5L2LA

Nab2 zn fingers 5-7 bound to a11g rna
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
72
structure length
72
Chain Sequence
SEKSLEQCKFGTHCTNKRCKYRHARSHIMCREGANCTRIDCLFGHPINEDCRFGVNCKNIYCLFRHPPGRVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis for the dimerization of Nab2 generated by RNA binding provides insight into its contribution to both poly(A) tail length determination and transcript compaction in Saccharomyces cerevisiae.
pubmed doi rcsb
source organism Saccharomyces cerevisiae yjm1574
molecule tags Rna binding protein
molecule keywords Nab2p
total genus 13
structure length 72
sequence length 72
chains with identical sequence B, E, F
ec nomenclature
pdb deposition date 2016-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14608 zf-CCCH_2 RNA-binding, Nab2-type zinc finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1670 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 5l2lA00
5L2LA 3ZJ2A 2LHNA 3ZJ1A
chains in the Genus database with same CATH superfamily
2I59A 1V9DA 1E2AA 2WP9A 2CBJA 5EK2A 4DV5T 1HR0T 2UUBT 2BBHA 3P4SA 2Y8DA 2WU5A 3E22E 4ASKA 2JQHA 5CA1E 4QKNA 2XAJB 2B76A 4H9OC 1YKEB 1XMOT 2XM2A 3PUSA 1OEDC 2C0SA 5AQRB 1OEDB 2IMLA 3FZHB 4HN9A 4EOZB 5FP3A 5C8YE 1WCRA 2X51A 4CN4A 4JV5T 4DR7T 5M4YA 4ILCA 5JDFA 2FJDA 3DTOA 1UK5A 2DHRA 4ADZA 2V5DA 1NEKA 3SFEA 2XPKA 3OPCA 4U31A 4NPPA 2VKDA 2W62A 3BQKA 3RHWA 4MFRA 2IDOB 2MOZA 4X1YE 4AKRB 3NRXA 3Q5DA 1NWMX 3AB3B 1UX4A 4YSZA 4ZI3D 1HX8A 3ZJ1A 4PK4A 4DBQA 3Q5EA 3LSVA 2LOSA 5L3EB 4IDNA 1IJ6A 1L0VA 4UF0B 4G2AA 3N2GE 3UU6A 3KDSE 1ZOYA 4A97A 3FBZA 2X66A 2UXBT 2JPFA 5J1GA 3WAKA 4EAHA 4NUVA 4UIGA 3KBTA 1T98A 2CMRA 4HFIA 3CMLA 2XQ9A 3T8OA 4WBNE 4JI3T 1JNZA 1WR0A 2L9QA 2P9BA 3LG7A 2YINA 3PUYF 3PUZF 5HCMA 2HN2A 4OHFA 4COFA 2LE8A 3PUQA 4HKAA 4JEUB 4IDPA 5FYMA 2W61A 2GK9A 3GN5B 2ZM8A 4CQIA 4YT0A 3RF1A 4JUYA 2XQAA 2BZBA 2DLRA 4IDOA 4PFPA 4IT4A 4WYVA 3ZT7A 2CEAA 2JRKA 4WBOA 4F6RC 3ZMUB 3SRZA 3O9XA 4OYJA 3UUBA 3L8RA 5AQUB 4U2YA 2J4GA 3GMIA 1OXZA 3N9NA 3QB5A 3CQXC 4MBQA 5H6QB 2X9YA 2JQ9A 2XQYA 3NVOA 4HWDA 4YTMA 4IHJE 1D0XA 3PUAA 4X1KE 5CA0E 4XBFB 2ES0A 3FZFB 4I55E 1WYBA 1D0ZA 4QXHB 4LF4T 4NIQA 5LHGB 5IUXA 3KV5A 3UQ7A 1IBMT 3I0QA 5EZYE 4AXPA 3QUJA 4X5TA 2KT9A 3BQLA 3AE3A 2Z6EA 5HWXA 2X0LB 4LMJA 4BAYB 2WDRA 3OJAA 3RIFA 3OYZA 3C50A 4C90A 4H9QC 4YLHA 2XAFB 5LGNB 1SE7A 4J2CA 5AQIB 4H9PC 1SA0E 4P0AA 4EEBA 3PURA 3K3QC 4O4HE 4X62T 2MYSA 1MMDA 3K3OA 5AQQB 4IE0A 2A72A 5AQTB 5LBMA 2XQ4A 2JMHA 2KNDA 1ZEEA 3RQWA 1VCTA 4AQFA 4DV3T 4DR2T 3UU5A 1WFDA 4IE7A 1YQ4A 2Q9QA 2V6YB 4U7YA 2NW8A 4PAGA 4KHPT 4LF8T 1LVKA 3OYXA 4HFHA 5FMNA 4DV6T 3P4WA 4JYAT 3AE6A 1O3XA 3ZCIA 2WBLA 2CLYC 4UV9B 2D2SA 1HG2A 5HEJA 4ZS2A 3C4WA 3E08A 5BR8T 4YSXA 2K5BB 5HEHA 2XQ7A 2XSBA 2LSJA 5F8PA 2LSYA 3JADA 2QYWA 2ZM2A 5ABHA 2WU2A 2HHHT 2IIUA 3VR8A 5ABEA 2E9XB 2KLQA 2YEVC 1VOMA 4PFOA 3W15B 5HEGA 4A5XA 5L3FB 1UUSA 3A5XA 3ZJ2A 5HYAA 3DJBA 4QH5A 1CHUA 4Q25A 3VRAA 2K48A 3K8PC 3UT5E 5JDQA 1S35A 3FXEB 2YDSA 3BQIA 4DR1T 2NTYA 4QX7B 3AE7A 2J1DG 2CA5A 1WLXA 2VVNA 2CHOA 3C4XA 3FHNA 4UF0A 5JDMA 4DUZT 3FB2A 4TUYE 3ZMSB 2XAGB 4O4LE 4QXBB 5JDGA 2YU1A 1QSDA 3ZPOA 4TN7B 2H7OA 5KDMC 2OA5A 2IUBA 2K24A 1QLBA 1J5WA 5HWYA 2LHRA 4EYYR 5L3BB 2AE9A 2XJ7A 2V7JA 3S4UA 4DV4T 3PE0A 4DO0A 4UVAB 5JDNA 2Y6XA 1W0AA 4LF6T 5JRCA 3AAAB 4BJMA 5LHIB 4YJ3E 4ZHQE 3ZC0A 2LM2A 4JI7T 2E9XC 2LKGA 2XZEA 3UUXB 3QB5K 2NW9A 1IZNB 2DNXA 4Z91A 4LFAT 2LM9A 3I1AA 1B7TA 3VU7H 4U72A 4DR5T 2WMOA 4ILAA 5FVKA 3AA7B 2QGSA 2DWKA 2X9WA 1MIWA 4WW0A 5EK4A 3B5MA 4ZI2C 5LGTB 3RYIE 2E2AA 3L3PA 3CQGB 3Q2MA 4JEHB 5L2LA 2ACXA 3D0TA 4U7IA 4OK0A 1VRBA 4I4TE 4P1NA 4OFZA 3MXZA 1US7B 2JJ9A 3P4RA 1XZYA 2HPLA 3Q5WA 1BR2A 5FY0A 2VASA 2X0YA 5CB4E 5L4EA 3ONLC 4B3RT 2G0UA 3FBLA 3RKOA 4EXTA 1T7SA 1W9RA 4LFCT 2BG9C 3ETUA 3LK3B 3RGLA 1Y01A 3P4PA 4TNWA 4L5GA 3E0ZA 1IAPA 2C5KT 2JQQA 5LJMA 3KINB 4QH1A 1MIYA 4DVDA 4JBWF 3GWHA 4ERRA 2RP4A 3OVUA 2BS3A 3NWIA 3ANWB 2KZ7B 4M1PA 4MALA 2X0HA 2XAQB 3OBVE 3HA4A 4L0RA 3RRWA 3RYHE 4QHOA 3TLUA 1VCSA 5LNKA 1BR0A 1ZKEA 2VURA 3AECA 3J9X1 3AEDA 3ZMTB 5FVLA 3H3MA 4H63H 4B3ST 2N9DA 3GA8A 2UXDT 3AA0B 3NZQA 4CXXA 4BA9A 2X9XA 3KBUA 2YDRA 4O4IE 4PJLA 4DMWA 4JI1T 4A98A 4BJNA 1FJGT 4GYRA 1W0BA 3CX7B 3AAEB 3UUMA 2ODVA 1WR6A 2LJLA 1J1JA 2QRXA 3I0OA 3O1HA 4ZXLA 3RKGA 4ILUA 4GK0E 4EZ4A 5FXWA 3UU3A 2E8IA 2EHOD 2VKJA 4YSYA 2IC6A 3P4QA 4NXNT 3PUGA 3AVRA 2CXLA 4DBRA 3NRYA 4O2BE 4U74A 3AE5A 2H3RA 2UUAT 2K3WA 1Y64B 2VKHA 3QK6A 2KMFA 2WQYA 1XDOA 1HFAA 2VVSA 3PUWF 2WAUA 2VL0A 3ZSTA 1KNRA 3BK9A 5LOVE 3RC3A 3AE2A 1U4QA 2X9HA 4X20E 1X9BA 4EV6A 4EGWA 2J47A 5LCYA 2HH7A 1HNXT 4LF5T 5CFBA 2FJAA 2WM9A 2PG8A 1YQ3A 1NENA 1ZV4X 2CE7A 2DCFA 2KWIB 2WWUA 3C51A 3CQCB 3GN5A 3RI5A 4O2AE 3NBXX 5KXJA 4KMCA 2V8SV 2ZLYA 2RPAA 3WAJA 4UELA 5AQPB 5LP6E 4DV2T 1D1AA 2D0UA 5HAXA 5L3GB 5J0ZA 2UU9T 4KI0F 2NWBA 3N2KE 4ILBA 3V5SA 1N33T 3OKQA 2PFVA 4HFDA 5LGUB 2D0TA 3DP7A 4QWNB 4HWCA 4WNKA 2CBIA 4I43B 4JI2T 4C91A 2NR4A 4ISTA 4HFBA 1DU2A 4AQFC 4V1Av 4CN6A 5JDHA 4PJJA 4UXNB 3ZYMA 2WDVA 1N36T 4O8SA 3KVBA 4CZZB 1N32T 5HEOA 5L3CB 1J5ET 1U5PA 1KNZA 2VQFT 3CKDA 3IF8B 3PUVF 5FXVA 2BKNA 3LFMA 3TLWA 4TV8E 3SS1A 2FJEA 4KHZF 3F31A 4ISSA 4DV0T 4ZZCA 5LMNT 2CPTA 4IE5A 4N78D 4ZI7E 5LYJE 5AQHB 2W66A 3AE9A 2V5CA 2W0GA 1BR1A 4U2ZA 1GQEA 2LOPA 3TKLB 3RPUA 4TNVA 1HX1B 2MTQA 2V1DB 2W4XA 2LRLA 3NZPA 3UQ4A 3ZKRA 3Q5XA 4HWIB 2BKOA 2HPJA 3EHZA 3EVYA 4JI5T 4QX8B 4WZXA 4EB6E 4B6XA 3M3ZB 3JAFA 2FBWA 4AKIA 3SWHA 5AQLB 1Z8UA 2XTLA 2VB6A 3NKZA 4P09A 2XUEA 3I9YA 5JR9A 3PU8A 3N9PA 4HFVA 3UUNA 4XAXB 4EEDA 2D5UA 4HWFA 5CJ5A 3J7Yq 3ZYKA 2XQ8A 5LMUT 2WS3A 4IE4A 4FI5A 3UU8A 1I94T 1D1CA 2NTXA 3ONXA 4TWFA 5C2TA 4AKLA 4G63A 1LVFA 5H6RB 3FZKB 4A56A 3ZSSA 4EZHA 5C3JA 4DUYT 3MJXA 1HNZT 1EZ3A 4ZI3C 3L39A 3RC8A 4OX9T 3RIUC 2WMNA 2DL1A 3O1IA 2YOEA 5DJQC 3ZT5A 3U78A 2EHOB 4HGAA 3FZLB 5JH7E 2W63A 2XAHB 5AQSB 3RIUA 5ABFB 2BS2A 4UR9A 4TZ4C 1YW0A 4JI6T 4DR4T 3UFGA 1FEWA 3VHLA 2WZHA 2YK0A 3N9QA 2CXDA 2MBGA 3L09A 5E0OA 4ZZBA 2NW7A 1E7PA 2SPCA 4HFEA 1XNQT 4GOUA 4H9SE 2F4VT 2HN1A 1D1BA 3LJCA 3ZC1A 3F57A 4QH4A 3MKDA 2AXDS 5IHYA 4AI6A 2Y48B 3O4XE 3Q9DA 4YHHT 2WSSV 3MACA 3AAIA 3HI2A 4YTPA 3PU3A 1HTJF 5JR9B 1OWAA 4HEAA 3AE8A 4PK5A 4AISA 1YXRA 4AKHA 1OEDA 4X64T 1X79A 3QC9A 2PTFA 2OV9A 1AJ3A 2VK9A 2H88A 2R6GF 3CPZA 3KVAA 3AVSA 4TV9E 2B1EA 2IC9A 3A7MA 3R6NA 5DABA 5AQMB 3RRCA 5HXEA 3P50A 3C4ZA 1HF8A 2Q9QD 5AQVB 3TLVA 2WB5A 2CRBA 4GK5E 3JC6C 5JR9C 2E9XD 3ZLIA 5ADXL 2UXCT 3VKHA 5HCJA 3FXDB 2LEHA 2ODUA 3FZMB 3SFDA 5HXSA 2Q9QC 5HXCA 3AA6B 4HFCA 1NAFA 4LF9T 3PUXF 2IHR1 4IIJE 3HL6A 2CHNA 3RYCE 3VKGA 4UEMA 3ZN0B 4CXWA 3LK2B 5HEUA 2KWHA 2L3LA 4U3CA 2M6IA 4X66T 4X65T 4GIWA 2LRKA 3QOFA 3K1SA 3HKEE 4IDZA 3AEAA 3N9LA 3N2OA 5GONE 2QVAA 1MNDA 1IJ5A 2NP9A 2D9DA 5AQKB 2CXFA 2I6HA 4F8HA 5FL1A 2E5LT 5FNVE 3ESLA 1XWMA 3HKDE 3EI0A 3QNUA 4H9NC 3ZCJA 2JMKA 4DIDB 2BKPA 2BG9B 4ZI2D 4CN1A 3IHRA 3ZEFB 4Z90A 2V7KA 5J2TE 2MPKA 1S94A 2BG9A 1XMQT 2YN6A 2LKHA 2YDQA 4B3MT 5AFUL 4TX5A 2LSKA 3CK6A 2QA7A 5J2UE 5IYZE 2N2NA 5JDLA 4YTNA 2XM1A 2XQ5A 3AXJB 4ZOLE 5LG4A 3H3AA 2K9AA 4UVBB 5BMVE 4I0UA 4CI2B 1OEDE 3MZKB 2BDEA 1KNPA 2KXPB 3ABVA 5EK3A 5AQGB 3OTOT 1I6ZA 4H63V 4PJMA 4O4JE 4CI3B 5FXXA 5LJNA 4HTEA 2C5IT 4UVCB 3G06A 3R84B 5L3DB 2DWGA 4IGUA 4YY3T 2V7MA 5JRCB 2H89A 3AE4A 4HWHA 2M6BA 2WWVA 5KMGP 3T1HT 4NXMT 5LA6E 2E9XA 3JAEA 4IL9A 4EYUA 5LHHB 3LK42 5ABGA 1KK7A 2BG9E 3RYFE 1YD8G 2ZM6T 1G73A 1D0YA 5AQFB 5KX5E 4L9IA 2LHNA 3V5UA 4TWDA 1ZHCA 3AEFA 3MK7C 1MMNA 3RQUA 3UTKA 3ZMVB 2WDQA 4YHJA 2IAKA 3P8CD 4YXDA 2L8KA 1MNEA 2V7IA 2VL8A 1UX5A 4IDQA 4U33A 3U3IA 4CXYA 1UURA 3AA1B 1H7CA 1WRDA 4EIWA 5IWAT 2BS4A 2CWYA 2V26A 5FY1A 4E7SA 5LXTE 4AQGA 3B57A 5LBQB 2CWOA 2A3DA 3ANWA 1WYCA 3CX8B 4E7ZA 5F5WA 2ZM0A 3H37A 3AEEA 2A2FX 4MLKA 5DQVA 1IBKT 3X1DA 2WZIA 3TLSA 2NOXA 1MIVA 5CGMA 3F2EA 3LBXA 3C64A 3KV9A 4PK6A 5AQOB 2BVMA 4ZEYA 5JQGE 2LSGA 1XDPA 2CM0A 2V6XA 2XASB 3EABA 1UGOA 4I50E 5FXZA 5AQNB 1SHZC 3N5LA 3T1YT 3AEBA 5HXHA 1E1HB 4QXCB 1HNWT 4KBMB 2DI4A 5JREA 2LSIA 2Q9QB 2V6YA 2X67A 2XQ3A 5LG3A 5ABFA 2WY2A 4B3TT 4JI4T 1XNRT 3VRBA 4AQYT 2UXNB 2V7LA 2WCAA 4H9RC 3N9MA 4FJOA 1UCUA 2CLYB 4LMKA 5FY7A 1IBLT 2IW5B 1FMVA 4IE6A 5DQWA 4ANJA 2XY8B 4JI0T 4TWHA 4YJ2E 3ZN1B 5TAOA 2XSAA 4Z8XA 3VR9A 2VQET 3LDQB 3RLFF 2VKOA 4PW8A 5FKYA 1Z0PA 3EAMA 3PJAJ 2FUPA 5LB7B 2UXXB 1KEYA 2PBIA 4DV1T 4PNIA 3SOLA 2C5JA 4MHCA 5AQJB 4X1IE 3I9WA 4AKGA 4JLEA 3HR0A 4XZCA 1FIOA 3IBPA 2MAWA 3P7IA 5HXRA 1BR4A 1M62A 1T72A 2KINB 1M7KA 3EDUA 3LBXB 1R8IA 1SUMB 3AE1A 2YKSA 3PV0F 4NUUA 1LKXA 2W2UA 3ZMZB 1LRZA 1G8XA 1MMGA 2M67A 2XHEB 5F3JA 2N1GA 1YKHB 3JCFA 4AIUA 1HS7A 5JVDE 3RIAA 5ETWA 1MMAA 1HG5A 1W09A 5L47A 2W67A 1HCIA 4DMVA 4ZS3A 2BVLA 2UUCT 3PJAA 3IEEA 4JI8T 2A9UA 2FJBA 1KFYA 4UV8B 1ZP0A 5L4HA 1N34T 2H7VC 3AXJA 4LFBT 3CWZB 2EHOC 2VWAA 2PJQA 3MA9A 2X68A 2ZMAA 4PJNA 3ZT6A 3ZYLA 2JQKA 3O1JA 4CI1B 3AEGA 2LLYA 1T8BA 3CX6B 4GYSA 4KUMB 4GKJT 2OLTA 3EUHA 3KFWX 3ONJA 2KSRA 4DNDA 3CIRA 2EHOA 3ETVA 3M65A 2JIWA 4OYKA 4DV7T 3PTRB 4LMLA 3UU4A 4GKKT 4HE8A 3N9OA 5FL0A 1JNRA 1KF6A 4DR3T 3WI3A 3A8YC 3RH3A 2I0MA 2YU2A 3B13A 3K3NA 2E5VA 4IREA 1CUNA 2RA1A 3JC6D 3EDVA 4K0KT 4K0UA 2BBJA 1FMWA 3HKCE 4YFSA 3UFEA 3UULA 2J62A 3RX6A 1QUUA 4DR6T 4LF7T 2CCQA 3KV6A 4KX6A 2LT3A 2ACZA 3IA3A 3TLTA 2W00A 2XQ6A 3HKBE 3C98B 3CVRA 4P0BA 3KV4A 4IL4A 5JTGA 5A1LA 3PDYA 4KP3C
chains in the Genus database with same CATH topology
2I59A 1V9DA 5EK2A 2Y8DA 3E22E 4ASKA 5CA1E 4QKNA 2XAJB 4H9OC 1YKEB 3PUSA 2C0SA 4EOZB 4HN9A 5FP3A 5C8YE 2X51A 5M4YA 5JDFA 4ADZA 3DTOA 2DHRA 2VKDA 2W62A 3BQKA 4AKRB 4MFRA 2MOZA 4X1YE 4CQIA 4ZI3D 3NRXA 1NWMX 3AB3B 1UX4A 1HX8A 3ZJ1A 4PK4A 4DBQA 5L3EB 2LOSA 1IJ6A 4UF0B 4G2AA 3N2GE 3KDSE 3FBZA 2X66A 2JPFA 5J1GA 3WAKA 4EAHA 4NUVA 4UIGA 3KBTA 1T98A 2CMRA 3T8OA 3CMLA 4WBNE 2L9QA 2P9BA 3LG7A 2YINA 4OHFA 2LE8A 3PUQA 4HKAA 4JEUB 5FYMA 2W61A 2GK9A 3GN5B 2ZM8A 4JUYA 2BZBA 2DLRA 4F6RC 4PFPA 2CEAA 2JRKA 4WBOA 3ZMUB 3SRZA 3O9XA 4OYJA 3GMIA 1OXZA 3N9NA 3CQXC 4MBQA 5H6QB 2X9YA 2XQYA 4IHJE 1D0XA 3PUAA 4X1KE 5CA0E 4XBFB 2ES0A 4I55E 1WYBA 1D0ZA 4QXHB 5LHGB 3KV5A 3I0QA 5EZYE 4AXPA 3QUJA 2KT9A 3BQLA 2Z6EA 5HWXA 2X0LB 4BAYB 3OJAA 3OYZA 3C50A 4C90A 4H9QC 4YLHA 2XAFB 5LGNB 4J2CA 4P0AA 4H9PC 1SA0E 3PURA 3K3QC 4O4HE 2MYSA 1MMDA 3K3OA 4IE0A 2A72A 5LBMA 2JMHA 2KNDA 1ZEEA 4IE7A 2Q9QA 2NW8A 4PAGA 1LVKA 3OYXA 5FMNA 1O3XA 3ZCIA 2WBLA 2CLYC 4UV9B 2D2SA 1HG2A 4ZS2A 3C4WA 3E08A 2K5BB 2LSJA 5F8PA 2LSYA 2ZM2A 2E9XB 2KLQA 2YEVC 1VOMA 4PFOA 3W15B 5L3FB 3A5XA 3ZJ2A 5HYAA 3DJBA 2K48A 3K8PC 3UT5E 5JDQA 1S35A 3FXEB 3BQIA 2NTYA 4QX7B 2J1DG 3FHNA 3C4XA 2CA5A 1WLXA 4UF0A 5JDMA 3FB2A 4TUYE 3ZMSB 2XAGB 4O4LE 4QXBB 5JDGA 2YU1A 1QSDA 3ZPOA 4TN7B 2H7OA 5KDMC 2OA5A 2K24A 5HWYA 2LHRA 4EYYR 5L3BB 3S4UA 2V7JA 3PE0A 4DO0A 4UVAB 5JDNA 2Y6XA 5JRCA 3AAAB 4BJMA 5LHIB 4YJ3E 4ZHQE 3ZC0A 2E9XC 3UUXB 2NW9A 1IZNB 2DNXA 2LM9A 3I1AA 1B7TA 3VU7H 4U72A 2WMOA 3AA7B 2QGSA 2DWKA 2X9WA 1MIWA 4WW0A 5EK4A 4ZI2C 5LGTB 3RYIE 3L3PA 3CQGB 3Q2MA 4JEHB 5L2LA 2ACXA 3D0TA 4OK0A 1VRBA 4I4TE 4OFZA 3MXZA 1US7B 2JJ9A 2HPLA 3Q5WA 1BR2A 5FY0A 2VASA 5CB4E 2G0UA 3FBLA 3RKOA 4EXTA 3ETUA 3LK3B 4L5GA 3E0ZA 1IAPA 2C5KT 2JQQA 5LJMA 3KINB 1MIYA 4DVDA 3GWHA 4ERRA 2RP4A 3ANWB 2KZ7B 4M1PA 4MALA 2XAQB 3OBVE 3RRWA 3HA4A 4L0RA 3RYHE 4AQFA 4QHOA 1BR0A 5LNKA 1ZKEA 3J9X1 3ZMTB 4H63H 2N9DA 3GA8A 3AA0B 3NZQA 4CXXA 4BA9A 2X9XA 3KBUA 4PJLA 4O4IE 4DMWA 4BJNA 4GYRA 3CX7B 3UUMA 3AAEB 5KX5E 2ODVA 1WR6A 2LJLA 3I0OA 3O1HA 4EZ4A 4ILUA 4GK0E 5FXWA 2E8IA 2EHOD 2VKJA 2IC6A 3PUGA 3AVRA 2CXLA 4DBRA 3NRYA 4O2BE 4U74A 2H3RA 2VKHA 1Y64B 3QK6A 2KMFA 1HFAA 2WAUA 3BK9A 5LOVE 3RC3A 1U4QA 2X9HA 4X20E 5LCYA 2HH7A 2WM9A 2PG8A 1ZV4X 3GN5A 2CE7A 2DCFA 2WWUA 2KWIB 3CQCB 3C51A 4O2AE 3NBXX 4KMCA 2ZLYA 3WAJA 4UELA 5LP6E 1D1AA 2D0UA 5HAXA 5L3GB 2NWBA 3N2KE 3V5SA 3OKQA 2PFVA 5LGUB 2D0TA 3DP7A 4QWNB 4WNKA 4I43B 4C91A 4ISTA 4AQFC 4V1Av 5JDHA 4PJJA 4UXNB 3ZYMA 4O8SA 3KVBA 4CZZB 5L3CB 1U5PA 1KNZA 3CKDA 3IF8B 5FXVA 3LFMA 4TV8E 3SS1A 3F31A 4ISSA 4IE5A 4N78D 4ZI7E 5LYJE 2W0GA 1BR1A 2LOPA 3TKLB 3RPUA 2MTQA 2V1DB 3NZPA 3Q5XA 2HPJA 3EVYA 4EB6E 4QX8B 4B6XA 4AKIA 3SWHA 2XTLA 2VB6A 4P09A 2XUEA 3I9YA 5JR9A 3PU8A 3N9PA 4HFVA 3UUNA 4XAXB 3J7Yq 2D5UA 3ZYKA 4IE4A 4FI5A 1D1CA 2NTXA 3ONXA 4AKLA 4G63A 1LVFA 5H6RB 4A56A 4EZHA 3RC8A 3MJXA 1EZ3A 4ZI3C 2WMNA 3O1IA 5DJQC 3U78A 2EHOB 4HGAA 5JH7E 2W63A 2XAHB 4TZ4C 1YW0A 1FEWA 3VHLA 2YK0A 3N9QA 2CXDA 2MBGA 3L09A 5E0OA 2NW7A 2SPCA 4GOUA 4H9SE 3LJCA 1D1BA 3ZC1A 3F57A 3MKDA 5IHYA 4AI6A 2Y48B 3O4XE 3Q9DA 2WSSV 3MACA 3AAIA 3HI2A 3PU3A 1HTJF 5JR9B 1OWAA 4HEAA 4PK5A 4AKHA 1X79A 3QC9A 1AJ3A 2VK9A 3CPZA 3KVAA 3AVSA 4TV9E 2B1EA 2IC9A 3R6NA 3RRCA 5DABA 5HXEA 3C4ZA 1HF8A 2Q9QD 5JR9C 4GK5E 3VKHA 3JC6C 2E9XD 3ZLIA 5ADXL 3FXDB 2LEHA 2ODUA 5HXSA 2Q9QC 5HXCA 3AA6B 1NAFA 3HL6A 3RYCE 3VKGA 4UEMA 3ZN0B 4CXWA 3LK2B 2KWHA 2L3LA 4GIWA 3HKEE 4IDZA 3N9LA 3N2OA 5GONE 1MNDA 1IJ5A 2NP9A 2CXFA 5FNVE 3ESLA 3HKDE 4H9NC 3ZCJA 2JMKA 4ZI2D 3ZEFB 3IHRA 5J2TE 2V7KA 1S94A 5AFUL 4TX5A 2LSKA 5J2UE 2QA7A 5JDLA 5IYZE 2N2NA 4ZOLE 5LG4A 3H3AA 2K9AA 4UVBB 5BMVE 4CI2B 3MZKB 2BDEA 2KXPB 5EK3A 4H63V 4PJMA 4O4JE 4CI3B 5FXXA 5LJNA 4HTEA 2C5IT 4UVCB 3R84B 5L3DB 2DWGA 4IGUA 2V7MA 5JRCB 5KMGP 5LA6E 2E9XA 5LHHB 4EYUA 3LK42 1KK7A 3RYFE 1YD8G 1G73A 1D0YA 4L9IA 2LHNA 3V5UA 1ZHCA 3MK7C 3ZMVB 1MMNA 3UTKA 4YHJA 2IAKA 3P8CD 2L8KA 1MNEA 2V7IA 2VL8A 1UX5A 3U3IA 4CXYA 3AA1B 1H7CA 1WRDA 4EIWA 2CWYA 5FY1A 2V26A 4E7SA 5LXTE 4AQGA 3B57A 5LBQB 2CWOA 2A3DA 3ANWA 1WYCA 3CX8B 4E7ZA 2ZM0A 3H37A 4MLKA 2A2FX 5DQVA 2NOXA 1MIVA 3F2EA 3LBXA 3C64A 3KV9A 4PK6A 2BVMA 5JQGE 2CM0A 2LSGA 4I50E 5FXZA 2XASB 1SHZC 3N5LA 5HXHA 1E1HB 4QXCB 4KBMB 2DI4A 5JREA 2LSIA 2Q9QB 2X67A 2UXNB 2V7LA 4H9RC 3N9MA 4FJOA 1UCUA 2CLYB 5FY7A 2IW5B 1FMVA 4IE6A 5DQWA 4ANJA 4YJ2E 3ZN1B 5TAOA 4Z8XA 2VKOA 4PW8A 1Z0PA 2UXXB 2PBIA 4PNIA 3SOLA 2C5JA 4MHCA 4X1IE 3I9WA 4AKGA 4JLEA 3HR0A 4XZCA 1FIOA 3IBPA 3P7IA 5HXRA 1BR4A 4IIJE 3EDUA 2KINB 4NUUA 3LBXB 3ZMZB 1LKXA 1LRZA 1G8XA 1MMGA 2M67A 2XHEB 5F3JA 2N1GA 1YKHB 1HS7A 5JVDE 5ETWA 1MMAA 1HG5A 4DMVA 1HCIA 4ZS3A 2BVLA 3IEEA 4UV8B 2H7VC 3CWZB 2EHOC 2VWAA 2PJQA 3MA9A 2ZMAA 2X68A 4PJNA 3ZYLA 3O1JA 4CI1B 3CX6B 4GYSA 4KUMB 3EUHA 3KFWX 4DNDA 2EHOA 3ETVA 3M65A 4OYKA 3PTRB 4HE8A 3N9OA 3WI3A 3RH3A 2YU2A 3B13A 3K3NA 1CUNA 2RA1A 3JC6D 3EDVA 4K0UA 4YFSA 1FMWA 3HKCE 3UFEA 3UULA 3RX6A 1QUUA 2CCQA 3KV6A 2LT3A 2W00A 3HKBE 3C98B 3CVRA 4P0BA 3KV4A 5A1LA 3PDYA 4KP3C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5L2L A;  3ZJ2 A;  2LHN A;  3ZJ1 A; 
#chains in the Genus database with same CATH topology
 2I59 A;  1V9D A;  1E2A A;  2WP9 A;  2CBJ A;  5EK2 A;  4DV5 T;  1HR0 T;  2UUB T;  2BBH A;  3P4S A;  2Y8D A;  2WU5 A;  3E22 E;  4ASK A;  2JQH A;  5CA1 E;  4QKN A;  2XAJ B;  2B76 A;  4H9O C;  1YKE B;  1XMO T;  2XM2 A;  3PUS A;  1OED C;  2C0S A;  5AQR B;  1OED B;  2IML A;  3FZH B;  4HN9 A;  4EOZ B;  5FP3 A;  5C8Y E;  1WCR A;  2X51 A;  4CN4 A;  4JV5 T;  4DR7 T;  5M4Y A;  4ILC A;  5JDF A;  2FJD A;  3DTO A;  1UK5 A;  2DHR A;  4ADZ A;  2V5D A;  1NEK A;  3SFE A;  2XPK A;  3OPC A;  4U31 A;  4NPP A;  2VKD A;  2W62 A;  3BQK A;  3RHW A;  4MFR A;  2IDO B;  2MOZ A;  4X1Y E;  4AKR B;  3NRX A;  3Q5D A;  1NWM X;  3AB3 B;  1UX4 A;  4YSZ A;  4ZI3 D;  1HX8 A;  3ZJ1 A;  4PK4 A;  4DBQ A;  3Q5E A;  3LSV A;  2LOS A;  5L3E B;  4IDN A;  1IJ6 A;  1L0V A;  4UF0 B;  4G2A A;  3N2G E;  3UU6 A;  3KDS E;  1ZOY A;  4A97 A;  3FBZ A;  2X66 A;  2UXB T;  2JPF A;  5J1G A;  3WAK A;  4EAH A;  4NUV A;  4UIG A;  3KBT A;  1T98 A;  2CMR A;  4HFI A;  3CML A;  2XQ9 A;  3T8O A;  4WBN E;  4JI3 T;  1JNZ A;  1WR0 A;  2L9Q A;  2P9B A;  3LG7 A;  2YIN A;  3PUY F;  3PUZ F;  5HCM A;  2HN2 A;  4OHF A;  4COF A;  2LE8 A;  3PUQ A;  4HKA A;  4JEU B;  4IDP A;  5FYM A;  2W61 A;  2GK9 A;  3GN5 B;  2ZM8 A;  4CQI A;  4YT0 A;  3RF1 A;  4JUY A;  2XQA A;  2BZB A;  2DLR A;  4IDO A;  4PFP A;  4IT4 A;  4WYV A;  3ZT7 A;  2CEA A;  2JRK A;  4WBO A;  4F6R C;  3ZMU B;  3SRZ A;  3O9X A;  4OYJ A;  3UUB A;  3L8R A;  5AQU B;  4U2Y A;  2J4G A;  3GMI A;  1OXZ A;  3N9N A;  3QB5 A;  3CQX C;  4MBQ A;  5H6Q B;  2X9Y A;  2JQ9 A;  2XQY A;  3NVO A;  4HWD A;  4YTM A;  4IHJ E;  1D0X A;  3PUA A;  4X1K E;  5CA0 E;  4XBF B;  2ES0 A;  3FZF B;  4I55 E;  1WYB A;  1D0Z A;  4QXH B;  4LF4 T;  4NIQ A;  5LHG B;  5IUX A;  3KV5 A;  3UQ7 A;  1IBM T;  3I0Q A;  5EZY E;  4AXP A;  3QUJ A;  4X5T A;  2KT9 A;  3BQL A;  3AE3 A;  2Z6E A;  5HWX A;  2X0L B;  4LMJ A;  4BAY B;  2WDR A;  3OJA A;  3RIF A;  3OYZ A;  3C50 A;  4C90 A;  4H9Q C;  4YLH A;  2XAF B;  5LGN B;  1SE7 A;  4J2C A;  5AQI B;  4H9P C;  1SA0 E;  4P0A A;  4EEB A;  3PUR A;  3K3Q C;  4O4H E;  4X62 T;  2MYS A;  1MMD A;  3K3O A;  5AQQ B;  4IE0 A;  2A72 A;  5AQT B;  5LBM A;  2XQ4 A;  2JMH A;  2KND A;  1ZEE A;  3RQW A;  1VCT A;  4AQF A;  4DV3 T;  4DR2 T;  3UU5 A;  1WFD A;  4IE7 A;  1YQ4 A;  2Q9Q A;  2V6Y B;  4U7Y A;  2NW8 A;  4PAG A;  4KHP T;  4LF8 T;  1LVK A;  3OYX A;  4HFH A;  5FMN A;  4DV6 T;  3P4W A;  4JYA T;  3AE6 A;  1O3X A;  3ZCI A;  2WBL A;  2CLY C;  4UV9 B;  2D2S A;  1HG2 A;  5HEJ A;  4ZS2 A;  3C4W A;  3E08 A;  5BR8 T;  4YSX A;  2K5B B;  5HEH A;  2XQ7 A;  2XSB A;  2LSJ A;  5F8P A;  2LSY A;  3JAD A;  2QYW A;  2ZM2 A;  5ABH A;  2WU2 A;  2HHH T;  2IIU A;  3VR8 A;  5ABE A;  2E9X B;  2KLQ A;  2YEV C;  1VOM A;  4PFO A;  3W15 B;  5HEG A;  4A5X A;  5L3F B;  1UUS A;  3A5X A;  3ZJ2 A;  5HYA A;  3DJB A;  4QH5 A;  1CHU A;  4Q25 A;  3VRA A;  2K48 A;  3K8P C;  3UT5 E;  5JDQ A;  1S35 A;  3FXE B;  2YDS A;  3BQI A;  4DR1 T;  2NTY A;  4QX7 B;  3AE7 A;  2J1D G;  2CA5 A;  1WLX A;  2VVN A;  2CHO A;  3C4X A;  3FHN A;  4UF0 A;  5JDM A;  4DUZ T;  3FB2 A;  4TUY E;  3ZMS B;  2XAG B;  4O4L E;  4QXB B;  5JDG A;  2YU1 A;  1QSD A;  3ZPO A;  4TN7 B;  2H7O A;  5KDM C;  2OA5 A;  2IUB A;  2K24 A;  1QLB A;  1J5W A;  5HWY A;  2LHR A;  4EYY R;  5L3B B;  2AE9 A;  2XJ7 A;  2V7J A;  3S4U A;  4DV4 T;  3PE0 A;  4DO0 A;  4UVA B;  5JDN A;  2Y6X A;  1W0A A;  4LF6 T;  5JRC A;  3AAA B;  4BJM A;  5LHI B;  4YJ3 E;  4ZHQ E;  3ZC0 A;  2LM2 A;  4JI7 T;  2E9X C;  2LKG A;  2XZE A;  3UUX B;  3QB5 K;  2NW9 A;  1IZN B;  2DNX A;  4Z91 A;  4LFA T;  2LM9 A;  3I1A A;  1B7T A;  3VU7 H;  4U72 A;  4DR5 T;  2WMO A;  4ILA A;  5FVK A;  3AA7 B;  2QGS A;  2DWK A;  2X9W A;  1MIW A;  4WW0 A;  5EK4 A;  3B5M A;  4ZI2 C;  5LGT B;  3RYI E;  2E2A A;  3L3P A;  3CQG B;  3Q2M A;  4JEH B;  5L2L A;  2ACX A;  3D0T A;  4U7I A;  4OK0 A;  1VRB A;  4I4T E;  4P1N A;  4OFZ A;  3MXZ A;  1US7 B;  2JJ9 A;  3P4R A;  1XZY A;  2HPL A;  3Q5W A;  1BR2 A;  5FY0 A;  2VAS A;  2X0Y A;  5CB4 E;  5L4E A;  3ONL C;  4B3R T;  2G0U A;  3FBL A;  3RKO A;  4EXT A;  1T7S A;  1W9R A;  4LFC T;  2BG9 C;  3ETU A;  3LK3 B;  3RGL A;  1Y01 A;  3P4P A;  4TNW A;  4L5G A;  3E0Z A;  1IAP A;  2C5K T;  2JQQ A;  5LJM A;  3KIN B;  4QH1 A;  1MIY A;  4DVD A;  4JBW F;  3GWH A;  4ERR A;  2RP4 A;  3OVU A;  2BS3 A;  3NWI A;  3ANW B;  2KZ7 B;  4M1P A;  4MAL A;  2X0H A;  2XAQ B;  3OBV E;  3HA4 A;  4L0R A;  3RRW A;  3RYH E;  4QHO A;  3TLU A;  1VCS A;  5LNK A;  1BR0 A;  1ZKE A;  2VUR A;  3AEC A;  3J9X 1;  3AED A;  3ZMT B;  5FVL A;  3H3M A;  4H63 H;  4B3S T;  2N9D A;  3GA8 A;  2UXD T;  3AA0 B;  3NZQ A;  4CXX A;  4BA9 A;  2X9X A;  3KBU A;  2YDR A;  4O4I E;  4PJL A;  4DMW A;  4JI1 T;  4A98 A;  4BJN A;  1FJG T;  4GYR A;  1W0B A;  3CX7 B;  3AAE B;  3UUM A;  2ODV A;  1WR6 A;  2LJL A;  1J1J A;  2QRX A;  3I0O A;  3O1H A;  4ZXL A;  3RKG A;  4ILU A;  4GK0 E;  4EZ4 A;  5FXW A;  3UU3 A;  2E8I A;  2EHO D;  2VKJ A;  4YSY A;  2IC6 A;  3P4Q A;  4NXN T;  3PUG A;  3AVR A;  2CXL A;  4DBR A;  3NRY A;  4O2B E;  4U74 A;  3AE5 A;  2H3R A;  2UUA T;  2K3W A;  1Y64 B;  2VKH A;  3QK6 A;  2KMF A;  2WQY A;  1XDO A;  1HFA A;  2VVS A;  3PUW F;  2WAU A;  2VL0 A;  3ZST A;  1KNR A;  3BK9 A;  5LOV E;  3RC3 A;  3AE2 A;  1U4Q A;  2X9H A;  4X20 E;  1X9B A;  4EV6 A;  4EGW A;  2J47 A;  5LCY A;  2HH7 A;  1HNX T;  4LF5 T;  5CFB A;  2FJA A;  2WM9 A;  2PG8 A;  1YQ3 A;  1NEN A;  1ZV4 X;  2CE7 A;  2DCF A;  2KWI B;  2WWU A;  3C51 A;  3CQC B;  3GN5 A;  3RI5 A;  4O2A E;  3NBX X;  5KXJ A;  4KMC A;  2V8S V;  2ZLY A;  2RPA A;  3WAJ A;  4UEL A;  5AQP B;  5LP6 E;  4DV2 T;  1D1A A;  2D0U A;  5HAX A;  5L3G B;  5J0Z A;  2UU9 T;  4KI0 F;  2NWB A;  3N2K E;  4ILB A;  3V5S A;  1N33 T;  3OKQ A;  2PFV A;  4HFD A;  5LGU B;  2D0T A;  3DP7 A;  4QWN B;  4HWC A;  4WNK A;  2CBI A;  4I43 B;  4JI2 T;  4C91 A;  2NR4 A;  4IST A;  4HFB A;  1DU2 A;  4AQF C;  4V1A v;  4CN6 A;  5JDH A;  4PJJ A;  4UXN B;  3ZYM A;  2WDV A;  1N36 T;  4O8S A;  3KVB A;  4CZZ B;  1N32 T;  5HEO A;  5L3C B;  1J5E T;  1U5P A;  1KNZ A;  2VQF T;  3CKD A;  3IF8 B;  3PUV F;  5FXV A;  2BKN A;  3LFM A;  3TLW A;  4TV8 E;  3SS1 A;  2FJE A;  4KHZ F;  3F31 A;  4ISS A;  4DV0 T;  4ZZC A;  5LMN T;  2CPT A;  4IE5 A;  4N78 D;  4ZI7 E;  5LYJ E;  5AQH B;  2W66 A;  3AE9 A;  2V5C A;  2W0G A;  1BR1 A;  4U2Z A;  1GQE A;  2LOP A;  3TKL B;  3RPU A;  4TNV A;  1HX1 B;  2MTQ A;  2V1D B;  2W4X A;  2LRL A;  3NZP A;  3UQ4 A;  3ZKR A;  3Q5X A;  4HWI B;  2BKO A;  2HPJ A;  3EHZ A;  3EVY A;  4JI5 T;  4QX8 B;  4WZX A;  4EB6 E;  4B6X A;  3M3Z B;  3JAF A;  2FBW A;  4AKI A;  3SWH A;  5AQL B;  1Z8U A;  2XTL A;  2VB6 A;  3NKZ A;  4P09 A;  2XUE A;  3I9Y A;  5JR9 A;  3PU8 A;  3N9P A;  4HFV A;  3UUN A;  4XAX B;  4EED A;  2D5U A;  4HWF A;  5CJ5 A;  3J7Y q;  3ZYK A;  2XQ8 A;  5LMU T;  2WS3 A;  4IE4 A;  4FI5 A;  3UU8 A;  1I94 T;  1D1C A;  2NTX A;  3ONX A;  4TWF A;  5C2T A;  4AKL A;  4G63 A;  1LVF A;  5H6R B;  3FZK B;  4A56 A;  3ZSS A;  4EZH A;  5C3J A;  4DUY T;  3MJX A;  1HNZ T;  1EZ3 A;  4ZI3 C;  3L39 A;  3RC8 A;  4OX9 T;  3RIU C;  2WMN A;  2DL1 A;  3O1I A;  2YOE A;  5DJQ C;  3ZT5 A;  3U78 A;  2EHO B;  4HGA A;  3FZL B;  5JH7 E;  2W63 A;  2XAH B;  5AQS B;  3RIU A;  5ABF B;  2BS2 A;  4UR9 A;  4TZ4 C;  1YW0 A;  4JI6 T;  4DR4 T;  3UFG A;  1FEW A;  3VHL A;  2WZH A;  2YK0 A;  3N9Q A;  2CXD A;  2MBG A;  3L09 A;  5E0O A;  4ZZB A;  2NW7 A;  1E7P A;  2SPC A;  4HFE A;  1XNQ T;  4GOU A;  4H9S E;  2F4V T;  2HN1 A;  1D1B A;  3LJC A;  3ZC1 A;  3F57 A;  4QH4 A;  3MKD A;  2AXD S;  5IHY A;  4AI6 A;  2Y48 B;  3O4X E;  3Q9D A;  4YHH T;  2WSS V;  3MAC A;  3AAI A;  3HI2 A;  4YTP A;  3PU3 A;  1HTJ F;  5JR9 B;  1OWA A;  4HEA A;  3AE8 A;  4PK5 A;  4AIS A;  1YXR A;  4AKH A;  1OED A;  4X64 T;  1X79 A;  3QC9 A;  2PTF A;  2OV9 A;  1AJ3 A;  2VK9 A;  2H88 A;  2R6G F;  3CPZ A;  3KVA A;  3AVS A;  4TV9 E;  2B1E A;  2IC9 A;  3A7M A;  3R6N A;  5DAB A;  5AQM B;  3RRC A;  5HXE A;  3P50 A;  3C4Z A;  1HF8 A;  2Q9Q D;  5AQV B;  3TLV A;  2WB5 A;  2CRB A;  4GK5 E;  3JC6 C;  5JR9 C;  2E9X D;  3ZLI A;  5ADX L;  2UXC T;  3VKH A;  5HCJ A;  3FXD B;  2LEH A;  2ODU A;  3FZM B;  3SFD A;  5HXS A;  2Q9Q C;  5HXC A;  3AA6 B;  4HFC A;  1NAF A;  4LF9 T;  3PUX F;  2IHR 1;  4IIJ E;  3HL6 A;  2CHN A;  3RYC E;  3VKG A;  4UEM A;  3ZN0 B;  4CXW A;  3LK2 B;  5HEU A;  2KWH A;  2L3L A;  4U3C A;  2M6I A;  4X66 T;  4X65 T;  4GIW A;  2LRK A;  3QOF A;  3K1S A;  3HKE E;  4IDZ A;  3AEA A;  3N9L A;  3N2O A;  5GON E;  2QVA A;  1MND A;  1IJ5 A;  2NP9 A;  2D9D A;  5AQK B;  2CXF A;  2I6H A;  4F8H A;  5FL1 A;  2E5L T;  5FNV E;  3ESL A;  1XWM A;  3HKD E;  3EI0 A;  3QNU A;  4H9N C;  3ZCJ A;  2JMK A;  4DID B;  2BKP A;  2BG9 B;  4ZI2 D;  4CN1 A;  3IHR A;  3ZEF B;  4Z90 A;  2V7K A;  5J2T E;  2MPK A;  1S94 A;  2BG9 A;  1XMQ T;  2YN6 A;  2LKH A;  2YDQ A;  4B3M T;  5AFU L;  4TX5 A;  2LSK A;  3CK6 A;  2QA7 A;  5J2U E;  5IYZ E;  2N2N A;  5JDL A;  4YTN A;  2XM1 A;  2XQ5 A;  3AXJ B;  4ZOL E;  5LG4 A;  3H3A A;  2K9A A;  4UVB B;  5BMV E;  4I0U A;  4CI2 B;  1OED E;  3MZK B;  2BDE A;  1KNP A;  2KXP B;  3ABV A;  5EK3 A;  5AQG B;  3OTO T;  1I6Z A;  4H63 V;  4PJM A;  4O4J E;  4CI3 B;  5FXX A;  5LJN A;  4HTE A;  2C5I T;  4UVC B;  3G06 A;  3R84 B;  5L3D B;  2DWG A;  4IGU A;  4YY3 T;  2V7M A;  5JRC B;  2H89 A;  3AE4 A;  4HWH A;  2M6B A;  2WWV A;  5KMG P;  3T1H T;  4NXM T;  5LA6 E;  2E9X A;  3JAE A;  4IL9 A;  4EYU A;  5LHH B;  3LK4 2;  5ABG A;  1KK7 A;  2BG9 E;  3RYF E;  1YD8 G;  2ZM6 T;  1G73 A;  1D0Y A;  5AQF B;  5KX5 E;  4L9I A;  2LHN A;  3V5U A;  4TWD A;  1ZHC A;  3AEF A;  3MK7 C;  1MMN A;  3RQU A;  3UTK A;  3ZMV B;  2WDQ A;  4YHJ A;  2IAK A;  3P8C D;  4YXD A;  2L8K A;  1MNE A;  2V7I A;  2VL8 A;  1UX5 A;  4IDQ A;  4U33 A;  3U3I A;  4CXY A;  1UUR A;  3AA1 B;  1H7C A;  1WRD A;  4EIW A;  5IWA T;  2BS4 A;  2CWY A;  2V26 A;  5FY1 A;  4E7S A;  5LXT E;  4AQG A;  3B57 A;  5LBQ B;  2CWO A;  2A3D A;  3ANW A;  1WYC A;  3CX8 B;  4E7Z A;  5F5W A;  2ZM0 A;  3H37 A;  3AEE A;  2A2F X;  4MLK A;  5DQV A;  1IBK T;  3X1D A;  2WZI A;  3TLS A;  2NOX A;  1MIV A;  5CGM A;  3F2E A;  3LBX A;  3C64 A;  3KV9 A;  4PK6 A;  5AQO B;  2BVM A;  4ZEY A;  5JQG E;  2LSG A;  1XDP A;  2CM0 A;  2V6X A;  2XAS B;  3EAB A;  1UGO A;  4I50 E;  5FXZ A;  5AQN B;  1SHZ C;  3N5L A;  3T1Y T;  3AEB A;  5HXH A;  1E1H B;  4QXC B;  1HNW T;  4KBM B;  2DI4 A;  5JRE A;  2LSI A;  2Q9Q B;  2V6Y A;  2X67 A;  2XQ3 A;  5LG3 A;  5ABF A;  2WY2 A;  4B3T T;  4JI4 T;  1XNR T;  3VRB A;  4AQY T;  2UXN B;  2V7L A;  2WCA A;  4H9R C;  3N9M A;  4FJO A;  1UCU A;  2CLY B;  4LMK A;  5FY7 A;  1IBL T;  2IW5 B;  1FMV A;  4IE6 A;  5DQW A;  4ANJ A;  2XY8 B;  4JI0 T;  4TWH A;  4YJ2 E;  3ZN1 B;  5TAO A;  2XSA A;  4Z8X A;  3VR9 A;  2VQE T;  3LDQ B;  3RLF F;  2VKO A;  4PW8 A;  5FKY A;  1Z0P A;  3EAM A;  3PJA J;  2FUP A;  5LB7 B;  2UXX B;  1KEY A;  2PBI A;  4DV1 T;  4PNI A;  3SOL A;  2C5J A;  4MHC A;  5AQJ B;  4X1I E;  3I9W A;  4AKG A;  4JLE A;  3HR0 A;  4XZC A;  1FIO A;  3IBP A;  2MAW A;  3P7I A;  5HXR A;  1BR4 A;  1M62 A;  1T72 A;  2KIN B;  1M7K A;  3EDU A;  3LBX B;  1R8I A;  1SUM B;  3AE1 A;  2YKS A;  3PV0 F;  4NUU A;  1LKX A;  2W2U A;  3ZMZ B;  1LRZ A;  1G8X A;  1MMG A;  2M67 A;  2XHE B;  5F3J A;  2N1G A;  1YKH B;  3JCF A;  4AIU A;  1HS7 A;  5JVD E;  3RIA A;  5ETW A;  1MMA A;  1HG5 A;  1W09 A;  5L47 A;  2W67 A;  1HCI A;  4DMV A;  4ZS3 A;  2BVL A;  2UUC T;  3PJA A;  3IEE A;  4JI8 T;  2A9U A;  2FJB A;  1KFY A;  4UV8 B;  1ZP0 A;  5L4H A;  1N34 T;  2H7V C;  3AXJ A;  4LFB T;  3CWZ B;  2EHO C;  2VWA A;  2PJQ A;  3MA9 A;  2X68 A;  2ZMA A;  4PJN A;  3ZT6 A;  3ZYL A;  2JQK A;  3O1J A;  4CI1 B;  3AEG A;  2LLY A;  1T8B A;  3CX6 B;  4GYS A;  4KUM B;  4GKJ T;  2OLT A;  3EUH A;  3KFW X;  3ONJ A;  2KSR A;  4DND A;  3CIR A;  2EHO A;  3ETV A;  3M65 A;  2JIW A;  4OYK A;  4DV7 T;  3PTR B;  4LML A;  3UU4 A;  4GKK T;  4HE8 A;  3N9O A;  5FL0 A;  1JNR A;  1KF6 A;  4DR3 T;  3WI3 A;  3A8Y C;  3RH3 A;  2I0M A;  2YU2 A;  3B13 A;  3K3N A;  2E5V A;  4IRE A;  1CUN A;  2RA1 A;  3JC6 D;  3EDV A;  4K0K T;  4K0U A;  2BBJ A;  1FMW A;  3HKC E;  4YFS A;  3UFE A;  3UUL A;  2J62 A;  3RX6 A;  1QUU A;  4DR6 T;  4LF7 T;  2CCQ A;  3KV6 A;  4KX6 A;  2LT3 A;  2ACZ A;  3IA3 A;  3TLT A;  2W00 A;  2XQ6 A;  3HKB E;  3C98 B;  3CVR A;  4P0B A;  3KV4 A;  4IL4 A;  5JTG A;  5A1L A;  3PDY A;  4KP3 C; 
#chains in the Genus database with same CATH homology
 2I59 A;  1V9D A;  5EK2 A;  2Y8D A;  3E22 E;  4ASK A;  5CA1 E;  4QKN A;  2XAJ B;  4H9O C;  1YKE B;  3PUS A;  2C0S A;  4EOZ B;  4HN9 A;  5FP3 A;  5C8Y E;  2X51 A;  5M4Y A;  5JDF A;  4ADZ A;  3DTO A;  2DHR A;  2VKD A;  2W62 A;  3BQK A;  4AKR B;  4MFR A;  2MOZ A;  4X1Y E;  4CQI A;  4ZI3 D;  3NRX A;  1NWM X;  3AB3 B;  1UX4 A;  1HX8 A;  3ZJ1 A;  4PK4 A;  4DBQ A;  5L3E B;  2LOS A;  1IJ6 A;  4UF0 B;  4G2A A;  3N2G E;  3KDS E;  3FBZ A;  2X66 A;  2JPF A;  5J1G A;  3WAK A;  4EAH A;  4NUV A;  4UIG A;  3KBT A;  1T98 A;  2CMR A;  3T8O A;  3CML A;  4WBN E;  2L9Q A;  2P9B A;  3LG7 A;  2YIN A;  4OHF A;  2LE8 A;  3PUQ A;  4HKA A;  4JEU B;  5FYM A;  2W61 A;  2GK9 A;  3GN5 B;  2ZM8 A;  4JUY A;  2BZB A;  2DLR A;  4F6R C;  4PFP A;  2CEA A;  2JRK A;  4WBO A;  3ZMU B;  3SRZ A;  3O9X A;  4OYJ A;  3GMI A;  1OXZ A;  3N9N A;  3CQX C;  4MBQ A;  5H6Q B;  2X9Y A;  2XQY A;  4IHJ E;  1D0X A;  3PUA A;  4X1K E;  5CA0 E;  4XBF B;  2ES0 A;  4I55 E;  1WYB A;  1D0Z A;  4QXH B;  5LHG B;  3KV5 A;  3I0Q A;  5EZY E;  4AXP A;  3QUJ A;  2KT9 A;  3BQL A;  2Z6E A;  5HWX A;  2X0L B;  4BAY B;  3OJA A;  3OYZ A;  3C50 A;  4C90 A;  4H9Q C;  4YLH A;  2XAF B;  5LGN B;  4J2C A;  4P0A A;  4H9P C;  1SA0 E;  3PUR A;  3K3Q C;  4O4H E;  2MYS A;  1MMD A;  3K3O A;  4IE0 A;  2A72 A;  5LBM A;  2JMH A;  2KND A;  1ZEE A;  4IE7 A;  2Q9Q A;  2NW8 A;  4PAG A;  1LVK A;  3OYX A;  5FMN A;  1O3X A;  3ZCI A;  2WBL A;  2CLY C;  4UV9 B;  2D2S A;  1HG2 A;  4ZS2 A;  3C4W A;  3E08 A;  2K5B B;  2LSJ A;  5F8P A;  2LSY A;  2ZM2 A;  2E9X B;  2KLQ A;  2YEV C;  1VOM A;  4PFO A;  3W15 B;  5L3F B;  3A5X A;  3ZJ2 A;  5HYA A;  3DJB A;  2K48 A;  3K8P C;  3UT5 E;  5JDQ A;  1S35 A;  3FXE B;  3BQI A;  2NTY A;  4QX7 B;  2J1D G;  3FHN A;  3C4X A;  2CA5 A;  1WLX A;  4UF0 A;  5JDM A;  3FB2 A;  4TUY E;  3ZMS B;  2XAG B;  4O4L E;  4QXB B;  5JDG A;  2YU1 A;  1QSD A;  3ZPO A;  4TN7 B;  2H7O A;  5KDM C;  2OA5 A;  2K24 A;  5HWY A;  2LHR A;  4EYY R;  5L3B B;  3S4U A;  2V7J A;  3PE0 A;  4DO0 A;  4UVA B;  5JDN A;  2Y6X A;  5JRC A;  3AAA B;  4BJM A;  5LHI B;  4YJ3 E;  4ZHQ E;  3ZC0 A;  2E9X C;  3UUX B;  2NW9 A;  1IZN B;  2DNX A;  2LM9 A;  3I1A A;  1B7T A;  3VU7 H;  4U72 A;  2WMO A;  3AA7 B;  2QGS A;  2DWK A;  2X9W A;  1MIW A;  4WW0 A;  5EK4 A;  4ZI2 C;  5LGT B;  3RYI E;  3L3P A;  3CQG B;  3Q2M A;  4JEH B;  5L2L A;  2ACX A;  3D0T A;  4OK0 A;  1VRB A;  4I4T E;  4OFZ A;  3MXZ A;  1US7 B;  2JJ9 A;  2HPL A;  3Q5W A;  1BR2 A;  5FY0 A;  2VAS A;  5CB4 E;  2G0U A;  3FBL A;  3RKO A;  4EXT A;  3ETU A;  3LK3 B;  4L5G A;  3E0Z A;  1IAP A;  2C5K T;  2JQQ A;  5LJM A;  3KIN B;  1MIY A;  4DVD A;  3GWH A;  4ERR A;  2RP4 A;  3ANW B;  2KZ7 B;  4M1P A;  4MAL A;  2XAQ B;  3OBV E;  3RRW A;  3HA4 A;  4L0R A;  3RYH E;  4AQF A;  4QHO A;  1BR0 A;  5LNK A;  1ZKE A;  3J9X 1;  3ZMT B;  4H63 H;  2N9D A;  3GA8 A;  3AA0 B;  3NZQ A;  4CXX A;  4BA9 A;  2X9X A;  3KBU A;  4PJL A;  4O4I E;  4DMW A;  4BJN A;  4GYR A;  3CX7 B;  3UUM A;  3AAE B;  5KX5 E;  2ODV A;  1WR6 A;  2LJL A;  3I0O A;  3O1H A;  4EZ4 A;  4ILU A;  4GK0 E;  5FXW A;  2E8I A;  2EHO D;  2VKJ A;  2IC6 A;  3PUG A;  3AVR A;  2CXL A;  4DBR A;  3NRY A;  4O2B E;  4U74 A;  2H3R A;  2VKH A;  1Y64 B;  3QK6 A;  2KMF A;  1HFA A;  2WAU A;  3BK9 A;  5LOV E;  3RC3 A;  1U4Q A;  2X9H A;  4X20 E;  5LCY A;  2HH7 A;  2WM9 A;  2PG8 A;  1ZV4 X;  3GN5 A;  2CE7 A;  2DCF A;  2WWU A;  2KWI B;  3CQC B;  3C51 A;  4O2A E;  3NBX X;  4KMC A;  2ZLY A;  3WAJ A;  4UEL A;  5LP6 E;  1D1A A;  2D0U A;  5HAX A;  5L3G B;  2NWB A;  3N2K E;  3V5S A;  3OKQ A;  2PFV A;  5LGU B;  2D0T A;  3DP7 A;  4QWN B;  4WNK A;  4I43 B;  4C91 A;  4IST A;  4AQF C;  4V1A v;  5JDH A;  4PJJ A;  4UXN B;  3ZYM A;  4O8S A;  3KVB A;  4CZZ B;  5L3C B;  1U5P A;  1KNZ A;  3CKD A;  3IF8 B;  5FXV A;  3LFM A;  4TV8 E;  3SS1 A;  3F31 A;  4ISS A;  4IE5 A;  4N78 D;  4ZI7 E;  5LYJ E;  2W0G A;  1BR1 A;  2LOP A;  3TKL B;  3RPU A;  2MTQ A;  2V1D B;  3NZP A;  3Q5X A;  2HPJ A;  3EVY A;  4EB6 E;  4QX8 B;  4B6X A;  4AKI A;  3SWH A;  2XTL A;  2VB6 A;  4P09 A;  2XUE A;  3I9Y A;  5JR9 A;  3PU8 A;  3N9P A;  4HFV A;  3UUN A;  4XAX B;  3J7Y q;  2D5U A;  3ZYK A;  4IE4 A;  4FI5 A;  1D1C A;  2NTX A;  3ONX A;  4AKL A;  4G63 A;  1LVF A;  5H6R B;  4A56 A;  4EZH A;  3RC8 A;  3MJX A;  1EZ3 A;  4ZI3 C;  2WMN A;  3O1I A;  5DJQ C;  3U78 A;  2EHO B;  4HGA A;  5JH7 E;  2W63 A;  2XAH B;  4TZ4 C;  1YW0 A;  1FEW A;  3VHL A;  2YK0 A;  3N9Q A;  2CXD A;  2MBG A;  3L09 A;  5E0O A;  2NW7 A;  2SPC A;  4GOU A;  4H9S E;  3LJC A;  1D1B A;  3ZC1 A;  3F57 A;  3MKD A;  5IHY A;  4AI6 A;  2Y48 B;  3O4X E;  3Q9D A;  2WSS V;  3MAC A;  3AAI A;  3HI2 A;  3PU3 A;  1HTJ F;  5JR9 B;  1OWA A;  4HEA A;  4PK5 A;  4AKH A;  1X79 A;  3QC9 A;  1AJ3 A;  2VK9 A;  3CPZ A;  3KVA A;  3AVS A;  4TV9 E;  2B1E A;  2IC9 A;  3R6N A;  3RRC A;  5DAB A;  5HXE A;  3C4Z A;  1HF8 A;  2Q9Q D;  5JR9 C;  4GK5 E;  3VKH A;  3JC6 C;  2E9X D;  3ZLI A;  5ADX L;  3FXD B;  2LEH A;  2ODU A;  5HXS A;  2Q9Q C;  5HXC A;  3AA6 B;  1NAF A;  3HL6 A;  3RYC E;  3VKG A;  4UEM A;  3ZN0 B;  4CXW A;  3LK2 B;  2KWH A;  2L3L A;  4GIW A;  3HKE E;  4IDZ A;  3N9L A;  3N2O A;  5GON E;  1MND A;  1IJ5 A;  2NP9 A;  2CXF A;  5FNV E;  3ESL A;  3HKD E;  4H9N C;  3ZCJ A;  2JMK A;  4ZI2 D;  3ZEF B;  3IHR A;  5J2T E;  2V7K A;  1S94 A;  5AFU L;  4TX5 A;  2LSK A;  5J2U E;  2QA7 A;  5JDL A;  5IYZ E;  2N2N A;  4ZOL E;  5LG4 A;  3H3A A;  2K9A A;  4UVB B;  5BMV E;  4CI2 B;  3MZK B;  2BDE A;  2KXP B;  5EK3 A;  4H63 V;  4PJM A;  4O4J E;  4CI3 B;  5FXX A;  5LJN A;  4HTE A;  2C5I T;  4UVC B;  3R84 B;  5L3D B;  2DWG A;  4IGU A;  2V7M A;  5JRC B;  5KMG P;  5LA6 E;  2E9X A;  5LHH B;  4EYU A;  3LK4 2;  1KK7 A;  3RYF E;  1YD8 G;  1G73 A;  1D0Y A;  4L9I A;  2LHN A;  3V5U A;  1ZHC A;  3MK7 C;  3ZMV B;  1MMN A;  3UTK A;  4YHJ A;  2IAK A;  3P8C D;  2L8K A;  1MNE A;  2V7I A;  2VL8 A;  1UX5 A;  3U3I A;  4CXY A;  3AA1 B;  1H7C A;  1WRD A;  4EIW A;  2CWY A;  5FY1 A;  2V26 A;  4E7S A;  5LXT E;  4AQG A;  3B57 A;  5LBQ B;  2CWO A;  2A3D A;  3ANW A;  1WYC A;  3CX8 B;  4E7Z A;  2ZM0 A;  3H37 A;  4MLK A;  2A2F X;  5DQV A;  2NOX A;  1MIV A;  3F2E A;  3LBX A;  3C64 A;  3KV9 A;  4PK6 A;  2BVM A;  5JQG E;  2CM0 A;  2LSG A;  4I50 E;  5FXZ A;  2XAS B;  1SHZ C;  3N5L A;  5HXH A;  1E1H B;  4QXC B;  4KBM B;  2DI4 A;  5JRE A;  2LSI A;  2Q9Q B;  2X67 A;  2UXN B;  2V7L A;  4H9R C;  3N9M A;  4FJO A;  1UCU A;  2CLY B;  5FY7 A;  2IW5 B;  1FMV A;  4IE6 A;  5DQW A;  4ANJ A;  4YJ2 E;  3ZN1 B;  5TAO A;  4Z8X A;  2VKO A;  4PW8 A;  1Z0P A;  2UXX B;  2PBI A;  4PNI A;  3SOL A;  2C5J A;  4MHC A;  4X1I E;  3I9W A;  4AKG A;  4JLE A;  3HR0 A;  4XZC A;  1FIO A;  3IBP A;  3P7I A;  5HXR A;  1BR4 A;  4IIJ E;  3EDU A;  2KIN B;  4NUU A;  3LBX B;  3ZMZ B;  1LKX A;  1LRZ A;  1G8X A;  1MMG A;  2M67 A;  2XHE B;  5F3J A;  2N1G A;  1YKH B;  1HS7 A;  5JVD E;  5ETW A;  1MMA A;  1HG5 A;  4DMV A;  1HCI A;  4ZS3 A;  2BVL A;  3IEE A;  4UV8 B;  2H7V C;  3CWZ B;  2EHO C;  2VWA A;  2PJQ A;  3MA9 A;  2ZMA A;  2X68 A;  4PJN A;  3ZYL A;  3O1J A;  4CI1 B;  3CX6 B;  4GYS A;  4KUM B;  3EUH A;  3KFW X;  4DND A;  2EHO A;  3ETV A;  3M65 A;  4OYK A;  3PTR B;  4HE8 A;  3N9O A;  3WI3 A;  3RH3 A;  2YU2 A;  3B13 A;  3K3N A;  1CUN A;  2RA1 A;  3JC6 D;  3EDV A;  4K0U A;  4YFS A;  1FMW A;  3HKC E;  3UFE A;  3UUL A;  3RX6 A;  1QUU A;  2CCQ A;  3KV6 A;  2LT3 A;  2W00 A;  3HKB E;  3C98 B;  3CVR A;  4P0B A;  3KV4 A;  5A1L A;  3PDY A;  4KP3 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...