW0 A;  3CVR A;  4ILU A;  4IE0 A;  2UXC T;  5L3C B;  3CWZ B;  2UU9 T;  3AXJ B;  3ZC1 A;  4LFC T;  4U31 A;  3S4U A;  3LDQ B;  1M7K A;  2B76 A;  1FIO A;  3EDU A;  4ASK A;  4KUM B;  2H89 A;  4M1P A;  2IW5 B;  2XSB A;  2G0U A;  2X66 A;  2X68 A;  4NPP A;  3BQL A;  4Q25 A;  5F3J A;  4HFC A;  4LF9 T;  2C0S A;  4U74 A;  1JNR A;  1HNW T;  3KFW X;  5FKY A;  3P4R A;  1XZY A;  2BDE A;  4OHF A;  5KDM C;  3MKD A;  1FJG T;  3ESL A;  2J62 A;  5HAX A;  4X62 T;  2RA1 A;  1OED C;  4P0A A;  1NEK A;  1SUM B;  1MMG A;  2KWI B;  4MBQ A;  2DWK A;  3RHW A;  3RIU A;  5J2U E;  3Q5D A;  3PV0 F;  3ZSS A;  1VRB A;  2EHO B;  2YU2 A;  5FY7 A;  5FXX A;  5J1G A;  2VK9 A;  3RYI E;  3PUR A;  2LSJ A;  1WLX A;  2WCA A;  2LRL A;  4DR4 T;  4DR5 T;  3MAC A;  4X5T A;  2WDV A;  5LHH B;  2FJB A;  5JDN A;  1YXR A;  2HPJ A;  2X51 A;  3AAI A;  3FZL B;  4I43 B;  2PJQ A;  2XPK A;  4HGA A;  2BG9 B;  2CXL A;  2X67 A;  2BKP A;  3HKE E;  3MK7 C;  1E1H B;  3PU8 A;  3QC9 A;  4X1I E;  2XY8 B;  4KHP T;  3K1S A;  2XQ9 A;  3UUX B;  2V7M A;  5JDL A;  1E7P A;  3A8Y C;  2KLQ A;  1YQ4 A;  3HR0 A;  4ILA A;  5C2T A;  2YK0 A;  2ES0 A;  5ETW A;  4QWN B;  2HN1 A;  2YIN A;  1UX4 A;  4G63 A;  4JI2 T;  4DV7 T;  2ZM6 T;  4K0K T;  2VKH A;  5DQW A;  3R6N A;  3UU3 A;  1XNR T;  1OED E;  3GWH A;  1HCI A;  4O2A E;  1YD8 G;  2BKO A;  2KT9 A;  4IL9 A;  3DJB A;  4LF5 T;  3FZM B;  2FJE A;  4I0U A;  3WI3 A;  2LOS A;  4YXD A;  4DR3 T;  5HEJ A;  4TWD A;  1DU2 A;  5LG3 A;  2Q9Q B;  5L3E B;  3AVS A;  3NRX A;  3RLF F;  5CA0 E;  3OTO T;  3OYZ A;  2JMK A;  1G8X A;  2VUR A;  3RX6 A;  2CRB A;  3CQG B;  3LK2 B;  3Q5W A;  2JIW A;  3UQ4 A;  2YN6 A;  3QK6 A;  4AQF A;  4CI3 B;  4CZZ B;  4DUY T;  2WWV A;  3O9X A;  4L9I A;  5HEU A;  3VRA A;  3EVY A;  4P1N A;  2CLY C;  1OED B;  2LKG A;  3LJC A;  1YKE B;  4BJN A;  2X9Y A;  4EZ4 A;  2UUC T;  1D0X A;  2LM2 A;  3CQX C;  2DCF A;  2J4G A;  2PTF A;  3LBX A;  4HN9 A;  4Z90 A;  2UUB T;  2CBI A;  4JI0 T;  4GKJ T;  2NW7 A;  2M6B A;  2KSR A;  4IDO A;  3JCF A;  3R84 B;  3V5S A;  3ZT6 A;  2X9X A;  5KMG P;  1O3X A;  3CKD A;  3HKD E;  4QH4 A;  5LJN A;  2E9X D;  1XNQ T;  1X79 A;  2CPT A;  3FBL A;  3I9W A;  3QB5 K;  4ZS2 A;  4ZHQ E;  4LF7 T;  5EK2 A;  2WS3 A;  2CE7 A;  4OFZ A;  1MMA A;  2BZB A;  4EV6 A;  3P4W A;  4IE5 A;  4JI3 T;  5FP3 A;  2DHR A;  5JRC B;  1KEY A;  4I4T E;  2CXF A;  4BJM A;  4HE8 A;  3HI2 A;  4LFA T;  2WMO A;  4JI6 T;  5LYJ E;  1EZ3 A;  2LSG A;  3ONJ A;  4DMV A;  4O2B E;  4GK0 E;  2JRK A;  4U33 A;  2D0U A;  2H88 A;  3H37 A;  4I50 E;  4XZC A;  5AQN B;  3C4X A;  2M6I A;  3WAK A;  5L4E A;  4GOU A;  3ZMV B;  3JAF A;  4IE4 A;  3PUS A;  5AQM B;  2W4X A;  3ETU A;  4AIS A;  4U7I A;  2MOZ A;  2A2F X;  3PUQ A;  3QUJ A;  1HTJ F;  4ZI2 C;  2X9W A;  3BK9 A;  3KIN B;  2A3D A;  5L4H A;  4U3C A;  4DVD A;  5BMV E;  4WBN E;  4DO0 A;  4NXM T;  1YKH B;  2L9Q A;  2C5J A;  2XTL A;  2XAQ B;  4WW0 A;  4ZI2 D;  2V6Y A;  4CQI A;  4U7Y A;  2ACZ A;  3PUG A;  3A7M A;  3EDV A;  2E5V A;  2CXD A;  1IAP A;  2HN2 A;  3ANW B;  3MZK B;  4P0B A;  4ZOL E;  3VR8 A;  1Y64 B;  1H7C A;  2W00 A;  1GQE A;  3GMI A;  4JI4 T;  4CN4 A;  1Z0P A;  5DAB A;  2K9A A;  2Q9Q C;  4UVC B;  3ZPO A;  2IML A;  2LKH A;  2X0L B;  1HNX T;  2X0H A;  1UX5 A;  4H63 V;  1UCU A;  4UEM A;  2XAH B;  3LK4 2;  4X1K E;  1XWM A;  4CI1 B;  1WR0 A;  4PK6 A;  2X9H A;  2NWB A;  5LBQ B;  3RGL A;  3ZCJ A;  2VKO A;  4KX6 A;  3RF1 A;  2CLY B;  2E9X C;  4YJ2 E;  4P09 A;  4C90 A;  2KZ7 B;  3RKO A;  1BR1 A;  1M62 A;  3N2O A;  2BBH A;  3V5U A;  2FJA A;  2XSA A;  2I59 A;  2PBI A;  2XQ6 A;  3H3A A;  5HXR A;  1SE7 A;  2LSK A;  3PJA A;  2LHR A;  5AQO B;  5FNV E;  2BG9 E;  3EAM A;  4GKK T;  4YTN A;  3VKG A;  1NWM X;  3B5M A;  4QH5 A;  4EXT A;  4CXY A;  2XQ5 A;  3C4W A;  1HX1 B;  4KMC A;  4UF0 B;  3ZKR A;  4AQF C;  2IHR 1;  3T8O A;  3RIA A;  2V8S V;  3VU7 H;  2V6X A;  2KMF A;  2M67 A;  2NTY A;  2ZM0 A;  3AB3 B;  2H7O A;  4ANJ A;  3TKL B;  5AQR B;  5HWX A;  2OLT A;  3EAB A;  5L47 A;  2XAS B;  5HEH A;  4DND A;  2IDO B;  3U3I A;  3AA6 B;  1LKX A;  2V7I A;  4GK5 E;  2UXB T;  3GN5 B;  4DR1 T;  4EOZ B;  5FXZ A;  4GYR A;  3NVO A;  2E8I A;  1E2A A;  2N9D A;  2H3R A;  2BS4 A;  2XM1 A;  3NZP A;  5F8P A;  4YSX A;  1BR0 A;  4AKI A;  2WWU A;  3CX7 B;  2IIU A;  2A72 A;  2YDR A;  3K3N A;  2L8K A;  4PFP A;  3UU4 A;  3KBU A;  3VHL A;  2N2N A;  5FXV A;  4B3T T;  5JDF A;  3N9M A;  2FJD A;  1L0V A;  4CN6 A;  1KNP A;  1S35 A;  2WAU A;  2CEA A;  2YEV C;  3K3O A;  3MXZ A;  3L3P A;  4TWF A;  2V5D A;  4XAX B;  2Q9Q D;  4Z8X A;  2XAF B;  2V1D B;  2YKS A;  3C64 A;  2CWY A;  3X1D A;  4AIU A;  4B6X A;  5BR8 T;  1V9D A;  4QXB B;  2Y48 B;  4GYS A;  4NIQ A;  3AE5 A;  2YOE A;  4H9P C;  3VRB A;  1UGO A;  5H6R B;  2WU5 A;  3F57 A;  3NRY A;  4GIW A;  3UT5 E;  3ZMZ B;  2R6G F;  3KBT A;  5LJM A;  3RYH E;  4JV5 T;  4JEH B;  4LMJ A;  3N9P A;  4A97 A;  5ABE A;  3IF8 B;  4ILB A;  4IL4 A;  4U2Z A;  4WZX A;  2XJ7 A;  5LB7 B;  4DV4 T;  2WQY A;  4OYK A;  3BQI A;  4NUU A;  3T1H T;  5AQH B;  4YHH T;  4JI7 T;  1MNE A;  2CHN A;  4YLH A;  4TNW A;  1OED A;  2CHO A;  1D0Z A;  3C50 A;  5LXT E;  1XDP A;  2VAS A;  4EYU A;  5HYA A;  5KXJ A;  4PFO A;  2N1G A;  3CML A;  3NZQ A;  3ZT7 A;  4L5G A;  4DBQ A;  5C3J A;  2V7L A;  3ZMT B;  3UUL A;  1D1C A;  1B7T A;  3L8R A;  4KHZ F;  4QH1 A;  5LBM A;  2KIN B;  3AA1 B;  2D5U A;  4JLE A;  4PJL A;  3CQC B;  2XQ4 A;  4J2C A;  4ERR A;  2VL0 A;  3LFM A;  4H9Q C; 
#chains in the Genus database with same CATH homology
 1ZEE A;  3O1J A;  4G2A A;  3E08 A;  5CB4 E;  5DQV A;  2RP4 A;  2E9X B;  3I9Y A;  4WNK A;  2Z6E A;  5DJQ C;  5JRE A;  2ZLY A;  2UXX B;  3C98 B;  3J7Y q;  4PK4 A;  3PDY A;  2XUE A;  2HPL A;  1U4Q A;  1KNZ A;  3ONX A;  4TV9 E;  3IBP A;  4QXH B;  2XAJ B;  4V1A v;  2JJ9 A;  2MYS A;  5IYZ E;  4EB6 E;  3KV5 A;  2XAG B;  3CX6 B;  2IC9 A;  3GN5 A;  2BVL A;  4UEL A;  1HFA A;  4QX7 B;  3LG7 A;  2V7K A;  2HH7 A;  4YJ3 E;  3UTK A;  4TN7 B;  3AAA B;  3RPU A;  5JDH A;  2LM9 A;  3NBX X;  2V26 A;  3O4X E;  3SWH A;  2NW8 A;  2IAK A;  4WBO A;  1D1A A;  2LHN A;  2Y8D A;  4FJO A;  5JDM A;  4AKG A;  3K3Q C;  1KK7 A;  4U72 A;  1BR2 A;  2WBL A;  4TUY E;  4UVB B;  2QA7 A;  2K5B B;  3KV9 A;  3ZJ1 A;  2LOP A;  3B13 A;  4UVA B;  3ANW A;  4UV9 B;  2WSS V;  4IHJ E;  4F6R C;  1MIY A;  2GK9 A;  4IDZ A;  5JH7 E;  5L2L A;  3N5L A;  4AI6 A;  3HKB E;  5HXE A;  5LHI B;  4CI2 B;  3Q5X A;  5JR9 C;  2L3L A;  2W62 A;  5L3F B;  4QKN A;  4UF0 A;  2ZM2 A;  5A1L A;  5LHG B;  4O4H E;  5LCY A;  4EYY R;  2EHO D;  2DI4 A;  2NTX A;  4O4I E;  4PJJ A;  3RRC A;  3JC6 C;  4EZH A;  4IE7 A;  3ZYK A;  5L3D B;  5HWY A;  1HG5 A;  1QUU A;  2WM9 A;  4KP3 C;  2J1D G;  1AJ3 A;  1HG2 A;  1U5P A;  2W0G A;  4TX5 A;  1US7 B;  1HF8 A;  4DMW A;  5LGN B;  3O1I A;  5ADX L;  5LGT B;  5L3B B;  3CX8 B;  2BVM A;  2JMH A;  2LJL A;  4XBF B;  1QSD A;  3AVR A;  3ETV A;  4A56 A;  4ZS3 A;  4BA9 A;  3Q2M A;  4NUV A;  5FYM A;  5JVD E;  1HX8 A;  1OXZ A;  2VL8 A;  3AA7 B;  3BQK A;  4PW8 A;  4HTE A;  2WMN A;  2P9B A;  2C5K T;  3KDS E;  1IZN B;  4H9R C;  3AA0 B;  4JUY A;  3PE0 A;  4MHC A;  4ZI7 E;  1SA0 E;  3AAE B;  3N9L A;  3ZN1 B;  5JQG E;  5GON E;  1WYC A;  2V7J A;  2C5I T;  3DTO A;  3FXD B;  3IEE A;  3HA4 A;  1IJ6 A;  2Q9Q A;  4OYJ A;  4YFS A;  5HXS A;  1G73 A;  1HS7 A;  2VB6 A;  4AXP A;  4E7Z A;  3DP7 A;  3F31 A;  3FBZ A;  2EHO C;  4X20 E;  3SS1 A;  3FXE B;  3B57 A;  1LVF A;  4IST A;  2IC6 A;  2Y6X A;  4UIG A;  2CM0 A;  1FEW A;  2CA5 A;  3HKC E;  3ZC0 A;  3RC3 A;  4O8S A;  4UV8 B;  4H63 H;  4PNI A;  3E0Z A;  3L09 A;  3F2E A;  4IGU A;  5LG4 A;  2OA5 A;  1BR4 A;  3I1A A;  3KV6 A;  5LGU B;  4TZ4 C;  4BAY B;  2DLR A;  5LOV E;  3FB2 A;  3N2G E;  3LK3 B;  3P8C D;  4E7S A;  3A5X A;  5LP6 E;  5C8Y E;  5J2T E;  1D1B A;  2B1E A;  3RYF E;  2JPF A;  1T98 A;  5IHY A;  4HKA A;  2VKJ A;  5AFU L;  1CUN A;  4YHJ A;  5EK3 A;  4ADZ A;  3FHN A;  5FY0 A;  2MBG A;  5M4Y A;  5CA1 E;  2EHO A;  5FXW A;  3C51 A;  3PU3 A;  2VKD A;  3JC6 D;  3OBV E;  3I0O A;  2DNX A;  2LEH A;  3I0Q A;  3OKQ A;  3ZLI A;  2DWG A;  1LVK A;  1NAF A;  2LSI A;  2LT3 A;  3ZN0 B;  4ZI3 D;  3M65 A;  5EZY E;  2NP9 A;  5HXH A;  4KBM B;  3N9Q A;  4QHO A;  3ZMU B;  4AKL A;  5L3G B;  2CWO A;  4K0U A;  5E0O A;  4CXX A;  3C4Z A;  4H9S E;  3ZCI A;  2K24 A;  2W61 A;  3SOL A;  3W15 B;  3PUA A;  5EK4 A;  2ZMA A;  3ZMS B;  2CCQ A;  4QX8 B;  3HL6 A;  3KVA A;  4IE6 A;  2PG8 A;  5LNK A;  2LSY A;  5HXC A;  2H7V C;  5FMN A;  4H9O C;  4O4J E;  1FMW A;  4CXW A;  4PJN A;  3ZYL A;  1MIW A;  4PK5 A;  4HFV A;  3N9O A;  1WYB A;  4FI5 A;  4JEU B;  3UFE A;  3ZJ2 A;  1SHZ C;  2KXP B;  4X1Y E;  2PFV A;  3N9N A;  2KWH A;  4H9N C;  3J9X 1;  4HEA A;  1ZKE A;  5JRC A;  1MMD A;  1S94 A;  2JQQ A;  3O1H A;  4PJM A;  5KX5 E;  1VOM A;  1WRD A;  1LRZ A;  3RRW A;  3KV4 A;  5TAO A;  3E22 E;  4IIJ E;  3SRZ A;  5JR9 A;  3GA8 A;  4AKR B;  3OYX A;  4L0R A;  5JDQ A;  2YU1 A;  1MND A;  4O4L E;  3UUM A;  3D0T A;  5LA6 E;  3Q9D A;  5JDG A;  2MTQ A;  4OK0 A;  4EAH A;  4MFR A;  3VKH A;  2ODV A;  3MA9 A;  2E9X A;  3N2K E;  3IHR A;  4ISS A;  2CMR A;  4DBR A;  2ODU A;  5H6Q B;  1WR6 A;  3P7I A;  2NOX A;  4UXN B;  4MAL A;  2ACX A;  5JR9 B;  3CPZ A;  3LBX B;  2K48 A;  2ZM8 A;  1ZV4 X;  3K8P C;  2D0T A;  1OWA A;  3U78 A;  1FMV A;  2W63 A;  4N78 D;  2XQY A;  3UUN A;  1ZHC A;  4MLK A;  2LE8 A;  4I55 E;  3EUH A;  4PAG A;  3RH3 A;  4C91 A;  4TV8 E;  3RYC E;  4QXC B;  1MMN A;  2VWA A;  4EIW A;  2NW9 A;  2KND A;  2UXN B;  1IJ5 A;  3OJA A;  4AKH A;  3KVB A;  2D2S A;  3ZYM A;  3ZEF B;  3WAJ A;  3MJX A;  1D0Y A;  3RC8 A;  5FY1 A;  4ZI3 C;  3PTR B;  2SPC A;  1MIV A;  2QGS A;  2XHE B;  1YW0 A;  3CVR A;  4ILU A;  4IE0 A;  5L3C B;  3CWZ B;  3ZC1 A;  3S4U A;  4ASK A;  1FIO A;  3EDU A;  4KUM B;  4M1P A;  2IW5 B;  2G0U A;  2X66 A;  2X68 A;  5F3J A;  3BQL A;  2C0S A;  4U74 A;  3KFW X;  2BDE A;  4OHF A;  5KDM C;  3MKD A;  3ESL A;  5HAX A;  2RA1 A;  4P0A A;  1MMG A;  2KWI B;  4MBQ A;  2DWK A;  5J2U E;  1VRB A;  2EHO B;  2YU2 A;  5FY7 A;  5FXX A;  5J1G A;  2VK9 A;  3RYI E;  3PUR A;  2LSJ A;  1WLX A;  3MAC A;  5LHH B;  5JDN A;  2HPJ A;  2X51 A;  3AAI A;  4I43 B;  2PJQ A;  4HGA A;  4EXT A;  4X1I E;  2CXL A;  2X67 A;  3MK7 C;  3HKE E;  3QC9 A;  1E1H B;  3PU8 A;  2V7M A;  5JDL A;  2KLQ A;  3HR0 A;  2YK0 A;  2ES0 A;  5ETW A;  4QWN B;  2YIN A;  4G63 A;  1UX4 A;  2VKH A;  5DQW A;  3R6N A;  3GWH A;  1HCI A;  4O2A E;  1YD8 G;  2KT9 A;  3DJB A;  3WI3 A;  2LOS A;  2Q9Q B;  5L3E B;  3AVS A;  3NRX A;  5CA0 E;  3OYZ A;  2JMK A;  1G8X A;  3RX6 A;  3CQG B;  3LK2 B;  3Q5W A;  4CI3 B;  4CZZ B;  4AQF A;  3QK6 A;  4L9I A;  3EVY A;  2CLY C;  3LJC A;  4EZ4 A;  1YKE B;  4BJN A;  2X9Y A;  1D0X A;  3CQX C;  2DCF A;  3LBX A;  4HN9 A;  2NW7 A;  3R84 B;  3V5S A;  2X9X A;  5KMG P;  1O3X A;  3CKD A;  3HKD E;  5LJN A;  2E9X D;  1X79 A;  3FBL A;  3I9W A;  4ZS2 A;  4ZHQ E;  5EK2 A;  2CE7 A;  4OFZ A;  1MMA A;  2BZB A;  4IE5 A;  5FP3 A;  2DHR A;  5JRC B;  4I4T E;  4BJM A;  2CXF A;  4HE8 A;  3HI2 A;  2WMO A;  5LYJ E;  1EZ3 A;  2LSG A;  4DMV A;  4O2B E;  4GK0 E;  2JRK A;  4AQG A;  2D0U A;  3H37 A;  4I50 E;  4XZC A;  3WAK A;  3C4X A;  4GOU A;  3ZMV B;  4IE4 A;  3PUS A;  3ETU A;  2MOZ A;  2A2F X;  3PUQ A;  3QUJ A;  1HTJ F;  4ZI2 C;  2X9W A;  3BK9 A;  3KIN B;  2A3D A;  4DVD A;  5BMV E;  4WBN E;  4DO0 A;  1YKH B;  2L9Q A;  2C5J A;  2XTL A;  2XAQ B;  4WW0 A;  4ZI2 D;  4CQI A;  3PUG A;  3EDV A;  3MZK B;  3ANW B;  2CXD A;  1IAP A;  4P0B A;  4UEM A;  4ZOL E;  1Y64 B;  1H7C A;  2W00 A;  3GMI A;  1Z0P A;  5DAB A;  2K9A A;  2Q9Q C;  4UVC B;  3ZPO A;  2X0L B;  1UX5 A;  4H63 V;  1UCU A;  2XAH B;  3LK4 2;  4X1K E;  4CI1 B;  4PK6 A;  2X9H A;  2NWB A;  5LBQ B;  3ZCJ A;  2VKO A;  2CLY B;  2E9X C;  4YJ2 E;  4P09 A;  4C90 A;  2KZ7 B;  3RKO A;  1BR1 A;  3N2O A;  3V5U A;  3H3A A;  2I59 A;  2PBI A;  5HXR A;  2LSK A;  2LHR A;  5FNV E;  3VKG A;  1NWM X;  4CXY A;  3C4W A;  4KMC A;  4UF0 B;  4AQF C;  3T8O A;  3VU7 H;  2KMF A;  2M67 A;  2NTY A;  2ZM0 A;  3AB3 B;  2H7O A;  4ANJ A;  3TKL B;  5HWX A;  2XAS B;  4DND A;  3U3I A;  3AA6 B;  1LKX A;  2V7I A;  4GK5 E;  3GN5 B;  4EOZ B;  5FXZ A;  4GYR A;  3NZP A;  2E8I A;  2N9D A;  3UUX B;  2H3R A;  1BR0 A;  5F8P A;  4AKI A;  2WWU A;  3CX7 B;  2A72 A;  3K3N A;  2L8K A;  4PFP A;  3KBU A;  3VHL A;  2N2N A;  5FXV A;  5JDF A;  3N9M A;  1S35 A;  2YEV C;  2WAU A;  2CEA A;  3K3O A;  3MXZ A;  3L3P A;  4XAX B;  4Z8X A;  2Q9Q D;  2XAF B;  2V1D B;  4B6X A;  3C64 A;  2CWY A;  1V9D A;  4QXB B;  2Y48 B;  4GYS A;  4H9P C;  5H6R B;  3UT5 E;  3F57 A;  3NRY A;  4GIW A;  3ZMZ B;  3KBT A;  5LJM A;  3RYH E;  4JEH B;  3N9P A;  3O9X A;  3IF8 B;  4OYK A;  3BQI A;  4NUU A;  1MNE A;  4YLH A;  3C50 A;  1D0Z A;  5LXT E;  2VAS A;  4EYU A;  5HYA A;  4PFO A;  2N1G A;  3CML A;  3NZQ A;  4L5G A;  4DBQ A;  2V7L A;  3ZMT B;  3UUL A;  1D1C A;  1B7T A;  5LBM A;  2KIN B;  3AA1 B;  2D5U A;  4JLE A;  4PJL A;  3CQC B;  4J2C A;  4ERR A;  3LFM A;  4H9Q C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...