3VU7H

Crystal structure of rev1-rev7-rev3 ternary complex
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
94
structure length
94
Chain Sequence
PNLAGAVEFNDVKTLLREWITTISDPMEEDILQVVKYCTDLIEEKDLEKLDLVIKYMKRLMQQSVESVWNMAFDFILDNVQVVLQQTYGSTLKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis of recruitment of DNA polymerase [zeta] by interaction between REV1 and REV7 proteins
pubmed doi rcsb
source organism Homo sapiens
molecule tags Replication
molecule keywords DNA repair protein REV1
total genus 31
structure length 94
sequence length 94
ec nomenclature
pdb deposition date 2012-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF16727 REV1_C DNA repair protein REV1 C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1280 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3vu7H00
2LSYA 2LSJA 4FJOA 3VU7H 2N1GA 4EXTA 4GK0E 4BA9A 2LSKA 2LSIA 4GK5E 2LSGA
chains in the Genus database with same CATH superfamily
4YTMA 4CQIA 2D5UA 3PUWF 3IBPA 2A9UA 2NOXA 3F2EA 4WBOA 3IHRA 2WMNA 4DUZT 2AE9A 3QNUA 5KX5E 4YJ2E 3D0TA 2CXLA 4Z91A 5LOVE 2KINB 2X0LB 2QRXA 3NKZA 5AQUB 1I94T 2E5LT 3C64A 3N9QA 2UXDT 3HR0A 2WQYA 4O2BE 4TV8E 4HN9A 1XNQT 2VVNA 4U33A 3MA9A 3OKQA 4AKIA 2XAFB 2LSJA 4A5XA 3VKGA 3RYHE 3LSVA 2IIUA 4JEHB 2V1DB 5FKYA 1SA0E 2JJ9A 2QA7A 3AECA 4PJJA 3R6NA 2FJEA 5EK2A 4QH4A 4EIWA 2X51A 1WCRA 3AXJA 4KMCA 4KX6A 4YSZA 4H9SE 2VK9A 3AE1A 4O8SA 3UT5E 2V5CA 4XZCA 3ZLIA 4YSXA 1I6ZA 1FIOA 2MOZA 3LJCA 4HWCA 3PUQA 3PV0F 4IHJE 3ABVA 3HL6A 4O4HE 1WYCA 4UV9B 4ZOLE 5HWYA 4DMWA 3AEBA 1MIVA 4PK5A 3RPUA 4H9QC 5JRCB 5KXJA 2YK0A 2ZMAA 4PJNA 2V7MA 3CWZB 2X68A 3W15B 2MYSA 1D1CA 4DMVA 2LOSA 3RIFA 4JV5T 2L8KA 3CKDA 2JPFA 5LG4A 2ZM6T 1D1AA 3JC6D 4QWNB 4GKJT 3ZMTB 4AI6A 4U3CA 2I0MA 3AE5A 1IZNB 4QH1A 2NW9A 3VHLA 1T8BA 5LHIB 4IL4A 1R8IA 3TLTA 4HFIA 5AQTB 3CQXC 2J1DG 2I59A 5FL1A 4IDQA 2EHOD 3ANWB 3TLVA 1WYBA 1H7CA 4AXPA 5JQGE 3P4SA 2MAWA 5HCMA 5JVDE 2V7IA 5F5WA 3UU5A 4GIWA 3RHWA 4I55E 3NZPA 2X9YA 5F8PA 4ANJA 3EI0A 4DR5T 4IIJE 4NPPA 2KXPB 3U3IA 1HF8A 3QB5K 5HXCA 2WB5A 2ZLYA 3ZN0B 4EV6A 2YKSA 5LB7B 3ZSTA 1N34T 2E5VA 5FY1A 2J62A 3L3PA 4YJ3E 4UEMA 3J9X1 4C90A 1J5ET 2CLYC 4XAXB 4AKRB 1IBMT 2BG9A 4DBQA 2UUBT 3PTRB 4B6XA 5FNVE 3UULA 4NUVA 4ZS3A 1HFAA 1Z8UA 3Q9DA 4U2ZA 4ZI3D 2ZM0A 5JDMA 5L4EA 2WWVA 3MACA 1BR1A 5ABHA 3AEFA 4IE5A 4IDOA 5FY7A 5L3CB 5EK3A 4C91A 3ZMUB 4LF6T 3NBXX 4MFRA 3MKDA 2KMFA 2ACXA 1JNZA 1HS7A 2CXDA 2W66A 2M6BA 2UXNB 3CQGB 3UU6A 2JQQA 3VU7H 2BS3A 3B13A 3NRXA 3HI2A 2J4GA 3CPZA 2YDRA 4GOUA 1MNDA 1Y01A 2GK9A 2DWKA 4AKGA 5JDHA 2BG9C 4HFDA 1OEDA 2CMRA 4ISTA 4LF5T 2V6YA 2EHOB 3N9OA 4HKAA 4GYSA 3RYFE 4BAYB 3RYCE 5A1LA 2SPCA 4ZXLA 2CE7A 2XY8B 5JDNA 1YQ3A 2Q9QB 2VKHA 3RLFF 2LEHA 1NWMX 3MJXA 4NIQA 1IJ5A 3FBZA 5AQIB 5CB4E 4TN7B 3ZT5A 2X0YA 5JTGA 5EK4A 3QUJA 5HYAA 2XQ8A 4IDZA 3GMIA 3Q5WA 2NWBA 2Z6EA 4I4TE 3AEAA 5HEHA 5HCJA 1UURA 3AE2A 1X9BA 4CXXA 3QB5A 2CCQA 2UUCT 4FI5A 5TAOA 2D0TA 4CI1B 1NEKA 2F4VT 1OEDC 3PUVF 5AQLB 4F6RC 2B76A 2XSAA 3FXDB 4LMLA 3VRAA 4EOZB 4PK4A 3ZSSA 1YD8G 2YDQA 4DV6T 3IA3A 2D2SA 2XTLA 3PU3A 2VL8A 4O4LE 3C4WA 1S94A 2IHR1 2JQKA 2WZIA 2CEAA 5FVKA 2UXCT 4DIDB 1KK7A 3A7MA 2JQ9A 3K1SA 5H6RB 3VR8A 4BJMA 5LHHB 4DR7T 2BKNA 3FZHB 4PNIA 2RA1A 2VVSA 3X1DA 3ZYLA 4CN1A 3I1AA 4KHPT 1US7B 2XAGB 3L8RA 2WS3A 3PUXF 4E7ZA 3Q2MA 2XAJB 3P4QA 4HTEA 5FYMA 2VKOA 2DWGA 2BKOA 2VB6A 3CK6A 3LDQB 4IE4A 4OHFA 3AE4A 4KI0F 3UU8A 5KDMC 1NENA 4LFBT 3O1IA 2VASA 3ZEFB 3PJAJ 2XM2A 3FHNA 2IC9A 2IW5B 1WRDA 3FZFB 4KHZF 3AE3A 1BR4A 1MIWA 1XWMA 3PUAA 1S35A 5DJQC 5FXZA 5M4YA 4CN4A 2E9XD 2QVAA 3C51A 2NTYA 4OK0A 4QXCB 2UXXB 1HR0T 1HNWT 4DV1T 4TNWA 2WM9A 3UUMA 3O9XA 2C0SA 3CX7B 3AEDA 2CWYA 3KINB 2XQ5A 2KLQA 4WZXA 4IREA 2BKPA 2E8IA 2VURA 3P4PA 4HWDA 3ZMZB 5LMNT 1E2AA 3PUGA 4B3MT 5FL0A 4DR1T 5J2UE 5JR9B 4DV3T 2PBIA 2X9XA 4F8HA 4QH5A 4HFEA 1FEWA 2CM0A 2W00A 3AEEA 2CHOA 5ABFB 2W4XA 4K0UA 5LGNB 5LJNA 1OEDE 2LOPA 2AXDS 4TZ4C 4OFZA 5DQVA 1W0BA 3CVRA 4GK0E 3SOLA 2LSIA 3K8PC 3HKCE 4KUMB 4U2YA 3ZN1B 2LJLA 3FB2A 2PG8A 4DO0A 2IC6A 5ETWA 3UUXB 3E0ZA 4O2AE 4WW0A 1T98A 2VQFT 2CHNA 5LP6E 2VQET 4DR3T 2HN2A 4G2AA 2LE8A 3V5UA 3LG7A 4EEBA 4B3RT 2Q9QC 5L4HA 2WDQA 3O4XE 2A72A 4X20E 2WY2A 4LF8T 3SS1A 2W0GA 5HXEA 3B5MA 4A56A 4PAGA 4PK6A 2G0UA 3LK3B 4G63A 4YLHA 5LA6E 2FBWA 4COFA 4DV2T 4L5GA 5AQJB 3KFWX 4CXYA 2OV9A 4LFCT 4ILCA 4EAHA 3SFEA 3J7Yq 4JI1T 2E9XB 2BS4A 3LBXB 2LT3A 5LHGB 4LF9T 2DNXA 3U78A 4YHJA 4WBNE 3I9WA 3M65A 1GQEA 4YT0A 4JYAT 1VRBA 1HX1B 2DHRA 4DNDA 4GYRA 5CGMA 5FXXA 5LNKA 1KNPA 3N2OA 2Q9QA 2LSYA 2W2UA 3QOFA 2LHRA 4CI2B 1ZHCA 1G8XA 5JH7E 5L3DB 1G73A 2DCFA 1QUUA 3GA8A 4A97A 3AE9A 1XMQT 1XDOA 2BDEA 2XAHB 3BQIA 3AAEB 3AXJB 3IF8B 3UU4A 4GKKT 2DL1A 2NW7A 5AQHB 2WU2A 2Y6XA 3TLWA 1XNRT 3BK9A 3BQKA 1JNRA 3PURA 5ADXL 1MNEA 2A3DA 2LRKA 4TV9E 3ZPOA 5LYJE 2KT9A 2KWHA 2ACZA 4B3TT 4ILBA 4UELA 4X66T 3KV4A 3PE0A 4HEAA 2UU9T 1HNXT 2NW8A 4ILAA 1E1HB 1UGOA 4MHCA 4ZS2A 4AQGA 1V9DA 5IWAT 4U7IA 4FJOA 5J0ZA 1X79A 3K3QC 5IHYA 3ZYKA 4X65T 1KEYA 4AIUA 2QYWA 2CWOA 5FXVA 4P09A 2ODVA 5ABGA 5JRCA 4TNVA 4LF4T 4J2CA 2CLYB 3AE6A 4HFBA 4EEDA 1T72A 3AVSA 4JBWF 4O4JE 3ZC1A 3ZKRA 1QLBA 1WR6A 2LRLA 4HE8A 3ANWA 5LBMA 3FZLB 1WFDA 4TUYE 1O3XA 4UR9A 4Z90A 3RIAA 5JDGA 4DV5T 4ZI2D 1T7SA 4ERRA 2V8SV 5CFBA 3AE8A 2XPKA 2DI4A 3N9NA 2UUAT 2HPLA 1U4QA 5FMNA 4UXNB 4ASKA 4WNKA 2WBLA 1XDPA 3M3ZB 4HWIB 3ZYMA 5LGUB 2WCAA 4I50E 3N9MA 3ZCIA 1FMWA 2XQ9A 5LGTB 5JDQA 2L9QA 2XQ7A 4PFPA 3FXEB 4K0KT 4KP3C 2C5JA 5L3BB 4YHHT 4V1Av 4P0AA 4JI4T 2NP9A 2LHNA 4N78D 3SRZA 1W9RA 5H6QB 2YOEA 2YDSA 2ES0A 2XQ6A 2OA5A 2P9BA 2YU1A 3QC9A 2BVMA 2X67A 2Y8DA 4B3ST 3A5XA 3EDVA 4EYYR 4EZ4A 4X1IE 5FY0A 3MXZA 3OYZA 1KF6A 2VKJA 4IT4A 4YFSA 3RI5A 3IEEA 4ZEYA 5AQKB 3EABA 1U5PA 2N1GA 3JAFA 4IGUA 5L3EB 5LMUT 3TLUA 4KBMB 5E0OA 2WDRA 3ONJA 4HFHA 3JC6C 1LVFA 2BVLA 3NVOA 3OTOT 2V5DA 4DR2T 2BBJA 4TX5A 1HCIA 2V7LA 3AAIA 2WWUA 4CN6A 2WAUA 2W61A 2VKDA 3OJAA 4IL9A 1OWAA 5AQSB 3RIUC 4NUUA 4JEUB 4XBFB 3H3MA 5DABA 4AISA 4JI0T 2CBJA 1YKHB 1UX5A 2JMHA 4I43B 5CA0E 2HN1A 3N2KE 4AKHA 3VKHA 4IE7A 1NAFA 4ZI2C 2FJAA 2VL0A 3S4UA 3AB3B 2HHHT 2ZM8A 3VR9A 3HA4A 3CQCB 4HWHA 4ISSA 4OYJA 2R6GF 5AQVB 2A2FX 2FJDA 4QKNA 5FP3A 3RX6A 4JUYA 5JREA 3CIRA 2KWIB 3E22E 4MLKA 5F3JA 3UU3A 4QX7B 3ESLA 1D0YA 3O1JA 5JDFA 4ZZBA 5ABEA 2BG9E 5LBQB 4JI2T 3C4ZA 3P4RA 4H9RC 2ODUA 2KNDA 4UV8B 3WAKA 3L09A 3RIUA 5C2TA 4DVDA 4P1NA 3CMLA 1MMDA 1ZV4X 2RPAA 2XASB 3HKEE 5L3GB 1N36T 2WSSV 4H9OC 2QGSA 4YTPA 1J1JA 2Q9QD 3GN5A 4Q25A 3AVRA 3ZC0A 1XMOT 2YINA 3JCFA 3NWIA 4UF0B 1IBKT 3RGLA 1LRZA 4CXWA 5BMVE 4YXDA 3T1HT 3RH3A 2CPTA 3LK2B 2NTXA 2C5KT 2CXFA 3NZQA 4MBQA 4DV7T 3PJAA 1HG2A 3EVYA 3ZMSB 2FUPA 1W09A 5L47A 4DR6T 1EZ3A 3PUYF 3R84B 3ZJ1A 4BJNA 1FJGT 3UFEA 3NRYA 5JR9C 4UVAB 2XUEA 2XSBA 1D0ZA 2JQHA 2NR4A 4EXTA 4JI6T 2N2NA 2BG9B 2KSRA 4QHOA 4U31A 4ZI7E 1VOMA 1WLXA 3C98B 2XQAA 3N9LA 1D1BA 1MMGA 1W0AA 1B7TA 4H9NC 4EB6E 4NXNT 1N33T 3CX6B 3QK6A 5ABFA 1YKEB 3KV5A 3N2GE 3N9PA 2CBIA 5HWXA 3UQ4A 4HFCA 5C3JA 2LM2A 2YEVC 4LF7T 3AA1B 5AQMB 4DR4T 2JRKA 2PFVA 1HTJF 2H89A 4PW8A 4AQFC 2E9XC 2RP4A 5KMGP 2LKGA 3I9YA 3FZMB 2HH7A 2LSKA 5LCYA 1J5WA 4NXMT 2V26A 4HFVA 5JR9A 2MBGA 1OXZA 2XJ7A 3FBLA 2D9DA 2K3WA 4ZZCA 2H88A 2K9AA 3RKGA 4AQYT 2LM9A 4M1PA 3RF1A 5C8YE 1SHZC 5AQGB 1ZKEA 1AJ3A 3UUBA 4JI5T 5HEUA 5HXRA 1ZOYA 4TWHA 4LMJA 4L9IA 2X0HA 4TWFA 2M6IA 3EHZA 1KNRA 3AA7B 3HKDE 2YN6A 1HNZT 2M67A 2BBHA 3KVBA 4X1YE 1L0VA 4LFAT 2XM1A 2K48A 2W62A 1KNZA 2MPKA 3ZCJA 2E9XA 3LBXA 4AQFA 1SUMB 3F31A 5AQRB 2K5BB 4A98A 3RC3A 3KDSE 3E08A 2BZBA 3PDYA 4ILUA 4GK5E 2CRBA 3BQLA 3P7IA 2X9WA 2ZM2A 3AA6B 3I0QA 4U72A 5J1GA 3RRWA 5DQWA 1OEDB 1ZEEA 2H7VC 5L2LA 4O4IE 2VWAA 1VCSA 3MK7C 4UVBB 3KBTA 3C4XA 3DTOA 4QX8B 1M7KA 3RYIE 1YW0A 3ZMVB 1SE7A 2CA5A 4CI3B 4CZZB 4HGAA 1VCTA 2IUBA 1ZP0A 3JAEA 4DUYT 2H7OA 4YSYA 2PTFA 3JADA 3VRBA 2L3LA 5BR8T 2XQ4A 1IAPA 5HAXA 5EZYE 3EDUA 1KFYA 5HEJA 3MZKB 3KVAA 2WDVA 4PJLA 1LVKA 5HXHA 4H63H 3P50A 3UUNA 3V5SA 3G06A 3ONLC 5LXTE 5AQNB 3OVUA 1CUNA 2J47A 3H3AA 3P8CD 4JLEA 3ETUA 4OYKA 5FXWA 3UFGA 4OX9T 2D0UA 3T1YT 1E7PA 3Q5XA 4AKLA 2XQ3A 2WMOA 4ADZA 4TWDA 2V6XA 3T8OA 4I0UA 4IDPA 1FMVA 2HPJA 1CHUA 4JI7T 4PJMA 3PU8A 5AQFB 2H3RA 3KV6A 1UX4A 4X62T 1HG5A 2IAKA 4U7YA 2WU5A 3L39A 5AQPB 4HWFA 3FZKB 3I0OA 4H63V 3GN5B 3LFMA 3Q5DA 2IDOB 3SWHA 4ZHQE 4ZI3C 2Y48B 3O1HA 3SFDA 4DBRA 3C50A 1XZYA 3GWHA 2X66A 4UF0A 4IE6A 4WYVA 5AFUL 4JI8T 4QXHB 2OLTA 4IDNA 1MMAA 1HX8A 5CJ5A 3KBUA 3A8YC 2C5IT 4X64T 3RC8A 1WR0A 1M62A 2IMLA 2BS2A 3PUZF 3RQUA 1Y64B 5AQOB 1MIYA 3UTKA 2PJQA 3LK42 4IE0A 2KZ7B 3UQ7A 2B1EA 2XZEA 4EZHA 3DP7A 2I6HA 2W63A 2W67A 3OBVE 4X5TA 3KV9A 4EYUA 2UXBT 3N5LA 1BR0A 3OPCA 5HEGA 3ZJ2A 1MMNA 5HXSA 5LG3A 1UK5A 4QXBB 4DV0T 4JI3T 3AA0B 5JDLA 2WZHA 4PFOA 1IJ6A 2EHOC 2JIWA 1LKXA 2WP9A 2XHEB 4E7SA 3RRCA 5FVLA 3DJBA 4MALA 5J2TE 3ETVA 1UUSA 4L0RA 4YY3T 3RQWA 2DLRA 2JMKA 3B57A 1BR2A 1QSDA 1YQ4A 3P4WA 3PUSA 3Q5EA 3CX8B 1N32T 4UIGA 3F57A 3K3NA 3OYXA 3ZT6A 5LJMA 2LSGA 2XAQB 2YU2A 4P0BA 1Z0PA 3ONXA 3EUHA 5IUXA 5L3FB 3AEGA 1DU2A 4LMKA 3K3OA 4U74A 3RKOA 3ZT7A 2N9DA 3HKBE 3WI3A 3EAMA 5CA1E 2V7JA 2V7KA 2XQYA 4Z8XA 2MTQA 4BA9A 1IBLT 5HEOA 4YTNA 3TLSA 4X1KE 4H9PC 3AAAB 4UVCB 1YXRA 2X9HA 5AQQB 2E2AA 5IYZE 1UCUA 3AE7A 2V6YB 3WAJA 2K24A 5GONE 2EHOA 3TKLB 4DV4T 2LKHA 2LLYA 4EGWA 1D0XA 2FJBA 3H37A
chains in the Genus database with same CATH topology
4CQIA 2D5UA 3IBPA 2NOXA 3F2EA 4WBOA 3IHRA 2WMNA 5KX5E 4YJ2E 3D0TA 2CXLA 5LOVE 2KINB 2X0LB 3C64A 3N9QA 3HR0A 4O2BE 4TV8E 4AKIA 4HN9A 3MA9A 3OKQA 2XAFB 2LSJA 3VKGA 3RYHE 3R6NA 4JEHB 2V1DB 1SA0E 2JJ9A 2QA7A 4PJJA 5EK2A 5LJMA 4EIWA 2X51A 4KMCA 4H9SE 2VK9A 4O8SA 3UT5E 4XZCA 3ZLIA 1FIOA 2MOZA 3LJCA 4O4HE 3PUQA 4IHJE 4DMWA 3HL6A 4UV9B 4ZOLE 1WYCA 5HWYA 1MIVA 4PK5A 3RPUA 4H9QC 5JRCB 2YK0A 2ZMAA 4PJNA 2V7MA 3CWZB 2X68A 3W15B 2MYSA 1D1CA 4DMVA 2LOSA 2L8KA 3CKDA 2JPFA 5LG4A 1D1AA 3JC6D 4QWNB 3ZMTB 4AI6A 2NW9A 3VHLA 1IZNB 5LHIB 3CQXC 2J1DG 2I59A 2EHOD 3ANWB 1WYBA 1H7CA 4AXPA 5JQGE 5JVDE 2V7IA 4GIWA 4I55E 3NZPA 2X9YA 5F8PA 4ANJA 4IIJE 2KXPB 3U3IA 1HF8A 5HXCA 2ZLYA 3ZN0B 5FY1A 3L3PA 4YJ3E 4UEMA 3J9X1 4C90A 2CLYC 4XAXB 4AKRB 4DBQA 3PTRB 4B6XA 5FNVE 3UULA 4NUVA 4ZS3A 1HFAA 3Q9DA 4ZI3D 5JDMA 2ZM0A 3MACA 1BR1A 4IE5A 5FY7A 5L3CB 5EK3A 4C91A 3ZMUB 3NBXX 4MFRA 3MKDA 2KMFA 2ACXA 2CXDA 3CQGB 2UXNB 3VU7H 2JQQA 3B13A 3NRXA 3HI2A 3CPZA 4GOUA 1MNDA 2GK9A 2DWKA 4AKGA 5JDHA 2CMRA 4ISTA 2EHOB 3N9OA 4HKAA 4GYSA 3RYFE 4BAYB 3RYCE 5A1LA 2SPCA 2CE7A 5JDNA 2Q9QB 2VKHA 2LEHA 1NWMX 3MJXA 1IJ5A 3FBZA 5CB4E 4TN7B 5EK4A 3QUJA 4IDZA 3GMIA 3Q5WA 2NWBA 2Z6EA 4I4TE 2CCQA 4FI5A 5TAOA 2D0TA 4CI1B 4F6RC 3FXDB 4EOZB 4PK4A 1YD8G 2D2SA 2XTLA 3PU3A 2VL8A 4O4LE 3C4WA 1S94A 2CEAA 1KK7A 4BJMA 5H6RB 5LHHB 4PNIA 2RA1A 3ZYLA 3I1AA 1US7B 2XAGB 4E7ZA 3Q2MA 2XAJB 4HTEA 5FYMA 2VKOA 2DWGA 2VB6A 4IE4A 5KDMC 4OHFA 3O1IA 2VASA 3ZEFB 3FHNA 2IC9A 2IW5B 1WRDA 1BR4A 1MIWA 3PUAA 5FXZA 1S35A 5DJQC 5M4YA 2E9XD 4QXCB 3C51A 2NTYA 4OK0A 2UXXB 2WM9A 3UUMA 3O9XA 2C0SA 3CX7B 2CWYA 3KINB 2KLQA 2E8IA 3ZMZB 3PUGA 5J2UE 5JR9B 2PBIA 2X9XA 1FEWA 2CM0A 2W00A 4K0UA 5LGNB 5LJNA 2LOPA 4TZ4C 4OFZA 5DQVA 3CVRA 4GK0E 3SOLA 2LSIA 3K8PC 3HKCE 4KUMB 3ZN1B 2LJLA 3FB2A 2PG8A 2IC6A 5ETWA 3UUXB 3E0ZA 4O2AE 4WW0A 1T98A 5LP6E 4G2AA 2LE8A 3V5UA 3LG7A 2Q9QC 3O4XE 2A72A 4X20E 3SS1A 5HXEA 2W0GA 4A56A 4PAGA 4PK6A 2G0UA 3LK3B 4G63A 4YLHA 5LA6E 4L5GA 3KFWX 4CXYA 4EAHA 3J7Yq 2E9XB 3LBXB 2LT3A 5LHGB 2DNXA 3U78A 4YHJA 4WBNE 3I9WA 3M65A 1VRBA 2DHRA 4DNDA 4GYRA 5LNKA 5FXXA 3N2OA 2Q9QA 2LSYA 4CI2B 2LHRA 1ZHCA 1G8XA 5JH7E 5L3DB 1G73A 3GA8A 2DCFA 1QUUA 2BDEA 2XAHB 3BQIA 3AAEB 3IF8B 2NW7A 2Y6XA 3BK9A 3BQKA 3PURA 5ADXL 1MNEA 2A3DA 3ZPOA 5LYJE 2KT9A 2KWHA 4UELA 3KV4A 3PE0A 4HEAA 2NW8A 4ZS2A 1E1HB 4MHCA 4AQGA 1V9DA 4FJOA 1X79A 3K3QC 5IHYA 3ZYKA 2CWOA 5FXVA 4P09A 2ODVA 5JRCA 4J2CA 2CLYB 3ZC1A 3AVSA 4DO0A 4O4JE 5LBMA 1WR6A 4HE8A 3ANWA 4TUYE 5JDGA 1O3XA 4ZI2D 4ERRA 2DI4A 3N9NA 2HPLA 1U4QA 5FMNA 4UXNB 4ASKA 4WNKA 2WBLA 5LGUB 3ZYMA 4I50E 3N9MA 3ZCIA 1FMWA 5LGTB 5JDQA 2L9QA 4PFPA 3FXEB 4KP3C 2C5JA 5L3BB 4P0AA 4V1Av 2NP9A 2LHNA 4N78D 3SRZA 5H6QB 2ES0A 2YU1A 2OA5A 2P9BA 3QC9A 1HS7A 2BVMA 2X67A 2Y8DA 3A5XA 3EDVA 4EYYR 4EZ4A 4X1IE 5FY0A 3MXZA 3OYZA 2VKJA 4YFSA 3IEEA 1U5PA 2N1GA 5L3EB 4IGUA 4KBMB 5E0OA 3JC6C 1LVFA 2BVLA 4TX5A 1HCIA 2V7LA 3AAIA 2WWUA 2WAUA 2W61A 2VKDA 3OJAA 1OWAA 4NUUA 4JEUB 4XBFB 5DABA 2JMHA 1YKHB 1UX5A 4I43B 5CA0E 3VKHA 3N2KE 4AKHA 4IE7A 1NAFA 4ZI2C 3S4UA 3AB3B 2ZM8A 3HA4A 3CQCB 5FP3A 4ISSA 4OYJA 2A2FX 4QKNA 3RX6A 5JREA 4JUYA 2KWIB 3E22E 4MLKA 5F3JA 4QX7B 3ESLA 1D0YA 3O1JA 5JDFA 5LBQB 3C4ZA 4H9RC 3WAKA 2ODUA 2KNDA 4UV8B 3L09A 4DVDA 3CMLA 1MMDA 1ZV4X 2XASB 3HKEE 5L3GB 2WSSV 4H9OC 2QGSA 2Q9QD 3GN5A 3AVRA 3ZC0A 2YINA 4UF0B 1LRZA 4CXWA 5BMVE 3RH3A 3LK2B 2C5KT 2CXFA 2NTXA 3NZQA 4MBQA 1HG2A 3EVYA 3ZMSB 1EZ3A 3ZJ1A 3R84B 4BJNA 3UFEA 3NRYA 5JR9C 4UVAB 2XUEA 1D0ZA 4EXTA 2N2NA 4QHOA 4ZI7E 1VOMA 1WLXA 3C98B 3N9LA 1D1BA 1MMGA 4EB6E 1B7TA 4H9NC 3CX6B 3QK6A 5HWXA 1YKEB 3KV5A 3N2GE 3N9PA 2YEVC 3AA1B 2JRKA 2PFVA 1HTJF 4PW8A 4AQFC 2E9XC 2RP4A 5KMGP 3I9YA 2HH7A 2LSKA 5LCYA 2V26A 4HFVA 5JR9A 2MBGA 1OXZA 3FBLA 2K9AA 1KNZA 2LM9A 4M1PA 5C8YE 1SHZC 1ZKEA 1AJ3A 5HXRA 4L9IA 3AA7B 3HKDE 2M67A 3KVBA 4X1YE 2K48A 2W62A 4AQFA 3ZCJA 2E9XA 3LBXA 3F31A 2K5BB 3RC3A 3KDSE 3E08A 2BZBA 3PDYA 4ILUA 4GK5E 3BQLA 4TV9E 3P7IA 2X9WA 2ZM2A 3AA6B 3I0QA 4U72A 5J1GA 3RRWA 5DQWA 2H7VC 1ZEEA 5L2LA 4O4IE 2VWAA 3MK7C 3ZMVB 4UVBB 3KBTA 3C4XA 3DTOA 4QX8B 4CXXA 3RYIE 1YW0A 4CI3B 2CA5A 4DBRA 5HYAA 4CZZB 4HGAA 2H7OA 2L3LA 1IAPA 5HAXA 5EZYE 3EDUA 3MZKB 3KVAA 4PJLA 1LVKA 5HXHA 4H63H 3UUNA 3V5SA 5LXTE 1CUNA 3H3AA 3P8CD 4JLEA 4OYKA 3ETUA 5FXWA 2D0UA 3Q5XA 4AKLA 2WMOA 4ADZA 3T8OA 1FMVA 2HPJA 4PJMA 3PU8A 2H3RA 3KV6A 1UX4A 1HG5A 2IAKA 3I0OA 4H63V 3GN5B 3LFMA 3SWHA 4ZHQE 4ZI3C 2Y48B 3O1HA 3C50A 3GWHA 2X66A 4UF0A 4IE6A 5AFUL 4QXHB 1MMAA 1HX8A 3KBUA 2C5IT 3RC8A 1Y64B 1MIYA 3UTKA 2PJQA 3LK42 4IE0A 2KZ7B 2B1EA 4EZHA 3DP7A 2W63A 3OBVE 4EYUA 3KV9A 1BR0A 3N5LA 3ZJ2A 1MMNA 5HXSA 4QXBB 3AA0B 5JDLA 4PFOA 1IJ6A 2EHOC 2XHEB 1LKXA 4E7SA 3RRCA 3DJBA 4MALA 5J2TE 3ETVA 4L0RA 2DLRA 2JMKA 3B57A 1BR2A 1QSDA 3PUSA 3CX8B 4UIGA 3F57A 3K3NA 3OYXA 2YU2A 2LSGA 2XAQB 4P0BA 1Z0PA 3ONXA 3EUHA 5L3FB 4U74A 3K3OA 3RKOA 2N9DA 3HKBE 3WI3A 5CA1E 2V7JA 2V7KA 2XQYA 4Z8XA 2MTQA 4BA9A 4X1KE 4H9PC 3AAAB 4UVCB 5IYZE 2X9HA 1UCUA 3WAJA 2K24A 5GONE 2EHOA 3TKLB 1D0XA 3H37A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LSY A;  2LSJ A;  4FJO A;  3VU7 H;  2N1G A;  4EXT A;  4GK0 E;  4BA9 A;  2LSK A;  2LSI A;  4GK5 E;  2LSG A; 
#chains in the Genus database with same CATH topology
 4YTM A;  4CQI A;  2D5U A;  3PUW F;  3IBP A;  2A9U A;  2NOX A;  3F2E A;  4WBO A;  3IHR A;  2WMN A;  4DUZ T;  2AE9 A;  3QNU A;  5KX5 E;  4YJ2 E;  3D0T A;  2CXL A;  4Z91 A;  5LOV E;  2KIN B;  2X0L B;  2QRX A;  3NKZ A;  5AQU B;  1I94 T;  2E5L T;  3C64 A;  3N9Q A;  2UXD T;  3HR0 A;  2WQY A;  4O2B E;  4TV8 E;  4HN9 A;  1XNQ T;  2VVN A;  4U33 A;  3MA9 A;  3OKQ A;  4AKI A;  2XAF B;  2LSJ A;  4A5X A;  3VKG A;  3RYH E;  3LSV A;  2IIU A;  4JEH B;  2V1D B;  5FKY A;  1SA0 E;  2JJ9 A;  2QA7 A;  3AEC A;  4PJJ A;  3R6N A;  2FJE A;  5EK2 A;  4QH4 A;  4EIW A;  2X51 A;  1WCR A;  3AXJ A;  4KMC A;  4KX6 A;  4YSZ A;  4H9S E;  2VK9 A;  3AE1 A;  4O8S A;  3UT5 E;  2V5C A;  4XZC A;  3ZLI A;  4YSX A;  1I6Z A;  1FIO A;  2MOZ A;  3LJC A;  4HWC A;  3PUQ A;  3PV0 F;  4IHJ E;  3ABV A;  3HL6 A;  4O4H E;  1WYC A;  4UV9 B;  4ZOL E;  5HWY A;  4DMW A;  3AEB A;  1MIV A;  4PK5 A;  3RPU A;  4H9Q C;  5JRC B;  5KXJ A;  2YK0 A;  2ZMA A;  4PJN A;  2V7M A;  3CWZ B;  2X68 A;  3W15 B;  2MYS A;  1D1C A;  4DMV A;  2LOS A;  3RIF A;  4JV5 T;  2L8K A;  3CKD A;  2JPF A;  5LG4 A;  2ZM6 T;  1D1A A;  3JC6 D;  4QWN B;  4GKJ T;  3ZMT B;  4AI6 A;  4U3C A;  2I0M A;  3AE5 A;  1IZN B;  4QH1 A;  2NW9 A;  3VHL A;  1T8B A;  5LHI B;  4IL4 A;  1R8I A;  3TLT A;  4HFI A;  5AQT B;  3CQX C;  2J1D G;  2I59 A;  5FL1 A;  4IDQ A;  2EHO D;  3ANW B;  3TLV A;  1WYB A;  1H7C A;  4AXP A;  5JQG E;  3P4S A;  2MAW A;  5HCM A;  5JVD E;  2V7I A;  5F5W A;  3UU5 A;  4GIW A;  3RHW A;  4I55 E;  3NZP A;  2X9Y A;  5F8P A;  4ANJ A;  3EI0 A;  4DR5 T;  4IIJ E;  4NPP A;  2KXP B;  3U3I A;  1HF8 A;  3QB5 K;  5HXC A;  2WB5 A;  2ZLY A;  3ZN0 B;  4EV6 A;  2YKS A;  5LB7 B;  3ZST A;  1N34 T;  2E5V A;  5FY1 A;  2J62 A;  3L3P A;  4YJ3 E;  4UEM A;  3J9X 1;  4C90 A;  1J5E T;  2CLY C;  4XAX B;  4AKR B;  1IBM T;  2BG9 A;  4DBQ A;  2UUB T;  3PTR B;  4B6X A;  5FNV E;  3UUL A;  4NUV A;  4ZS3 A;  1HFA A;  1Z8U A;  3Q9D A;  4U2Z A;  4ZI3 D;  2ZM0 A;  5JDM A;  5L4E A;  2WWV A;  3MAC A;  1BR1 A;  5ABH A;  3AEF A;  4IE5 A;  4IDO A;  5FY7 A;  5L3C B;  5EK3 A;  4C91 A;  3ZMU B;  4LF6 T;  3NBX X;  4MFR A;  3MKD A;  2KMF A;  2ACX A;  1JNZ A;  1HS7 A;  2CXD A;  2W66 A;  2M6B A;  2UXN B;  3CQG B;  3UU6 A;  2JQQ A;  3VU7 H;  2BS3 A;  3B13 A;  3NRX A;  3HI2 A;  2J4G A;  3CPZ A;  2YDR A;  4GOU A;  1MND A;  1Y01 A;  2GK9 A;  2DWK A;  4AKG A;  5JDH A;  2BG9 C;  4HFD A;  1OED A;  2CMR A;  4IST A;  4LF5 T;  2V6Y A;  2EHO B;  3N9O A;  4HKA A;  4GYS A;  3RYF E;  4BAY B;  3RYC E;  5A1L A;  2SPC A;  4ZXL A;  2CE7 A;  2XY8 B;  5JDN A;  1YQ3 A;  2Q9Q B;  2VKH A;  3RLF F;  2LEH A;  1NWM X;  3MJX A;  4NIQ A;  1IJ5 A;  3FBZ A;  5AQI B;  5CB4 E;  4TN7 B;  3ZT5 A;  2X0Y A;  5JTG A;  5EK4 A;  3QUJ A;  5HYA A;  2XQ8 A;  4IDZ A;  3GMI A;  3Q5W A;  2NWB A;  2Z6E A;  4I4T E;  3AEA A;  5HEH A;  5HCJ A;  1UUR A;  3AE2 A;  1X9B A;  4CXX A;  3QB5 A;  2CCQ A;  2UUC T;  4FI5 A;  5TAO A;  2D0T A;  4CI1 B;  1NEK A;  2F4V T;  1OED C;  3PUV F;  5AQL B;  4F6R C;  2B76 A;  2XSA A;  3FXD B;  4LML A;  3VRA A;  4EOZ B;  4PK4 A;  3ZSS A;  1YD8 G;  2YDQ A;  4DV6 T;  3IA3 A;  2D2S A;  2XTL A;  3PU3 A;  2VL8 A;  4O4L E;  3C4W A;  1S94 A;  2IHR 1;  2JQK A;  2WZI A;  2CEA A;  5FVK A;  2UXC T;  4DID B;  1KK7 A;  3A7M A;  2JQ9 A;  3K1S A;  5H6R B;  3VR8 A;  4BJM A;  5LHH B;  4DR7 T;  2BKN A;  3FZH B;  4PNI A;  2RA1 A;  2VVS A;  3X1D A;  3ZYL A;  4CN1 A;  3I1A A;  4KHP T;  1US7 B;  2XAG B;  3L8R A;  2WS3 A;  3PUX F;  4E7Z A;  3Q2M A;  2XAJ B;  3P4Q A;  4HTE A;  5FYM A;  2VKO A;  2DWG A;  2BKO A;  2VB6 A;  3CK6 A;  3LDQ B;  4IE4 A;  4OHF A;  3AE4 A;  4KI0 F;  3UU8 A;  5KDM C;  1NEN A;  4LFB T;  3O1I A;  2VAS A;  3ZEF B;  3PJA J;  2XM2 A;  3FHN A;  2IC9 A;  2IW5 B;  1WRD A;  3FZF B;  4KHZ F;  3AE3 A;  1BR4 A;  1MIW A;  1XWM A;  3PUA A;  1S35 A;  5DJQ C;  5FXZ A;  5M4Y A;  4CN4 A;  2E9X D;  2QVA A;  3C51 A;  2NTY A;  4OK0 A;  4QXC B;  2UXX B;  1HR0 T;  1HNW T;  4DV1 T;  4TNW A;  2WM9 A;  3UUM A;  3O9X A;  2C0S A;  3CX7 B;  3AED A;  2CWY A;  3KIN B;  2XQ5 A;  2KLQ A;  4WZX A;  4IRE A;  2BKP A;  2E8I A;  2VUR A;  3P4P A;  4HWD A;  3ZMZ B;  5LMN T;  1E2A A;  3PUG A;  4B3M T;  5FL0 A;  4DR1 T;  5J2U E;  5JR9 B;  4DV3 T;  2PBI A;  2X9X A;  4F8H A;  4QH5 A;  4HFE A;  1FEW A;  2CM0 A;  2W00 A;  3AEE A;  2CHO A;  5ABF B;  2W4X A;  4K0U A;  5LGN B;  5LJN A;  1OED E;  2LOP A;  2AXD S;  4TZ4 C;  4OFZ A;  5DQV A;  1W0B A;  3CVR A;  4GK0 E;  3SOL A;  2LSI A;  3K8P C;  3HKC E;  4KUM B;  4U2Y A;  3ZN1 B;  2LJL A;  3FB2 A;  2PG8 A;  4DO0 A;  2IC6 A;  5ETW A;  3UUX B;  3E0Z A;  4O2A E;  4WW0 A;  1T98 A;  2VQF T;  2CHN A;  5LP6 E;  2VQE T;  4DR3 T;  2HN2 A;  4G2A A;  2LE8 A;  3V5U A;  3LG7 A;  4EEB A;  4B3R T;  2Q9Q C;  5L4H A;  2WDQ A;  3O4X E;  2A72 A;  4X20 E;  2WY2 A;  4LF8 T;  3SS1 A;  2W0G A;  5HXE A;  3B5M A;  4A56 A;  4PAG A;  4PK6 A;  2G0U A;  3LK3 B;  4G63 A;  4YLH A;  5LA6 E;  2FBW A;  4COF A;  4DV2 T;  4L5G A;  5AQJ B;  3KFW X;  4CXY A;  2OV9 A;  4LFC T;  4ILC A;  4EAH A;  3SFE A;  3J7Y q;  4JI1 T;  2E9X B;  2BS4 A;  3LBX B;  2LT3 A;  5LHG B;  4LF9 T;  2DNX A;  3U78 A;  4YHJ A;  4WBN E;  3I9W A;  3M65 A;  1GQE A;  4YT0 A;  4JYA T;  1VRB A;  1HX1 B;  2DHR A;  4DND A;  4GYR A;  5CGM A;  5FXX A;  5LNK A;  1KNP A;  3N2O A;  2Q9Q A;  2LSY A;  2W2U A;  3QOF A;  2LHR A;  4CI2 B;  1ZHC A;  1G8X A;  5JH7 E;  5L3D B;  1G73 A;  2DCF A;  1QUU A;  3GA8 A;  4A97 A;  3AE9 A;  1XMQ T;  1XDO A;  2BDE A;  2XAH B;  3BQI A;  3AAE B;  3AXJ B;  3IF8 B;  3UU4 A;  4GKK T;  2DL1 A;  2NW7 A;  5AQH B;  2WU2 A;  2Y6X A;  3TLW A;  1XNR T;  3BK9 A;  3BQK A;  1JNR A;  3PUR A;  5ADX L;  1MNE A;  2A3D A;  2LRK A;  4TV9 E;  3ZPO A;  5LYJ E;  2KT9 A;  2KWH A;  2ACZ A;  4B3T T;  4ILB A;  4UEL A;  4X66 T;  3KV4 A;  3PE0 A;  4HEA A;  2UU9 T;  1HNX T;  2NW8 A;  4ILA A;  1E1H B;  1UGO A;  4MHC A;  4ZS2 A;  4AQG A;  1V9D A;  5IWA T;  4U7I A;  4FJO A;  5J0Z A;  1X79 A;  3K3Q C;  5IHY A;  3ZYK A;  4X65 T;  1KEY A;  4AIU A;  2QYW A;  2CWO A;  5FXV A;  4P09 A;  2ODV A;  5ABG A;  5JRC A;  4TNV A;  4LF4 T;  4J2C A;  2CLY B;  3AE6 A;  4HFB A;  4EED A;  1T72 A;  3AVS A;  4JBW F;  4O4J E;  3ZC1 A;  3ZKR A;  1QLB A;  1WR6 A;  2LRL A;  4HE8 A;  3ANW A;  5LBM A;  3FZL B;  1WFD A;  4TUY E;  1O3X A;  4UR9 A;  4Z90 A;  3RIA A;  5JDG A;  4DV5 T;  4ZI2 D;  1T7S A;  4ERR A;  2V8S V;  5CFB A;  3AE8 A;  2XPK A;  2DI4 A;  3N9N A;  2UUA T;  2HPL A;  1U4Q A;  5FMN A;  4UXN B;  4ASK A;  4WNK A;  2WBL A;  1XDP A;  3M3Z B;  4HWI B;  3ZYM A;  5LGU B;  2WCA A;  4I50 E;  3N9M A;  3ZCI A;  1FMW A;  2XQ9 A;  5LGT B;  5JDQ A;  2L9Q A;  2XQ7 A;  4PFP A;  3FXE B;  4K0K T;  4KP3 C;  2C5J A;  5L3B B;  4YHH T;  4V1A v;  4P0A A;  4JI4 T;  2NP9 A;  2LHN A;  4N78 D;  3SRZ A;  1W9R A;  5H6Q B;  2YOE A;  2YDS A;  2ES0 A;  2XQ6 A;  2OA5 A;  2P9B A;  2YU1 A;  3QC9 A;  2BVM A;  2X67 A;  2Y8D A;  4B3S T;  3A5X A;  3EDV A;  4EYY R;  4EZ4 A;  4X1I E;  5FY0 A;  3MXZ A;  3OYZ A;  1KF6 A;  2VKJ A;  4IT4 A;  4YFS A;  3RI5 A;  3IEE A;  4ZEY A;  5AQK B;  3EAB A;  1U5P A;  2N1G A;  3JAF A;  4IGU A;  5L3E B;  5LMU T;  3TLU A;  4KBM B;  5E0O A;  2WDR A;  3ONJ A;  4HFH A;  3JC6 C;  1LVF A;  2BVL A;  3NVO A;  3OTO T;  2V5D A;  4DR2 T;  2BBJ A;  4TX5 A;  1HCI A;  2V7L A;  3AAI A;  2WWU A;  4CN6 A;  2WAU A;  2W61 A;  2VKD A;  3OJA A;  4IL9 A;  1OWA A;  5AQS B;  3RIU C;  4NUU A;  4JEU B;  4XBF B;  3H3M A;  5DAB A;  4AIS A;  4JI0 T;  2CBJ A;  1YKH B;  1UX5 A;  2JMH A;  4I43 B;  5CA0 E;  2HN1 A;  3N2K E;  4AKH A;  3VKH A;  4IE7 A;  1NAF A;  4ZI2 C;  2FJA A;  2VL0 A;  3S4U A;  3AB3 B;  2HHH T;  2ZM8 A;  3VR9 A;  3HA4 A;  3CQC B;  4HWH A;  4ISS A;  4OYJ A;  2R6G F;  5AQV B;  2A2F X;  2FJD A;  4QKN A;  5FP3 A;  3RX6 A;  4JUY A;  5JRE A;  3CIR A;  2KWI B;  3E22 E;  4MLK A;  5F3J A;  3UU3 A;  4QX7 B;  3ESL A;  1D0Y A;  3O1J A;  5JDF A;  4ZZB A;  5ABE A;  2BG9 E;  5LBQ B;  4JI2 T;  3C4Z A;  3P4R A;  4H9R C;  2ODU A;  2KND A;  4UV8 B;  3WAK A;  3L09 A;  3RIU A;  5C2T A;  4DVD A;  4P1N A;  3CML A;  1MMD A;  1ZV4 X;  2RPA A;  2XAS B;  3HKE E;  5L3G B;  1N36 T;  2WSS V;  4H9O C;  2QGS A;  4YTP A;  1J1J A;  2Q9Q D;  3GN5 A;  4Q25 A;  3AVR A;  3ZC0 A;  1XMO T;  2YIN A;  3JCF A;  3NWI A;  4UF0 B;  1IBK T;  3RGL A;  1LRZ A;  4CXW A;  5BMV E;  4YXD A;  3T1H T;  3RH3 A;  2CPT A;  3LK2 B;  2NTX A;  2C5K T;  2CXF A;  3NZQ A;  4MBQ A;  4DV7 T;  3PJA A;  1HG2 A;  3EVY A;  3ZMS B;  2FUP A;  1W09 A;  5L47 A;  4DR6 T;  1EZ3 A;  3PUY F;  3R84 B;  3ZJ1 A;  4BJN A;  1FJG T;  3UFE A;  3NRY A;  5JR9 C;  4UVA B;  2XUE A;  2XSB A;  1D0Z A;  2JQH A;  2NR4 A;  4EXT A;  4JI6 T;  2N2N A;  2BG9 B;  2KSR A;  4QHO A;  4U31 A;  4ZI7 E;  1VOM A;  1WLX A;  3C98 B;  2XQA A;  3N9L A;  1D1B A;  1MMG A;  1W0A A;  1B7T A;  4H9N C;  4EB6 E;  4NXN T;  1N33 T;  3CX6 B;  3QK6 A;  5ABF A;  1YKE B;  3KV5 A;  3N2G E;  3N9P A;  2CBI A;  5HWX A;  3UQ4 A;  4HFC A;  5C3J A;  2LM2 A;  2YEV C;  4LF7 T;  3AA1 B;  5AQM B;  4DR4 T;  2JRK A;  2PFV A;  1HTJ F;  2H89 A;  4PW8 A;  4AQF C;  2E9X C;  2RP4 A;  5KMG P;  2LKG A;  3I9Y A;  3FZM B;  2HH7 A;  2LSK A;  5LCY A;  1J5W A;  4NXM T;  2V26 A;  4HFV A;  5JR9 A;  2MBG A;  1OXZ A;  2XJ7 A;  3FBL A;  2D9D A;  2K3W A;  4ZZC A;  2H88 A;  2K9A A;  3RKG A;  4AQY T;  2LM9 A;  4M1P A;  3RF1 A;  5C8Y E;  1SHZ C;  5AQG B;  1ZKE A;  1AJ3 A;  3UUB A;  4JI5 T;  5HEU A;  5HXR A;  1ZOY A;  4TWH A;  4LMJ A;  4L9I A;  2X0H A;  4TWF A;  2M6I A;  3EHZ A;  1KNR A;  3AA7 B;  3HKD E;  2YN6 A;  1HNZ T;  2M67 A;  2BBH A;  3KVB A;  4X1Y E;  1L0V A;  4LFA T;  2XM1 A;  2K48 A;  2W62 A;  1KNZ A;  2MPK A;  3ZCJ A;  2E9X A;  3LBX A;  4AQF A;  1SUM B;  3F31 A;  5AQR B;  2K5B B;  4A98 A;  3RC3 A;  3KDS E;  3E08 A;  2BZB A;  3PDY A;  4ILU A;  4GK5 E;  2CRB A;  3BQL A;  3P7I A;  2X9W A;  2ZM2 A;  3AA6 B;  3I0Q A;  4U72 A;  5J1G A;  3RRW A;  5DQW A;  1OED B;  1ZEE A;  2H7V C;  5L2L A;  4O4I E;  2VWA A;  1VCS A;  3MK7 C;  4UVB B;  3KBT A;  3C4X A;  3DTO A;  4QX8 B;  1M7K A;  3RYI E;  1YW0 A;  3ZMV B;  1SE7 A;  2CA5 A;  4CI3 B;  4CZZ B;  4HGA A;  1VCT A;  2IUB A;  1ZP0 A;  3JAE A;  4DUY T;  2H7O A;  4YSY A;  2PTF A;  3JAD A;  3VRB A;  2L3L A;  5BR8 T;  2XQ4 A;  1IAP A;  5HAX A;  5EZY E;  3EDU A;  1KFY A;  5HEJ A;  3MZK B;  3KVA A;  2WDV A;  4PJL A;  1LVK A;  5HXH A;  4H63 H;  3P50 A;  3UUN A;  3V5S A;  3G06 A;  3ONL C;  5LXT E;  5AQN B;  3OVU A;  1CUN A;  2J47 A;  3H3A A;  3P8C D;  4JLE A;  3ETU A;  4OYK A;  5FXW A;  3UFG A;  4OX9 T;  2D0U A;  3T1Y T;  1E7P A;  3Q5X A;  4AKL A;  2XQ3 A;  2WMO A;  4ADZ A;  4TWD A;  2V6X A;  3T8O A;  4I0U A;  4IDP A;  1FMV A;  2HPJ A;  1CHU A;  4JI7 T;  4PJM A;  3PU8 A;  5AQF B;  2H3R A;  3KV6 A;  1UX4 A;  4X62 T;  1HG5 A;  2IAK A;  4U7Y A;  2WU5 A;  3L39 A;  5AQP B;  4HWF A;  3FZK B;  3I0O A;  4H63 V;  3GN5 B;  3LFM A;  3Q5D A;  2IDO B;  3SWH A;  4ZHQ E;  4ZI3 C;  2Y48 B;  3O1H A;  3SFD A;  4DBR A;  3C50 A;  1XZY A;  3GWH A;  2X66 A;  4UF0 A;  4IE6 A;  4WYV A;  5AFU L;  4JI8 T;  4QXH B;  2OLT A;  4IDN A;  1MMA A;  1HX8 A;  5CJ5 A;  3KBU A;  3A8Y C;  2C5I T;  4X64 T;  3RC8 A;  1WR0 A;  1M62 A;  2IML A;  2BS2 A;  3PUZ F;  3RQU A;  1Y64 B;  5AQO B;  1MIY A;  3UTK A;  2PJQ A;  3LK4 2;  4IE0 A;  2KZ7 B;  3UQ7 A;  2B1E A;  2XZE A;  4EZH A;  3DP7 A;  2I6H A;  2W63 A;  2W67 A;  3OBV E;  4X5T A;  3KV9 A;  4EYU A;  2UXB T;  3N5L A;  1BR0 A;  3OPC A;  5HEG A;  3ZJ2 A;  1MMN A;  5HXS A;  5LG3 A;  1UK5 A;  4QXB B;  4DV0 T;  4JI3 T;  3AA0 B;  5JDL A;  2WZH A;  4PFO A;  1IJ6 A;  2EHO C;  2JIW A;  1LKX A;  2WP9 A;  2XHE B;  4E7S A;  3RRC A;  5FVL A;  3DJB A;  4MAL A;  5J2T E;  3ETV A;  1UUS A;  4L0R A;  4YY3 T;  3RQW A;  2DLR A;  2JMK A;  3B57 A;  1BR2 A;  1QSD A;  1YQ4 A;  3P4W A;  3PUS A;  3Q5E A;  3CX8 B;  1N32 T;  4UIG A;  3F57 A;  3K3N A;  3OYX A;  3ZT6 A;  5LJM A;  2LSG A;  2XAQ B;  2YU2 A;  4P0B A;  1Z0P A;  3ONX A;  3EUH A;  5IUX A;  5L3F B;  3AEG A;  1DU2 A;  4LMK A;  3K3O A;  4U74 A;  3RKO A;  3ZT7 A;  2N9D A;  3HKB E;  3WI3 A;  3EAM A;  5CA1 E;  2V7J A;  2V7K A;  2XQY A;  4Z8X A;  2MTQ A;  4BA9 A;  1IBL T;  5HEO A;  4YTN A;  3TLS A;  4X1K E;  4H9P C;  3AAA B;  4UVC B;  1YXR A;  2X9H A;  5AQQ B;  2E2A A;  5IYZ E;  1UCU A;  3AE7 A;  2V6Y B;  3WAJ A;  2K24 A;  5GON E;  2EHO A;  3TKL B;  4DV4 T;  2LKH A;  2LLY A;  4EGW A;  1D0X A;  2FJB A;  3H37 A; 
#chains in the Genus database with same CATH homology
 4CQI A;  2D5U A;  3IBP A;  2NOX A;  3F2E A;  4WBO A;  3IHR A;  2WMN A;  5KX5 E;  4YJ2 E;  3D0T A;  2CXL A;  5LOV E;  2KIN B;  2X0L B;  3C64 A;  3N9Q A;  3HR0 A;  4O2B E;  4TV8 E;  4AKI A;  4HN9 A;  3MA9 A;  3OKQ A;  2XAF B;  2LSJ A;  3VKG A;  3RYH E;  3R6N A;  4JEH B;  2V1D B;  1SA0 E;  2JJ9 A;  2QA7 A;  4PJJ A;  5EK2 A;  5LJM A;  4EIW A;  2X51 A;  4KMC A;  4H9S E;  2VK9 A;  4O8S A;  3UT5 E;  4XZC A;  3ZLI A;  1FIO A;  2MOZ A;  3LJC A;  4O4H E;  3PUQ A;  4IHJ E;  4DMW A;  3HL6 A;  4UV9 B;  4ZOL E;  1WYC A;  5HWY A;  1MIV A;  4PK5 A;  3RPU A;  4H9Q C;  5JRC B;  2YK0 A;  2ZMA A;  4PJN A;  2V7M A;  3CWZ B;  2X68 A;  3W15 B;  2MYS A;  1D1C A;  4DMV A;  2LOS A;  2L8K A;  3CKD A;  2JPF A;  5LG4 A;  1D1A A;  3JC6 D;  4QWN B;  3ZMT B;  4AI6 A;  2NW9 A;  3VHL A;  1IZN B;  5LHI B;  3CQX C;  2J1D G;  2I59 A;  2EHO D;  3ANW B;  1WYB A;  1H7C A;  4AXP A;  5JQG E;  5JVD E;  2V7I A;  4GIW A;  4I55 E;  3NZP A;  2X9Y A;  5F8P A;  4ANJ A;  4IIJ E;  2KXP B;  3U3I A;  1HF8 A;  5HXC A;  2ZLY A;  3ZN0 B;  5FY1 A;  3L3P A;  4YJ3 E;  4UEM A;  3J9X 1;  4C90 A;  2CLY C;  4XAX B;  4AKR B;  4DBQ A;  3PTR B;  4B6X A;  5FNV E;  3UUL A;  4NUV A;  4ZS3 A;  1HFA A;  3Q9D A;  4ZI3 D;  5JDM A;  2ZM0 A;  3MAC A;  1BR1 A;  4IE5 A;  5FY7 A;  5L3C B;  5EK3 A;  4C91 A;  3ZMU B;  3NBX X;  4MFR A;  3MKD A;  2KMF A;  2ACX A;  2CXD A;  3CQG B;  2UXN B;  3VU7 H;  2JQQ A;  3B13 A;  3NRX A;  3HI2 A;  3CPZ A;  4GOU A;  1MND A;  2GK9 A;  2DWK A;  4AKG A;  5JDH A;  2CMR A;  4IST A;  2EHO B;  3N9O A;  4HKA A;  4GYS A;  3RYF E;  4BAY B;  3RYC E;  5A1L A;  2SPC A;  2CE7 A;  5JDN A;  2Q9Q B;  2VKH A;  2LEH A;  1NWM X;  3MJX A;  1IJ5 A;  3FBZ A;  5CB4 E;  4TN7 B;  5EK4 A;  3QUJ A;  4IDZ A;  3GMI A;  3Q5W A;  2NWB A;  2Z6E A;  4I4T E;  2CCQ A;  4FI5 A;  5TAO A;  2D0T A;  4CI1 B;  4F6R C;  3FXD B;  4EOZ B;  4PK4 A;  1YD8 G;  2D2S A;  2XTL A;  3PU3 A;  2VL8 A;  4O4L E;  3C4W A;  1S94 A;  2CEA A;  1KK7 A;  4BJM A;  5H6R B;  5LHH B;  4PNI A;  2RA1 A;  3ZYL A;  3I1A A;  1US7 B;  2XAG B;  4E7Z A;  3Q2M A;  2XAJ B;  4HTE A;  5FYM A;  2VKO A;  2DWG A;  2VB6 A;  4IE4 A;  5KDM C;  4OHF A;  3O1I A;  2VAS A;  3ZEF B;  3FHN A;  2IC9 A;  2IW5 B;  1WRD A;  1BR4 A;  1MIW A;  3PUA A;  5FXZ A;  1S35 A;  5DJQ C;  5M4Y A;  2E9X D;  4QXC B;  3C51 A;  2NTY A;  4OK0 A;  2UXX B;  2WM9 A;  3UUM A;  3O9X A;  2C0S A;  3CX7 B;  2CWY A;  3KIN B;  2KLQ A;  2E8I A;  3ZMZ B;  3PUG A;  5J2U E;  5JR9 B;  2PBI A;  2X9X A;  1FEW A;  2CM0 A;  2W00 A;  4K0U A;  5LGN B;  5LJN A;  2LOP A;  4TZ4 C;  4OFZ A;  5DQV A;  3CVR A;  4GK0 E;  3SOL A;  2LSI A;  3K8P C;  3HKC E;  4KUM B;  3ZN1 B;  2LJL A;  3FB2 A;  2PG8 A;  2IC6 A;  5ETW A;  3UUX B;  3E0Z A;  4O2A E;  4WW0 A;  1T98 A;  5LP6 E;  4G2A A;  2LE8 A;  3V5U A;  3LG7 A;  2Q9Q C;  3O4X E;  2A72 A;  4X20 E;  3SS1 A;  5HXE A;  2W0G A;  4A56 A;  4PAG A;  4PK6 A;  2G0U A;  3LK3 B;  4G63 A;  4YLH A;  5LA6 E;  4L5G A;  3KFW X;  4CXY A;  4EAH A;  3J7Y q;  2E9X B;  3LBX B;  2LT3 A;  5LHG B;  2DNX A;  3U78 A;  4YHJ A;  4WBN E;  3I9W A;  3M65 A;  1VRB A;  2DHR A;  4DND A;  4GYR A;  5LNK A;  5FXX A;  3N2O A;  2Q9Q A;  2LSY A;  4CI2 B;  2LHR A;  1ZHC A;  1G8X A;  5JH7 E;  5L3D B;  1G73 A;  3GA8 A;  2DCF A;  1QUU A;  2BDE A;  2XAH B;  3BQI A;  3AAE B;  3IF8 B;  2NW7 A;  2Y6X A;  3BK9 A;  3BQK A;  3PUR A;  5ADX L;  1MNE A;  2A3D A;  3ZPO A;  5LYJ E;  2KT9 A;  2KWH A;  4UEL A;  3KV4 A;  3PE0 A;  4HEA A;  2NW8 A;  4ZS2 A;  1E1H B;  4MHC A;  4AQG A;  1V9D A;  4FJO A;  1X79 A;  3K3Q C;  5IHY A;  3ZYK A;  2CWO A;  5FXV A;  4P09 A;  2ODV A;  5JRC A;  4J2C A;  2CLY B;  3ZC1 A;  3AVS A;  4DO0 A;  4O4J E;  5LBM A;  1WR6 A;  4HE8 A;  3ANW A;  4TUY E;  5JDG A;  1O3X A;  4ZI2 D;  4ERR A;  2DI4 A;  3N9N A;  2HPL A;  1U4Q A;  5FMN A;  4UXN B;  4ASK A;  4WNK A;  2WBL A;  5LGU B;  3ZYM A;  4I50 E;  3N9M A;  3ZCI A;  1FMW A;  5LGT B;  5JDQ A;  2L9Q A;  4PFP A;  3FXE B;  4KP3 C;  2C5J A;  5L3B B;  4P0A A;  4V1A v;  2NP9 A;  2LHN A;  4N78 D;  3SRZ A;  5H6Q B;  2ES0 A;  2YU1 A;  2OA5 A;  2P9B A;  3QC9 A;  1HS7 A;  2BVM A;  2X67 A;  2Y8D A;  3A5X A;  3EDV A;  4EYY R;  4EZ4 A;  4X1I E;  5FY0 A;  3MXZ A;  3OYZ A;  2VKJ A;  4YFS A;  3IEE A;  1U5P A;  2N1G A;  5L3E B;  4IGU A;  4KBM B;  5E0O A;  3JC6 C;  1LVF A;  2BVL A;  4TX5 A;  1HCI A;  2V7L A;  3AAI A;  2WWU A;  2WAU A;  2W61 A;  2VKD A;  3OJA A;  1OWA A;  4NUU A;  4JEU B;  4XBF B;  5DAB A;  2JMH A;  1YKH B;  1UX5 A;  4I43 B;  5CA0 E;  3VKH A;  3N2K E;  4AKH A;  4IE7 A;  1NAF A;  4ZI2 C;  3S4U A;  3AB3 B;  2ZM8 A;  3HA4 A;  3CQC B;  5FP3 A;  4ISS A;  4OYJ A;  2A2F X;  4QKN A;  3RX6 A;  5JRE A;  4JUY A;  2KWI B;  3E22 E;  4MLK A;  5F3J A;  4QX7 B;  3ESL A;  1D0Y A;  3O1J A;  5JDF A;  5LBQ B;  3C4Z A;  4H9R C;  3WAK A;  2ODU A;  2KND A;  4UV8 B;  3L09 A;  4DVD A;  3CML A;  1MMD A;  1ZV4 X;  2XAS B;  3HKE E;  5L3G B;  2WSS V;  4H9O C;  2QGS A;  2Q9Q D;  3GN5 A;  3AVR A;  3ZC0 A;  2YIN A;  4UF0 B;  1LRZ A;  4CXW A;  5BMV E;  3RH3 A;  3LK2 B;  2C5K T;  2CXF A;  2NTX A;  3NZQ A;  4MBQ A;  1HG2 A;  3EVY A;  3ZMS B;  1EZ3 A;  3ZJ1 A;  3R84 B;  4BJN A;  3UFE A;  3NRY A;  5JR9 C;  4UVA B;  2XUE A;  1D0Z A;  4EXT A;  2N2N A;  4QHO A;  4ZI7 E;  1VOM A;  1WLX A;  3C98 B;  3N9L A;  1D1B A;  1MMG A;  4EB6 E;  1B7T A;  4H9N C;  3CX6 B;  3QK6 A;  5HWX A;  1YKE B;  3KV5 A;  3N2G E;  3N9P A;  2YEV C;  3AA1 B;  2JRK A;  2PFV A;  1HTJ F;  4PW8 A;  4AQF C;  2E9X C;  2RP4 A;  5KMG P;  3I9Y A;  2HH7 A;  2LSK A;  5LCY A;  2V26 A;  4HFV A;  5JR9 A;  2MBG A;  1OXZ A;  3FBL A;  2K9A A;  1KNZ A;  2LM9 A;  4M1P A;  5C8Y E;  1SHZ C;  1ZKE A;  1AJ3 A;  5HXR A;  4L9I A;  3AA7 B;  3HKD E;  2M67 A;  3KVB A;  4X1Y E;  2K48 A;  2W62 A;  4AQF A;  3ZCJ A;  2E9X A;  3LBX A;  3F31 A;  2K5B B;  3RC3 A;  3KDS E;  3E08 A;  2BZB A;  3PDY A;  4ILU A;  4GK5 E;  3BQL A;  4TV9 E;  3P7I A;  2X9W A;  2ZM2 A;  3AA6 B;  3I0Q A;  4U72 A;  5J1G A;  3RRW A;  5DQW A;  2H7V C;  1ZEE A;  5L2L A;  4O4I E;  2VWA A;  3MK7 C;  3ZMV B;  4UVB B;  3KBT A;  3C4X A;  3DTO A;  4QX8 B;  4CXX A;  3RYI E;  1YW0 A;  4CI3 B;  2CA5 A;  4DBR A;  5HYA A;  4CZZ B;  4HGA A;  2H7O A;  2L3L A;  1IAP A;  5HAX A;  5EZY E;  3EDU A;  3MZK B;  3KVA A;  4PJL A;  1LVK A;  5HXH A;  4H63 H;  3UUN A;  3V5S A;  5LXT E;  1CUN A;  3H3A A;  3P8C D;  4JLE A;  4OYK A;  3ETU A;  5FXW A;  2D0U A;  3Q5X A;  4AKL A;  2WMO A;  4ADZ A;  3T8O A;  1FMV A;  2HPJ A;  4PJM A;  3PU8 A;  2H3R A;  3KV6 A;  1UX4 A;  1HG5 A;  2IAK A;  3I0O A;  4H63 V;  3GN5 B;  3LFM A;  3SWH A;  4ZHQ E;  4ZI3 C;  2Y48 B;  3O1H A;  3C50 A;  3GWH A;  2X66 A;  4UF0 A;  4IE6 A;  5AFU L;  4QXH B;  1MMA A;  1HX8 A;  3KBU A;  2C5I T;  3RC8 A;  1Y64 B;  1MIY A;  3UTK A;  2PJQ A;  3LK4 2;  4IE0 A;  2KZ7 B;  2B1E A;  4EZH A;  3DP7 A;  2W63 A;  3OBV E;  4EYU A;  3KV9 A;  1BR0 A;  3N5L A;  3ZJ2 A;  1MMN A;  5HXS A;  4QXB B;  3AA0 B;  5JDL A;  4PFO A;  1IJ6 A;  2EHO C;  2XHE B;  1LKX A;  4E7S A;  3RRC A;  3DJB A;  4MAL A;  5J2T E;  3ETV A;  4L0R A;  2DLR A;  2JMK A;  3B57 A;  1BR2 A;  1QSD A;  3PUS A;  3CX8 B;  4UIG A;  3F57 A;  3K3N A;  3OYX A;  2YU2 A;  2LSG A;  2XAQ B;  4P0B A;  1Z0P A;  3ONX A;  3EUH A;  5L3F B;  4U74 A;  3K3O A;  3RKO A;  2N9D A;  3HKB E;  3WI3 A;  5CA1 E;  2V7J A;  2V7K A;  2XQY A;  4Z8X A;  2MTQ A;  4BA9 A;  4X1K E;  4H9P C;  3AAA B;  4UVC B;  5IYZ E;  2X9H A;  1UCU A;  3WAJ A;  2K24 A;  5GON E;  2EHO A;  3TKL B;  1D0X A;  3H37 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...