5L2LA

Nab2 zn fingers 5-7 bound to a11g rna
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
72
structure length
72
Chain Sequence
SEKSLEQCKFGTHCTNKRCKYRHARSHIMCREGANCTRIDCLFGHPINEDCRFGVNCKNIYCLFRHPPGRVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Rna binding protein
molecule keywords Nab2p
publication title Structural basis for the dimerization of Nab2 generated by RNA binding provides insight into its contribution to both poly(A) tail length determination and transcript compaction in Saccharomyces cerevisiae.
pubmed doi rcsb
source organism Saccharomyces cerevisiae yjm1574
total genus 13
structure length 72
sequence length 72
chains with identical sequence B, E, F
ec nomenclature
pdb deposition date 2016-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14608 zf-CCCH_2 RNA-binding, Nab2-type zinc finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1670 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 5l2lA00
3ZJ1A 3ZJ2A 5L2LA 2LHNA
chains in the Genus database with same CATH superfamily
1IZNB 2BKPA 1VCTA 2WU5A 3ZMUB 5FXWA 2YDQA 1YXRA 2VWAA 5EK2A 5HYAA 3PUAA 4HWDA 3M65A 1B7TA 3ONLC 3R84B 5C2TA 3LBXA 1MMDA 3N9NA 3BQLA 4QX7B 2ZM6T 1HG5A 3KV9A 2HHHT 3C98B 4NXNT 4DUYT 4QH4A 1HF8A 1N34T 4DBQA 3PV0F 2Y48B 4EZHA 3C50A 2JQKA 3RH3A 3F57A 3AEEA 1SUMB 5LG3A 3UFEA 2KLQA 2XSBA 4EYUA 3I0OA 3FB2A 3C4XA 4X1KE 3PUWF 3R6NA 1XNQT 3TLSA 1G8XA 4LFCT 5JR9B 5JH7E 2LOSA 1SE7A 4DMWA 3EVYA 3LK3B 2NOXA 2XQ8A 4O4HE 2LEHA 2JQQA 3CX7B 1YQ4A 2I59A 2NW8A 4YTNA 5JQGE 3ZKRA 2K3WA 2NW7A 4YSXA 4UR9A 2VK9A 4ADZA 1NEKA 4HTEA 5BR8T 4PJNA 5FY1A 3L39A 3WAJA 4PK6A 3EDVA 1IJ6A 1OWAA 3C4ZA 5L2LA 5ABEA 2YU2A 2I6HA 4XBFB 2AE9A 2YOEA 2C0SA 3TKLB 1E7PA 2JMHA 4KI0F 4IL4A 2XPKA 4ISTA 5EK4A 1SA0E 3CIRA 2CXFA 5ABHA 3AE2A 4YJ2E 5JRCB 1MMNA 4DV2T 3K3QC 5JDMA 4JI1T 4X66T 2XQ5A 5ABGA 5HEGA 5CB4E 4EB6E 2IC6A 1UGOA 4JUYA 2MBGA 5LHGB 1UURA 3G06A 3TLUA 2YEVC 4NPPA 2I0MA 3P8CD 2WMNA 2H89A 4MHCA 2L3LA 2C5KT 3SWHA 3JCFA 2IC9A 3CMLA 4GKJT 4HWIB 4DV7T 1IBKT 4OHFA 4DV4T 4F6RC 5ETWA 4YLHA 3PUXF 5ADXL 3K8PC 3SFEA 4IDNA 3RC3A 3VU7H 4UELA 4X1YE 3A5XA 3VKHA 1U4QA 2FJAA 2WSSV 2WMOA 5J2UE 2X0HA 4OK0A 4PFOA 4U72A 4MFRA 4CI3B 3UUNA 2N9DA 2BDEA 3ANWB 3H3AA 2HN1A 4XAXB 2VVNA 2XASB 3ZT6A 3J9X1 4KP3C 3M3ZB 4AKIA 5J1GA 4AISA 3RRWA 2E9XD 4JI6T 5JDGA 4B3RT 3C64A 4OYKA 5HXEA 4ZEYA 4IDQA 3V5UA 3QB5K 4DV5T 5FKYA 5LA6E 4PJMA 1N36T 3E08A 2CBJA 5LYJE 4P0BA 2XQ6A 5H6QB 2W2UA 2Q9QC 1FEWA 4CQIA 5HEUA 3PJAA 2K24A 3Q5EA 3HL6A 2UXDT 2C5IT 3CKDA 4Z90A 5FL0A 1Y01A 4JBWF 5L3EB 3K3OA 2YINA 3NRYA 3LK2B 4HFVA 5CA0E 4C91A 5FY7A 2WDQA 5AQUB 4BAYB 1WFDA 4IE7A 3EUHA 4DR7T 2W66A 2LRLA 2OA5A 4WZXA 4U31A 5AQFB 1FMVA 4X62T 2DNXA 4A98A 1HR0T 5JVDE 3OYXA 1WR6A 4EEBA 5DQWA 2ZLYA 1OEDC 2AXDS 1XDOA 2RA1A 2WP9A 3PTRB 3GMIA 3AEGA 2B76A 2M6BA 3PURA 2WWUA 1D1CA 5AQTB 1D0YA 4WW0A 3UUXB 2V7LA 4X65T 1HFAA 2X9HA 1US7B 4IL9A 1QUUA 2E9XC 5ABFB 3UUMA 1JNRA 2X67A 3PUYF 2WZHA 5L3DB 2XAQB 2YK0A 4TN7B 4H63H 4LF5T 2XUEA 3EAMA 4HEAA 3EABA 4O2AE 4DV1T 3QUJA 2X0YA 4UV8B 4HFDA 4DR4T 2LOPA 3P50A 4GYSA 2BG9E 4PJJA 3UUBA 3LDQB 5LMUT 1VOMA 5JREA 2BS2A 3V5SA 2XQYA 2UUCT 5CA1E 4AKHA 1KFYA 2XQ9A 2VB6A 4JI3T 3QK6A 4WYVA 2PG8A 3VRBA 1X79A 3WAKA 2IUBA 3AAAB 3PU3A 2YDSA 2ZM8A 2XAHB 2J62A 2DHRA 2FJBA 1VCSA 2KWHA 2UXCT 1HX8A 4KMCA 2K48A 1J1JA 5LNKA 3C4WA 4QXBB 4ZS3A 5C3JA 2QVAA 2ZM2A 3OVUA 3PUGA 2M67A 3IEEA 1W09A 2X9WA 4DR6T 1FMWA 4PK5A 2PFVA 1YKHB 2FUPA 1D0ZA 5AQQB 3RYHE 2CRBA 3HKDE 2G0UA 2WQYA 5L4HA 3L3PA 1OXZA 3F2EA 5JR9C 1CHUA 3RIUC 3HKEE 2FBWA 4DIDB 4LMLA 3GA8A 4Z8XA 3QB5A 3GWHA 4UF0A 1L0VA 4LF9T 2IHR1 4IIJE 5AQPB 3ZJ2A 3QNUA 5FP3A 2W00A 5EZYE 4I4TE 2WDVA 4X5TA 3KBTA 4KHPT 1NENA 4U74A 2YN6A 3J7Yq 3ZJ1A 2HH7A 3CVRA 2WWVA 2X9YA 4CN4A 4H9PC 1ZEEA 3T1HT 1HCIA 4N78D 2H3RA 4AKRB 3I1AA 2LM2A 4KUMB 4YSZA 2ZMAA 3K3NA 1KNPA 2X9XA 2DI4A 1T7SA 3ZN0B 2JMKA 1T72A 5DJQC 2JJ9A 3AA0B 4LMKA 5HXHA 4IE0A 4EYYR 3MJXA 3ZSSA 2J1DG 3Q5DA 2Q9QA 5CJ5A 3AE8A 5L3CB 3FBLA 3UTKA 2W63A 2DCFA 4U33A 3RHWA 4NUVA 4MBQA 3FBZA 4BJNA 4FI5A 2YKSA 4H63V 2VKJA 1U5PA 2QYWA 4P09A 1LVKA 4TV8E 4DR5T 1WLXA 4AQFC 2K5BB 5J0ZA 3AE4A 2W0GA 3AEFA 4JI5T 5HWXA 4H9SE 4LMJA 2LT3A 2LE8A 3AVSA 4TWFA 4HWCA 2OLTA 1O3XA 4DV6T 2CBIA 5J2TE 4IGUA 3H3MA 3KV6A 3UU5A 3AE9A 3F31A 1XDPA 4PJLA 2X68A 3LFMA 1XWMA 4ZOLE 4YTPA 4ZHQE 1OEDA 2IAKA 1G73A 3RYCE 1WCRA 2LLYA 3SS1A 4LF7T 5LHIB 2CLYC 3VR8A 1UUSA 2WB5A 3Q2MA 3P4SA 5E0OA 3HA4A 1W9RA 2NWBA 2D9DA 5LCYA 3EHZA 3ZN1B 3VKGA 2E9XA 5HWYA 2W61A 2XZEA 5A1LA 3KVBA 2V5DA 5IYZE 2LSGA 2OV9A 2ZM0A 5LG4A 3P4WA 4CZZB 2NTYA 1M62A 1LVFA 3CQGB 2V7IA 3ZMVB 4H9QC 4QHOA 3AA6B 4GK0E 5L3FB 4FJOA 3AXJB 2LSYA 5F5WA 5HCMA 5IUXA 2RPAA 2VL0A 3MACA 2V6YA 4CI2B 1KNZA 2CHNA 4X64T 2V7KA 4I50E 5AQSB 3RI5A 3QOFA 4PFPA 2VKHA 2XM1A 2QA7A 3PUZF 4DR3T 4JI7T 1MNEA 2WCAA 3RQUA 1S94A 2JRKA 2CA5A 3DJBA 4TWDA 4GYRA 4H9NC 5DABA 5H6RB 2CHOA 4HWHA 2Y8DA 3RIAA 4L9IA 1IAPA 2BG9C 4UXNB 5KX5E 1WRDA 5FXZA 3KINB 1ZKEA 1HNXT 1X9BA 3U3IA 2NR4A 5JR9A 2IMLA 4AKLA 4BA9A 3RIUA 2EHOD 5L47A 4ZI7E 3HKBE 3I9WA 1D1AA 2HPLA 4ANJA 4YJ3E 3T1YT 4TNVA 3TLVA 1J5ET 3K1SA 3IF8B 3SFDA 3UFGA 3CX8B 2HN2A 3AE7A 1KF6A 4YT0A 4QWNB 3JAEA 3DTOA 3TLTA 3UT5E 5F3JA 4X1IE 5LBMA 3ZC0A 5F8PA 5GONE 3O1JA 3H37A 1E1HB 3AE6A 3PU8A 3UU8A 2LKHA 3JC6D 1HS7A 1VRBA 4F8HA 2W62A 3N9PA 1D1BA 5LMNT 1W0BA 2FJEA 4O4LE 4J2CA 5LGUB 2KZ7B 3ZMZB 4ZZBA 1JNZA 3RRCA 5AQNB 2PBIA 2A9UA 2VASA 4UEMA 4HE8A 2LHRA 3PDYA 1KK7A 3AE3A 5AQMB 3UU3A 3MXZA 2UU9T 2W67A 2HPJA 1V9DA 3ZMSB 3AAIA 3OJAA 2WBLA 4U2ZA 1HG2A 2KMFA 4AQFA 3LJCA 4V1Av 2XM2A 3P4RA 2PTFA 2MPKA 4EGWA 4ZXLA 2Z6EA 1HTJF 2EHOC 2V26A 4OX9T 4YY3T 3W15B 3Q5XA 3CQXC 4LF4T 1AJ3A 3FHNA 3AVRA 5HEHA 2XY8B 2XQ7A 4K0KT 2BKOA 4U2YA 3UU4A 3MKDA 2YDRA 3P7IA 2VQET 4NXMT 4ILCA 4ZI2D 5AQVB 3LSVA 3FZFB 3FZLB 1NAFA 3ZPOA 3KV5A 4IE4A 3EI0A 4UVBB 4LFBT 4HFIA 1XNRT 2JPFA 4KX6A 5M4YA 5IWAT 4X20E 3LBXB 3NZPA 1W0AA 2XSAA 5LJMA 3ZYMA 4DNDA 3N9OA 2XJ7A 1KEYA 3S4UA 1NWMX 2Q9QB 3AB3B 4COFA 1YKEB 3IA3A 4PW8A 4B3ST 5LBQB 1IJ5A 3WI3A 3N2KE 5HXSA 2H88A 2ODVA 5AQIB 4DMVA 3KBUA 4NUUA 1XMOT 3CWZB 5AQLB 4JI2T 4B6XA 4YHHT 2KWIB 2A3DA 3B5MA 3Q9DA 4EXTA 2MAWA 2CPTA 2GK9A 3VHLA 4NIQA 1E2AA 2BS3A 4U7IA 4I43B 3FZHB 4CXXA 2WU2A 4O2BE 2BBHA 3PUVF 4OYJA 4KBMB 1OEDB 3FZMB 4YHJA 3RYIE 4YSYA 5HCJA 2L9QA 2YU1A 4XZCA 1UX4A 4CXYA 2CWOA 2D2SA 4UVCB 4IE6A 1HNWT 4HWFA 3ZSTA 5FXVA 4ASKA 4K0UA 4ZI3D 1GQEA 2V5CA 1BR2A 5FY0A 3ABVA 3P4QA 2NP9A 3UULA 2CMRA 2E9XB 2WY2A 1T98A 5LHHB 2RP4A 2WZIA 5HEJA 3KV4A 1M7KA 5HXCA 2H7VC 3ONXA 3JAFA 4JLEA 2BG9A 2X66A 2WDRA 5LJNA 3O4XE 5LGNB 4HGAA 5AQHB 5CGMA 4GK5E 5FYMA 2VQFT 2CXLA 4JI0T 1SHZC 1LRZA 5JDHA 2V8SV 3A7MA 2A72A 1J5WA 2ES0A 3N2OA 3GN5A 4HN9A 3N9LA 3U78A 2QRXA 4WBNE 1XZYA 2DWKA 4HFBA 2V6YB 2V1DB 5JDLA 2X0LB 4TX5A 1ZP0A 2XQAA 5IHYA 2JIWA 1S35A 1N33T 5AQKB 2BZBA 3L09A 2XQ3A 4U7YA 3PUSA 4ZS2A 2Y6XA 5AFUL 4IT4A 5CFBA 2WM9A 5FMNA 3AA7B 2D0UA 2R6GF 4ILAA 4B3MT 1KNRA 4TZ4C 1MIWA 3BQKA 1FIOA 4O8SA 3D0TA 2F4VT 3HI2A 5HXRA 2D0TA 2ACZA 5KDMC 4HFCA 3OBVE 4WBOA 1IBLT 4IDPA 1EZ3A 4AXPA 1H7CA 2LRKA 3I9YA 2LHNA 3NBXX 5FVLA 4Z91A 4MALA 1N32T 2FJDA 3AA1B 1ZOYA 4ZI3C 3RKOA 5LGTB 1FJGT 1YW0A 5LOVE 2WAUA 4OFZA 5JTGA 1R8IA 2BS4A 4G63A 3NWIA 2UUAT 3ZT7A 3ZEFB 3AE1A 4MLKA 3CQCB 4TV9E 4ILUA 4PAGA 4EOZB 1XMQT 4ZZCA 3L8RA 3OYZA 3NZQA 3ZLIA 4QH1A 5KXJA 1WYCA 3DP7A 4QH5A 2LSIA 2E5VA 2XAFB 2EHOA 3AE5A 2BVMA 4DBRA 4JEHB 1MNDA 4TWHA 2UXXB 4HKAA 2XHEB 2UXBT 4M1PA 4CI1B 2DL1A 2IDOB 3QC9A 5AQGB 1YD8G 3N5LA 3AEAA 1MMGA 2IW5B 4AKGA 4I0UA 4PK4A 2P9BA 3P4PA 3AEBA 1BR0A 2J4GA 5AQRB 5FL1A 1IBMT 2Q9QD 2V6XA 3O9XA 2CEAA 3EDUA 4L5GA 4A5XA 1YQ3A 4Q25A 3ONJA 2VKOA 3OKQA 2E2AA 2VL8A 3ETVA 2N1GA 3NRXA 4DV3T 4IHJE 3IHRA 4QX8B 2J47A 4TNWA 2SPCA 4P0AA 3AAEB 2IIUA 3Q5WA 4UV9B 3VR9A 2UXNB 4EAHA 3SOLA 3RC8A 3KFWX 3VRAA 5BMVE 4AQYT 4YTMA 4LF6T 1I6ZA 3FZKB 2V7MA 4IE5A 3KDSE 2KINB 3RYFE 4A97A 3NVOA 2ACXA 3MK7C 1HNZT 2CLYB 2W4XA 2CE7A 3PE0A 2NW9A 1LKXA 1QSDA 3PUQA 3BK9A 3RLFF 3KVAA 4EEDA 1Z0PA 3ZCJA 4DR2T 4UVAB 4EZ4A 2LKGA 3T8OA 3HKCE 4QXHB 3UQ4A 3RIFA 2LSKA 5EK3A 2K9AA 4UIGA 2BKNA 4QXCB 3RGLA 2E5LT 5JDFA 1D0XA 2KNDA 3CPZA 3AECA 2E8IA 2BBJA 4LF8T 2L8KA 3A8YC 2KT9A 2VKDA 4DVDA 3CK6A 3FXDB 4P1NA 5JRCA 4GIWA 1QLBA 3IBPA 4H9RC 3MA9A 1ZV4X 2XAJB 3N2GE 2X51A 3N9MA 4JV5T 4DV0T 4CN1A 4E7SA 4UF0B 4LFAT 1MMAA 2MYSA 2WS3A 4DR1T 3ZCIA 3LG7A 4TUYE 1BR4A 3AXJA 3HR0A 5FVKA 2NTXA 3PJAJ 3AEDA 4B3TT 4PNIA 5AQJB 4U3CA 4JI4T 2DWGA 5HEOA 3X1DA 2BG9B 3O1HA 3JADA 1I94T 2XQ4A 4IREA 2MTQA 3B13A 4WNKA 3ZMTB 2C5JA 1ZHCA 3GN5B 2CWYA 3ZC1A 4AI6A 4CXWA 2VURA 3BQIA 2CM0A 1WYBA 5L3GB 5L4EA 3OPCA 4IDOA 4HFEA 4C90A 3LK42 3N9QA 2QGSA 2JQ9A 4YXDA 2UUBT 5JDQA 2V7JA 5TAOA 4O4IE 2PJQA 3FXEB 3JC6C 3ANWA 3OTOT 1DU2A 4HFHA 2B1EA 4GOUA 1CUNA 3MZKB 4JEUB 1HX1B 2D5UA 4AIUA 2ODUA 1MIVA 5LXTE 1UX5A 5HAXA 3CX6B 3UU6A 4A56A 4BJMA 4I55E 2XTLA 5FNVE 3ZYKA 2H7OA 2BVLA 4JI8T 4E7ZA 3E22E 4ISSA 5LP6E 4AQGA 2JQHA 4L0RA 2LM9A 3TLWA 3RPUA 3ZT5A 3ZYLA 3RX6A 4DO0A 3RKGA 3ETUA 5LB7B 4QKNA 3UQ7A 3RF1A 3SRZA 3NKZA 5C8YE 4ERRA 4ZI2C 2LJLA 4O4JE 5L3BB 4GKKT 5AQOB 2EHOB 4CN6A 4EV6A 2KXPB 2M6IA 5DQVA 5JDNA 3ESLA 4YFSA 4JYAT 4EIWA 2CCQA 4DUZT 3B57A 4H9OC 4ILBA 3I0QA 3RQWA 2A2FX 1Z8UA 2KSRA 2VVSA 3C51A 2CXDA 2N2NA 1OEDE 1UK5A 3O1IA 5KMGP 1BR1A 3E0ZA 1T8BA 1UCUA 2DLRA 2MOZA 1MIYA 4G2AA 2LSJA 1WR0A 1Y64B 5FXXA 5ABFA 4IDZA 4KHZF 2XAGB
chains in the Genus database with same CATH topology
4PJJA 1IZNB 3QC9A 3CX8B 1YD8G 3N5LA 1MMGA 1VOMA 2IW5B 5JREA 4AKGA 3V5SA 2XQYA 4QWNB 3ZMUB 3DTOA 5CA1E 4PK4A 3UT5E 4X1IE 5F3JA 5LBMA 3ZC0A 4AKHA 5F8PA 2P9BA 5GONE 2VB6A 3O1JA 5FXWA 3H37A 1E1HB 2VWAA 3PU8A 3QK6A 5EK2A 5HYAA 3PUAA 3M65A 1B7TA 3JC6D 3R84B 1HS7A 1BR0A 1VRBA 2PG8A 3LBXA 1MMDA 1X79A 3WAKA 3N9NA 3AAAB 3PU3A 3BQLA 2W62A 3N9PA 1D1BA 2Q9QD 4QX7B 2ZM8A 2XAHB 1HG5A 3KV9A 3O9XA 3C98B 4O4LE 2CEAA 3EDUA 4L5GA 2DHRA 4J2CA 5LGUB 2KWHA 2KZ7B 3ZMZB 1HF8A 1HX8A 4KMCA 4DBQA 2K48A 2VKOA 3RRCA 5LNKA 3C4WA 2PBIA 3OKQA 2Y48B 4QXBB 4EZHA 2VL8A 3C50A 4ZS3A 2VASA 4UEMA 4HE8A 3ETVA 2N1GA 3RH3A 2ZM2A 3F57A 3NRXA 4IHJE 3PUGA 2M67A 3IHRA 2LHRA 4QX8B 3UFEA 3IEEA 2X9WA 2KLQA 2SPCA 1FMWA 3PDYA 4PK5A 4P0AA 4EYUA 3I0OA 3FB2A 1KK7A 2PFVA 3C4XA 4X1KE 3R6NA 1YKHB 3MXZA 3AAEB 1G8XA 5JR9B 1D0ZA 2HPJA 1V9DA 3RYHE 3ZMSB 3AAIA 3OJAA 5JH7E 2WBLA 3Q5WA 4UV9B 2LOSA 1HG2A 2UXNB 3HKDE 2KMFA 2G0UA 3SOLA 4AQFA 3LJCA 4V1Av 4DMWA 3L3PA 4EAHA 1OXZA 3EVYA 3KFWX 3LK3B 3F2EA 5JR9C 3RC8A 2NOXA 5BMVE 4O4HE 2LEHA 2JQQA 3HKEE 3CX7B 2I59A 2NW8A 3GA8A 4Z8XA 5JQGE 2Z6EA 1HTJF 2EHOC 2NW7A 3GWHA 2V26A 4UF0A 3W15B 3Q5XA 2VK9A 2V7MA 3CQXC 4ADZA 4IE5A 1AJ3A 3FHNA 3AVRA 4IIJE 3ZJ2A 5FP3A 2W00A 3KDSE 3MKDA 4I4TE 5EZYE 3P7IA 2KINB 3KBTA 3RYFE 4HTEA 4U74A 2ACXA 4ZI2D 4PJNA 3MK7C 5FY1A 3J7Yq 2CLYB 3WAJA 4PK6A 3ZJ1A 2HH7A 3CVRA 3EDVA 2X9YA 1NAFA 1IJ6A 2CE7A 3ZPOA 3PE0A 3KV5A 4IE4A 2NW9A 1OWAA 1LKXA 4UVBB 3C4ZA 1QSDA 3PUQA 3BK9A 2JPFA 5M4YA 4H9PC 1ZEEA 3KVAA 1HCIA 4N78D 4X20E 1Z0PA 2H3RA 3LBXB 4AKRB 5L2LA 3NZPA 3ZCJA 2YU2A 4UVAB 4XBFB 4EZ4A 5LJMA 3I1AA 2C0SA 3TKLB 3ZYMA 4DNDA 3T8OA 3HKCE 4KUMB 2JMHA 3N9OA 4QXHB 4ISTA 5EK4A 1NWMX 1SA0E 2Q9QB 3S4UA 2CXFA 3AB3B 2ZMAA 3K3NA 2LSKA 4YJ2E 1YKEB 2X9XA 4PW8A 5JRCB 5EK3A 2DI4A 2K9AA 1MMNA 5LBQB 4UIGA 1IJ5A 4QXCB 3ZN0B 3K3QC 2JMKA 5JDMA 5JDFA 3WI3A 1D0XA 2KNDA 5DJQC 2JJ9A 3AA0B 3CPZA 5HXHA 2E8IA 4IE0A 4EYYR 3N2KE 5CB4E 5HXSA 3MJXA 2ODVA 2J1DG 4DMVA 4EB6E 2IC6A 2Q9QA 2L8KA 5L3CB 3KBUA 3FBLA 4NUUA 3UTKA 2W63A 2KT9A 2DCFA 2VKDA 4DVDA 4JUYA 3CWZB 3FXDB 2MBGA 5LHGB 4NUVA 4MBQA 3FBZA 4BJNA 4FI5A 4B6XA 5JRCA 4GIWA 4H63V 2KWIB 2VKJA 2YEVC 3IBPA 4H9RC 1U5PA 3P8CD 2WMNA 3MA9A 4P09A 1ZV4X 1LVKA 2A3DA 4MHCA 2L3LA 3Q9DA 4TV8E 2C5KT 2XAJB 3SWHA 4EXTA 2IC9A 3N2GE 1WLXA 3CMLA 2X51A 2K5BB 4AQFC 2GK9A 3VHLA 3N9MA 4I43B 4E7SA 4CXXA 4UF0B 4OHFA 4F6RC 5ETWA 2W0GA 1MMAA 4O2BE 2MYSA 5HWXA 4YLHA 3ZCIA 3LG7A 4H9SE 5ADXL 4TUYE 3K8PC 1BR4A 4OYJA 4KBMB 2LT3A 2LE8A 3AVSA 3HR0A 4YHJA 3RC3A 3RYIE 2NTXA 1O3XA 3VU7H 4UELA 4PNIA 4X1YE 5J2TE 4IGUA 3KV6A 3A5XA 2L9QA 2YU1A 2DWGA 3VKHA 4XZCA 3F31A 1UX4A 4PJLA 4CXYA 1U4QA 2X68A 3LFMA 2CWOA 2D2SA 4UVCB 4IE6A 2WSSV 3O1HA 5FXVA 4ASKA 2WMOA 4K0UA 5J2UE 4ZOLE 4ZI3D 4OK0A 1BR2A 4ZHQE 2IAKA 4PFOA 2MTQA 5FY0A 2NP9A 1G73A 2CMRA 3B13A 2E9XB 4WNKA 4U72A 1T98A 2C5JA 4MFRA 3RYCE 3ZMTB 4CI3B 1ZHCA 3UUNA 5LHHB 3SS1A 2N9DA 2RP4A 2BDEA 3GN5B 3ANWB 3H3AA 2CWYA 3ZC1A 4AI6A 4XAXB 4CXWA 2XASB 3BQIA 5LHIB 3KV4A 5HXCA 3J9X1 2CLYC 2H7VC 3ONXA 4KP3C 3Q2MA 4JLEA 2X66A 2CM0A 5LJNA 1WYBA 3O4XE 5LGNB 5E0OA 4HGAA 5L3GB 4AKIA 5J1GA 3RRWA 3HA4A 2E9XD 2NWBA 5LCYA 5JDGA 4GK5E 3ZN1B 3C64A 4OYKA 4C90A 3VKGA 3LK42 3N9QA 5HXEA 5FYMA 2CXLA 2QGSA 1SHZC 1LRZA 2E9XA 3V5UA 5HWYA 5JDHA 5JDQA 2W61A 5LA6E 5A1LA 2V7JA 4PJMA 5TAOA 4O4IE 2A72A 2PJQA 2ES0A 3FXEB 3KVBA 3GN5A 3ANWA 3JC6C 3N2OA 3E08A 4HN9A 3N9LA 5IYZE 2LSGA 3U78A 5LYJE 4P0BA 4WBNE 5H6QB 2B1EA 4GOUA 1CUNA 2ZM0A 2DWKA 2Q9QC 1FEWA 4CQIA 5LG4A 2V1DB 3MZKB 5JDLA 2X0LB 4JEUB 4TX5A 4CZZB 2D5UA 2NTYA 3CQGB 1LVFA 2V7IA 3ZMVB 2K24A 2ODUA 5IHYA 1MIVA 1S35A 3HL6A 3UULA 4H9QC 5LXTE 1UX5A 5HAXA 2C5IT 2BZBA 3CKDA 4QHOA 3CX6B 4A56A 4BJMA 4I55E 3L09A 5L3EB 3AA6B 3K3OA 4GK0E 5L3FB 4FJOA 3PUSA 4ZS2A 2LSYA 2YINA 3NRYA 3LK2B 2Y6XA 5AFUL 4HFVA 3MACA 2XTLA 2WM9A 5FNVE 3ZYKA 5FMNA 4C91A 3AA7B 5CA0E 5FY7A 2D0UA 4CI2B 2H7OA 1KNZA 2BVLA 4BAYB 4TZ4C 2V7KA 4I50E 4IE7A 1MIWA 3BQKA 3EUHA 4E7ZA 1FIOA 4O8SA 2OA5A 3E22E 4ISSA 5LP6E 4PFPA 1FMVA 3D0TA 3HI2A 2VKHA 5HXRA 2D0TA 4AQGA 2DNXA 5KDMC 2QA7A 3OBVE 4L0RA 4WBOA 2LM9A 1EZ3A 4AXPA 1H7CA 5JVDE 3I9YA 2LHNA 3OYXA 1WR6A 3RPUA 1MNEA 5DQWA 2ZLYA 1S94A 2JRKA 3NBXX 3ZYLA 2CA5A 3RX6A 2RA1A 4MALA 4DO0A 3DJBA 3AA1B 4GYRA 4ZI3C 3ETUA 4H9NC 4QKNA 3RKOA 3SRZA 5LGTB 3PTRB 5C8YE 1YW0A 5LOVE 5DABA 3GMIA 4ERRA 5H6RB 2WAUA 4ZI2C 2LJLA 4OFZA 2Y8DA 4O4JE 4G63A 5L3BB 4L9IA 3PURA 2WWUA 1D1CA 1D0YA 1IAPA 2EHOB 3ZEFB 4MLKA 4UXNB 4WW0A 2KXPB 3UUXB 2V7LA 5KX5E 5DQVA 1HFAA 2X9HA 5JDNA 3ESLA 1WRDA 4YFSA 3CQCB 4TV9E 4EIWA 1US7B 1QUUA 5FXZA 2CCQA 3KINB 1ZKEA 2E9XC 4ILUA 3U3IA 4PAGA 4EOZB 3UUMA 3B57A 5JR9A 4H9OC 4AKLA 4BA9A 3I0QA 2EHOD 2X67A 2A2FX 3C51A 3OYZA 3NZQA 5L3DB 3ZLIA 2XAQB 4ZI7E 1WYCA 3DP7A 3HKBE 3I9WA 2YK0A 4TN7B 4H63H 2LSIA 2CXDA 2XAFB 2XUEA 2N2NA 2EHOA 3O1IA 1D1AA 2HPLA 2BVMA 4ANJA 5KMGP 4HEAA 1BR1A 4YJ3E 3E0ZA 4JEHB 1MNDA 4DBRA 2UXXB 1UCUA 4HKAA 2DLRA 2MOZA 2XHEB 4O2AE 3IF8B 1MIYA 4G2AA 2LSJA 1Y64B 3QUJA 5FXXA 4UV8B 4M1PA 2LOPA 4IDZA 4CI1B 4GYSA 2XAGB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZJ1 A;  3ZJ2 A;  5L2L A;  2LHN A; 
#chains in the Genus database with same CATH topology
 1IZN B;  2BKP A;  1VCT A;  2WU5 A;  3ZMU B;  5FXW A;  2YDQ A;  1YXR A;  2VWA A;  5EK2 A;  5HYA A;  3PUA A;  4HWD A;  3M65 A;  1B7T A;  3ONL C;  3R84 B;  5C2T A;  3LBX A;  1MMD A;  3N9N A;  3BQL A;  4QX7 B;  2ZM6 T;  1HG5 A;  3KV9 A;  2HHH T;  3C98 B;  4NXN T;  4DUY T;  4QH4 A;  1HF8 A;  1N34 T;  4DBQ A;  3PV0 F;  2Y48 B;  4EZH A;  3C50 A;  2JQK A;  3RH3 A;  3F57 A;  3AEE A;  1SUM B;  5LG3 A;  3UFE A;  2KLQ A;  2XSB A;  4EYU A;  3I0O A;  3FB2 A;  3C4X A;  4X1K E;  3PUW F;  3R6N A;  1XNQ T;  3TLS A;  1G8X A;  4LFC T;  5JR9 B;  5JH7 E;  2LOS A;  1SE7 A;  4DMW A;  3EVY A;  3LK3 B;  2NOX A;  2XQ8 A;  4O4H E;  2LEH A;  2JQQ A;  3CX7 B;  1YQ4 A;  2I59 A;  2NW8 A;  4YTN A;  5JQG E;  3ZKR A;  2K3W A;  2NW7 A;  4YSX A;  4UR9 A;  2VK9 A;  4ADZ A;  1NEK A;  4HTE A;  5BR8 T;  4PJN A;  5FY1 A;  3L39 A;  3WAJ A;  4PK6 A;  3EDV A;  1IJ6 A;  1OWA A;  3C4Z A;  5L2L A;  5ABE A;  2YU2 A;  2I6H A;  4XBF B;  2AE9 A;  2YOE A;  2C0S A;  3TKL B;  1E7P A;  2JMH A;  4KI0 F;  4IL4 A;  2XPK A;  4IST A;  5EK4 A;  1SA0 E;  3CIR A;  2CXF A;  5ABH A;  3AE2 A;  4YJ2 E;  5JRC B;  1MMN A;  4DV2 T;  3K3Q C;  5JDM A;  4JI1 T;  4X66 T;  2XQ5 A;  5ABG A;  5HEG A;  5CB4 E;  4EB6 E;  2IC6 A;  1UGO A;  4JUY A;  2MBG A;  5LHG B;  1UUR A;  3G06 A;  3TLU A;  2YEV C;  4NPP A;  2I0M A;  3P8C D;  2WMN A;  2H89 A;  4MHC A;  2L3L A;  2C5K T;  3SWH A;  3JCF A;  2IC9 A;  3CML A;  4GKJ T;  4HWI B;  4DV7 T;  1IBK T;  4OHF A;  4DV4 T;  4F6R C;  5ETW A;  4YLH A;  3PUX F;  5ADX L;  3K8P C;  3SFE A;  4IDN A;  3RC3 A;  3VU7 H;  4UEL A;  4X1Y E;  3A5X A;  3VKH A;  1U4Q A;  2FJA A;  2WSS V;  2WMO A;  5J2U E;  2X0H A;  4OK0 A;  4PFO A;  4U72 A;  4MFR A;  4CI3 B;  3UUN A;  2N9D A;  2BDE A;  3ANW B;  3H3A A;  2HN1 A;  4XAX B;  2VVN A;  2XAS B;  3ZT6 A;  3J9X 1;  4KP3 C;  3M3Z B;  4AKI A;  5J1G A;  4AIS A;  3RRW A;  2E9X D;  4JI6 T;  5JDG A;  4B3R T;  3C64 A;  4OYK A;  5HXE A;  4ZEY A;  4IDQ A;  3V5U A;  3QB5 K;  4DV5 T;  5FKY A;  5LA6 E;  4PJM A;  1N36 T;  3E08 A;  2CBJ A;  5LYJ E;  4P0B A;  2XQ6 A;  5H6Q B;  2W2U A;  2Q9Q C;  1FEW A;  4CQI A;  5HEU A;  3PJA A;  2K24 A;  3Q5E A;  3HL6 A;  2UXD T;  2C5I T;  3CKD A;  4Z90 A;  5FL0 A;  1Y01 A;  4JBW F;  5L3E B;  3K3O A;  2YIN A;  3NRY A;  3LK2 B;  4HFV A;  5CA0 E;  4C91 A;  5FY7 A;  2WDQ A;  5AQU B;  4BAY B;  1WFD A;  4IE7 A;  3EUH A;  4DR7 T;  2W66 A;  2LRL A;  2OA5 A;  4WZX A;  4U31 A;  5AQF B;  1FMV A;  4X62 T;  2DNX A;  4A98 A;  1HR0 T;  5JVD E;  3OYX A;  1WR6 A;  4EEB A;  5DQW A;  2ZLY A;  1OED C;  2AXD S;  1XDO A;  2RA1 A;  2WP9 A;  3PTR B;  3GMI A;  3AEG A;  2B76 A;  2M6B A;  3PUR A;  2WWU A;  1D1C A;  5AQT B;  1D0Y A;  4WW0 A;  3UUX B;  2V7L A;  4X65 T;  1HFA A;  2X9H A;  1US7 B;  4IL9 A;  1QUU A;  2E9X C;  5ABF B;  3UUM A;  1JNR A;  2X67 A;  3PUY F;  2WZH A;  5L3D B;  2XAQ B;  2YK0 A;  4TN7 B;  4H63 H;  4LF5 T;  2XUE A;  3EAM A;  4HEA A;  3EAB A;  4O2A E;  4DV1 T;  3QUJ A;  2X0Y A;  4UV8 B;  4HFD A;  4DR4 T;  2LOP A;  3P50 A;  4GYS A;  2BG9 E;  4PJJ A;  3UUB A;  3LDQ B;  5LMU T;  1VOM A;  5JRE A;  2BS2 A;  3V5S A;  2XQY A;  2UUC T;  5CA1 E;  4AKH A;  1KFY A;  2XQ9 A;  2VB6 A;  4JI3 T;  3QK6 A;  4WYV A;  2PG8 A;  3VRB A;  1X79 A;  3WAK A;  2IUB A;  3AAA B;  3PU3 A;  2YDS A;  2ZM8 A;  2XAH B;  2J62 A;  2DHR A;  2FJB A;  1VCS A;  2KWH A;  2UXC T;  1HX8 A;  4KMC A;  2K48 A;  1J1J A;  5LNK A;  3C4W A;  4QXB B;  4ZS3 A;  5C3J A;  2QVA A;  2ZM2 A;  3OVU A;  3PUG A;  2M67 A;  3IEE A;  1W09 A;  2X9W A;  4DR6 T;  1FMW A;  4PK5 A;  2PFV A;  1YKH B;  2FUP A;  1D0Z A;  5AQQ B;  3RYH E;  2CRB A;  3HKD E;  2G0U A;  2WQY A;  5L4H A;  3L3P A;  1OXZ A;  3F2E A;  5JR9 C;  1CHU A;  3RIU C;  3HKE E;  2FBW A;  4DID B;  4LML A;  3GA8 A;  4Z8X A;  3QB5 A;  3GWH A;  4UF0 A;  1L0V A;  4LF9 T;  2IHR 1;  4IIJ E;  5AQP B;  3ZJ2 A;  3QNU A;  5FP3 A;  2W00 A;  5EZY E;  4I4T E;  2WDV A;  4X5T A;  3KBT A;  4KHP T;  1NEN A;  4U74 A;  2YN6 A;  3J7Y q;  3ZJ1 A;  2HH7 A;  3CVR A;  2WWV A;  2X9Y A;  4CN4 A;  4H9P C;  1ZEE A;  3T1H T;  1HCI A;  4N78 D;  2H3R A;  4AKR B;  3I1A A;  2LM2 A;  4KUM B;  4YSZ A;  2ZMA A;  3K3N A;  1KNP A;  2X9X A;  2DI4 A;  1T7S A;  3ZN0 B;  2JMK A;  1T72 A;  5DJQ C;  2JJ9 A;  3AA0 B;  4LMK A;  5HXH A;  4IE0 A;  4EYY R;  3MJX A;  3ZSS A;  2J1D G;  3Q5D A;  2Q9Q A;  5CJ5 A;  3AE8 A;  5L3C B;  3FBL A;  3UTK A;  2W63 A;  2DCF A;  4U33 A;  3RHW A;  4NUV A;  4MBQ A;  3FBZ A;  4BJN A;  4FI5 A;  2YKS A;  4H63 V;  2VKJ A;  1U5P A;  2QYW A;  4P09 A;  1LVK A;  4TV8 E;  4DR5 T;  1WLX A;  4AQF C;  2K5B B;  5J0Z A;  3AE4 A;  2W0G A;  3AEF A;  4JI5 T;  5HWX A;  4H9S E;  4LMJ A;  2LT3 A;  2LE8 A;  3AVS A;  4TWF A;  4HWC A;  2OLT A;  1O3X A;  4DV6 T;  2CBI A;  5J2T E;  4IGU A;  3H3M A;  3KV6 A;  3UU5 A;  3AE9 A;  3F31 A;  1XDP A;  4PJL A;  2X68 A;  3LFM A;  1XWM A;  4ZOL E;  4YTP A;  4ZHQ E;  1OED A;  2IAK A;  1G73 A;  3RYC E;  1WCR A;  2LLY A;  3SS1 A;  4LF7 T;  5LHI B;  2CLY C;  3VR8 A;  1UUS A;  2WB5 A;  3Q2M A;  3P4S A;  5E0O A;  3HA4 A;  1W9R A;  2NWB A;  2D9D A;  5LCY A;  3EHZ A;  3ZN1 B;  3VKG A;  2E9X A;  5HWY A;  2W61 A;  2XZE A;  5A1L A;  3KVB A;  2V5D A;  5IYZ E;  2LSG A;  2OV9 A;  2ZM0 A;  5LG4 A;  3P4W A;  4CZZ B;  2NTY A;  1M62 A;  1LVF A;  3CQG B;  2V7I A;  3ZMV B;  4H9Q C;  4QHO A;  3AA6 B;  4GK0 E;  5L3F B;  4FJO A;  3AXJ B;  2LSY A;  5F5W A;  5HCM A;  5IUX A;  2RPA A;  2VL0 A;  3MAC A;  2V6Y A;  4CI2 B;  1KNZ A;  2CHN A;  4X64 T;  2V7K A;  4I50 E;  5AQS B;  3RI5 A;  3QOF A;  4PFP A;  2VKH A;  2XM1 A;  2QA7 A;  3PUZ F;  4DR3 T;  4JI7 T;  1MNE A;  2WCA A;  3RQU A;  1S94 A;  2JRK A;  2CA5 A;  3DJB A;  4TWD A;  4GYR A;  4H9N C;  5DAB A;  5H6R B;  2CHO A;  4HWH A;  2Y8D A;  3RIA A;  4L9I A;  1IAP A;  2BG9 C;  4UXN B;  5KX5 E;  1WRD A;  5FXZ A;  3KIN B;  1ZKE A;  1HNX T;  1X9B A;  3U3I A;  2NR4 A;  5JR9 A;  2IML A;  4AKL A;  4BA9 A;  3RIU A;  2EHO D;  5L47 A;  4ZI7 E;  3HKB E;  3I9W A;  1D1A A;  2HPL A;  4ANJ A;  4YJ3 E;  3T1Y T;  4TNV A;  3TLV A;  1J5E T;  3K1S A;  3IF8 B;  3SFD A;  3UFG A;  3CX8 B;  2HN2 A;  3AE7 A;  1KF6 A;  4YT0 A;  4QWN B;  3JAE A;  3DTO A;  3TLT A;  3UT5 E;  5F3J A;  4X1I E;  5LBM A;  3ZC0 A;  5F8P A;  5GON E;  3O1J A;  3H37 A;  1E1H B;  3AE6 A;  3PU8 A;  3UU8 A;  2LKH A;  3JC6 D;  1HS7 A;  1VRB A;  4F8H A;  2W62 A;  3N9P A;  1D1B A;  5LMN T;  1W0B A;  2FJE A;  4O4L E;  4J2C A;  5LGU B;  2KZ7 B;  3ZMZ B;  4ZZB A;  1JNZ A;  3RRC A;  5AQN B;  2PBI A;  2A9U A;  2VAS A;  4UEM A;  4HE8 A;  2LHR A;  3PDY A;  1KK7 A;  3AE3 A;  5AQM B;  3UU3 A;  3MXZ A;  2UU9 T;  2W67 A;  2HPJ A;  1V9D A;  3ZMS B;  3AAI A;  3OJA A;  2WBL A;  4U2Z A;  1HG2 A;  2KMF A;  4AQF A;  3LJC A;  4V1A v;  2XM2 A;  3P4R A;  2PTF A;  2MPK A;  4EGW A;  4ZXL A;  2Z6E A;  1HTJ F;  2EHO C;  2V26 A;  4OX9 T;  4YY3 T;  3W15 B;  3Q5X A;  3CQX C;  4LF4 T;  1AJ3 A;  3FHN A;  3AVR A;  5HEH A;  2XY8 B;  2XQ7 A;  4K0K T;  2BKO A;  4U2Y A;  3UU4 A;  3MKD A;  2YDR A;  3P7I A;  2VQE T;  4NXM T;  4ILC A;  4ZI2 D;  5AQV B;  3LSV A;  3FZF B;  3FZL B;  1NAF A;  3ZPO A;  3KV5 A;  4IE4 A;  3EI0 A;  4UVB B;  4LFB T;  4HFI A;  1XNR T;  2JPF A;  4KX6 A;  5M4Y A;  5IWA T;  4X20 E;  3LBX B;  3NZP A;  1W0A A;  2XSA A;  5LJM A;  3ZYM A;  4DND A;  3N9O A;  2XJ7 A;  1KEY A;  3S4U A;  1NWM X;  2Q9Q B;  3AB3 B;  4COF A;  1YKE B;  3IA3 A;  4PW8 A;  4B3S T;  5LBQ B;  1IJ5 A;  3WI3 A;  3N2K E;  5HXS A;  2H88 A;  2ODV A;  5AQI B;  4DMV A;  3KBU A;  4NUU A;  1XMO T;  3CWZ B;  5AQL B;  4JI2 T;  4B6X A;  4YHH T;  2KWI B;  2A3D A;  3B5M A;  3Q9D A;  4EXT A;  2MAW A;  2CPT A;  2GK9 A;  3VHL A;  4NIQ A;  1E2A A;  2BS3 A;  4U7I A;  4I43 B;  3FZH B;  4CXX A;  2WU2 A;  4O2B E;  2BBH A;  3PUV F;  4OYJ A;  4KBM B;  1OED B;  3FZM B;  4YHJ A;  3RYI E;  4YSY A;  5HCJ A;  2L9Q A;  2YU1 A;  4XZC A;  1UX4 A;  4CXY A;  2CWO A;  2D2S A;  4UVC B;  4IE6 A;  1HNW T;  4HWF A;  3ZST A;  5FXV A;  4ASK A;  4K0U A;  4ZI3 D;  1GQE A;  2V5C A;  1BR2 A;  5FY0 A;  3ABV A;  3P4Q A;  2NP9 A;  3UUL A;  2CMR A;  2E9X B;  2WY2 A;  1T98 A;  5LHH B;  2RP4 A;  2WZI A;  5HEJ A;  3KV4 A;  1M7K A;  5HXC A;  2H7V C;  3ONX A;  3JAF A;  4JLE A;  2BG9 A;  2X66 A;  2WDR A;  5LJN A;  3O4X E;  5LGN B;  4HGA A;  5AQH B;  5CGM A;  4GK5 E;  5FYM A;  2VQF T;  2CXL A;  4JI0 T;  1SHZ C;  1LRZ A;  5JDH A;  2V8S V;  3A7M A;  2A72 A;  1J5W A;  2ES0 A;  3N2O A;  3GN5 A;  4HN9 A;  3N9L A;  3U78 A;  2QRX A;  4WBN E;  1XZY A;  2DWK A;  4HFB A;  2V6Y B;  2V1D B;  5JDL A;  2X0L B;  4TX5 A;  1ZP0 A;  2XQA A;  5IHY A;  2JIW A;  1S35 A;  1N33 T;  5AQK B;  2BZB A;  3L09 A;  2XQ3 A;  4U7Y A;  3PUS A;  4ZS2 A;  2Y6X A;  5AFU L;  4IT4 A;  5CFB A;  2WM9 A;  5FMN A;  3AA7 B;  2D0U A;  2R6G F;  4ILA A;  4B3M T;  1KNR A;  4TZ4 C;  1MIW A;  3BQK A;  1FIO A;  4O8S A;  3D0T A;  2F4V T;  3HI2 A;  5HXR A;  2D0T A;  2ACZ A;  5KDM C;  4HFC A;  3OBV E;  4WBO A;  1IBL T;  4IDP A;  1EZ3 A;  4AXP A;  1H7C A;  2LRK A;  3I9Y A;  2LHN A;  3NBX X;  5FVL A;  4Z91 A;  4MAL A;  1N32 T;  2FJD A;  3AA1 B;  1ZOY A;  4ZI3 C;  3RKO A;  5LGT B;  1FJG T;  1YW0 A;  5LOV E;  2WAU A;  4OFZ A;  5JTG A;  1R8I A;  2BS4 A;  4G63 A;  3NWI A;  2UUA T;  3ZT7 A;  3ZEF B;  3AE1 A;  4MLK A;  3CQC B;  4TV9 E;  4ILU A;  4PAG A;  4EOZ B;  1XMQ T;  4ZZC A;  3L8R A;  3OYZ A;  3NZQ A;  3ZLI A;  4QH1 A;  5KXJ A;  1WYC A;  3DP7 A;  4QH5 A;  2LSI A;  2E5V A;  2XAF B;  2EHO A;  3AE5 A;  2BVM A;  4DBR A;  4JEH B;  1MND A;  4TWH A;  2UXX B;  4HKA A;  2XHE B;  2UXB T;  4M1P A;  4CI1 B;  2DL1 A;  2IDO B;  3QC9 A;  5AQG B;  1YD8 G;  3N5L A;  3AEA A;  1MMG A;  2IW5 B;  4AKG A;  4I0U A;  4PK4 A;  2P9B A;  3P4P A;  3AEB A;  1BR0 A;  2J4G A;  5AQR B;  5FL1 A;  1IBM T;  2Q9Q D;  2V6X A;  3O9X A;  2CEA A;  3EDU A;  4L5G A;  4A5X A;  1YQ3 A;  4Q25 A;  3ONJ A;  2VKO A;  3OKQ A;  2E2A A;  2VL8 A;  3ETV A;  2N1G A;  3NRX A;  4DV3 T;  4IHJ E;  3IHR A;  4QX8 B;  2J47 A;  4TNW A;  2SPC A;  4P0A A;  3AAE B;  2IIU A;  3Q5W A;  4UV9 B;  3VR9 A;  2UXN B;  4EAH A;  3SOL A;  3RC8 A;  3KFW X;  3VRA A;  5BMV E;  4AQY T;  4YTM A;  4LF6 T;  1I6Z A;  3FZK B;  2V7M A;  4IE5 A;  3KDS E;  2KIN B;  3RYF E;  4A97 A;  3NVO A;  2ACX A;  3MK7 C;  1HNZ T;  2CLY B;  2W4X A;  2CE7 A;  3PE0 A;  2NW9 A;  1LKX A;  1QSD A;  3PUQ A;  3BK9 A;  3RLF F;  3KVA A;  4EED A;  1Z0P A;  3ZCJ A;  4DR2 T;  4UVA B;  4EZ4 A;  2LKG A;  3T8O A;  3HKC E;  4QXH B;  3UQ4 A;  3RIF A;  2LSK A;  5EK3 A;  2K9A A;  4UIG A;  2BKN A;  4QXC B;  3RGL A;  2E5L T;  5JDF A;  1D0X A;  2KND A;  3CPZ A;  3AEC A;  2E8I A;  2BBJ A;  4LF8 T;  2L8K A;  3A8Y C;  2KT9 A;  2VKD A;  4DVD A;  3CK6 A;  3FXD B;  4P1N A;  5JRC A;  4GIW A;  1QLB A;  3IBP A;  4H9R C;  3MA9 A;  1ZV4 X;  2XAJ B;  3N2G E;  2X51 A;  3N9M A;  4JV5 T;  4DV0 T;  4CN1 A;  4E7S A;  4UF0 B;  4LFA T;  1MMA A;  2MYS A;  2WS3 A;  4DR1 T;  3ZCI A;  3LG7 A;  4TUY E;  1BR4 A;  3AXJ A;  3HR0 A;  5FVK A;  2NTX A;  3PJA J;  3AED A;  4B3T T;  4PNI A;  5AQJ B;  4U3C A;  4JI4 T;  2DWG A;  5HEO A;  3X1D A;  2BG9 B;  3O1H A;  3JAD A;  1I94 T;  2XQ4 A;  4IRE A;  2MTQ A;  3B13 A;  4WNK A;  3ZMT B;  2C5J A;  1ZHC A;  3GN5 B;  2CWY A;  3ZC1 A;  4AI6 A;  4CXW A;  2VUR A;  3BQI A;  2CM0 A;  1WYB A;  5L3G B;  5L4E A;  3OPC A;  4IDO A;  4HFE A;  4C90 A;  3LK4 2;  3N9Q A;  2QGS A;  2JQ9 A;  4YXD A;  2UUB T;  5JDQ A;  2V7J A;  5TAO A;  4O4I E;  2PJQ A;  3FXE B;  3JC6 C;  3ANW A;  3OTO T;  1DU2 A;  4HFH A;  2B1E A;  4GOU A;  1CUN A;  3MZK B;  4JEU B;  1HX1 B;  2D5U A;  4AIU A;  2ODU A;  1MIV A;  5LXT E;  1UX5 A;  5HAX A;  3CX6 B;  3UU6 A;  4A56 A;  4BJM A;  4I55 E;  2XTL A;  5FNV E;  3ZYK A;  2H7O A;  2BVL A;  4JI8 T;  4E7Z A;  3E22 E;  4ISS A;  5LP6 E;  4AQG A;  2JQH A;  4L0R A;  2LM9 A;  3TLW A;  3RPU A;  3ZT5 A;  3ZYL A;  3RX6 A;  4DO0 A;  3RKG A;  3ETU A;  5LB7 B;  4QKN A;  3UQ7 A;  3RF1 A;  3SRZ A;  3NKZ A;  5C8Y E;  4ERR A;  4ZI2 C;  2LJL A;  4O4J E;  5L3B B;  4GKK T;  5AQO B;  2EHO B;  4CN6 A;  4EV6 A;  2KXP B;  2M6I A;  5DQV A;  5JDN A;  3ESL A;  4YFS A;  4JYA T;  4EIW A;  2CCQ A;  4DUZ T;  3B57 A;  4H9O C;  4ILB A;  3I0Q A;  3RQW A;  2A2F X;  1Z8U A;  2KSR A;  2VVS A;  3C51 A;  2CXD A;  2N2N A;  1OED E;  1UK5 A;  3O1I A;  5KMG P;  1BR1 A;  3E0Z A;  1T8B A;  1UCU A;  2DLR A;  2MOZ A;  1MIY A;  4G2A A;  2LSJ A;  1WR0 A;  1Y64 B;  5FXX A;  5ABF A;  4IDZ A;  4KHZ F;  2XAG B; 
#chains in the Genus database with same CATH homology
 4PJJ A;  1IZN B;  3QC9 A;  3CX8 B;  1YD8 G;  3N5L A;  1MMG A;  1VOM A;  2IW5 B;  5JRE A;  4AKG A;  3V5S A;  2XQY A;  4QWN B;  3ZMU B;  3DTO A;  5CA1 E;  4PK4 A;  3UT5 E;  4X1I E;  5F3J A;  5LBM A;  3ZC0 A;  4AKH A;  5F8P A;  2P9B A;  5GON E;  2VB6 A;  3O1J A;  5FXW A;  3H37 A;  1E1H B;  2VWA A;  3PU8 A;  3QK6 A;  5EK2 A;  5HYA A;  3PUA A;  3M65 A;  1B7T A;  3JC6 D;  3R84 B;  1HS7 A;  1BR0 A;  1VRB A;  2PG8 A;  3LBX A;  1MMD A;  1X79 A;  3WAK A;  3N9N A;  3AAA B;  3PU3 A;  3BQL A;  2W62 A;  3N9P A;  1D1B A;  2Q9Q D;  4QX7 B;  2ZM8 A;  2XAH B;  1HG5 A;  3KV9 A;  3O9X A;  3C98 B;  4O4L E;  2CEA A;  3EDU A;  4L5G A;  2DHR A;  4J2C A;  5LGU B;  2KWH A;  2KZ7 B;  3ZMZ B;  1HF8 A;  1HX8 A;  4KMC A;  4DBQ A;  2K48 A;  2VKO A;  3RRC A;  5LNK A;  3C4W A;  2PBI A;  3OKQ A;  2Y48 B;  4QXB B;  4EZH A;  2VL8 A;  3C50 A;  4ZS3 A;  2VAS A;  4UEM A;  4HE8 A;  3ETV A;  2N1G A;  3RH3 A;  2ZM2 A;  3F57 A;  3NRX A;  4IHJ E;  3PUG A;  2M67 A;  3IHR A;  2LHR A;  4QX8 B;  3UFE A;  3IEE A;  2X9W A;  2KLQ A;  2SPC A;  1FMW A;  3PDY A;  4PK5 A;  4P0A A;  4EYU A;  3I0O A;  3FB2 A;  1KK7 A;  2PFV A;  3C4X A;  4X1K E;  3R6N A;  1YKH B;  3MXZ A;  3AAE B;  1G8X A;  5JR9 B;  1D0Z A;  2HPJ A;  1V9D A;  3RYH E;  3ZMS B;  3AAI A;  3OJA A;  5JH7 E;  2WBL A;  3Q5W A;  4UV9 B;  2LOS A;  1HG2 A;  2UXN B;  3HKD E;  2KMF A;  2G0U A;  3SOL A;  4AQF A;  3LJC A;  4V1A v;  4DMW A;  3L3P A;  4EAH A;  1OXZ A;  3EVY A;  3KFW X;  3LK3 B;  3F2E A;  5JR9 C;  3RC8 A;  2NOX A;  5BMV E;  4O4H E;  2LEH A;  2JQQ A;  3HKE E;  3CX7 B;  2I59 A;  2NW8 A;  3GA8 A;  4Z8X A;  5JQG E;  2Z6E A;  1HTJ F;  2EHO C;  2NW7 A;  3GWH A;  2V26 A;  4UF0 A;  3W15 B;  3Q5X A;  2VK9 A;  2V7M A;  3CQX C;  4ADZ A;  4IE5 A;  1AJ3 A;  3FHN A;  3AVR A;  4IIJ E;  3ZJ2 A;  5FP3 A;  2W00 A;  3KDS E;  3MKD A;  4I4T E;  5EZY E;  3P7I A;  2KIN B;  3KBT A;  3RYF E;  4HTE A;  4U74 A;  2ACX A;  4ZI2 D;  4PJN A;  3MK7 C;  5FY1 A;  3J7Y q;  2CLY B;  3WAJ A;  4PK6 A;  3ZJ1 A;  2HH7 A;  3CVR A;  3EDV A;  2X9Y A;  1NAF A;  1IJ6 A;  2CE7 A;  3ZPO A;  3PE0 A;  3KV5 A;  4IE4 A;  2NW9 A;  1OWA A;  1LKX A;  4UVB B;  3C4Z A;  1QSD A;  3PUQ A;  3BK9 A;  2JPF A;  5M4Y A;  4H9P C;  1ZEE A;  3KVA A;  1HCI A;  4N78 D;  4X20 E;  1Z0P A;  2H3R A;  3LBX B;  4AKR B;  5L2L A;  3NZP A;  3ZCJ A;  2YU2 A;  4UVA B;  4XBF B;  4EZ4 A;  5LJM A;  3I1A A;  2C0S A;  3TKL B;  3ZYM A;  4DND A;  3T8O A;  3HKC E;  4KUM B;  2JMH A;  3N9O A;  4QXH B;  4IST A;  5EK4 A;  1NWM X;  1SA0 E;  2Q9Q B;  3S4U A;  2CXF A;  3AB3 B;  2ZMA A;  3K3N A;  2LSK A;  4YJ2 E;  1YKE B;  2X9X A;  4PW8 A;  5JRC B;  5EK3 A;  2DI4 A;  2K9A A;  1MMN A;  5LBQ B;  4UIG A;  1IJ5 A;  4QXC B;  3ZN0 B;  3K3Q C;  2JMK A;  5JDM A;  5JDF A;  3WI3 A;  1D0X A;  2KND A;  5DJQ C;  2JJ9 A;  3AA0 B;  3CPZ A;  5HXH A;  2E8I A;  4IE0 A;  4EYY R;  3N2K E;  5CB4 E;  5HXS A;  3MJX A;  2ODV A;  2J1D G;  4DMV A;  4EB6 E;  2IC6 A;  2Q9Q A;  2L8K A;  5L3C B;  3KBU A;  3FBL A;  4NUU A;  3UTK A;  2W63 A;  2KT9 A;  2DCF A;  2VKD A;  4DVD A;  4JUY A;  3CWZ B;  3FXD B;  2MBG A;  5LHG B;  4NUV A;  4MBQ A;  3FBZ A;  4BJN A;  4FI5 A;  4B6X A;  5JRC A;  4GIW A;  4H63 V;  2KWI B;  2VKJ A;  2YEV C;  3IBP A;  4H9R C;  1U5P A;  3P8C D;  2WMN A;  3MA9 A;  4P09 A;  1ZV4 X;  1LVK A;  2A3D A;  4MHC A;  2L3L A;  3Q9D A;  4TV8 E;  2C5K T;  2XAJ B;  3SWH A;  4EXT A;  2IC9 A;  3N2G E;  1WLX A;  3CML A;  2X51 A;  2K5B B;  4AQF C;  2GK9 A;  3VHL A;  3N9M A;  4I43 B;  4E7S A;  4CXX A;  4UF0 B;  4OHF A;  4F6R C;  5ETW A;  2W0G A;  1MMA A;  4O2B E;  2MYS A;  5HWX A;  4YLH A;  3ZCI A;  3LG7 A;  4H9S E;  5ADX L;  4TUY E;  3K8P C;  1BR4 A;  4OYJ A;  4KBM B;  2LT3 A;  2LE8 A;  3AVS A;  3HR0 A;  4YHJ A;  3RC3 A;  3RYI E;  2NTX A;  1O3X A;  3VU7 H;  4UEL A;  4PNI A;  4X1Y E;  5J2T E;  4IGU A;  3KV6 A;  3A5X A;  2L9Q A;  2YU1 A;  2DWG A;  3VKH A;  4XZC A;  3F31 A;  1UX4 A;  4PJL A;  4CXY A;  1U4Q A;  2X68 A;  3LFM A;  2CWO A;  2D2S A;  4UVC B;  4IE6 A;  2WSS V;  3O1H A;  5FXV A;  4ASK A;  2WMO A;  4K0U A;  5J2U E;  4ZOL E;  4ZI3 D;  4OK0 A;  1BR2 A;  4ZHQ E;  2IAK A;  4PFO A;  2MTQ A;  5FY0 A;  2NP9 A;  1G73 A;  2CMR A;  3B13 A;  2E9X B;  4WNK A;  4U72 A;  1T98 A;  2C5J A;  4MFR A;  3RYC E;  3ZMT B;  4CI3 B;  1ZHC A;  3UUN A;  5LHH B;  3SS1 A;  2N9D A;  2RP4 A;  2BDE A;  3GN5 B;  3ANW B;  3H3A A;  2CWY A;  3ZC1 A;  4AI6 A;  4XAX B;  4CXW A;  2XAS B;  3BQI A;  5LHI B;  3KV4 A;  5HXC A;  3J9X 1;  2CLY C;  2H7V C;  3ONX A;  4KP3 C;  3Q2M A;  4JLE A;  2X66 A;  2CM0 A;  5LJN A;  1WYB A;  3O4X E;  5LGN B;  5E0O A;  4HGA A;  5L3G B;  4AKI A;  5J1G A;  3RRW A;  3HA4 A;  2E9X D;  2NWB A;  5LCY A;  5JDG A;  4GK5 E;  3ZN1 B;  3C64 A;  4OYK A;  4C90 A;  3VKG A;  3LK4 2;  3N9Q A;  5HXE A;  5FYM A;  2CXL A;  2QGS A;  1SHZ C;  1LRZ A;  2E9X A;  3V5U A;  5HWY A;  5JDH A;  5JDQ A;  2W61 A;  5LA6 E;  5A1L A;  2V7J A;  4PJM A;  5TAO A;  4O4I E;  2A72 A;  2PJQ A;  2ES0 A;  3FXE B;  3KVB A;  3GN5 A;  3ANW A;  3JC6 C;  3N2O A;  3E08 A;  4HN9 A;  3N9L A;  5IYZ E;  2LSG A;  3U78 A;  5LYJ E;  4P0B A;  4WBN E;  5H6Q B;  2B1E A;  4GOU A;  1CUN A;  2ZM0 A;  2DWK A;  2Q9Q C;  1FEW A;  4CQI A;  5LG4 A;  2V1D B;  3MZK B;  5JDL A;  2X0L B;  4JEU B;  4TX5 A;  4CZZ B;  2D5U A;  2NTY A;  3CQG B;  1LVF A;  2V7I A;  3ZMV B;  2K24 A;  2ODU A;  5IHY A;  1MIV A;  1S35 A;  3HL6 A;  3UUL A;  4H9Q C;  5LXT E;  1UX5 A;  5HAX A;  2C5I T;  2BZB A;  3CKD A;  4QHO A;  3CX6 B;  4A56 A;  4BJM A;  4I55 E;  3L09 A;  5L3E B;  3AA6 B;  3K3O A;  4GK0 E;  5L3F B;  4FJO A;  3PUS A;  4ZS2 A;  2LSY A;  2YIN A;  3NRY A;  3LK2 B;  2Y6X A;  5AFU L;  4HFV A;  3MAC A;  2XTL A;  2WM9 A;  5FNV E;  3ZYK A;  5FMN A;  4C91 A;  3AA7 B;  5CA0 E;  5FY7 A;  2D0U A;  4CI2 B;  2H7O A;  1KNZ A;  2BVL A;  4BAY B;  4TZ4 C;  2V7K A;  4I50 E;  4IE7 A;  1MIW A;  3BQK A;  3EUH A;  4E7Z A;  1FIO A;  4O8S A;  2OA5 A;  3E22 E;  4ISS A;  5LP6 E;  4PFP A;  1FMV A;  3D0T A;  3HI2 A;  2VKH A;  5HXR A;  2D0T A;  4AQG A;  2DNX A;  5KDM C;  2QA7 A;  3OBV E;  4L0R A;  4WBO A;  2LM9 A;  1EZ3 A;  4AXP A;  1H7C A;  5JVD E;  3I9Y A;  2LHN A;  3OYX A;  1WR6 A;  3RPU A;  1MNE A;  5DQW A;  2ZLY A;  1S94 A;  2JRK A;  3NBX X;  3ZYL A;  2CA5 A;  3RX6 A;  2RA1 A;  4MAL A;  4DO0 A;  3DJB A;  3AA1 B;  4GYR A;  4ZI3 C;  3ETU A;  4H9N C;  4QKN A;  3RKO A;  3SRZ A;  5LGT B;  3PTR B;  5C8Y E;  1YW0 A;  5LOV E;  5DAB A;  3GMI A;  4ERR A;  5H6R B;  2WAU A;  4ZI2 C;  2LJL A;  4OFZ A;  2Y8D A;  4O4J E;  4G63 A;  5L3B B;  4L9I A;  3PUR A;  2WWU A;  1D1C A;  1D0Y A;  1IAP A;  2EHO B;  3ZEF B;  4MLK A;  4UXN B;  4WW0 A;  2KXP B;  3UUX B;  2V7L A;  5KX5 E;  5DQV A;  1HFA A;  2X9H A;  5JDN A;  3ESL A;  1WRD A;  4YFS A;  3CQC B;  4TV9 E;  4EIW A;  1US7 B;  1QUU A;  5FXZ A;  2CCQ A;  3KIN B;  1ZKE A;  2E9X C;  4ILU A;  3U3I A;  4PAG A;  4EOZ B;  3UUM A;  3B57 A;  5JR9 A;  4H9O C;  4AKL A;  4BA9 A;  3I0Q A;  2EHO D;  2X67 A;  2A2F X;  3C51 A;  3OYZ A;  3NZQ A;  5L3D B;  3ZLI A;  2XAQ B;  4ZI7 E;  1WYC A;  3DP7 A;  3HKB E;  3I9W A;  2YK0 A;  4TN7 B;  4H63 H;  2LSI A;  2CXD A;  2XAF B;  2XUE A;  2N2N A;  2EHO A;  3O1I A;  1D1A A;  2HPL A;  2BVM A;  4ANJ A;  5KMG P;  4HEA A;  1BR1 A;  4YJ3 E;  3E0Z A;  4JEH B;  1MND A;  4DBR A;  2UXX B;  1UCU A;  4HKA A;  2DLR A;  2MOZ A;  2XHE B;  4O2A E;  3IF8 B;  1MIY A;  4G2A A;  2LSJ A;  1Y64 B;  3QUJ A;  5FXX A;  4UV8 B;  4M1P A;  2LOP A;  4IDZ A;  4CI1 B;  4GYS A;  2XAG B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...