3VU7H

Crystal structure of rev1-rev7-rev3 ternary complex
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
94
structure length
94
Chain Sequence
b'PNLAGAVEFNDVKTLLREWITTISDPMEEDILQVVKYCTDLIEEKDLEKLDLVIKYMKRLMQQSVESVWNMAFDFILDNVQVVLQQTYGSTLKV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA repair protein REV1
publication title Structural basis of recruitment of DNA polymerase [zeta] by interaction between REV1 and REV7 proteins
pubmed doi rcsb
source organism Homo sapiens
molecule tags Replication
total genus 31
structure length 94
sequence length 94
ec nomenclature
pdb deposition date 2012-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF16727 REV1_C DNA repair protein REV1 C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1280 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3vu7H00
4GK5E 4EXTA 4BA9A 4GK0E 2LSIA 2LSYA 2LSKA 4FJOA 3VU7H 2LSGA 2N1GA 2LSJA
chains in the Genus database with same CATH superfamily
3AE6A 2HN1A 2VVNA 1LVKA 3C51A 4UV8B 1HNXT 1KEYA 2L8KA 4DR1T 2FJBA 4U2ZA 4IE4A 2XQ5A 2XQ3A 1E1HB 2CA5A 3ZC0A 4DV4T 5JQGE 3EDVA 3HL6A 4KHZF 4AQFA 3LJCA 3HR0A 3I9YA 4YXDA 3O4XE 4A98A 4QWNB 2ZM8A 2Q9QC 4KI0F 2HH7A 3RQWA 4JI5T 4TWDA 4B6XA 3UULA 3EABA 3EHZA 1QSDA 4EGWA 2NW7A 2BS4A 2KXPB 5LYJE 5M4YA 4PJMA 4YLHA 2XQ6A 3K8PC 1SA0E 1T8BA 3VHLA 1QLBA 3A8YC 3PDYA 2VB6A 4TN7B 3ANWB 3KDSE 3B13A 4X1YE 4AKRB 3G06A 5LGNB 3JADA 2UXBT 4FI5A 4ZOLE 4C90A 4UR9A 3JCFA 3HKCE 5FXVA 1H7CA 4DBRA 5KX5E 3ZT5A 2NTXA 4YT0A 3UTKA 5FVKA 3RIUC 5JH7E 3OPCA 5HEGA 2XAHB 3IBPA 1W0AA 1V9DA 4AKIA 2C5JA 2YK0A 3MKDA 2CXLA 2YOEA 3QB5K 4U74A 2LEHA 4HGAA 3ZYMA 4QH1A 5TAOA 2FBWA 4A56A 3BK9A 2AXDS 2XM2A 1N36T 4JI2T 3T8OA 4ASKA 3IHRA 3DP7A 5ABFA 4E7ZA 2ZLYA 4DV1T 2CLYC 4I55E 4BJNA 3P4PA 4NUVA 2WY2A 4DO0A 3NRXA 3AE7A 5HWYA 4XZCA 2CWYA 5IHYA 4HFVA 2YEVC 3PUZF 1NAFA 1SUMB 3ZN0B 5J2TE 2E9XC 5HAXA 4OK0A 4KP3C 5LG4A 1YXRA 2NW9A 4BJMA 2MBGA 4B3ST 2A2FX 3PJAA 1HNZT 3OJAA 3FZFB 4LMLA 2DWKA 4C91A 1KNPA 3RH3A 1KNRA 4H63H 2BBHA 2WU5A 4O4IE 4X1KE 2CRBA 3VR9A 5JR9A 1VCSA 2UXNB 4IL4A 3PURA 4YHJA 4H9PC 3PJAJ 5HXHA 3RIFA 4CQIA 3AA7B 4YSXA 1WFDA 2R6GF 5LJMA 2WBLA 4UEMA 5L3EB 2KT9A 5LP6E 2IMLA 3RHWA 4U7IA 2E5LT 3AAIA 5AQPB 4UF0A 3AB3B 1SE7A 2BG9A 2LRKA 2N9DA 4ANJA 4CN4A 4WBNE 3UUBA 2ODVA 3ZMZB 2QA7A 5JREA 2LE8A 4NPPA 2XQ7A 1UUSA 3GN5A 3AE2A 4CXYA 4ZI3C 3N9PA 1D0ZA 2MTQA 2YINA 4ISSA 3ZJ2A 3AE9A 3PUAA 1MMDA 4ZI2C 2MAWA 2LOSA 1XMQT 2W62A 1O3XA 1IBMT 4PJJA 3AEDA 3EI0A 4L0RA 2NWBA 3AE5A 3IA3A 1X79A 5FVLA 2Q9QA 4JI7T 1Y64B 2FJEA 3RI5A 2D5UA 5DABA 1MMAA 3NBXX 4AISA 4TX5A 3SFDA 2V6YA 3LK42 2C0SA 1ZOYA 4ADZA 2K24A 2CHNA 5FYMA 2Q9QD 3C4WA 5LJNA 2DL1A 1J1JA 2CHOA 2D0UA 1WYBA 1ZEEA 2LSIA 3RF1A 4I43B 3PUWF 5CJ5A 3Q9DA 2WWVA 3AE3A 1W09A 4CN6A 3KV5A 1BR1A 4JI3T 1HR0T 4JV5T 5AQJB 5HEHA 3OVUA 1UX4A 1MNEA 1HCIA 1M62A 3C4XA 2KLQA 4Z90A 1WLXA 4DUZT 3RIUA 4COFA 2QYWA 2X51A 3LK2B 3C4ZA 3NWIA 1QUUA 4XBFB 3AXJA 4IDQA 3RLFF 3RQUA 4DMWA 2RP4A 2H3RA 4PK5A 1WRDA 3RGLA 4JI6T 3NZQA 3FBLA 4LF7T 2BKNA 3LBXB 5L3DB 1HG5A 4QH5A 3AE8A 1ZKEA 2D9DA 3KFWX 4IT4A 4DVDA 3ZLIA 2CM0A 2WWUA 3OTOT 3R84B 3RPUA 2VWAA 4ISTA 3F31A 5FL0A 4AKLA 1T72A 4JBWF 2KZ7B 2IW5B 4IE7A 4A5XA 5HXCA 4CXWA 5L3CB 1MIYA 1D1BA 2OV9A 4H9OC 4EIWA 5C2TA 4QXHB 3UQ4A 3NRYA 2NTYA 3TLSA 5LA6E 3T1YT 2V7KA 2JIWA 2VASA 4BAYB 4HFIA 1HF8A 1UGOA 2E9XA 3EDUA 4LMJA 3CX6B 3ZYLA 4UIGA 4PK4A 4PFPA 1KNZA 3U3IA 5DJQC 2Z6EA 1HG2A 3KVAA 2X66A 3HA4A 1FIOA 3N2GE 5AQUB 3HKEE 3U78A 1XNRT 4AKGA 4UVAB 2LM2A 3QOFA 2E9XD 1VRBA 5AQOB 2XHEB 4PAGA 4P09A 2UUBT 3I0OA 4GKJT 2PBIA 2NOXA 4O4JE 3UU6A 4YSZA 2ACXA 2WQYA 3PUVF 5F3JA 2BVLA 3P4RA 4BA9A 3I1AA 3AAAB 4I50E 2XQ9A 2JQHA 5JDQA 2E2AA 2LSGA 4F8HA 1BR4A 4O2BE 2RPAA 5FY0A 2VKJA 2NP9A 3KV9A 3ZCIA 2IDOB 2WMOA 1Z8UA 5LGUB 1WR0A 4EOZB 5F5WA 2H88A 5GONE 3N2KE 1G73A 1XMOT 3P8CD 5L4HA 4UVBB 1NENA 4B3MT 3LFMA 1ZV4X 4H9NC 2K5BB 4ILBA 5DQVA 4L9IA 4JUYA 3QUJA 3A7MA 4HWDA 5LXTE 5KDMC 2Y6XA 2JJ9A 1EZ3A 4H9RC 4WNKA 4ZS3A 1VCTA 2IHR1 4H9QC 1Y01A 4ZI3D 2Y48B 5AQRB 3JAEA 2BKPA 3AE4A 4CN1A 3OYXA 4HE8A 4ZI2D 2L3LA 5CA0E 2YN6A 5FNVE 1OEDE 5EZYE 1W0BA 2J1DG 2XUEA 3VU7H 2WM9A 1E2AA 3ZC1A 3ABVA 4EZ4A 1MIVA 1D1CA 1X9BA 2NW8A 5HXRA 5ABFB 4WBOA 4LF8T 3H3AA 3AVRA 5LNKA 4EAHA 4JI1T 5AQHB 4IDNA 2HHHT 4UV9B 3CMLA 2MOZA 4EEBA 2F4VT 3Q5DA 1HTJF 4FJOA 2I6HA 3ANWA 3VRAA 1FMVA 2ACZA 4GYSA 2XSAA 3RX6A 3AECA 5J0ZA 2I0MA 1N34T 5F8PA 5JRCB 2J47A 2W66A 3GA8A 1I6ZA 2HPLA 5LHIB 3PUYF 3AA0B 2VURA 4XAXB 2QVAA 4IREA 2BS3A 5H6RB 5IWAT 1R8IA 2FJAA 2WS3A 2W63A 4HTEA 2N1GA 3CVRA 2VQFT 2HPJA 1IAPA 2A3DA 2P9BA 2LM9A 1IBKT 5ABHA 3Q2MA 2M6IA 2X9XA 2XTLA 2QRXA 3WAJA 3L3PA 3CIRA 1YQ3A 3AE1A 4QH4A 3EUHA 1FJGT 3KVBA 2JMKA 4PFOA 3EVYA 5EK3A 1LVFA 4GK0E 2FUPA 2XAGB 1MMGA 4QXBB 4ZHQE 1OEDB 5CA1E 1MIWA 4X1IE 2V5CA 3TLWA 2A9UA 2YDSA 2PTFA 1IZNB 2XAQB 2XM1A 3X1DA 3ZCJA 4ERRA 4IDOA 2LKGA 5JDNA 3ONLC 1LKXA 5LBMA 4TNWA 3O1HA 3ONXA 5LB7B 3CQCB 3GMIA 5HEOA 4TUYE 2IIUA 2J62A 2B1EA 4LF5T 2V1DB 3LSVA 2MYSA 4HWIB 3N9QA 1J5WA 4P1NA 3LDQB 2XSBA 3TKLB 4PJNA 4DR5T 5FP3A 1XZYA 2YU1A 3E0ZA 3OKQA 3PUSA 5HEJA 5LMUT 1D0YA 4DNDA 2BZBA 3H3MA 4X66T 2V26A 2K9AA 3MXZA 3C64A 3ZKRA 3UUXB 3QC9A 5JTGA 2BKOA 4LF9T 3ZMTB 3UUMA 3BQKA 4DR7T 5FXZA 4X65T 4CI2B 2FJDA 1BR0A 5ETWA 2BBJA 5ABEA 5L2LA 5CGMA 2XAJB 3N9LA 3B5MA 2XASB 3KINB 4JEUB 2A72A 3T1HT 2MPKA 2SPCA 4U33A 3L39A 4IDZA 5AQVB 2VK9A 5AQNB 5BMVE 1G8XA 3PU8A 1XDOA 3ZT7A 2XZEA 2JQQA 3PUXF 4DV0T 3FB2A 3CX8B 4O4HE 3DTOA 3ZSSA 2HN2A 4GK5E 3ONJA 2W4XA 4YY3T 4PNIA 2DLRA 5ABGA 1HFAA 3CX7B 2X0LB 3CQGB 5AQQB 3GWHA 1HX1B 2BVMA 4HFHA 1CHUA 4OYJA 4DUYT 3I9WA 1FEWA 2J4GA 4YTNA 1YQ4A 1S94A 4Z8XA 2D0TA 2K3WA 4X5TA 3RYCE 4Z91A 3M3ZB 4P0AA 4YSYA 2E5VA 1WCRA 3AA6B 4CI3B 2CLYB 5AFUL 4F6RC 2VKOA 3TLTA 3RYFE 3AEGA 1WYCA 1HS7A 4L5GA 3J9X1 4KHPT 2WZHA 5CFBA 4HEAA 3O1IA 4J2CA 2V7IA 5LMNT 4WZXA 3HI2A 3KBUA 3ZPOA 3A5XA 4G63A 3AVSA 4DR2T 3N9MA 3RYHE 2WU2A 3AAEB 2CMRA 1E7PA 4O4LE 3UU3A 2EHOB 4NXNT 2CCQA 3SRZA 4UELA 2WDRA 2JMHA 3WI3A 2PFVA 1KF6A 4ZZCA 3ZEFB 2KINB 3J7Yq 2X67A 4JLEA 3K3NA 1M7KA 2WMNA 3Q5WA 4QKNA 2V7JA 2VVSA 4PJLA 1IJ5A 2CEAA 2WB5A 3LBXA 4HFEA 4X62T 2XQ4A 3UU8A 3CK6A 4MFRA 3CQXC 2LLYA 3E08A 3SWHA 3VKGA 2LSYA 4LFBT 5EK2A 4N78D 5L3FB 2H89A 3ETUA 3LG7A 4U2YA 2DI4A 2LKHA 4ZS2A 3AEAA 1IBLT 2KSRA 4TNVA 4CZZB 3UU5A 2H7OA 4U7YA 2W00A 4TWHA 2V7LA 5HXSA 4HFCA 3KV4A 2X0YA 4QX8B 4AQGA 5HXEA 1MNDA 4KX6A 4WYVA 1UX5A 2LSKA 3HKDE 4IHJE 2KNDA 2IC9A 4NXMT 1ZP0A 3O1JA 2DCFA 3UU4A 3VKHA 3UFGA 1WR6A 2LT3A 5DQWA 4YJ2E 1UCUA 4GKKT 4OX9T 2JPFA 5C3JA 2UXCT 4OFZA 5L3GB 4U31A 3MJXA 3VRBA 1YKEB 4H9SE 4IE6A 1T7SA 3RKGA 3TLUA 1XNQT 3MA9A 3DJBA 3NKZA 4ILUA 2VKDA 3PE0A 5JDLA 4AIUA 3I0QA 1I94T 4DBQA 3C98B 5LOVE 4IE0A 1NEKA 4DIDB 1JNZA 2W61A 3N9OA 1BR2A 1J5ET 3NVOA 3RYIE 1OXZA 4IDPA 2XQYA 4UXNB 2BG9E 2L9QA 3B57A 3UQ7A 5AQLB 3Q5EA 2V8SV 4EEDA 5A1LA 2LSJA 2CXDA 4I0UA 2WDVA 4MLKA 5JDFA 3F57A 2W0GA 4ZZBA 5JVDE 4LF4T 4HFDA 4TV8E 1T98A 2WSSV 3W15B 2D2SA 1B7TA 4E7SA 4LFCT 4U72A 2WDQA 3MK7C 3ZMUB 4MHCA 4AI6A 4TZ4C 1VOMA 3ETVA 2M67A 5BR8T 5AQMB 2CBIA 2I59A 4OHFA 4ILCA 1YW0A 3UFEA 2N2NA 4ZI7E 4PW8A 2CXFA 4UVCB 2ZMAA 3FBZA 4QHOA 1N33T 2XQAA 4QX7B 4YTMA 2OLTA 2UU9T 2BDEA 2KWIB 2GK9A 1JNRA 4Q25A 2X68A 3AEEA 4A97A 3JC6C 5AQIB 3UT5E 4HN9A 4HWHA 2E8IA 3V5SA 2IAKA 3SFEA 5JR9B 3ZT6A 5J1GA 2G0UA 2ODUA 3JAFA 4EZHA 3ZJ1A 3RC3A 1US7B 3FXEB 4NUUA 5ADXL 2CPTA 4U3CA 2V7MA 2PJQA 4IE5A 4LF6T 1FMWA 5FKYA 5KMGP 5JDGA 5AQTB 3AEBA 4UF0B 5JRCA 3HKBE 2KWHA 4AXPA 3FXDB 2BG9B 2UUCT 4ILAA 5HYAA 2W67A 4LFAT 3SS1A 4O8SA 2EHOC 2VKHA 5JDMA 3ZSTA 4GOUA 3QNUA 2KMFA 1KFYA 4IGUA 1Z0PA 4YFSA 3ZYKA 3GN5B 5L4EA 5FY7A 3SOLA 5H6QB 2ES0A 3IF8B 3FZHB 3ESLA 3UUNA 5LHGB 3F2EA 4KUMB 2LHRA 4JEHB 2PG8A 3KV6A 2X9HA 2JQ9A 3NZPA 2DWGA 3RKOA 1AJ3A 3WAKA 1XWMA 3D0TA 2WAUA 5AQGB 2Q9QB 3QK6A 5FXXA 4QXCB 1OEDA 5CB4E 4PK6A 2DHRA 1UK5A 4IL9A 2CWOA 2CE7A 3N9NA 2V6YB 5LHHB 2M6BA 3R6NA 1UURA 4AQFC 1DU2A 4CI1B 3ZMVB 4AKHA 2IUBA 3RC8A 3P50A 3PTRB 3K1SA 4DR3T 2V6XA 5FY1A 1SHZC 2WP9A 3FZMB 3PUQA 3P7IA 5LCYA 4M1PA 5HCJA 2X0HA 3LK3B 2CBJA 3CKDA 3H37A 3K3QC 3P4SA 4HKAA 4DV7T 3TLVA 5HEUA 1ZHCA 4GYRA 4ZXLA 3CWZB 1U4QA 3PUGA 5LBQB 3AXJB 3RRCA 1D0XA 4EYYR 1S35A 3EAMA 4ZEYA 1KK7A 2XQ8A 3ZMSB 4K0KT 2H7VC 1YKHB 4HWFA 3FZLB 4IIJE 3KBTA 4B3TT 2XJ7A 2XAFB 2WCAA 3N2OA 3M65A 4TV9E 4JI4T 2ZM6T 3RRWA 5HCMA 5C8YE 1MMNA 4HWCA 4NIQA 5L47A 1HX8A 2DNXA 4G2AA 3ZN1B 1U5PA 2K48A 3AA1B 3PV0F 3L8RA 2LRLA 1L0VA 4OYKA 4DR4T 1D1AA 2VQET 2C5IT 4DV3T 2UXXB 2NR4A 3L09A 1N32T 5IUXA 5J2UE 2LHNA 4X20E 4CXXA 4B3RT 4EB6E 1CUNA 2X9YA 4DV5T 3CPZA 3E22E 3FZKB 2YKSA 3PU3A 2E9XB 5L3BB 3O9XA 4K0UA 4GIWA 4DR6T 4EYUA 2BS2A 3MACA 4LMKA 3MZKB 4MBQA 5E0OA 2ZM0A 2V5DA 4V1Av 2UUAT 2AE9A 5AQKB 5IYZE 3C50A 2Y8DA 3FHNA 3OYZA 1IJ6A 4YJ3E 3OBVE 3S4UA 2OA5A 4YHHT 3N5LA 1YD8G 4P0BA 2W2UA 1W9RA 5FMNA 3P4QA 1LRZA 3BQLA 1OWAA 4EXTA 1GQEA 4HFBA 4JYAT 2UXDT 3BQIA 5FXWA 4H63V 2RA1A 3JC6D 5LGTB 2YU2A 5AQSB 4DMVA 2YDRA 4I4TE 3IEEA 1NWMX 2JRKA 4DV6T 4X64T 1HNWT 5FL1A 2IC6A 3Q5XA 5JR9C 1XDPA 4JI0T 4JI8T 5AQFB 5EK4A 2XY8B 2X9WA 5KXJA 4DV2T 4AQYT 4YTPA 2EHOA 2ZM2A 3P4WA 2B76A 5HWXA 2VL0A 3AEFA 2XPKA 5JDHA 4O2AE 4KMCA 2C5KT 3K3OA 1OEDC 2WZIA 2BG9C 2LOPA 2LJLA 4MALA 5LG3A 3RIAA 4WW0A 2EHOD 3V5UA 4EV6A 3VR8A 3QB5A 2JQKA 2YDQA 2QGSA 2VL8A 4TWFA 4KBMB
chains in the Genus database with same CATH topology
2RP4A 4OHFA 2H3RA 4PK5A 1WRDA 1YW0A 3UFEA 1LVKA 3C51A 2N2NA 3NZQA 4UV8B 3FBLA 3ZMTB 4ZI7E 4PW8A 2CXFA 4UVCB 2L8KA 2ZMAA 3UUMA 3BQKA 3LBXB 5L3DB 1HG5A 3FBZA 4QHOA 4QX7B 1ZKEA 4IE4A 3KFWX 5FXZA 4DVDA 2BDEA 2KWIB 2GK9A 1E1HB 2CA5A 3ZC0A 2X68A 5JQGE 3EDVA 3HL6A 3ZLIA 2CM0A 2WWUA 3JC6C 4CI2B 4AQFA 3LJCA 1BR0A 3HR0A 3I9YA 3UT5E 4HN9A 3O4XE 5ETWA 4QWNB 3R84B 2ZM8A 2E8IA 3RPUA 2Q9QC 2VWAA 3V5SA 2IAKA 2HH7A 4ISTA 5L2LA 3F31A 4B6XA 3UULA 5JR9B 1QSDA 2XAJB 3N9LA 2NW7A 2KXPB 2XASB 5J1GA 4AKLA 3KINB 2G0UA 4JEUB 5LYJE 2ODUA 2A72A 5M4YA 4EZHA 2KZ7B 3ZJ1A 3RC3A 4PJMA 1US7B 4YLHA 2IW5B 3FXEB 2SPCA 4NUUA 5ADXL 4IE7A 4IDZA 5HXCA 4CXWA 5L3CB 2V7MA 2PJQA 3K8PC 1SA0E 4IE5A 1MIYA 1D1BA 4H9OC 4EIWA 4QXHB 1FMWA 3NRYA 2NTYA 5KMGP 2VK9A 5LA6E 5JDGA 2V7KA 1G8XA 5BMVE 2VASA 3PU8A 4BAYB 1HF8A 4UF0B 5JRCA 3VHLA 3HKBE 2KWHA 3PDYA 2E9XA 3EDUA 4AXPA 3FXDB 2VB6A 2JQQA 5HYAA 4TN7B 3ANWB 3CX6B 3ZYLA 4UIGA 3FB2A 3SS1A 4O8SA 3KDSE 2EHOC 2VKHA 4PK4A 3B13A 3CX8B 4O4HE 4PFPA 4X1YE 4AKRB 5JDMA 4GOUA 3DTOA 1KNZA 2KMFA 5LGNB 3U3IA 4GK5E 4IGUA 1Z0PA 4YFSA 5DJQC 2Z6EA 3GN5B 3ZYKA 1HG2A 5FY7A 3SOLA 3KVAA 4FI5A 4ZOLE 4C90A 2X66A 3HA4A 5H6QB 2ES0A 3IF8B 1FIOA 3ESLA 3N2GE 3HKCE 4PNIA 3HKEE 2DLRA 3UUNA 3U78A 4AKGA 4UVAB 1HFAA 3CX7B 2E9XD 1H7CA 2X0LB 3CQGB 5FXVA 4DBRA 5KX5E 5LHGB 2NTXA 3F2EA 3UTKA 3GWHA 4KUMB 1VRBA 2BVMA 5JH7E 4OYJA 2XHEB 2LHRA 4PAGA 4JEHB 4P09A 3I9WA 2PG8A 3KV6A 1FEWA 1S94A 2X9HA 3I0OA 4Z8XA 2PBIA 2NOXA 3NZPA 2D0TA 2DWGA 3RKOA 2XAHB 1AJ3A 4O4JE 3IBPA 2ACXA 3WAKA 3D0TA 1V9DA 2WAUA 3RYCE 5F3JA 2BVLA 4AKIA 2C5JA 4BA9A 4P0AA 2Q9QB 2YK0A 3I1AA 3QK6A 3AAAB 4I50E 5FXXA 3MKDA 4QXCB 5CB4E 4PK6A 2DHRA 2CXLA 3AA6B 5JDQA 4CI3B 2LSGA 2CLYB 5AFUL 4F6RC 2VKOA 2CWOA 1BR4A 3RYFE 4U74A 1WYCA 2LEHA 4O2BE 4HGAA 5FY0A 1HS7A 2VKJA 4L5GA 2CE7A 3N9NA 3J9X1 3ZYMA 2NP9A 5TAOA 3KV9A 3ZCIA 5LHHB 2WMOA 3BK9A 4A56A 5LGUB 3R6NA 4AQFC 4CI1B 4HEAA 4EOZB 3ZMVB 3O1IA 4J2CA 2V7IA 3T8OA 4ASKA 3HI2A 3KBUA 3IHRA 4AKHA 3ZPOA 3A5XA 3DP7A 4G63A 5GONE 3AVSA 3RC8A 3PTRB 4E7ZA 3N2KE 1G73A 2ZLYA 3N9MA 3P8CD 3RYHE 4UVBB 3AAEB 5FY1A 2CMRA 1SHZC 3LFMA 4O4LE 3PUQA 3P7IA 5LCYA 2CLYC 1ZV4X 2EHOB 4I55E 4NUVA 4BJNA 4DO0A 4H9NC 2CCQA 4M1PA 3NRXA 2K5BB 3SRZA 4UELA 2JMHA 5DQVA 4L9IA 4JUYA 3LK3B 3QUJA 5HWYA 4XZCA 3CKDA 3H37A 3K3QC 2CWYA 4HKAA 5LXTE 5IHYA 3WI3A 2PFVA 4HFVA 2YEVC 1NAFA 3ZN0B 5J2TE 3ZEFB 2KINB 2E9XC 1ZHCA 4GYRA 4OK0A 5HAXA 3J7Yq 5KDMC 4KP3C 2X67A 2Y6XA 2JJ9A 4JLEA 1EZ3A 5LG4A 4H9RC 4WNKA 2NW9A 3K3NA 4ZS3A 3CWZB 2WMNA 3Q5WA 1U4QA 4H9QC 4QKNA 4BJMA 2MBGA 2V7JA 4ZI3D 3PUGA 4PJLA 2Y48B 5LBQB 3RRCA 1D0XA 1IJ5A 2CEAA 3LBXA 4EYYR 1S35A 3OYXA 1KK7A 4HE8A 4ZI2D 2A2FX 2L3LA 3ZMSB 2H7VC 5CA0E 4MFRA 1YKHB 3OJAA 3CQXC 4IIJE 2DWKA 3E08A 3KBTA 5FNVE 3SWHA 3VKGA 2XAFB 4C91A 5EZYE 2LSYA 3N2OA 5EK2A 3M65A 4N78D 4TV9E 5L3FB 3ETUA 3LG7A 3RH3A 4H63H 2J1DG 3RRWA 2XUEA 4O4IE 4X1KE 3VU7H 5C8YE 2WM9A 5JR9A 1MMNA 2DI4A 2UXNB 3ZC1A 3PURA 4EZ4A 1MIVA 4YHJA 1D1CA 4ZS2A 4H9PC 1HX8A 5HXHA 2NW8A 5HXRA 4CQIA 3AA7B 4WBOA 5LJMA 2WBLA 4UEMA 4CZZB 5L3EB 2DNXA 3H3AA 3AVRA 5LNKA 2KT9A 4EAHA 5LP6E 4G2AA 2H7OA 3ZN1B 1U5PA 2W00A 2K48A 3AAIA 3AA1B 4OYKA 1D1AA 4UF0A 2C5IT 3AB3B 2V7LA 4UV9B 3CMLA 2MOZA 5HXSA 2UXXB 2N9DA 4ANJA 3L09A 4WBNE 1HTJF 4FJOA 3KV4A 3ANWA 2ODVA 4QX8B 4AQGA 5J2UE 5HXEA 3ZMZB 1FMVA 3RX6A 4GYSA 1MNDA 2QA7A 2LHNA 5JREA 4X20E 4CXXA 4EB6E 1CUNA 1UX5A 2LE8A 2LSKA 2X9YA 3CPZA 3HKDE 3GN5A 5F8PA 5JRCB 3GA8A 3E22E 2HPLA 3PU3A 5LHIB 2E9XB 4IHJE 5L3BB 2KNDA 3AA0B 2IC9A 3O9XA 4XAXB 4K0UA 5H6RB 4CXYA 4GIWA 4ZI3C 3O1JA 2DCFA 4EYUA 3MACA 1D0ZA 3N9PA 3VKHA 3MZKB 4MBQA 5E0OA 2ZM0A 1WR6A 2MTQA 2YINA 4ISSA 2W63A 4V1Av 2LT3A 3ZJ2A 3PUAA 1MMDA 2N1GA 4HTEA 5DQWA 3CVRA 4YJ2E 4ZI2C 5IYZE 1UCUA 2LOSA 2HPJA 2JPFA 3C50A 2W62A 2Y8DA 4OFZA 5L3GB 1IAPA 3FHNA 3OYZA 3MJXA 1O3XA 1YKEB 1IJ6A 2A3DA 2P9BA 4YJ3E 2LM9A 4PJJA 4H9SE 4IE6A 4L0RA 3OBVE 3S4UA 3Q2MA 2NWBA 2OA5A 2X9XA 1X79A 2XTLA 3MA9A 3L3PA 1YD8G 3N5LA 2Q9QA 3DJBA 3WAJA 1Y64B 4ILUA 2VKDA 3PE0A 5JDLA 3EUHA 3KVBA 2JMKA 3I0QA 4P0BA 2D5UA 4DBQA 3C98B 4PFOA 5FMNA 5DABA 1LRZA 1MMAA 3BQLA 3EVYA 3NBXX 4IE0A 5EK3A 4TX5A 1OWAA 1LVFA 5LOVE 4EXTA 4GK0E 3BQIA 2W61A 5FXWA 2XAGB 4H63V 1MMGA 3LK42 3N9OA 2RA1A 1BR2A 3JC6D 3RYIE 4QXBB 2YU2A 4ZHQE 5LGTB 4DMVA 2C0SA 4I4TE 1OXZA 3IEEA 4ADZA 2K24A 1NWMX 2JRKA 5FYMA 5CA1E 1MIWA 2XQYA 2Q9QD 3C4WA 4UXNB 2IC6A 4X1IE 5LJNA 3Q5XA 2L9QA 3B57A 5JR9C 2XAQB 1IZNB 3ZCJA 4ERRA 5EK4A 2D0UA 1WYBA 1ZEEA 2LSIA 2X9WA 5JDNA 1LKXA 5LBMA 5A1LA 2LSJA 3O1HA 2EHOA 4I43B 3ONXA 2CXDA 3CQCB 3GMIA 2ZM2A 4TUYE 4MLKA 2B1EA 3Q9DA 2V1DB 5JDFA 3F57A 2MYSA 5HWXA 2W0GA 3KV5A 5JDHA 1BR1A 3N9QA 4O2AE 4KMCA 5JVDE 4TV8E 2C5KT 3K3OA 1T98A 1UX4A 2WSSV 3TKLB 3W15B 1MNEA 1HCIA 3C4XA 2KLQA 4PJNA 2D2SA 1B7TA 2LOPA 1WLXA 2LJLA 4MALA 5FP3A 4E7SA 2X51A 3LK2B 3C4ZA 4U72A 3MK7C 4WW0A 2YU1A 2EHOD 3ZMUB 1QUUA 4XBFB 3V5UA 3E0ZA 3OKQA 3PUSA 4MHCA 4AI6A 4TZ4C 1VOMA 3ETVA 1D0YA 4DNDA 2BZBA 2M67A 2V26A 2K9AA 3MXZA 3C64A 3UUXB 2QGSA 3QC9A 4DMWA 2VL8A 4KBMB 2I59A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GK5 E;  4EXT A;  4BA9 A;  4GK0 E;  2LSI A;  2LSY A;  2LSK A;  4FJO A;  3VU7 H;  2LSG A;  2N1G A;  2LSJ A; 
#chains in the Genus database with same CATH topology
 3AE6 A;  2HN1 A;  2VVN A;  1LVK A;  3C51 A;  4UV8 B;  1HNX T;  1KEY A;  2L8K A;  4DR1 T;  2FJB A;  4U2Z A;  4IE4 A;  2XQ5 A;  2XQ3 A;  1E1H B;  2CA5 A;  3ZC0 A;  4DV4 T;  5JQG E;  3EDV A;  3HL6 A;  4KHZ F;  4AQF A;  3LJC A;  3HR0 A;  3I9Y A;  4YXD A;  3O4X E;  4A98 A;  4QWN B;  2ZM8 A;  2Q9Q C;  4KI0 F;  2HH7 A;  3RQW A;  4JI5 T;  4TWD A;  4B6X A;  3UUL A;  3EAB A;  3EHZ A;  1QSD A;  4EGW A;  2NW7 A;  2BS4 A;  2KXP B;  5LYJ E;  5M4Y A;  4PJM A;  4YLH A;  2XQ6 A;  3K8P C;  1SA0 E;  1T8B A;  3VHL A;  1QLB A;  3A8Y C;  3PDY A;  2VB6 A;  4TN7 B;  3ANW B;  3KDS E;  3B13 A;  4X1Y E;  4AKR B;  3G06 A;  5LGN B;  3JAD A;  2UXB T;  4FI5 A;  4ZOL E;  4C90 A;  4UR9 A;  3JCF A;  3HKC E;  5FXV A;  1H7C A;  4DBR A;  5KX5 E;  3ZT5 A;  2NTX A;  4YT0 A;  3UTK A;  5FVK A;  3RIU C;  5JH7 E;  3OPC A;  5HEG A;  2XAH B;  3IBP A;  1W0A A;  1V9D A;  4AKI A;  2C5J A;  2YK0 A;  3MKD A;  2CXL A;  2YOE A;  3QB5 K;  4U74 A;  2LEH A;  4HGA A;  3ZYM A;  4QH1 A;  5TAO A;  2FBW A;  4A56 A;  3BK9 A;  2AXD S;  2XM2 A;  1N36 T;  4JI2 T;  3T8O A;  4ASK A;  3IHR A;  3DP7 A;  5ABF A;  4E7Z A;  2ZLY A;  4DV1 T;  2CLY C;  4I55 E;  4BJN A;  3P4P A;  4NUV A;  2WY2 A;  4DO0 A;  3NRX A;  3AE7 A;  5HWY A;  4XZC A;  2CWY A;  5IHY A;  4HFV A;  2YEV C;  3PUZ F;  1NAF A;  1SUM B;  3ZN0 B;  5J2T E;  2E9X C;  5HAX A;  4OK0 A;  4KP3 C;  5LG4 A;  1YXR A;  2NW9 A;  4BJM A;  2MBG A;  4B3S T;  2A2F X;  3PJA A;  1HNZ T;  3OJA A;  3FZF B;  4LML A;  2DWK A;  4C91 A;  1KNP A;  3RH3 A;  1KNR A;  4H63 H;  2BBH A;  2WU5 A;  4O4I E;  4X1K E;  2CRB A;  3VR9 A;  5JR9 A;  1VCS A;  2UXN B;  4IL4 A;  3PUR A;  4YHJ A;  4H9P C;  3PJA J;  5HXH A;  3RIF A;  4CQI A;  3AA7 B;  4YSX A;  1WFD A;  2R6G F;  5LJM A;  2WBL A;  4UEM A;  5L3E B;  2KT9 A;  5LP6 E;  2IML A;  3RHW A;  4U7I A;  2E5L T;  3AAI A;  5AQP B;  4UF0 A;  3AB3 B;  1SE7 A;  2BG9 A;  2LRK A;  2N9D A;  4ANJ A;  4CN4 A;  4WBN E;  3UUB A;  2ODV A;  3ZMZ B;  2QA7 A;  5JRE A;  2LE8 A;  4NPP A;  2XQ7 A;  1UUS A;  3GN5 A;  3AE2 A;  4CXY A;  4ZI3 C;  3N9P A;  1D0Z A;  2MTQ A;  2YIN A;  4ISS A;  3ZJ2 A;  3AE9 A;  3PUA A;  1MMD A;  4ZI2 C;  2MAW A;  2LOS A;  1XMQ T;  2W62 A;  1O3X A;  1IBM T;  4PJJ A;  3AED A;  3EI0 A;  4L0R A;  2NWB A;  3AE5 A;  3IA3 A;  1X79 A;  5FVL A;  2Q9Q A;  4JI7 T;  1Y64 B;  2FJE A;  3RI5 A;  2D5U A;  5DAB A;  1MMA A;  3NBX X;  4AIS A;  4TX5 A;  3SFD A;  2V6Y A;  3LK4 2;  2C0S A;  1ZOY A;  4ADZ A;  2K24 A;  2CHN A;  5FYM A;  2Q9Q D;  3C4W A;  5LJN A;  2DL1 A;  1J1J A;  2CHO A;  2D0U A;  1WYB A;  1ZEE A;  2LSI A;  3RF1 A;  4I43 B;  3PUW F;  5CJ5 A;  3Q9D A;  2WWV A;  3AE3 A;  1W09 A;  4CN6 A;  3KV5 A;  1BR1 A;  4JI3 T;  1HR0 T;  4JV5 T;  5AQJ B;  5HEH A;  3OVU A;  1UX4 A;  1MNE A;  1HCI A;  1M62 A;  3C4X A;  2KLQ A;  4Z90 A;  1WLX A;  4DUZ T;  3RIU A;  4COF A;  2QYW A;  2X51 A;  3LK2 B;  3C4Z A;  3NWI A;  1QUU A;  4XBF B;  3AXJ A;  4IDQ A;  3RLF F;  3RQU A;  4DMW A;  2RP4 A;  2H3R A;  4PK5 A;  1WRD A;  3RGL A;  4JI6 T;  3NZQ A;  3FBL A;  4LF7 T;  2BKN A;  3LBX B;  5L3D B;  1HG5 A;  4QH5 A;  3AE8 A;  1ZKE A;  2D9D A;  3KFW X;  4IT4 A;  4DVD A;  3ZLI A;  2CM0 A;  2WWU A;  3OTO T;  3R84 B;  3RPU A;  2VWA A;  4IST A;  3F31 A;  5FL0 A;  4AKL A;  1T72 A;  4JBW F;  2KZ7 B;  2IW5 B;  4IE7 A;  4A5X A;  5HXC A;  4CXW A;  5L3C B;  1MIY A;  1D1B A;  2OV9 A;  4H9O C;  4EIW A;  5C2T A;  4QXH B;  3UQ4 A;  3NRY A;  2NTY A;  3TLS A;  5LA6 E;  3T1Y T;  2V7K A;  2JIW A;  2VAS A;  4BAY B;  4HFI A;  1HF8 A;  1UGO A;  2E9X A;  3EDU A;  4LMJ A;  3CX6 B;  3ZYL A;  4UIG A;  4PK4 A;  4PFP A;  1KNZ A;  3U3I A;  5DJQ C;  2Z6E A;  1HG2 A;  3KVA A;  2X66 A;  3HA4 A;  1FIO A;  3N2G E;  5AQU B;  3HKE E;  3U78 A;  1XNR T;  4AKG A;  4UVA B;  2LM2 A;  3QOF A;  2E9X D;  1VRB A;  5AQO B;  2XHE B;  4PAG A;  4P09 A;  2UUB T;  3I0O A;  4GKJ T;  2PBI A;  2NOX A;  4O4J E;  3UU6 A;  4YSZ A;  2ACX A;  2WQY A;  3PUV F;  5F3J A;  2BVL A;  3P4R A;  4BA9 A;  3I1A A;  3AAA B;  4I50 E;  2XQ9 A;  2JQH A;  5JDQ A;  2E2A A;  2LSG A;  4F8H A;  1BR4 A;  4O2B E;  2RPA A;  5FY0 A;  2VKJ A;  2NP9 A;  3KV9 A;  3ZCI A;  2IDO B;  2WMO A;  1Z8U A;  5LGU B;  1WR0 A;  4EOZ B;  5F5W A;  2H88 A;  5GON E;  3N2K E;  1G73 A;  1XMO T;  3P8C D;  5L4H A;  4UVB B;  1NEN A;  4B3M T;  3LFM A;  1ZV4 X;  4H9N C;  2K5B B;  4ILB A;  5DQV A;  4L9I A;  4JUY A;  3QUJ A;  3A7M A;  4HWD A;  5LXT E;  5KDM C;  2Y6X A;  2JJ9 A;  1EZ3 A;  4H9R C;  4WNK A;  4ZS3 A;  1VCT A;  2IHR 1;  4H9Q C;  1Y01 A;  4ZI3 D;  2Y48 B;  5AQR B;  3JAE A;  2BKP A;  3AE4 A;  4CN1 A;  3OYX A;  4HE8 A;  4ZI2 D;  2L3L A;  5CA0 E;  2YN6 A;  5FNV E;  1OED E;  5EZY E;  1W0B A;  2J1D G;  2XUE A;  3VU7 H;  2WM9 A;  1E2A A;  3ZC1 A;  3ABV A;  4EZ4 A;  1MIV A;  1D1C A;  1X9B A;  2NW8 A;  5HXR A;  5ABF B;  4WBO A;  4LF8 T;  3H3A A;  3AVR A;  5LNK A;  4EAH A;  4JI1 T;  5AQH B;  4IDN A;  2HHH T;  4UV9 B;  3CML A;  2MOZ A;  4EEB A;  2F4V T;  3Q5D A;  1HTJ F;  4FJO A;  2I6H A;  3ANW A;  3VRA A;  1FMV A;  2ACZ A;  4GYS A;  2XSA A;  3RX6 A;  3AEC A;  5J0Z A;  2I0M A;  1N34 T;  5F8P A;  5JRC B;  2J47 A;  2W66 A;  3GA8 A;  1I6Z A;  2HPL A;  5LHI B;  3PUY F;  3AA0 B;  2VUR A;  4XAX B;  2QVA A;  4IRE A;  2BS3 A;  5H6R B;  5IWA T;  1R8I A;  2FJA A;  2WS3 A;  2W63 A;  4HTE A;  2N1G A;  3CVR A;  2VQF T;  2HPJ A;  1IAP A;  2A3D A;  2P9B A;  2LM9 A;  1IBK T;  5ABH A;  3Q2M A;  2M6I A;  2X9X A;  2XTL A;  2QRX A;  3WAJ A;  3L3P A;  3CIR A;  1YQ3 A;  3AE1 A;  4QH4 A;  3EUH A;  1FJG T;  3KVB A;  2JMK A;  4PFO A;  3EVY A;  5EK3 A;  1LVF A;  4GK0 E;  2FUP A;  2XAG B;  1MMG A;  4QXB B;  4ZHQ E;  1OED B;  5CA1 E;  1MIW A;  4X1I E;  2V5C A;  3TLW A;  2A9U A;  2YDS A;  2PTF A;  1IZN B;  2XAQ B;  2XM1 A;  3X1D A;  3ZCJ A;  4ERR A;  4IDO A;  2LKG A;  5JDN A;  3ONL C;  1LKX A;  5LBM A;  4TNW A;  3O1H A;  3ONX A;  5LB7 B;  3CQC B;  3GMI A;  5HEO A;  4TUY E;  2IIU A;  2J62 A;  2B1E A;  4LF5 T;  2V1D B;  3LSV A;  2MYS A;  4HWI B;  3N9Q A;  1J5W A;  4P1N A;  3LDQ B;  2XSB A;  3TKL B;  4PJN A;  4DR5 T;  5FP3 A;  1XZY A;  2YU1 A;  3E0Z A;  3OKQ A;  3PUS A;  5HEJ A;  5LMU T;  1D0Y A;  4DND A;  2BZB A;  3H3M A;  4X66 T;  2V26 A;  2K9A A;  3MXZ A;  3C64 A;  3ZKR A;  3UUX B;  3QC9 A;  5JTG A;  2BKO A;  4LF9 T;  3ZMT B;  3UUM A;  3BQK A;  4DR7 T;  5FXZ A;  4X65 T;  4CI2 B;  2FJD A;  1BR0 A;  5ETW A;  2BBJ A;  5ABE A;  5L2L A;  5CGM A;  2XAJ B;  3N9L A;  3B5M A;  2XAS B;  3KIN B;  4JEU B;  2A72 A;  3T1H T;  2MPK A;  2SPC A;  4U33 A;  3L39 A;  4IDZ A;  5AQV B;  2VK9 A;  5AQN B;  5BMV E;  1G8X A;  3PU8 A;  1XDO A;  3ZT7 A;  2XZE A;  2JQQ A;  3PUX F;  4DV0 T;  3FB2 A;  3CX8 B;  4O4H E;  3DTO A;  3ZSS A;  2HN2 A;  4GK5 E;  3ONJ A;  2W4X A;  4YY3 T;  4PNI A;  2DLR A;  5ABG A;  1HFA A;  3CX7 B;  2X0L B;  3CQG B;  5AQQ B;  3GWH A;  1HX1 B;  2BVM A;  4HFH A;  1CHU A;  4OYJ A;  4DUY T;  3I9W A;  1FEW A;  2J4G A;  4YTN A;  1YQ4 A;  1S94 A;  4Z8X A;  2D0T A;  2K3W A;  4X5T A;  3RYC E;  4Z91 A;  3M3Z B;  4P0A A;  4YSY A;  2E5V A;  1WCR A;  3AA6 B;  4CI3 B;  2CLY B;  5AFU L;  4F6R C;  2VKO A;  3TLT A;  3RYF E;  3AEG A;  1WYC A;  1HS7 A;  4L5G A;  3J9X 1;  4KHP T;  2WZH A;  5CFB A;  4HEA A;  3O1I A;  4J2C A;  2V7I A;  5LMN T;  4WZX A;  3HI2 A;  3KBU A;  3ZPO A;  3A5X A;  4G63 A;  3AVS A;  4DR2 T;  3N9M A;  3RYH E;  2WU2 A;  3AAE B;  2CMR A;  1E7P A;  4O4L E;  3UU3 A;  2EHO B;  4NXN T;  2CCQ A;  3SRZ A;  4UEL A;  2WDR A;  2JMH A;  3WI3 A;  2PFV A;  1KF6 A;  4ZZC A;  3ZEF B;  2KIN B;  3J7Y q;  2X67 A;  4JLE A;  3K3N A;  1M7K A;  2WMN A;  3Q5W A;  4QKN A;  2V7J A;  2VVS A;  4PJL A;  1IJ5 A;  2CEA A;  2WB5 A;  3LBX A;  4HFE A;  4X62 T;  2XQ4 A;  3UU8 A;  3CK6 A;  4MFR A;  3CQX C;  2LLY A;  3E08 A;  3SWH A;  3VKG A;  2LSY A;  4LFB T;  5EK2 A;  4N78 D;  5L3F B;  2H89 A;  3ETU A;  3LG7 A;  4U2Y A;  2DI4 A;  2LKH A;  4ZS2 A;  3AEA A;  1IBL T;  2KSR A;  4TNV A;  4CZZ B;  3UU5 A;  2H7O A;  4U7Y A;  2W00 A;  4TWH A;  2V7L A;  5HXS A;  4HFC A;  3KV4 A;  2X0Y A;  4QX8 B;  4AQG A;  5HXE A;  1MND A;  4KX6 A;  4WYV A;  1UX5 A;  2LSK A;  3HKD E;  4IHJ E;  2KND A;  2IC9 A;  4NXM T;  1ZP0 A;  3O1J A;  2DCF A;  3UU4 A;  3VKH A;  3UFG A;  1WR6 A;  2LT3 A;  5DQW A;  4YJ2 E;  1UCU A;  4GKK T;  4OX9 T;  2JPF A;  5C3J A;  2UXC T;  4OFZ A;  5L3G B;  4U31 A;  3MJX A;  3VRB A;  1YKE B;  4H9S E;  4IE6 A;  1T7S A;  3RKG A;  3TLU A;  1XNQ T;  3MA9 A;  3DJB A;  3NKZ A;  4ILU A;  2VKD A;  3PE0 A;  5JDL A;  4AIU A;  3I0Q A;  1I94 T;  4DBQ A;  3C98 B;  5LOV E;  4IE0 A;  1NEK A;  4DID B;  1JNZ A;  2W61 A;  3N9O A;  1BR2 A;  1J5E T;  3NVO A;  3RYI E;  1OXZ A;  4IDP A;  2XQY A;  4UXN B;  2BG9 E;  2L9Q A;  3B57 A;  3UQ7 A;  5AQL B;  3Q5E A;  2V8S V;  4EED A;  5A1L A;  2LSJ A;  2CXD A;  4I0U A;  2WDV A;  4MLK A;  5JDF A;  3F57 A;  2W0G A;  4ZZB A;  5JVD E;  4LF4 T;  4HFD A;  4TV8 E;  1T98 A;  2WSS V;  3W15 B;  2D2S A;  1B7T A;  4E7S A;  4LFC T;  4U72 A;  2WDQ A;  3MK7 C;  3ZMU B;  4MHC A;  4AI6 A;  4TZ4 C;  1VOM A;  3ETV A;  2M67 A;  5BR8 T;  5AQM B;  2CBI A;  2I59 A;  4OHF A;  4ILC A;  1YW0 A;  3UFE A;  2N2N A;  4ZI7 E;  4PW8 A;  2CXF A;  4UVC B;  2ZMA A;  3FBZ A;  4QHO A;  1N33 T;  2XQA A;  4QX7 B;  4YTM A;  2OLT A;  2UU9 T;  2BDE A;  2KWI B;  2GK9 A;  1JNR A;  4Q25 A;  2X68 A;  3AEE A;  4A97 A;  3JC6 C;  5AQI B;  3UT5 E;  4HN9 A;  4HWH A;  2E8I A;  3V5S A;  2IAK A;  3SFE A;  5JR9 B;  3ZT6 A;  5J1G A;  2G0U A;  2ODU A;  3JAF A;  4EZH A;  3ZJ1 A;  3RC3 A;  1US7 B;  3FXE B;  4NUU A;  5ADX L;  2CPT A;  4U3C A;  2V7M A;  2PJQ A;  4IE5 A;  4LF6 T;  1FMW A;  5FKY A;  5KMG P;  5JDG A;  5AQT B;  3AEB A;  4UF0 B;  5JRC A;  3HKB E;  2KWH A;  4AXP A;  3FXD B;  2BG9 B;  2UUC T;  4ILA A;  5HYA A;  2W67 A;  4LFA T;  3SS1 A;  4O8S A;  2EHO C;  2VKH A;  5JDM A;  3ZST A;  4GOU A;  3QNU A;  2KMF A;  1KFY A;  4IGU A;  1Z0P A;  4YFS A;  3ZYK A;  3GN5 B;  5L4E A;  5FY7 A;  3SOL A;  5H6Q B;  2ES0 A;  3IF8 B;  3FZH B;  3ESL A;  3UUN A;  5LHG B;  3F2E A;  4KUM B;  2LHR A;  4JEH B;  2PG8 A;  3KV6 A;  2X9H A;  2JQ9 A;  3NZP A;  2DWG A;  3RKO A;  1AJ3 A;  3WAK A;  1XWM A;  3D0T A;  2WAU A;  5AQG B;  2Q9Q B;  3QK6 A;  5FXX A;  4QXC B;  1OED A;  5CB4 E;  4PK6 A;  2DHR A;  1UK5 A;  4IL9 A;  2CWO A;  2CE7 A;  3N9N A;  2V6Y B;  5LHH B;  2M6B A;  3R6N A;  1UUR A;  4AQF C;  1DU2 A;  4CI1 B;  3ZMV B;  4AKH A;  2IUB A;  3RC8 A;  3P50 A;  3PTR B;  3K1S A;  4DR3 T;  2V6X A;  5FY1 A;  1SHZ C;  2WP9 A;  3FZM B;  3PUQ A;  3P7I A;  5LCY A;  4M1P A;  5HCJ A;  2X0H A;  3LK3 B;  2CBJ A;  3CKD A;  3H37 A;  3K3Q C;  3P4S A;  4HKA A;  4DV7 T;  3TLV A;  5HEU A;  1ZHC A;  4GYR A;  4ZXL A;  3CWZ B;  1U4Q A;  3PUG A;  5LBQ B;  3AXJ B;  3RRC A;  1D0X A;  4EYY R;  1S35 A;  3EAM A;  4ZEY A;  1KK7 A;  2XQ8 A;  3ZMS B;  4K0K T;  2H7V C;  1YKH B;  4HWF A;  3FZL B;  4IIJ E;  3KBT A;  4B3T T;  2XJ7 A;  2XAF B;  2WCA A;  3N2O A;  3M65 A;  4TV9 E;  4JI4 T;  2ZM6 T;  3RRW A;  5HCM A;  5C8Y E;  1MMN A;  4HWC A;  4NIQ A;  5L47 A;  1HX8 A;  2DNX A;  4G2A A;  3ZN1 B;  1U5P A;  2K48 A;  3AA1 B;  3PV0 F;  3L8R A;  2LRL A;  1L0V A;  4OYK A;  4DR4 T;  1D1A A;  2VQE T;  2C5I T;  4DV3 T;  2UXX B;  2NR4 A;  3L09 A;  1N32 T;  5IUX A;  5J2U E;  2LHN A;  4X20 E;  4CXX A;  4B3R T;  4EB6 E;  1CUN A;  2X9Y A;  4DV5 T;  3CPZ A;  3E22 E;  3FZK B;  2YKS A;  3PU3 A;  2E9X B;  5L3B B;  3O9X A;  4K0U A;  4GIW A;  4DR6 T;  4EYU A;  2BS2 A;  3MAC A;  4LMK A;  3MZK B;  4MBQ A;  5E0O A;  2ZM0 A;  2V5D A;  4V1A v;  2UUA T;  2AE9 A;  5AQK B;  5IYZ E;  3C50 A;  2Y8D A;  3FHN A;  3OYZ A;  1IJ6 A;  4YJ3 E;  3OBV E;  3S4U A;  2OA5 A;  4YHH T;  3N5L A;  1YD8 G;  4P0B A;  2W2U A;  1W9R A;  5FMN A;  3P4Q A;  1LRZ A;  3BQL A;  1OWA A;  4EXT A;  1GQE A;  4HFB A;  4JYA T;  2UXD T;  3BQI A;  5FXW A;  4H63 V;  2RA1 A;  3JC6 D;  5LGT B;  2YU2 A;  5AQS B;  4DMV A;  2YDR A;  4I4T E;  3IEE A;  1NWM X;  2JRK A;  4DV6 T;  4X64 T;  1HNW T;  5FL1 A;  2IC6 A;  3Q5X A;  5JR9 C;  1XDP A;  4JI0 T;  4JI8 T;  5AQF B;  5EK4 A;  2XY8 B;  2X9W A;  5KXJ A;  4DV2 T;  4AQY T;  4YTP A;  2EHO A;  2ZM2 A;  3P4W A;  2B76 A;  5HWX A;  2VL0 A;  3AEF A;  2XPK A;  5JDH A;  4O2A E;  4KMC A;  2C5K T;  3K3O A;  1OED C;  2WZI A;  2BG9 C;  2LOP A;  2LJL A;  4MAL A;  5LG3 A;  3RIA A;  4WW0 A;  2EHO D;  3V5U A;  4EV6 A;  3VR8 A;  3QB5 A;  2JQK A;  2YDQ A;  2QGS A;  2VL8 A;  4TWF A;  4KBM B; 
#chains in the Genus database with same CATH homology
 2RP4 A;  4OHF A;  2H3R A;  4PK5 A;  1WRD A;  1YW0 A;  3UFE A;  1LVK A;  3C51 A;  2N2N A;  3NZQ A;  4UV8 B;  3FBL A;  3ZMT B;  4ZI7 E;  4PW8 A;  2CXF A;  4UVC B;  2L8K A;  2ZMA A;  3UUM A;  3BQK A;  3LBX B;  5L3D B;  1HG5 A;  3FBZ A;  4QHO A;  4QX7 B;  1ZKE A;  4IE4 A;  3KFW X;  5FXZ A;  4DVD A;  2BDE A;  2KWI B;  2GK9 A;  1E1H B;  2CA5 A;  3ZC0 A;  2X68 A;  5JQG E;  3EDV A;  3HL6 A;  3ZLI A;  2CM0 A;  2WWU A;  3JC6 C;  4CI2 B;  4AQF A;  3LJC A;  1BR0 A;  3HR0 A;  3I9Y A;  3UT5 E;  4HN9 A;  3O4X E;  5ETW A;  4QWN B;  3R84 B;  2ZM8 A;  2E8I A;  3RPU A;  2Q9Q C;  2VWA A;  3V5S A;  2IAK A;  2HH7 A;  4IST A;  5L2L A;  3F31 A;  4B6X A;  3UUL A;  5JR9 B;  1QSD A;  2XAJ B;  3N9L A;  2NW7 A;  2KXP B;  2XAS B;  5J1G A;  4AKL A;  3KIN B;  2G0U A;  4JEU B;  5LYJ E;  2ODU A;  2A72 A;  5M4Y A;  4EZH A;  2KZ7 B;  3ZJ1 A;  3RC3 A;  4PJM A;  1US7 B;  4YLH A;  2IW5 B;  3FXE B;  2SPC A;  4NUU A;  5ADX L;  4IE7 A;  4IDZ A;  5HXC A;  4CXW A;  5L3C B;  2V7M A;  2PJQ A;  3K8P C;  1SA0 E;  4IE5 A;  1MIY A;  1D1B A;  4H9O C;  4EIW A;  4QXH B;  1FMW A;  3NRY A;  2NTY A;  5KMG P;  2VK9 A;  5LA6 E;  5JDG A;  2V7K A;  1G8X A;  5BMV E;  2VAS A;  3PU8 A;  4BAY B;  1HF8 A;  4UF0 B;  5JRC A;  3VHL A;  3HKB E;  2KWH A;  3PDY A;  2E9X A;  3EDU A;  4AXP A;  3FXD B;  2VB6 A;  2JQQ A;  5HYA A;  4TN7 B;  3ANW B;  3CX6 B;  3ZYL A;  4UIG A;  3FB2 A;  3SS1 A;  4O8S A;  3KDS E;  2EHO C;  2VKH A;  4PK4 A;  3B13 A;  3CX8 B;  4O4H E;  4PFP A;  4X1Y E;  4AKR B;  5JDM A;  4GOU A;  3DTO A;  1KNZ A;  2KMF A;  5LGN B;  3U3I A;  4GK5 E;  4IGU A;  1Z0P A;  4YFS A;  5DJQ C;  2Z6E A;  3GN5 B;  3ZYK A;  1HG2 A;  5FY7 A;  3SOL A;  3KVA A;  4FI5 A;  4ZOL E;  4C90 A;  2X66 A;  3HA4 A;  5H6Q B;  2ES0 A;  3IF8 B;  1FIO A;  3ESL A;  3N2G E;  3HKC E;  4PNI A;  3HKE E;  2DLR A;  3UUN A;  3U78 A;  4AKG A;  4UVA B;  1HFA A;  3CX7 B;  2E9X D;  1H7C A;  2X0L B;  3CQG B;  5FXV A;  4DBR A;  5KX5 E;  5LHG B;  2NTX A;  3F2E A;  3UTK A;  3GWH A;  4KUM B;  1VRB A;  2BVM A;  5JH7 E;  4OYJ A;  2XHE B;  2LHR A;  4PAG A;  4JEH B;  4P09 A;  3I9W A;  2PG8 A;  3KV6 A;  1FEW A;  1S94 A;  2X9H A;  3I0O A;  4Z8X A;  2PBI A;  2NOX A;  3NZP A;  2D0T A;  2DWG A;  3RKO A;  2XAH B;  1AJ3 A;  4O4J E;  3IBP A;  2ACX A;  3WAK A;  3D0T A;  1V9D A;  2WAU A;  3RYC E;  5F3J A;  2BVL A;  4AKI A;  2C5J A;  4BA9 A;  4P0A A;  2Q9Q B;  2YK0 A;  3I1A A;  3QK6 A;  3AAA B;  4I50 E;  5FXX A;  3MKD A;  4QXC B;  5CB4 E;  4PK6 A;  2DHR A;  2CXL A;  3AA6 B;  5JDQ A;  4CI3 B;  2LSG A;  2CLY B;  5AFU L;  4F6R C;  2VKO A;  2CWO A;  1BR4 A;  3RYF E;  4U74 A;  1WYC A;  2LEH A;  4O2B E;  4HGA A;  5FY0 A;  1HS7 A;  2VKJ A;  4L5G A;  2CE7 A;  3N9N A;  3J9X 1;  3ZYM A;  2NP9 A;  5TAO A;  3KV9 A;  3ZCI A;  5LHH B;  2WMO A;  3BK9 A;  4A56 A;  5LGU B;  3R6N A;  4AQF C;  4CI1 B;  4HEA A;  4EOZ B;  3ZMV B;  3O1I A;  4J2C A;  2V7I A;  3T8O A;  4ASK A;  3HI2 A;  3KBU A;  3IHR A;  4AKH A;  3ZPO A;  3A5X A;  3DP7 A;  4G63 A;  5GON E;  3AVS A;  3RC8 A;  3PTR B;  4E7Z A;  3N2K E;  1G73 A;  2ZLY A;  3N9M A;  3P8C D;  3RYH E;  4UVB B;  3AAE B;  5FY1 A;  2CMR A;  1SHZ C;  3LFM A;  4O4L E;  3PUQ A;  3P7I A;  5LCY A;  2CLY C;  1ZV4 X;  2EHO B;  4I55 E;  4NUV A;  4BJN A;  4DO0 A;  4H9N C;  2CCQ A;  4M1P A;  3NRX A;  2K5B B;  3SRZ A;  4UEL A;  2JMH A;  5DQV A;  4L9I A;  4JUY A;  3LK3 B;  3QUJ A;  5HWY A;  4XZC A;  3CKD A;  3H37 A;  3K3Q C;  2CWY A;  4HKA A;  5LXT E;  5IHY A;  3WI3 A;  2PFV A;  4HFV A;  2YEV C;  1NAF A;  3ZN0 B;  5J2T E;  3ZEF B;  2KIN B;  2E9X C;  1ZHC A;  4GYR A;  4OK0 A;  5HAX A;  3J7Y q;  5KDM C;  4KP3 C;  2X67 A;  2Y6X A;  2JJ9 A;  4JLE A;  1EZ3 A;  5LG4 A;  4H9R C;  4WNK A;  2NW9 A;  3K3N A;  4ZS3 A;  3CWZ B;  2WMN A;  3Q5W A;  1U4Q A;  4H9Q C;  4QKN A;  4BJM A;  2MBG A;  2V7J A;  4ZI3 D;  3PUG A;  4PJL A;  2Y48 B;  5LBQ B;  3RRC A;  1D0X A;  1IJ5 A;  2CEA A;  3LBX A;  4EYY R;  1S35 A;  3OYX A;  1KK7 A;  4HE8 A;  4ZI2 D;  2A2F X;  2L3L A;  3ZMS B;  2H7V C;  5CA0 E;  4MFR A;  1YKH B;  3OJA A;  3CQX C;  4IIJ E;  2DWK A;  3E08 A;  3KBT A;  5FNV E;  3SWH A;  3VKG A;  2XAF B;  4C91 A;  5EZY E;  2LSY A;  3N2O A;  5EK2 A;  3M65 A;  4N78 D;  4TV9 E;  5L3F B;  3ETU A;  3LG7 A;  3RH3 A;  4H63 H;  2J1D G;  3RRW A;  2XUE A;  4O4I E;  4X1K E;  3VU7 H;  5C8Y E;  2WM9 A;  5JR9 A;  1MMN A;  2DI4 A;  2UXN B;  3ZC1 A;  3PUR A;  4EZ4 A;  1MIV A;  4YHJ A;  1D1C A;  4ZS2 A;  4H9P C;  1HX8 A;  5HXH A;  2NW8 A;  5HXR A;  4CQI A;  3AA7 B;  4WBO A;  5LJM A;  2WBL A;  4UEM A;  4CZZ B;  5L3E B;  2DNX A;  3H3A A;  3AVR A;  5LNK A;  2KT9 A;  4EAH A;  5LP6 E;  4G2A A;  2H7O A;  3ZN1 B;  1U5P A;  2W00 A;  2K48 A;  3AAI A;  3AA1 B;  4OYK A;  1D1A A;  4UF0 A;  2C5I T;  3AB3 B;  2V7L A;  4UV9 B;  3CML A;  2MOZ A;  5HXS A;  2UXX B;  2N9D A;  4ANJ A;  3L09 A;  4WBN E;  1HTJ F;  4FJO A;  3KV4 A;  3ANW A;  2ODV A;  4QX8 B;  4AQG A;  5J2U E;  5HXE A;  3ZMZ B;  1FMV A;  3RX6 A;  4GYS A;  1MND A;  2QA7 A;  2LHN A;  5JRE A;  4X20 E;  4CXX A;  4EB6 E;  1CUN A;  1UX5 A;  2LE8 A;  2LSK A;  2X9Y A;  3CPZ A;  3HKD E;  3GN5 A;  5F8P A;  5JRC B;  3GA8 A;  3E22 E;  2HPL A;  3PU3 A;  5LHI B;  2E9X B;  4IHJ E;  5L3B B;  2KND A;  3AA0 B;  2IC9 A;  3O9X A;  4XAX B;  4K0U A;  5H6R B;  4CXY A;  4GIW A;  4ZI3 C;  3O1J A;  2DCF A;  4EYU A;  3MAC A;  1D0Z A;  3N9P A;  3VKH A;  3MZK B;  4MBQ A;  5E0O A;  2ZM0 A;  1WR6 A;  2MTQ A;  2YIN A;  4ISS A;  2W63 A;  4V1A v;  2LT3 A;  3ZJ2 A;  3PUA A;  1MMD A;  2N1G A;  4HTE A;  5DQW A;  3CVR A;  4YJ2 E;  4ZI2 C;  5IYZ E;  1UCU A;  2LOS A;  2HPJ A;  2JPF A;  3C50 A;  2W62 A;  2Y8D A;  4OFZ A;  5L3G B;  1IAP A;  3FHN A;  3OYZ A;  3MJX A;  1O3X A;  1YKE B;  1IJ6 A;  2A3D A;  2P9B A;  4YJ3 E;  2LM9 A;  4PJJ A;  4H9S E;  4IE6 A;  4L0R A;  3OBV E;  3S4U A;  3Q2M A;  2NWB A;  2OA5 A;  2X9X A;  1X79 A;  2XTL A;  3MA9 A;  3L3P A;  1YD8 G;  3N5L A;  2Q9Q A;  3DJB A;  3WAJ A;  1Y64 B;  4ILU A;  2VKD A;  3PE0 A;  5JDL A;  3EUH A;  3KVB A;  2JMK A;  3I0Q A;  4P0B A;  2D5U A;  4DBQ A;  3C98 B;  4PFO A;  5FMN A;  5DAB A;  1LRZ A;  1MMA A;  3BQL A;  3EVY A;  3NBX X;  4IE0 A;  5EK3 A;  4TX5 A;  1OWA A;  1LVF A;  5LOV E;  4EXT A;  4GK0 E;  3BQI A;  2W61 A;  5FXW A;  2XAG B;  4H63 V;  1MMG A;  3LK4 2;  3N9O A;  2RA1 A;  1BR2 A;  3JC6 D;  3RYI E;  4QXB B;  2YU2 A;  4ZHQ E;  5LGT B;  4DMV A;  2C0S A;  4I4T E;  1OXZ A;  3IEE A;  4ADZ A;  2K24 A;  1NWM X;  2JRK A;  5FYM A;  5CA1 E;  1MIW A;  2XQY A;  2Q9Q D;  3C4W A;  4UXN B;  2IC6 A;  4X1I E;  5LJN A;  3Q5X A;  2L9Q A;  3B57 A;  5JR9 C;  2XAQ B;  1IZN B;  3ZCJ A;  4ERR A;  5EK4 A;  2D0U A;  1WYB A;  1ZEE A;  2LSI A;  2X9W A;  5JDN A;  1LKX A;  5LBM A;  5A1L A;  2LSJ A;  3O1H A;  2EHO A;  4I43 B;  3ONX A;  2CXD A;  3CQC B;  3GMI A;  2ZM2 A;  4TUY E;  4MLK A;  2B1E A;  3Q9D A;  2V1D B;  5JDF A;  3F57 A;  2MYS A;  5HWX A;  2W0G A;  3KV5 A;  5JDH A;  1BR1 A;  3N9Q A;  4O2A E;  4KMC A;  5JVD E;  4TV8 E;  2C5K T;  3K3O A;  1T98 A;  1UX4 A;  2WSS V;  3TKL B;  3W15 B;  1MNE A;  1HCI A;  3C4X A;  2KLQ A;  4PJN A;  2D2S A;  1B7T A;  2LOP A;  1WLX A;  2LJL A;  4MAL A;  5FP3 A;  4E7S A;  2X51 A;  3LK2 B;  3C4Z A;  4U72 A;  3MK7 C;  4WW0 A;  2YU1 A;  2EHO D;  3ZMU B;  1QUU A;  4XBF B;  3V5U A;  3E0Z A;  3OKQ A;  3PUS A;  4MHC A;  4AI6 A;  4TZ4 C;  1VOM A;  3ETV A;  1D0Y A;  4DND A;  2BZB A;  2M67 A;  2V26 A;  2K9A A;  3MXZ A;  3C64 A;  3UUX B;  2QGS A;  3QC9 A;  4DMW A;  2VL8 A;  4KBM B;  2I59 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...