5L2LA

Nab2 zn fingers 5-7 bound to a11g rna
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
72
structure length
72
Chain Sequence
SEKSLEQCKFGTHCTNKRCKYRHARSHIMCREGANCTRIDCLFGHPINEDCRFGVNCKNIYCLFRHPPGRVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Nab2p
publication title Structural basis for the dimerization of Nab2 generated by RNA binding provides insight into its contribution to both poly(A) tail length determination and transcript compaction in Saccharomyces cerevisiae.
pubmed doi rcsb
source organism Saccharomyces cerevisiae yjm1574
molecule tags Rna binding protein
total genus 13
structure length 72
sequence length 72
chains with identical sequence B, E, F
ec nomenclature
pdb deposition date 2016-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14608 zf-CCCH_2 RNA-binding, Nab2-type zinc finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1670 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 5l2lA00
3ZJ1A 5L2LA 2LHNA 3ZJ2A
chains in the Genus database with same CATH superfamily
3PURA 3NRXA 5LP6E 3PV0F 3AA7B 5IWAT 3IEEA 3UULA 1MNEA 4U2YA 3ZPOA 2VKOA 1QSDA 3ZSSA 1HTJF 3C4WA 5HCMA 3ZT5A 5ETWA 4TNWA 5KMGP 5HXHA 3ETUA 3H37A 2GK9A 3CPZA 4H63H 2H7VC 5CA0E 2JRKA 2W63A 5HYAA 4IDNA 1W0AA 3P50A 3QOFA 4CN4A 2V1DB 3SFEA 3J9X1 2VL8A 3V5UA 2D0TA 5LYJE 5IHYA 2H89A 2I0MA 4WBNE 2L8KA 4CXXA 3CQCB 2YN6A 1R8IA 4XAXB 4DR1T 4PJJA 1M62A 2A3DA 3AAEB 4B3ST 4WYVA 2VASA 5J1GA 1U4QA 2CRBA 2CLYC 2PBIA 5HEOA 3GA8A 1J1JA 1SHZC 4JBWF 2V8SV 3T1HT 4EB6E 1KNPA 2V6XA 3FZHB 2JQKA 4ZOLE 4DVDA 3Q5WA 3AA0B 2LM9A 4PFPA 2YINA 2YDSA 4AISA 3HI2A 3RF1A 3AVSA 1MIYA 3RIUC 1HF8A 3K3NA 3UUNA 4MFRA 1ZV4X 4LMLA 2W4XA 5C8YE 5AQPB 3RH3A 5JR9B 4O4IE 1E1HB 5JH7E 4YHJA 2YDRA 2NW9A 4Q25A 1ZOYA 3ZT6A 4YSYA 3KV9A 2W0GA 3AE8A 4BJNA 2DCFA 4P0AA 2DNXA 2WP9A 3AE4A 4TWDA 3WAJA 4LF5T 4HN9A 1FMWA 1W0BA 4ISSA 3F31A 3RKOA 4ZS3A 4CQIA 3FHNA 4JI5T 2WU2A 5EK4A 4ILAA 2KNDA 2WY2A 4U72A 5JRCB 3UU3A 3EDVA 2HPJA 3CX7B 3PJAA 2LLYA 4TNVA 4J2CA 3MKDA 2IDOB 2QRXA 3GN5A 4DIDB 5DQVA 3VRBA 3VRAA 4UVCB 4PJNA 3DJBA 5F5WA 3AE1A 1SUMB 2LSJA 3KVAA 3KBUA 4LF8T 4X5TA 1UX4A 4HFVA 4KUMB 2LHRA 5AQQB 4O4HE 2LSKA 2YEVC 2EHOD 1HNWT 4DMWA 4CXYA 3AEAA 1D1CA 4AKGA 5H6RB 2C5IT 3I0QA 5DABA 4YJ3E 5AQJB 5LHIB 3ESLA 4JI8T 3N9PA 1UX5A 3CQXC 3PUWF 5AQHB 3FBZA 4AQFA 3PUQA 4HTEA 3I1AA 3WI3A 3AEDA 5TAOA 3PJAJ 4A97A 2ZM2A 3LDQB 4JI0T 3HKCE 2WDVA 4KHPT 4GK0E 4P09A 3RIFA 5LGTB 4CI1B 3IBPA 3SOLA 3RRCA 4TWHA 4QX8B 1Z8UA 3BQIA 3MA9A 1ZHCA 3RGLA 2IC6A 4ADZA 3VKHA 1KK7A 5FXWA 1OEDC 5JDQA 4G63A 4QWNB 3PU8A 2WU5A 2X9YA 4KI0F 4U74A 1WLXA 3CMLA 4I0UA 3Q5EA 3RYFE 4QH5A 2Q9QB 3RI5A 2KZ7B 3N5LA 4CXWA 2JJ9A 5EK3A 4JV5T 5HEUA 3EUHA 4DR5T 1WR0A 3ETVA 5LBQB 2ODUA 2IIUA 2WMNA 2X67A 3ZEFB 3UUBA 4JI2T 1GQEA 4V1Av 3F2EA 5AFUL 4UV9B 3PE0A 3ZJ1A 2JMHA 5DQWA 3BQKA 4GIWA 4I4TE 2LOPA 4HFHA 3JAEA 2CMRA 1LRZA 3L39A 1E2AA 5L3BB 3VU7H 4ZHQE 5FVLA 5JDFA 5HEJA 3TLVA 1MMAA 1IAPA 4LMJA 5L3EB 1QLBA 1IBKT 3FZMB 2K3WA 5FL0A 3HKDE 3ZMUB 1E7PA 2VKDA 3O9XA 3O1IA 1UURA 2UUAT 2BG9C 5LHGB 3L09A 3BK9A 5JRCA 2BKOA 5HEGA 4XZCA 2WS3A 5LMUT 1HS7A 2L3LA 3I9WA 4AKIA 4CN6A 2X9WA 4I55E 2XAHB 2Y8DA 2CA5A 2E2AA 2MYSA 4MALA 3TLUA 3CK6A 4HFDA 2HPLA 3CVRA 4LF7T 2XSAA 5ADXL 5J0ZA 2XQ4A 4TUYE 4YSXA 2CXFA 2VKHA 4WBOA 3UUMA 4GOUA 2LKGA 5FY7A 2LRKA 4Z91A 5L4HA 3RRWA 4M1PA 1BR0A 2WMOA 4AI6A 4UVAB 2LM2A 1KFYA 3FBLA 3HA4A 2IUBA 4PNIA 5AQLB 3A5XA 2NWBA 3L8RA 5JVDE 4OK0A 2XQ5A 3ONJA 2J4GA 2UUCT 2XM1A 2CPTA 3PU3A 3ZYLA 2CHOA 1HNXT 3PUGA 2XQAA 2XZEA 3B5MA 4TV9E 4ILBA 2X9HA 4TZ4C 4IE4A 2JMKA 3C50A 5HXSA 3MXZA 2LEHA 1XMQT 4GKKT 1IBLT 3HKBE 1ZP0A 4DV3T 3NZQA 3OTOT 4E7SA 3KV5A 5M4YA 2WQYA 4L5GA 2W61A 3P7IA 1WYBA 3H3MA 4JI6T 1J5ET 3DTOA 3RQWA 5AQNB 3LBXB 2WDQA 4DV4T 1JNRA 3AAIA 1I94T 2X0YA 1N33T 5LG3A 5KDMC 5FY1A 3CX6B 4X64T 2Q9QA 3QUJA 4DO0A 2MAWA 3KDSE 5L4EA 2LJLA 1WR6A 3AE6A 3PUVF 2CM0A 2ZLYA 2N9DA 2BBJA 4N78D 4TWFA 2HHHT 3JAFA 4LFAT 4EYYR 5JQGE 2XM2A 2XPKA 2NTYA 3AEBA 2BVLA 4AQGA 4OHFA 2WCAA 2ZM0A 5LHHB 3IHRA 5KX5E 1IZNB 4H9SE 4OFZA 3O1HA 1FIOA 5LOVE 2NW8A 4EZ4A 4DV1T 1T72A 4ERRA 4WW0A 3KV4A 2RPAA 2CHNA 3OBVE 4YFSA 4IDZA 3C64A 4P1NA 4BJMA 1B7TA 4H9RC 2EHOC 1OXZA 2YK0A 4UVBB 4MBQA 2KSRA 2XY8B 1D0ZA 4O8SA 3OYZA 4CI2B 4DV2T 2M6BA 5AQRB 5AQUB 3UT5E 2Y6XA 5ABEA 5L3FB 4QXCB 4I50E 3C51A 5E0OA 4O2AE 4X1YE 3UU4A 2I59A 1HFAA 4LF9T 3RKGA 1XDOA 1FMVA 5CFBA 3KVBA 3MK7C 4DR3T 4Z90A 3HKEE 3K3OA 2E9XA 3HL6A 2R6GF 4UELA 2YOEA 4Z8XA 4JI3T 5AQFB 4DV0T 2JQ9A 5J2UE 4GK5E 5LG4A 3IA3A 3TLSA 4PJMA 2UXCT 2VK9A 5HXCA 1BR2A 3IF8B 3RHWA 3GMIA 2H3RA 1S94A 4HFEA 3UUXB 1NEKA 5CGMA 2VVSA 4EIWA 4UF0B 1UGOA 5C2TA 4K0UA 3M65A 4EYUA 5JDHA 5FKYA 2CWOA 4AKLA 2K24A 3KBTA 2WZIA 4DR6T 5FL1A 1IBMT 1S35A 3Q5DA 4WNKA 3ZN0B 4X62T 3RIAA 1X79A 3G06A 5FP3A 4PK6A 3AE7A 2ACXA 3RPUA 3JC6C 4HFBA 1CUNA 5HXRA 2W2UA 4ASKA 2E9XC 2MTQA 1OWAA 2W67A 2MOZA 3N2KE 2OV9A 4DUYT 3P4WA 4YXDA 2XQ9A 3B57A 3ZCIA 3LK2B 4DUZT 2XAFB 5IUXA 2QYWA 5LA6E 4O4LE 3A7MA 1CHUA 1D1AA 4HFIA 4MLKA 3AXJA 2LT3A 2RP4A 2E5LT 1H7CA 1NAFA 4QHOA 2UXBT 4UXNB 1ZEEA 2XQ8A 3TLTA 5AQMB 5ABFB 4QXHB 1BR4A 2Q9QD 2WBLA 1HG2A 5C3JA 2LKHA 3OJAA 3EVYA 1AJ3A 2BDEA 1T98A 5AQSB 4UEMA 5DJQC 2NOXA 4EGWA 2DLRA 4EV6A 1D0XA 1XWMA 2F4VT 4B6XA 4LMKA 4KX6A 2XJ7A 2BVMA 4TN7B 4I43B 1O3XA 2BS3A 5LXTE 1UUSA 4IIJE 3AEFA 3V5SA 1G73A 3ZJ2A 2NW7A 3UFGA 3U78A 2HN1A 3I9YA 3ZT7A 3UU5A 2BKPA 4U33A 1IJ5A 2DWKA 3OKQA 4HKAA 2CBIA 4YLHA 3NVOA 4DMVA 2FJBA 3MZKB 1YW0A 4GYRA 1NWMX 1YKHB 5F3JA 4XBFB 4L9IA 3D0TA 3AE5A 4DBRA 4EAHA 5L2LA 3RLFF 3A8YC 4AQFC 4H63V 3N2GE 5FMNA 2H88A 5LJNA 1IJ6A 2WWUA 2WWVA 4JUYA 1I6ZA 3KINB 5FYMA 2Z6EA 3N9NA 4KBMB 3JC6D 5JR9A 4U31A 2PTFA 2CLYB 3AE3A 1Z0PA 4PFOA 1JNZA 2E9XD 3P4QA 3E22E 2ZM8A 4H9PC 1YQ3A 1VCSA 1YQ4A 2XAGB 2C0SA 3ABVA 1MIWA 1OEDE 3ZKRA 4YT0A 4UF0A 2A9UA 1VRBA 4ZI7E 4NXMT 3P4RA 4JI4T 5LMNT 3JCFA 2XAJB 3K3QC 1XNQT 3SFDA 3AA1B 3ONLC 2WB5A 3ANWB 4HWIB 4IHJE 1HR0T 4HWFA 3UQ7A 4IE7A 2AXDS 1MMNA 2XASB 2PJQA 2XTLA 3ZSTA 1YXRA 3LK3B 4HGAA 2D5UA 2CCQA 3X1DA 3AAAB 3FZKB 3E08A 5JR9C 3AECA 2LE8A 3C98B 2RA1A 4NUUA 1M7KA 3N2OA 3P4PA 2VQFT 5L47A 2M67A 1D1BA 2LRLA 2IC9A 5ABFA 2VVNA 4ZS2A 4ILUA 4TX5A 3OYXA 3UTKA 2BG9E 4B3RT 1UCUA 4COFA 2KXPB 5LGUB 4U7IA 2WDRA 5LB7B 4O4JE 3RYCE 3O4XE 4CI3B 2G0UA 2XUEA 4IL4A 2YKSA 3UU8A 4DV6T 4HWDA 2FJAA 4LFBT 2XQ3A 3Q5XA 3PUZF 3RC8A 3OPCA 2BS2A 3NRYA 1N34T 5FXVA 4YSZA 5LBMA 4QH4A 1DU2A 4UV8B 5FXZA 3C4ZA 4DBQA 3EABA 1L0VA 2B1EA 4IT4A 4HFCA 4F6RC 3PTRB 4ZI2D 3PUAA 1US7B 3ZYKA 5L3DB 3C4XA 5AQOB 5CJ5A 3MACA 4PK5A 4AKRB 2UXXB 4C91A 4YTMA 3ZMTB 2FBWA 1VCTA 2ZM6T 3KFWX 4ISTA 2X68A 3ZMZB 4AQYT 1MIVA 3KV6A 2UXDT 4L0RA 3PUYF 3AE2A 5FVKA 4F8HA 2KLQA 1WRDA 5A1LA 4U3CA 2CWYA 4BA9A 2JIWA 5HWYA 2YU2A 4HEAA 2KMFA 1XMOT 5JDNA 3TLWA 2FUPA 2Y48B 4AIUA 3H3AA 4B3MT 2LOSA 2DI4A 3AEEA 3DP7A 2N1GA 1OEDB 3GWHA 4IE6A 2IW5B 3I0OA 4DV7T 4NUVA 3FB2A 1W9RA 5HWXA 2X51A 2P9BA 3N9MA 4NXNT 2J1DG 2V7IA 5ABHA 3CQGB 2YU1A 3K1SA 3LFMA 3RIUA 4LF6T 3FZFB 2V7LA 1KNZA 1SA0E 3W15B 3QK6A 2VWAA 3LSVA 4GYSA 1V9DA 3ANWA 2ES0A 5BR8T 1HG5A 4A56A 2Q9QC 4ANJA 4H9NC 4ZI3C 1XDPA 2E5VA 2X0HA 4IE5A 1QUUA 4IDQA 3B13A 2W62A 2KINB 2L9QA 3N9OA 1U5PA 3EAMA 2UXNB 1N32T 2D0UA 2CXDA 2YDQA 2CBJA 2DWGA 2XQ7A 1KF6A 3AB3B 3RC3A 1LVFA 4JEHB 2D9DA 1WCRA 3ZCJA 1W09A 4QH1A 4H9OC 1KEYA 3SWHA 3L3PA 2KWIB 1HX8A 2JPFA 2BG9B 3N9QA 3CWZB 3LJCA 4ZEYA 4KP3C 3ZLIA 5LJMA 2VL0A 2K48A 3ONXA 5HXEA 2PFVA 2NTXA 3HR0A 4JEUB 2UU9T 4GKJT 2FJEA 3CIRA 1UK5A 2CEAA 2NP9A 2W00A 2ZMAA 1KNRA 4IREA 1XZYA 1Y01A 5LGNB 3NZPA 2PG8A 3R6NA 3OVUA 2XAQB 2QA7A 5KXJA 2LSIA 3EDUA 5JDLA 2N2NA 2C5KT 4B3TT 4YJ2E 5FY0A 3RYIE 3LK42 2JQQA 3RX6A 4X65T 2WSSV 2W66A 1VOMA 2QGSA 2XHEB 3S4UA 4C90A 3ZC0A 2DL1A 3FXEB 3NKZA 4QKNA 4X1IE 3LBXA 4PW8A 2HN2A 5L3CB 4PJLA 2V5CA 1WFDA 1MMGA 3QNUA 4LF4T 5AQKB 2E8IA 3U3IA 5LCYA 4DR2T 4JLEA 3EHZA 2KT9A 2BZBA 3WAKA 2VURA 3BQLA 4IDPA 2M6IA 4G2AA 2V7KA 5L3GB 5AQGB 5JREA 2CE7A 5CB4E 4HWCA 4PK4A 2JQHA 4ZI3D 3N9LA 1HX1B 3NBXX 4K0KT 2V6YB 1OEDA 4PAGA 3QB5A 4AKHA 2J62A 2H7OA 4X66T 2SPCA 2FJDA 5JDMA 4HE8A 2IHR1 2VB6A 4WZXA 1J5WA 4A98A 3NWIA 3SRZA 5FNVE 5EZYE 3K8PC 5BMVE 5EK2A 2BKNA 3ZN1B 4TV8E 4EZHA 5JDGA 1YKEB 4NIQA 4X20E 5HEHA 2HH7A 4X1KE 4H9QC 2B76A 5HAXA 4CN1A 1HCIA 2K9AA 4DR7T 4DV5T 4O2BE 3JADA 2X66A 2UUBT 2NR4A 4P0BA 3P8CD 2LSYA 2WAUA 3ZMSB 3VR8A 3UU6A 4YY3T 1NENA 4E7ZA 2WZHA 5HCJA 3VKGA 3CX8B 4EEDA 2LHNA 2MPKA 2EHOB 3Q9DA 1SE7A 4EOZB 4KMCA 4EXTA 2BG9A 3MJXA 4ZI2C 4LFCT 4U7YA 4FI5A 2I6HA 2XQYA 4JI7T 1T7SA 4ZXLA 3SS1A 4FJOA 2A72A 3PUSA 2OLTA 2J47A 2ODVA 2V7JA 2MBGA 2X9XA 2OA5A 3PUXF 2AE9A 5J2TE 3O1JA 3QC9A 4KHZF 4CZZB 4OX9T 1G8XA 2BBHA 5F8PA 2ACZA 1FJGT 2D2SA 1LVKA 4OYKA 4JI1T 3E0ZA 1Y64B 1WYCA 4OYJA 2KWHA 3F57A 4YTNA 2V7MA 2X0LB 5FXXA 1EZ3A 3AA6B 4NPPA 3R84B 4BAYB 3UQ4A 3TKLB 2VQET 4DNDA 2QVAA 1YD8G 4ZZBA 5H6QB 2V5DA 2A2FX 2WM9A 5CA1E 1N36T 2BS4A 5LNKA 2CXLA 3ZMVB 2C5JA 2E9XB 4EEBA 2XSBA 2DHRA 3Q2MA 2V6YA 1BR1A 1LKXA 3AVRA 3LG7A 2IAKA 4YTPA 1MMDA 3AEGA 5ABGA 1ZKEA 3ZYMA 1HNZT 4A5XA 1D0YA 1T8BA 4MHCA 3T1YT 4UR9A 4QX7B 2VKJA 4IDOA 1FEWA 4IGUA 2LSGA 4IL9A 4QXBB 3RYHE 3QB5K 3RQUA 3EI0A 4JYAT 3UFEA 3ZC1A 3FXDB 3VR9A 2V26A 4YHHT 3CKDA 5AQTB 3J7Yq 3PDYA 2IMLA 3M3ZB 4DR4T 4AXPA 3AE9A 1MNDA 3T8OA 2XQ6A 4U2ZA 1X9BA 5GONE 4IE0A 3VHLA 1XNRT 3P4SA 3GN5B 4UIGA 5AQVB 5JTGA 5IYZE 4HWHA 5AQIB 2EHOA 2K5BB 4ILCA 4ZZCA 3FZLB 3AXJB
chains in the Genus database with same CATH topology
3PURA 2W00A 3NRXA 5LP6E 2ZMAA 4IIJE 3AA7B 2L3LA 3I9WA 1HS7A 3IEEA 4AKIA 2X9WA 3UULA 4I55E 2XAHB 2Y8DA 1G73A 3V5SA 1MNEA 3ZPOA 2VKOA 1QSDA 3ZJ2A 5LGNB 3NZPA 2CA5A 2NW7A 1HTJF 3C4WA 2MYSA 2PG8A 3R6NA 4MALA 2XAQB 2QA7A 5ETWA 3U78A 2LSIA 3EDUA 5JDLA 2HPLA 2N2NA 5KMGP 3CVRA 2C5KT 5ADXL 5HXHA 4YJ2E 3I9YA 3ETUA 4TUYE 5FY0A 3RYIE 3H37A 2CXFA 3LK42 2JQQA 2VKHA 4WBOA 3RX6A 1IJ5A 3UUMA 2DWKA 3OKQA 4GOUA 4HKAA 2GK9A 5FY7A 2WSSV 4YLHA 3CPZA 3RRWA 4H63H 1VOMA 2QGSA 4M1PA 4DMVA 2H7VC 1BR0A 2WMOA 4AI6A 4UVAB 3MZKB 1YW0A 5CA0E 2JRKA 2XHEB 3FBLA 3HA4A 4GYRA 3S4UA 2W63A 1NWMX 4C90A 5HYAA 3ZC0A 3FXEB 1YKHB 5F3JA 4XBFB 4L9IA 3D0TA 4QKNA 4DBRA 2V1DB 4X1IE 4EAHA 4PNIA 5L2LA 3LBXA 3A5XA 4PW8A 3J9X1 4AQFC 4H63V 3N2GE 5FMNA 2NWBA 5JVDE 2VL8A 3V5UA 5L3CB 4PJLA 2D0TA 4OK0A 5LJNA 5LYJE 1IJ6A 2WWUA 1MMGA 5IHYA 4JUYA 2E8IA 3KINB 5FYMA 2Z6EA 4WBNE 3PU3A 3U3IA 3N9NA 5LCYA 3ZYLA 4JLEA 2L8KA 3PUGA 4KBMB 4CXXA 3JC6D 5JR9A 3CQCB 2CLYB 4XAXB 2KT9A 2BZBA 3WAKA 1Z0PA 4PJJA 4TV9E 4PFOA 3BQLA 2A3DA 2E9XD 3AAEB 2X9HA 4TZ4C 4G2AA 3E22E 4IE4A 2ZM8A 2JMKA 2V7KA 3C50A 4H9PC 5L3GB 2VASA 5HXSA 5J1GA 1U4QA 5JREA 3MXZA 2LEHA 2CLYC 2XAGB 2C0SA 1MIWA 3HKBE 3NZQA 2PBIA 2CE7A 5CB4E 4E7SA 4UF0A 4PK4A 3KV5A 3GA8A 4ZI3D 3N9LA 5M4YA 1SHZC 3NBXX 4EB6E 1VRBA 4ZOLE 4ZI7E 4PAGA 4AKHA 4L5GA 2W61A 4DVDA 3Q5WA 3AA0B 2H7OA 2LM9A 2YINA 3P7IA 4PFPA 1WYBA 2SPCA 2XAJB 3HI2A 5JDMA 3DTOA 3K3QC 3AVSA 4HE8A 1MIYA 2VB6A 3AA1B 3LBXB 1HF8A 3ANWB 4IHJE 3AAIA 3K3NA 3UUNA 4MFRA 4IE7A 3SRZA 1ZV4X 5FNVE 5EZYE 3K8PC 5BMVE 1MMNA 5KDMC 5EK2A 2XASB 5C8YE 5FY1A 2PJQA 3RH3A 2XTLA 3CX6B 5JR9B 4O4IE 2Q9QA 1E1HB 3QUJA 5JH7E 4DO0A 4YHJA 3ZN1B 3KDSE 3LK3B 4TV8E 4EZHA 2NW9A 5JDGA 4HGAA 1YKEB 2LJLA 1WR6A 2CCQA 2D5UA 3AAAB 3KV9A 4X20E 3E08A 2CM0A 5JR9C 2HH7A 2LE8A 2ZLYA 4X1KE 2N9DA 2W0GA 4BJNA 2DCFA 4H9QC 3C98B 4P0AA 2DNXA 2RA1A 4N78D 5HAXA 1HCIA 4NUUA 2K9AA 4EYYR 5JQGE 3N2OA 3WAJA 2NTYA 4O2BE 2BVLA 2X66A 4AQGA 4OHFA 4HN9A 1FMWA 4P0BA 2M67A 3P8CD 2LSYA 1D1BA 2WAUA 2IC9A 2ZM0A 5LHHB 4ISSA 3IHRA 3ZMSB 3F31A 3RKOA 5KX5E 1IZNB 4H9SE 4ZS3A 4ZS2A 4CQIA 4OFZA 4ILUA 3O1HA 4E7ZA 1FIOA 3FHNA 4TX5A 3OYXA 5LOVE 5EK4A 2NW8A 3UTKA 4EZ4A 3VKGA 3CX8B 2KNDA 4ERRA 1UCUA 2LHNA 4WW0A 2KXPB 5LGUB 4U72A 5JRCB 2EHOB 3KV4A 4O4JE 3Q9DA 3RYCE 3O4XE 4EOZB 3EDVA 2HPJA 3CX7B 3OBVE 3MJXA 4KMCA 4EXTA 4ZI2C 4CI3B 2G0UA 4YFSA 2XUEA 4FI5A 3C64A 4IDZA 2XQYA 4BJMA 1B7TA 4H9RC 2EHOC 4J2CA 3MKDA 1OXZA 2YK0A 4UVBB 3Q5XA 4MBQA 3SS1A 3GN5A 1D0ZA 4O8SA 5DQVA 3RC8A 4FJOA 3OYZA 4CI2B 2A72A 3PUSA 3NRYA 4UVCB 5FXVA 4PJNA 2ODVA 2V7JA 3UT5E 3DJBA 2Y6XA 5LBMA 2MBGA 4UV8B 5FXZA 2LSJA 2X9XA 2OA5A 5L3FB 3C4ZA 3KVAA 4DBQA 3KBUA 4QXCB 5J2TE 2B1EA 3O1JA 4I50E 1UX4A 3PTRB 3C51A 2LHRA 4HFVA 4KUMB 4F6RC 4O4HE 4ZI2D 3PUAA 5E0OA 1US7B 4O2AE 3QC9A 2LSKA 4X1YE 3ZYKA 5L3DB 3C4XA 4CZZB 2YEVC 2I59A 1HFAA 1G8XA 2EHOD 3MACA 4PK5A 4AKRB 2UXXB 1FMVA 4C91A 3KVBA 3MK7C 4DMWA 3ZMTB 4CXYA 1D1CA 4AKGA 5F8PA 2D2SA 5H6RB 3HKEE 2C5IT 2E9XA 3I0QA 3K3OA 3KFWX 4ISTA 4YJ3E 5DABA 5LHIB 2X68A 3ESLA 3HL6A 3ZMZB 1LVKA 4OYKA 3N9PA 4UELA 1UX5A 1MIVA 3CQXC 4Z8XA 3KV6A 3E0ZA 1Y64B 4L0RA 3FBZA 1WYCA 5J2UE 4GK5E 4AQFA 5LG4A 4PJMA 2KLQA 4OYJA 2KWHA 3F57A 3PUQA 4HTEA 3I1AA 3WI3A 1WRDA 2VK9A 5HXCA 1BR2A 5TAOA 5A1LA 2V7MA 2X0LB 3IF8B 5FXXA 2CWYA 1EZ3A 2ZM2A 3AA6B 4BA9A 5HWYA 2YU2A 3GMIA 4HEAA 2H3RA 3HKCE 3R84B 2KMFA 1S94A 4BAYB 4GK0E 3UUXB 4P09A 3TKLB 5JDNA 4EIWA 5LGTB 4CI1B 2Y48B 4UF0B 3IBPA 4DNDA 3SOLA 3RRCA 3H3AA 4QX8B 2LOSA 1YD8G 2DI4A 4K0UA 3M65A 3DP7A 2N1GA 5H6QB 4EYUA 3GWHA 4IE6A 3BQIA 3MA9A 5JDHA 2IW5B 2A2FX 2CWOA 1ZHCA 4AKLA 2K24A 2WM9A 3KBTA 5CA1E 2IC6A 3I0OA 4ADZA 3VKHA 4NUVA 3FB2A 5LNKA 1KK7A 5HWXA 1S35A 2X51A 4WNKA 5FXWA 2CXLA 3ZN0B 3ZMVB 2P9BA 5JDQA 2C5JA 1X79A 3N9MA 4G63A 2E9XB 4PK6A 5FP3A 2J1DG 4QWNB 2ACXA 2V7IA 3PU8A 3CQGB 2DHRA 3RPUA 3JC6C 3Q2MA 2X9YA 1BR1A 2YU1A 1LKXA 3LFMA 4U74A 1CUNA 3AVRA 1WLXA 3CMLA 3LG7A 5HXRA 3RYFE 2IAKA 2V7LA 4ASKA 2E9XC 1MMDA 1KNZA 2Q9QB 2MTQA 1OWAA 1SA0E 2KZ7B 3N5LA 2MOZA 3W15B 4CXWA 3N2KE 3QK6A 2VWAA 2JJ9A 5EK3A 1ZKEA 3ZYMA 4GYSA 3B57A 1V9DA 3ANWA 3ZCIA 2ES0A 3LK2B 1D0YA 2XAFB 1HG5A 4A56A 5LA6E 3EUHA 2Q9QC 4O4LE 4H9NC 4ANJA 4MHCA 3ETVA 4ZI3C 5LBQB 1D1AA 2ODUA 2WMNA 4IE5A 2X67A 1QUUA 4MLKA 3B13A 2W62A 3ZEFB 2KINB 4QX7B 2L9QA 3N9OA 1U5PA 2LT3A 2VKJA 4V1Av 1FEWA 2RP4A 3F2EA 2UXNB 5AFUL 4IGUA 2LSGA 4UV9B 1H7CA 3PE0A 4QXBB 3ZJ1A 1NAFA 4QHOA 2JMHA 5DQWA 2D0UA 2CXDA 3RYHE 3BQKA 4GIWA 4I4TE 4UXNB 1ZEEA 2DWGA 2LOPA 3AB3B 4QXHB 1BR4A 3RC3A 3UFEA 2CMRA 1LVFA 1LRZA 4JEHB 3ZC1A 3ZCJA 3FXDB 2V26A 4H9OC 3CKDA 3SWHA 2Q9QD 3L3PA 2WBLA 2KWIB 5L3BB 3VU7H 3J7Yq 1HG2A 4ZHQE 1HX8A 3PDYA 3OJAA 3EVYA 2JPFA 5JDFA 1AJ3A 1MMAA 2BDEA 1T98A 1IAPA 4AXPA 5L3EB 3N9QA 3CWZB 3LJCA 4KP3C 4UEMA 3HKDE 5DJQC 1MNDA 3T8OA 3ZMUB 2NOXA 3ZLIA 5LJMA 2VKDA 2K48A 3O9XA 3O1IA 2DLRA 3ONXA 5GONE 4IE0A 5HXEA 2PFVA 1D0XA 3VHLA 3GN5B 2NTXA 4UIGA 4B6XA 3HR0A 5LHGB 3L09A 4JEUB 2BVMA 3BK9A 4TN7B 4I43B 5IYZE 1O3XA 5JRCA 2EHOA 2CEAA 4XZCA 5LXTE 2K5BB 2NP9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZJ1 A;  5L2L A;  2LHN A;  3ZJ2 A; 
#chains in the Genus database with same CATH topology
 3PUR A;  3NRX A;  5LP6 E;  3PV0 F;  3AA7 B;  5IWA T;  3IEE A;  3UUL A;  1MNE A;  4U2Y A;  3ZPO A;  2VKO A;  1QSD A;  3ZSS A;  1HTJ F;  3C4W A;  5HCM A;  3ZT5 A;  5ETW A;  4TNW A;  5KMG P;  5HXH A;  3ETU A;  3H37 A;  2GK9 A;  3CPZ A;  4H63 H;  2H7V C;  5CA0 E;  2JRK A;  2W63 A;  5HYA A;  4IDN A;  1W0A A;  3P50 A;  3QOF A;  4CN4 A;  2V1D B;  3SFE A;  3J9X 1;  2VL8 A;  3V5U A;  2D0T A;  5LYJ E;  5IHY A;  2H89 A;  2I0M A;  4WBN E;  2L8K A;  4CXX A;  3CQC B;  2YN6 A;  1R8I A;  4XAX B;  4DR1 T;  4PJJ A;  1M62 A;  2A3D A;  3AAE B;  4B3S T;  4WYV A;  2VAS A;  5J1G A;  1U4Q A;  2CRB A;  2CLY C;  2PBI A;  5HEO A;  3GA8 A;  1J1J A;  1SHZ C;  4JBW F;  2V8S V;  3T1H T;  4EB6 E;  1KNP A;  2V6X A;  3FZH B;  2JQK A;  4ZOL E;  4DVD A;  3Q5W A;  3AA0 B;  2LM9 A;  4PFP A;  2YIN A;  2YDS A;  4AIS A;  3HI2 A;  3RF1 A;  3AVS A;  1MIY A;  3RIU C;  1HF8 A;  3K3N A;  3UUN A;  4MFR A;  1ZV4 X;  4LML A;  2W4X A;  5C8Y E;  5AQP B;  3RH3 A;  5JR9 B;  4O4I E;  1E1H B;  5JH7 E;  4YHJ A;  2YDR A;  2NW9 A;  4Q25 A;  1ZOY A;  3ZT6 A;  4YSY A;  3KV9 A;  2W0G A;  3AE8 A;  4BJN A;  2DCF A;  4P0A A;  2DNX A;  2WP9 A;  3AE4 A;  4TWD A;  3WAJ A;  4LF5 T;  4HN9 A;  1FMW A;  1W0B A;  4ISS A;  3F31 A;  3RKO A;  4ZS3 A;  4CQI A;  3FHN A;  4JI5 T;  2WU2 A;  5EK4 A;  4ILA A;  2KND A;  2WY2 A;  4U72 A;  5JRC B;  3UU3 A;  3EDV A;  2HPJ A;  3CX7 B;  3PJA A;  2LLY A;  4TNV A;  4J2C A;  3MKD A;  2IDO B;  2QRX A;  3GN5 A;  4DID B;  5DQV A;  3VRB A;  3VRA A;  4UVC B;  4PJN A;  3DJB A;  5F5W A;  3AE1 A;  1SUM B;  2LSJ A;  3KVA A;  3KBU A;  4LF8 T;  4X5T A;  1UX4 A;  4HFV A;  4KUM B;  2LHR A;  5AQQ B;  4O4H E;  2LSK A;  2YEV C;  2EHO D;  1HNW T;  4DMW A;  4CXY A;  3AEA A;  1D1C A;  4AKG A;  5H6R B;  2C5I T;  3I0Q A;  5DAB A;  4YJ3 E;  5AQJ B;  5LHI B;  3ESL A;  4JI8 T;  3N9P A;  1UX5 A;  3CQX C;  3PUW F;  5AQH B;  3FBZ A;  4AQF A;  3PUQ A;  4HTE A;  3I1A A;  3WI3 A;  3AED A;  5TAO A;  3PJA J;  4A97 A;  2ZM2 A;  3LDQ B;  4JI0 T;  3HKC E;  2WDV A;  4KHP T;  4GK0 E;  4P09 A;  3RIF A;  5LGT B;  4CI1 B;  3IBP A;  3SOL A;  3RRC A;  4TWH A;  4QX8 B;  1Z8U A;  3BQI A;  3MA9 A;  1ZHC A;  3RGL A;  2IC6 A;  4ADZ A;  3VKH A;  1KK7 A;  5FXW A;  1OED C;  5JDQ A;  4G63 A;  4QWN B;  3PU8 A;  2WU5 A;  2X9Y A;  4KI0 F;  4U74 A;  1WLX A;  3CML A;  4I0U A;  3Q5E A;  3RYF E;  4QH5 A;  2Q9Q B;  3RI5 A;  2KZ7 B;  3N5L A;  4CXW A;  2JJ9 A;  5EK3 A;  4JV5 T;  5HEU A;  3EUH A;  4DR5 T;  1WR0 A;  3ETV A;  5LBQ B;  2ODU A;  2IIU A;  2WMN A;  2X67 A;  3ZEF B;  3UUB A;  4JI2 T;  1GQE A;  4V1A v;  3F2E A;  5AFU L;  4UV9 B;  3PE0 A;  3ZJ1 A;  2JMH A;  5DQW A;  3BQK A;  4GIW A;  4I4T E;  2LOP A;  4HFH A;  3JAE A;  2CMR A;  1LRZ A;  3L39 A;  1E2A A;  5L3B B;  3VU7 H;  4ZHQ E;  5FVL A;  5JDF A;  5HEJ A;  3TLV A;  1MMA A;  1IAP A;  4LMJ A;  5L3E B;  1QLB A;  1IBK T;  3FZM B;  2K3W A;  5FL0 A;  3HKD E;  3ZMU B;  1E7P A;  2VKD A;  3O9X A;  3O1I A;  1UUR A;  2UUA T;  2BG9 C;  5LHG B;  3L09 A;  3BK9 A;  5JRC A;  2BKO A;  5HEG A;  4XZC A;  2WS3 A;  5LMU T;  1HS7 A;  2L3L A;  3I9W A;  4AKI A;  4CN6 A;  2X9W A;  4I55 E;  2XAH B;  2Y8D A;  2CA5 A;  2E2A A;  2MYS A;  4MAL A;  3TLU A;  3CK6 A;  4HFD A;  2HPL A;  3CVR A;  4LF7 T;  2XSA A;  5ADX L;  5J0Z A;  2XQ4 A;  4TUY E;  4YSX A;  2CXF A;  2VKH A;  4WBO A;  3UUM A;  4GOU A;  2LKG A;  5FY7 A;  2LRK A;  4Z91 A;  5L4H A;  3RRW A;  4M1P A;  1BR0 A;  2WMO A;  4AI6 A;  4UVA B;  2LM2 A;  1KFY A;  3FBL A;  3HA4 A;  2IUB A;  4PNI A;  5AQL B;  3A5X A;  2NWB A;  3L8R A;  5JVD E;  4OK0 A;  2XQ5 A;  3ONJ A;  2J4G A;  2UUC T;  2XM1 A;  2CPT A;  3PU3 A;  3ZYL A;  2CHO A;  1HNX T;  3PUG A;  2XQA A;  2XZE A;  3B5M A;  4TV9 E;  4ILB A;  2X9H A;  4TZ4 C;  4IE4 A;  2JMK A;  3C50 A;  5HXS A;  3MXZ A;  2LEH A;  1XMQ T;  4GKK T;  1IBL T;  3HKB E;  1ZP0 A;  4DV3 T;  3NZQ A;  3OTO T;  4E7S A;  3KV5 A;  5M4Y A;  2WQY A;  4L5G A;  2W61 A;  3P7I A;  1WYB A;  3H3M A;  4JI6 T;  1J5E T;  3DTO A;  3RQW A;  5AQN B;  3LBX B;  2WDQ A;  4DV4 T;  1JNR A;  3AAI A;  1I94 T;  2X0Y A;  1N33 T;  5LG3 A;  5KDM C;  5FY1 A;  3CX6 B;  4X64 T;  2Q9Q A;  3QUJ A;  4DO0 A;  2MAW A;  3KDS E;  5L4E A;  2LJL A;  1WR6 A;  3AE6 A;  3PUV F;  2CM0 A;  2ZLY A;  2N9D A;  2BBJ A;  4N78 D;  4TWF A;  2HHH T;  3JAF A;  4LFA T;  4EYY R;  5JQG E;  2XM2 A;  2XPK A;  2NTY A;  3AEB A;  2BVL A;  4AQG A;  4OHF A;  2WCA A;  2ZM0 A;  5LHH B;  3IHR A;  5KX5 E;  1IZN B;  4H9S E;  4OFZ A;  3O1H A;  1FIO A;  5LOV E;  2NW8 A;  4EZ4 A;  4DV1 T;  1T72 A;  4ERR A;  4WW0 A;  3KV4 A;  2RPA A;  2CHN A;  3OBV E;  4YFS A;  4IDZ A;  3C64 A;  4P1N A;  4BJM A;  1B7T A;  4H9R C;  2EHO C;  1OXZ A;  2YK0 A;  4UVB B;  4MBQ A;  2KSR A;  2XY8 B;  1D0Z A;  4O8S A;  3OYZ A;  4CI2 B;  4DV2 T;  2M6B A;  5AQR B;  5AQU B;  3UT5 E;  2Y6X A;  5ABE A;  5L3F B;  4QXC B;  4I50 E;  3C51 A;  5E0O A;  4O2A E;  4X1Y E;  3UU4 A;  2I59 A;  1HFA A;  4LF9 T;  3RKG A;  1XDO A;  1FMV A;  5CFB A;  3KVB A;  3MK7 C;  4DR3 T;  4Z90 A;  3HKE E;  3K3O A;  2E9X A;  3HL6 A;  2R6G F;  4UEL A;  2YOE A;  4Z8X A;  4JI3 T;  5AQF B;  4DV0 T;  2JQ9 A;  5J2U E;  4GK5 E;  5LG4 A;  3IA3 A;  3TLS A;  4PJM A;  2UXC T;  2VK9 A;  5HXC A;  1BR2 A;  3IF8 B;  3RHW A;  3GMI A;  2H3R A;  1S94 A;  4HFE A;  3UUX B;  1NEK A;  5CGM A;  2VVS A;  4EIW A;  4UF0 B;  1UGO A;  5C2T A;  4K0U A;  3M65 A;  4EYU A;  5JDH A;  5FKY A;  2CWO A;  4AKL A;  2K24 A;  3KBT A;  2WZI A;  4DR6 T;  5FL1 A;  1IBM T;  1S35 A;  3Q5D A;  4WNK A;  3ZN0 B;  4X62 T;  3RIA A;  1X79 A;  3G06 A;  5FP3 A;  4PK6 A;  3AE7 A;  2ACX A;  3RPU A;  3JC6 C;  4HFB A;  1CUN A;  5HXR A;  2W2U A;  4ASK A;  2E9X C;  2MTQ A;  1OWA A;  2W67 A;  2MOZ A;  3N2K E;  2OV9 A;  4DUY T;  3P4W A;  4YXD A;  2XQ9 A;  3B57 A;  3ZCI A;  3LK2 B;  4DUZ T;  2XAF B;  5IUX A;  2QYW A;  5LA6 E;  4O4L E;  3A7M A;  1CHU A;  1D1A A;  4HFI A;  4MLK A;  3AXJ A;  2LT3 A;  2RP4 A;  2E5L T;  1H7C A;  1NAF A;  4QHO A;  2UXB T;  4UXN B;  1ZEE A;  2XQ8 A;  3TLT A;  5AQM B;  5ABF B;  4QXH B;  1BR4 A;  2Q9Q D;  2WBL A;  1HG2 A;  5C3J A;  2LKH A;  3OJA A;  3EVY A;  1AJ3 A;  2BDE A;  1T98 A;  5AQS B;  4UEM A;  5DJQ C;  2NOX A;  4EGW A;  2DLR A;  4EV6 A;  1D0X A;  1XWM A;  2F4V T;  4B6X A;  4LMK A;  4KX6 A;  2XJ7 A;  2BVM A;  4TN7 B;  4I43 B;  1O3X A;  2BS3 A;  5LXT E;  1UUS A;  4IIJ E;  3AEF A;  3V5S A;  1G73 A;  3ZJ2 A;  2NW7 A;  3UFG A;  3U78 A;  2HN1 A;  3I9Y A;  3ZT7 A;  3UU5 A;  2BKP A;  4U33 A;  1IJ5 A;  2DWK A;  3OKQ A;  4HKA A;  2CBI A;  4YLH A;  3NVO A;  4DMV A;  2FJB A;  3MZK B;  1YW0 A;  4GYR A;  1NWM X;  1YKH B;  5F3J A;  4XBF B;  4L9I A;  3D0T A;  3AE5 A;  4DBR A;  4EAH A;  5L2L A;  3RLF F;  3A8Y C;  4AQF C;  4H63 V;  3N2G E;  5FMN A;  2H88 A;  5LJN A;  1IJ6 A;  2WWU A;  2WWV A;  4JUY A;  1I6Z A;  3KIN B;  5FYM A;  2Z6E A;  3N9N A;  4KBM B;  3JC6 D;  5JR9 A;  4U31 A;  2PTF A;  2CLY B;  3AE3 A;  1Z0P A;  4PFO A;  1JNZ A;  2E9X D;  3P4Q A;  3E22 E;  2ZM8 A;  4H9P C;  1YQ3 A;  1VCS A;  1YQ4 A;  2XAG B;  2C0S A;  3ABV A;  1MIW A;  1OED E;  3ZKR A;  4YT0 A;  4UF0 A;  2A9U A;  1VRB A;  4ZI7 E;  4NXM T;  3P4R A;  4JI4 T;  5LMN T;  3JCF A;  2XAJ B;  3K3Q C;  1XNQ T;  3SFD A;  3AA1 B;  3ONL C;  2WB5 A;  3ANW B;  4HWI B;  4IHJ E;  1HR0 T;  4HWF A;  3UQ7 A;  4IE7 A;  2AXD S;  1MMN A;  2XAS B;  2PJQ A;  2XTL A;  3ZST A;  1YXR A;  3LK3 B;  4HGA A;  2D5U A;  2CCQ A;  3X1D A;  3AAA B;  3FZK B;  3E08 A;  5JR9 C;  3AEC A;  2LE8 A;  3C98 B;  2RA1 A;  4NUU A;  1M7K A;  3N2O A;  3P4P A;  2VQF T;  5L47 A;  2M67 A;  1D1B A;  2LRL A;  2IC9 A;  5ABF A;  2VVN A;  4ZS2 A;  4ILU A;  4TX5 A;  3OYX A;  3UTK A;  2BG9 E;  4B3R T;  1UCU A;  4COF A;  2KXP B;  5LGU B;  4U7I A;  2WDR A;  5LB7 B;  4O4J E;  3RYC E;  3O4X E;  4CI3 B;  2G0U A;  2XUE A;  4IL4 A;  2YKS A;  3UU8 A;  4DV6 T;  4HWD A;  2FJA A;  4LFB T;  2XQ3 A;  3Q5X A;  3PUZ F;  3RC8 A;  3OPC A;  2BS2 A;  3NRY A;  1N34 T;  5FXV A;  4YSZ A;  5LBM A;  4QH4 A;  1DU2 A;  4UV8 B;  5FXZ A;  3C4Z A;  4DBQ A;  3EAB A;  1L0V A;  2B1E A;  4IT4 A;  4HFC A;  4F6R C;  3PTR B;  4ZI2 D;  3PUA A;  1US7 B;  3ZYK A;  5L3D B;  3C4X A;  5AQO B;  5CJ5 A;  3MAC A;  4PK5 A;  4AKR B;  2UXX B;  4C91 A;  4YTM A;  3ZMT B;  2FBW A;  1VCT A;  2ZM6 T;  3KFW X;  4IST A;  2X68 A;  3ZMZ B;  4AQY T;  1MIV A;  3KV6 A;  2UXD T;  4L0R A;  3PUY F;  3AE2 A;  5FVK A;  4F8H A;  2KLQ A;  1WRD A;  5A1L A;  4U3C A;  2CWY A;  4BA9 A;  2JIW A;  5HWY A;  2YU2 A;  4HEA A;  2KMF A;  1XMO T;  5JDN A;  3TLW A;  2FUP A;  2Y48 B;  4AIU A;  3H3A A;  4B3M T;  2LOS A;  2DI4 A;  3AEE A;  3DP7 A;  2N1G A;  1OED B;  3GWH A;  4IE6 A;  2IW5 B;  3I0O A;  4DV7 T;  4NUV A;  3FB2 A;  1W9R A;  5HWX A;  2X51 A;  2P9B A;  3N9M A;  4NXN T;  2J1D G;  2V7I A;  5ABH A;  3CQG B;  2YU1 A;  3K1S A;  3LFM A;  3RIU A;  4LF6 T;  3FZF B;  2V7L A;  1KNZ A;  1SA0 E;  3W15 B;  3QK6 A;  2VWA A;  3LSV A;  4GYS A;  1V9D A;  3ANW A;  2ES0 A;  5BR8 T;  1HG5 A;  4A56 A;  2Q9Q C;  4ANJ A;  4H9N C;  4ZI3 C;  1XDP A;  2E5V A;  2X0H A;  4IE5 A;  1QUU A;  4IDQ A;  3B13 A;  2W62 A;  2KIN B;  2L9Q A;  3N9O A;  1U5P A;  3EAM A;  2UXN B;  1N32 T;  2D0U A;  2CXD A;  2YDQ A;  2CBJ A;  2DWG A;  2XQ7 A;  1KF6 A;  3AB3 B;  3RC3 A;  1LVF A;  4JEH B;  2D9D A;  1WCR A;  3ZCJ A;  1W09 A;  4QH1 A;  4H9O C;  1KEY A;  3SWH A;  3L3P A;  2KWI B;  1HX8 A;  2JPF A;  2BG9 B;  3N9Q A;  3CWZ B;  3LJC A;  4ZEY A;  4KP3 C;  3ZLI A;  5LJM A;  2VL0 A;  2K48 A;  3ONX A;  5HXE A;  2PFV A;  2NTX A;  3HR0 A;  4JEU B;  2UU9 T;  4GKJ T;  2FJE A;  3CIR A;  1UK5 A;  2CEA A;  2NP9 A;  2W00 A;  2ZMA A;  1KNR A;  4IRE A;  1XZY A;  1Y01 A;  5LGN B;  3NZP A;  2PG8 A;  3R6N A;  3OVU A;  2XAQ B;  2QA7 A;  5KXJ A;  2LSI A;  3EDU A;  5JDL A;  2N2N A;  2C5K T;  4B3T T;  4YJ2 E;  5FY0 A;  3RYI E;  3LK4 2;  2JQQ A;  3RX6 A;  4X65 T;  2WSS V;  2W66 A;  1VOM A;  2QGS A;  2XHE B;  3S4U A;  4C90 A;  3ZC0 A;  2DL1 A;  3FXE B;  3NKZ A;  4QKN A;  4X1I E;  3LBX A;  4PW8 A;  2HN2 A;  5L3C B;  4PJL A;  2V5C A;  1WFD A;  1MMG A;  3QNU A;  4LF4 T;  5AQK B;  2E8I A;  3U3I A;  5LCY A;  4DR2 T;  4JLE A;  3EHZ A;  2KT9 A;  2BZB A;  3WAK A;  2VUR A;  3BQL A;  4IDP A;  2M6I A;  4G2A A;  2V7K A;  5L3G B;  5AQG B;  5JRE A;  2CE7 A;  5CB4 E;  4HWC A;  4PK4 A;  2JQH A;  4ZI3 D;  3N9L A;  1HX1 B;  3NBX X;  4K0K T;  2V6Y B;  1OED A;  4PAG A;  3QB5 A;  4AKH A;  2J62 A;  2H7O A;  4X66 T;  2SPC A;  2FJD A;  5JDM A;  4HE8 A;  2IHR 1;  2VB6 A;  4WZX A;  1J5W A;  4A98 A;  3NWI A;  3SRZ A;  5FNV E;  5EZY E;  3K8P C;  5BMV E;  5EK2 A;  2BKN A;  3ZN1 B;  4TV8 E;  4EZH A;  5JDG A;  1YKE B;  4NIQ A;  4X20 E;  5HEH A;  2HH7 A;  4X1K E;  4H9Q C;  2B76 A;  5HAX A;  4CN1 A;  1HCI A;  2K9A A;  4DR7 T;  4DV5 T;  4O2B E;  3JAD A;  2X66 A;  2UUB T;  2NR4 A;  4P0B A;  3P8C D;  2LSY A;  2WAU A;  3ZMS B;  3VR8 A;  3UU6 A;  4YY3 T;  1NEN A;  4E7Z A;  2WZH A;  5HCJ A;  3VKG A;  3CX8 B;  4EED A;  2LHN A;  2MPK A;  2EHO B;  3Q9D A;  1SE7 A;  4EOZ B;  4KMC A;  4EXT A;  2BG9 A;  3MJX A;  4ZI2 C;  4LFC T;  4U7Y A;  4FI5 A;  2I6H A;  2XQY A;  4JI7 T;  1T7S A;  4ZXL A;  3SS1 A;  4FJO A;  2A72 A;  3PUS A;  2OLT A;  2J47 A;  2ODV A;  2V7J A;  2MBG A;  2X9X A;  2OA5 A;  3PUX F;  2AE9 A;  5J2T E;  3O1J A;  3QC9 A;  4KHZ F;  4CZZ B;  4OX9 T;  1G8X A;  2BBH A;  5F8P A;  2ACZ A;  1FJG T;  2D2S A;  1LVK A;  4OYK A;  4JI1 T;  3E0Z A;  1Y64 B;  1WYC A;  4OYJ A;  2KWH A;  3F57 A;  4YTN A;  2V7M A;  2X0L B;  5FXX A;  1EZ3 A;  3AA6 B;  4NPP A;  3R84 B;  4BAY B;  3UQ4 A;  3TKL B;  2VQE T;  4DND A;  2QVA A;  1YD8 G;  4ZZB A;  5H6Q B;  2V5D A;  2A2F X;  2WM9 A;  5CA1 E;  1N36 T;  2BS4 A;  5LNK A;  2CXL A;  3ZMV B;  2C5J A;  2E9X B;  4EEB A;  2XSB A;  2DHR A;  3Q2M A;  2V6Y A;  1BR1 A;  1LKX A;  3AVR A;  3LG7 A;  2IAK A;  4YTP A;  1MMD A;  3AEG A;  5ABG A;  1ZKE A;  3ZYM A;  1HNZ T;  4A5X A;  1D0Y A;  1T8B A;  4MHC A;  3T1Y T;  4UR9 A;  4QX7 B;  2VKJ A;  4IDO A;  1FEW A;  4IGU A;  2LSG A;  4IL9 A;  4QXB B;  3RYH E;  3QB5 K;  3RQU A;  3EI0 A;  4JYA T;  3UFE A;  3ZC1 A;  3FXD B;  3VR9 A;  2V26 A;  4YHH T;  3CKD A;  5AQT B;  3J7Y q;  3PDY A;  2IML A;  3M3Z B;  4DR4 T;  4AXP A;  3AE9 A;  1MND A;  3T8O A;  2XQ6 A;  4U2Z A;  1X9B A;  5GON E;  4IE0 A;  3VHL A;  1XNR T;  3P4S A;  3GN5 B;  4UIG A;  5AQV B;  5JTG A;  5IYZ E;  4HWH A;  5AQI B;  2EHO A;  2K5B B;  4ILC A;  4ZZC A;  3FZL B;  3AXJ B; 
#chains in the Genus database with same CATH homology
 3PUR A;  2W00 A;  3NRX A;  5LP6 E;  2ZMA A;  4IIJ E;  3AA7 B;  2L3L A;  3I9W A;  1HS7 A;  3IEE A;  4AKI A;  2X9W A;  3UUL A;  4I55 E;  2XAH B;  2Y8D A;  1G73 A;  3V5S A;  1MNE A;  3ZPO A;  2VKO A;  1QSD A;  3ZJ2 A;  5LGN B;  3NZP A;  2CA5 A;  2NW7 A;  1HTJ F;  3C4W A;  2MYS A;  2PG8 A;  3R6N A;  4MAL A;  2XAQ B;  2QA7 A;  5ETW A;  3U78 A;  2LSI A;  3EDU A;  5JDL A;  2HPL A;  2N2N A;  5KMG P;  3CVR A;  2C5K T;  5ADX L;  5HXH A;  4YJ2 E;  3I9Y A;  3ETU A;  4TUY E;  5FY0 A;  3RYI E;  3H37 A;  2CXF A;  3LK4 2;  2JQQ A;  2VKH A;  4WBO A;  3RX6 A;  1IJ5 A;  3UUM A;  2DWK A;  3OKQ A;  4GOU A;  4HKA A;  2GK9 A;  5FY7 A;  2WSS V;  4YLH A;  3CPZ A;  3RRW A;  4H63 H;  1VOM A;  2QGS A;  4M1P A;  4DMV A;  2H7V C;  1BR0 A;  2WMO A;  4AI6 A;  4UVA B;  3MZK B;  1YW0 A;  5CA0 E;  2JRK A;  2XHE B;  3FBL A;  3HA4 A;  4GYR A;  3S4U A;  2W63 A;  1NWM X;  4C90 A;  5HYA A;  3ZC0 A;  3FXE B;  1YKH B;  5F3J A;  4XBF B;  4L9I A;  3D0T A;  4QKN A;  4DBR A;  2V1D B;  4X1I E;  4EAH A;  4PNI A;  5L2L A;  3LBX A;  3A5X A;  4PW8 A;  3J9X 1;  4AQF C;  4H63 V;  3N2G E;  5FMN A;  2NWB A;  5JVD E;  2VL8 A;  3V5U A;  5L3C B;  4PJL A;  2D0T A;  4OK0 A;  5LJN A;  5LYJ E;  1IJ6 A;  2WWU A;  1MMG A;  5IHY A;  4JUY A;  2E8I A;  3KIN B;  5FYM A;  2Z6E A;  4WBN E;  3PU3 A;  3U3I A;  3N9N A;  5LCY A;  3ZYL A;  4JLE A;  2L8K A;  3PUG A;  4KBM B;  4CXX A;  3JC6 D;  5JR9 A;  3CQC B;  2CLY B;  4XAX B;  2KT9 A;  2BZB A;  3WAK A;  1Z0P A;  4PJJ A;  4TV9 E;  4PFO A;  3BQL A;  2A3D A;  2E9X D;  3AAE B;  2X9H A;  4TZ4 C;  4G2A A;  3E22 E;  4IE4 A;  2ZM8 A;  2JMK A;  2V7K A;  3C50 A;  4H9P C;  5L3G B;  2VAS A;  5HXS A;  5J1G A;  1U4Q A;  5JRE A;  3MXZ A;  2LEH A;  2CLY C;  2XAG B;  2C0S A;  1MIW A;  3HKB E;  3NZQ A;  2PBI A;  2CE7 A;  5CB4 E;  4E7S A;  4UF0 A;  4PK4 A;  3KV5 A;  3GA8 A;  4ZI3 D;  3N9L A;  5M4Y A;  1SHZ C;  3NBX X;  4EB6 E;  1VRB A;  4ZOL E;  4ZI7 E;  4PAG A;  4AKH A;  4L5G A;  2W61 A;  4DVD A;  3Q5W A;  3AA0 B;  2H7O A;  2LM9 A;  2YIN A;  3P7I A;  4PFP A;  1WYB A;  2SPC A;  2XAJ B;  3HI2 A;  5JDM A;  3DTO A;  3K3Q C;  3AVS A;  4HE8 A;  1MIY A;  2VB6 A;  3AA1 B;  3LBX B;  1HF8 A;  3ANW B;  4IHJ E;  3AAI A;  3K3N A;  3UUN A;  4MFR A;  4IE7 A;  3SRZ A;  1ZV4 X;  5FNV E;  5EZY E;  3K8P C;  5BMV E;  1MMN A;  5KDM C;  5EK2 A;  2XAS B;  5C8Y E;  5FY1 A;  2PJQ A;  3RH3 A;  2XTL A;  3CX6 B;  5JR9 B;  4O4I E;  2Q9Q A;  1E1H B;  3QUJ A;  5JH7 E;  4DO0 A;  4YHJ A;  3ZN1 B;  3KDS E;  3LK3 B;  4TV8 E;  4EZH A;  2NW9 A;  5JDG A;  4HGA A;  1YKE B;  2LJL A;  1WR6 A;  2CCQ A;  2D5U A;  3AAA B;  3KV9 A;  4X20 E;  3E08 A;  2CM0 A;  5JR9 C;  2HH7 A;  2LE8 A;  2ZLY A;  4X1K E;  2N9D A;  2W0G A;  4BJN A;  2DCF A;  4H9Q C;  3C98 B;  4P0A A;  2DNX A;  2RA1 A;  4N78 D;  5HAX A;  1HCI A;  4NUU A;  2K9A A;  4EYY R;  5JQG E;  3N2O A;  3WAJ A;  2NTY A;  4O2B E;  2BVL A;  2X66 A;  4AQG A;  4OHF A;  4HN9 A;  1FMW A;  4P0B A;  2M67 A;  3P8C D;  2LSY A;  1D1B A;  2WAU A;  2IC9 A;  2ZM0 A;  5LHH B;  4ISS A;  3IHR A;  3ZMS B;  3F31 A;  3RKO A;  5KX5 E;  1IZN B;  4H9S E;  4ZS3 A;  4ZS2 A;  4CQI A;  4OFZ A;  4ILU A;  3O1H A;  4E7Z A;  1FIO A;  3FHN A;  4TX5 A;  3OYX A;  5LOV E;  5EK4 A;  2NW8 A;  3UTK A;  4EZ4 A;  3VKG A;  3CX8 B;  2KND A;  4ERR A;  1UCU A;  2LHN A;  4WW0 A;  2KXP B;  5LGU B;  4U72 A;  5JRC B;  2EHO B;  3KV4 A;  4O4J E;  3Q9D A;  3RYC E;  3O4X E;  4EOZ B;  3EDV A;  2HPJ A;  3CX7 B;  3OBV E;  3MJX A;  4KMC A;  4EXT A;  4ZI2 C;  4CI3 B;  2G0U A;  4YFS A;  2XUE A;  4FI5 A;  3C64 A;  4IDZ A;  2XQY A;  4BJM A;  1B7T A;  4H9R C;  2EHO C;  4J2C A;  3MKD A;  1OXZ A;  2YK0 A;  4UVB B;  3Q5X A;  4MBQ A;  3SS1 A;  3GN5 A;  1D0Z A;  4O8S A;  5DQV A;  3RC8 A;  4FJO A;  3OYZ A;  4CI2 B;  2A72 A;  3PUS A;  3NRY A;  4UVC B;  5FXV A;  4PJN A;  2ODV A;  2V7J A;  3UT5 E;  3DJB A;  2Y6X A;  5LBM A;  2MBG A;  4UV8 B;  5FXZ A;  2LSJ A;  2X9X A;  2OA5 A;  5L3F B;  3C4Z A;  3KVA A;  4DBQ A;  3KBU A;  4QXC B;  5J2T E;  2B1E A;  3O1J A;  4I50 E;  1UX4 A;  3PTR B;  3C51 A;  2LHR A;  4HFV A;  4KUM B;  4F6R C;  4O4H E;  4ZI2 D;  3PUA A;  5E0O A;  1US7 B;  4O2A E;  3QC9 A;  2LSK A;  4X1Y E;  3ZYK A;  5L3D B;  3C4X A;  4CZZ B;  2YEV C;  2I59 A;  1HFA A;  1G8X A;  2EHO D;  3MAC A;  4PK5 A;  4AKR B;  2UXX B;  1FMV A;  4C91 A;  3KVB A;  3MK7 C;  4DMW A;  3ZMT B;  4CXY A;  1D1C A;  4AKG A;  5F8P A;  2D2S A;  5H6R B;  3HKE E;  2C5I T;  2E9X A;  3I0Q A;  3K3O A;  3KFW X;  4IST A;  4YJ3 E;  5DAB A;  5LHI B;  2X68 A;  3ESL A;  3HL6 A;  3ZMZ B;  1LVK A;  4OYK A;  3N9P A;  4UEL A;  1UX5 A;  1MIV A;  3CQX C;  4Z8X A;  3KV6 A;  3E0Z A;  1Y64 B;  4L0R A;  3FBZ A;  1WYC A;  5J2U E;  4GK5 E;  4AQF A;  5LG4 A;  4PJM A;  2KLQ A;  4OYJ A;  2KWH A;  3F57 A;  3PUQ A;  4HTE A;  3I1A A;  3WI3 A;  1WRD A;  2VK9 A;  5HXC A;  1BR2 A;  5TAO A;  5A1L A;  2V7M A;  2X0L B;  3IF8 B;  5FXX A;  2CWY A;  1EZ3 A;  2ZM2 A;  3AA6 B;  4BA9 A;  5HWY A;  2YU2 A;  3GMI A;  4HEA A;  2H3R A;  3HKC E;  3R84 B;  2KMF A;  1S94 A;  4BAY B;  4GK0 E;  3UUX B;  4P09 A;  3TKL B;  5JDN A;  4EIW A;  5LGT B;  4CI1 B;  2Y48 B;  4UF0 B;  3IBP A;  4DND A;  3SOL A;  3RRC A;  3H3A A;  4QX8 B;  2LOS A;  1YD8 G;  2DI4 A;  4K0U A;  3M65 A;  3DP7 A;  2N1G A;  5H6Q B;  4EYU A;  3GWH A;  4IE6 A;  3BQI A;  3MA9 A;  5JDH A;  2IW5 B;  2A2F X;  2CWO A;  1ZHC A;  4AKL A;  2K24 A;  2WM9 A;  3KBT A;  5CA1 E;  2IC6 A;  3I0O A;  4ADZ A;  3VKH A;  4NUV A;  3FB2 A;  5LNK A;  1KK7 A;  5HWX A;  1S35 A;  2X51 A;  4WNK A;  5FXW A;  2CXL A;  3ZN0 B;  3ZMV B;  2P9B A;  5JDQ A;  2C5J A;  1X79 A;  3N9M A;  4G63 A;  2E9X B;  4PK6 A;  5FP3 A;  2J1D G;  4QWN B;  2ACX A;  2V7I A;  3PU8 A;  3CQG B;  2DHR A;  3RPU A;  3JC6 C;  3Q2M A;  2X9Y A;  1BR1 A;  2YU1 A;  1LKX A;  3LFM A;  4U74 A;  1CUN A;  3AVR A;  1WLX A;  3CML A;  3LG7 A;  5HXR A;  3RYF E;  2IAK A;  2V7L A;  4ASK A;  2E9X C;  1MMD A;  1KNZ A;  2Q9Q B;  2MTQ A;  1OWA A;  1SA0 E;  2KZ7 B;  3N5L A;  2MOZ A;  3W15 B;  4CXW A;  3N2K E;  3QK6 A;  2VWA A;  2JJ9 A;  5EK3 A;  1ZKE A;  3ZYM A;  4GYS A;  3B57 A;  1V9D A;  3ANW A;  3ZCI A;  2ES0 A;  3LK2 B;  1D0Y A;  2XAF B;  1HG5 A;  4A56 A;  5LA6 E;  3EUH A;  2Q9Q C;  4O4L E;  4H9N C;  4ANJ A;  4MHC A;  3ETV A;  4ZI3 C;  5LBQ B;  1D1A A;  2ODU A;  2WMN A;  4IE5 A;  2X67 A;  1QUU A;  4MLK A;  3B13 A;  2W62 A;  3ZEF B;  2KIN B;  4QX7 B;  2L9Q A;  3N9O A;  1U5P A;  2LT3 A;  2VKJ A;  4V1A v;  1FEW A;  2RP4 A;  3F2E A;  2UXN B;  5AFU L;  4IGU A;  2LSG A;  4UV9 B;  1H7C A;  3PE0 A;  4QXB B;  3ZJ1 A;  1NAF A;  4QHO A;  2JMH A;  5DQW A;  2D0U A;  2CXD A;  3RYH E;  3BQK A;  4GIW A;  4I4T E;  4UXN B;  1ZEE A;  2DWG A;  2LOP A;  3AB3 B;  4QXH B;  1BR4 A;  3RC3 A;  3UFE A;  2CMR A;  1LVF A;  1LRZ A;  4JEH B;  3ZC1 A;  3ZCJ A;  3FXD B;  2V26 A;  4H9O C;  3CKD A;  3SWH A;  2Q9Q D;  3L3P A;  2WBL A;  2KWI B;  5L3B B;  3VU7 H;  3J7Y q;  1HG2 A;  4ZHQ E;  1HX8 A;  3PDY A;  3OJA A;  3EVY A;  2JPF A;  5JDF A;  1AJ3 A;  1MMA A;  2BDE A;  1T98 A;  1IAP A;  4AXP A;  5L3E B;  3N9Q A;  3CWZ B;  3LJC A;  4KP3 C;  4UEM A;  3HKD E;  5DJQ C;  1MND A;  3T8O A;  3ZMU B;  2NOX A;  3ZLI A;  5LJM A;  2VKD A;  2K48 A;  3O9X A;  3O1I A;  2DLR A;  3ONX A;  5GON E;  4IE0 A;  5HXE A;  2PFV A;  1D0X A;  3VHL A;  3GN5 B;  2NTX A;  4UIG A;  4B6X A;  3HR0 A;  5LHG B;  3L09 A;  4JEU B;  2BVM A;  3BK9 A;  4TN7 B;  4I43 B;  5IYZ E;  1O3X A;  5JRC A;  2EHO A;  2CEA A;  4XZC A;  5LXT E;  2K5B B;  2NP9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...