2GK9A

Human phosphatidylinositol-4-phosphate 5-kinase, type ii, gamma
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
373
structure length
243
Chain Sequence
DPLVGVFLWGVAHSINELSQVPPPVMLLPDDFKASSKIKVNNHLFHRENLPSHFKFKEYCPQVFRNLRDRFGIDDQDYLVSLTRNPPSESEFLISYDRTLVIKEVSSEDIADMHSNLSNYHQYIVKCHGNTLLPQFLGMYRVSVDNEDSYMLVMRNMFSHRLPVHRKYDLKGTLRDMDNKNQKVYIKKIFLEKLKRDVEFLVQLKIMDYSLLLGIHDIEVYFMGLIDILHPEQYAKRFLDFIT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Human Phosphatidylinositol-4-phosphate 5-kinase, type II, gamma
rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords phosphatidylinositol-4-phosphate 5-kinase, type II, gamma
total genus 57
structure length 243
sequence length 373
chains with identical sequence B, C, D
ec nomenclature ec 2.7.1.149: 1-phosphatidylinositol-5-phosphate 4-kinase.
pdb deposition date 2006-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01504 PIP5K Phosphatidylinositol-4-phosphate 5-Kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1870 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2gk9A02
3.30.800.10 Alpha Beta 2-Layer Sandwich Phosphatidylinositol Phosphate Kinase II Beta Phosphatidylinositol Phosphate Kinase II Beta 2gk9A01
3X02A 3WZZA 3X06A 3X09A 3X05A 5E3SA 3X04A 2YBXA 3X08A 1BO1A 3X01A 3X03A 2GK9A 3X07A 3X0CA 4TZ7A 5E3UA 3X0AA 5E3TA 3X0BA
chains in the Genus database with same CATH superfamily
2P9BA 2QYWA 3F57A 5AQPB 3VRBA 2WSSV 3RX6A 2JMHA 1W9RA 3G06A 2BKNA 3B13A 4HN9A 4PJLA 1NAFA 3I9WA 3I0OA 4PW8A 5L47A 4Q25A 2X0HA 1YKEB 4IL9A 5LXTE 1UURA 2BG9B 5HEJA 1US7B 3LSVA 4UVAB 5FY0A 3Q5WA 4DUZT 5HXRA 2X9XA 3UTKA 3UU8A 1BO1A 2D2SA 3ZT5A 3T1YT 5E3UA 1XDPA 3C50A 1XMQT 2XPKA 5AQHB 2PJQA 3CK6A 3KFWX 1WFDA 3PE0A 2A3DA 3VRAA 2BG9E 3VR9A 3ZT6A 2LRKA 5LOVE 5HAXA 3UUBA 1G8XA 3OTOT 3UU6A 4GK5E 1FIOA 3FZFB 2OA5A 2XQ8A 3NBXX 3C64A 2N9DA 1CUNA 5CFBA 4YFSA 4YY3T 1HTJF 3AEFA 1D1AA 3FHNA 3KBTA 5EK3A 4DV4T 2F4VT 4GIWA 4PK5A 4HFHA 5A1LA 4YLHA 5E0OA 4JI3T 5E3TA 2PTFA 5ABHA 1E1HB 2UUAT 5L3EB 3AXJA 3AECA 2L3LA 2ODUA 5C3JA 2IDOB 2B76A 2NW8A 4LMJA 2MBGA 3MK7C 4O4HE 3FBLA 2DL1A 3GA8A 4JBWF 5FXWA 1M7KA 1ZEEA 2QA7A 3AAIA 4UV8B 4UV9B 5LMUT 3VR8A 2W66A 4PFOA 2IMLA 3RIAA 4O2BE 4P1NA 3LK2B 1HF8A 4YTMA 1W0AA 5FMNA 4C90A 4DR5T 3E0ZA 1QSDA 2NOXA 3L8RA 4HFEA 3ZN0B 2I0MA 5JREA 2Y8DA 1YW0A 3CX7B 3RH3A 4AI6A 4FJOA 3BQIA 4X64T 1J1JA 2WDRA 3AEGA 5FXVA 4PJJA 2UXXB 2V5DA 3RQWA 2J62A 5KXJA 1BR0A 3AB3B 2VVSA 4B3TT 4GYRA 3CMLA 3ONJA 3X03A 4AQGA 2W62A 1KNZA 2VK9A 2VURA 3QB5A 4U33A 3UQ7A 5JVDE 4DV5T 3PTRB 1V9DA 4M1PA 5IUXA 2W4XA 2BS4A 4IE6A 5FXZA 3UUNA 2VASA 1Z8UA 3AEBA 3UUMA 1ZHCA 2H88A 3HA4A 3BQLA 3QC9A 3M65A 3LG7A 2H7OA 4H9PC 1KNPA 1VCTA 4H63V 2QRXA 3FB2A 2CEAA 3C51A 4PJNA 3SFDA 3T1HT 3AAEB 3P50A 3LFMA 4O8SA 2KNDA 3CIRA 3F2EA 4IREA 3VKHA 4GKKT 3N9OA 4EEBA 4YTNA 4TNVA 2X9WA 2Q9QB 2V7JA 2Q9QC 1M62A 3AEDA 1H7CA 4JI0T 3WZZA 3WAKA 4CQIA 4L5GA 5AQNB 2CLYC 5AQRB 4DMWA 4TWDA 5ABEA 2WM9A 5L4EA 4H63H 4KUMB 4NPPA 4U72A 2VL8A 3AA6B 2HN2A 5JDMA 1JNZA 2ACXA 1W09A 4BA9A 2HHHT 2L9QA 3HKBE 4LF9T 2JQQA 3X08A 3PUSA 3FXDB 5JH7E 2YOEA 4KX6A 5LP6E 3EI0A 3UU5A 1HNXT 5L4HA 4DIDB 2IAKA 1E7PA 4H9QC 4BJNA 1OEDC 2MPKA 3Q5EA 1KK7A 4UXNB 2ZM6T 5FVKA 2LSIA 1W0BA 4MBQA 4BJMA 2CXDA 2JRKA 1XZYA 4EXTA 4U7IA 4EB6E 4DR2T 5EK4A 4AXPA 2PBIA 4EOZB 2RA1A 4IE5A 1B7TA 5FP3A 3ZCIA 4ZZBA 3N9MA 5EK2A 1VCSA 1XMOT 4JI8T 3P4QA 4OYJA 2WY2A 5FY7A 4NUUA 3UT5E 2W0GA 2LM2A 4DR4T 4QXBB 3MACA 2IC6A 3ZJ1A 4AISA 2QGSA 5LHGB 3CVRA 4XBFB 3UU3A 1N34T 1MIVA 2JIWA 4KBMB 3H3MA 2XQ4A 4ZI7E 1ZP0A 4HFBA 3ZYLA 1WR0A 1WYCA 2V6YB 2J4GA 2E9XC 2JMKA 4QH1A 4A97A 2LHRA 1Y64B 3PJAJ 2KT9A 4BAYB 1XNQT 3RYIE 3X0CA 2WBLA 2BVLA 3DP7A 3AEAA 2UUCT 3TLWA 2ZMAA 3K3NA 5HWYA 1FMVA 5AQQB 2NW7A 3ZYKA 4JUYA 1S35A 3O1IA 4JYAT 2LRLA 4EV6A 2YDSA 5H6QB 4DBRA 4TWHA 4P09A 2WU5A 1QLBA 4DV2T 2VL0A 2X66A 1G73A 5LJMA 5HCJA 3A7MA 3ZLIA 2JQKA 5CA1E 3C4WA 2LLYA 4AKRB 2CPTA 4EIWA 4HWFA 2Y48B 2VKOA 2CXLA 4GOUA 2LOSA 4KHZF 2NTXA 2VVNA 4H9NC 2WB5A 4CXWA 4AQFC 3NWIA 3ZC1A 4F6RC 5CB4E 3RIFA 4QXHB 2BBJA 5HEUA 1HS7A 1J5WA 5LCYA 4HFIA 3RRWA 4A98A 3NRYA 1IJ6A 4QH4A 1NWMX 5FVLA 2V7IA 2EHOC 3N2GE 4EZ4A 3Q5XA 2LSKA 2XQ5A 3ABVA 3E08A 5JR9A 2BKPA 1IBMT 5E3SA 2QVAA 1X79A 2LSJA 3A5XA 3P4SA 2X68A 3O9XA 3LBXB 3ZN1B 4DV3T 2X0YA 2UUBT 4I4TE 4U3CA 2BS3A 4ASKA 2IHR1 3HKDE 3ZC0A 2WQYA 4DNDA 1BR1A 4WZXA 2K5BB 1MNDA 3FBZA 3RIUA 3HKEE 4DVDA 2C5IT 4WBOA 2J1DG 5H6RB 1NEKA 1O3XA 2V7LA 2A2FX 1N36T 4IL4A 5FL0A 5L3DB 1EZ3A 5LJNA 2B1EA 3ZPOA 5IWAT 2YDRA 1I94T 3KBUA 4CN6A 5FL1A 2CRBA 3UQ4A 3AE3A 5AQUB 1KNRA 3ETVA 1NENA 4ERRA 3WAJA 2BBHA 4E7ZA 3X09A 4YHHT 2XHEB 3X01A 2WZHA 4DBQA 5AQOB 3SWHA 2XASB 5JDHA 3AA7B 4PNIA 4A5XA 5JQGE 2CHOA 5JTGA 3TLVA 2H89A 2UU9T 3X05A 1FJGT 4X20E 3EAMA 4PK6A 4EYYR 3QNUA 5JDQA 3ESLA 4CI3B 2XAGB 4YXDA 5J2UE 3EUHA 3EVYA 3RKOA 2WZIA 5ABGA 3RYFE 3X04A 2XQ7A 4YT0A 3RHWA 4LFCT 3PU8A 3R6NA 4IDOA 4ZHQE 2YN6A 4X1IE 3K1SA 4XAXB 2W63A 5EZYE 3U3IA 4DO0A 2PFVA 5HXEA 1MMGA 4HFVA 3V5SA 4YSYA 4DR6T 2GK9A 4TNWA 2NP9A 3JC6D 3EABA 5BMVE 3RRCA 4LF7T 5LG3A 1YXRA 3R84B 4V1Av 4OK0A 3AA0B 3L09A 3NVOA 3P4RA 2VQFT 3X06A 4O4LE 1S94A 4ZI2D 1ZKEA 1OEDB 3HKCE 2BDEA 5TAOA 2XAHB 3V5UA 3ZMZB 2AXDS 2E9XD 4YHJA 3ZYMA 4DV1T 5J1GA 3ZJ2A 2E5LT 2XM2A 3OPCA 4ADZA 2XY8B 3FXEB 3OKQA 3QB5K 4U31A 2Q9QD 1HG2A 3J7Yq 1X9BA 1FMWA 3JAEA 3KV6A 3ZMUB 3CX6B 3RLFF 3UFGA 1FEWA 5KX5E 3T8OA 4YJ3E 1OEDA 4MHCA 3PUYF 2CXFA 4L9IA 5IHYA 3K3QC 2WWVA 4DR7T 2XUEA 3EHZA 4X1YE 3FZLB 4QKNA 2AE9A 4H9RC 1MNEA 5LHIB 2WU2A 4NIQA 3SS1A 2XTLA 4DV0T 3I0QA 1R8IA 4WW0A 5HXSA 5AFUL 4QX7B 5CJ5A 5L3FB 3QOFA 4ISTA 3OJAA 3RYHE 4E7SA 5JRCB 3F31A 4LFBT 4WYVA 4HEAA 5LGNB 2Z6EA 4CI2B 2MOZA 3JAFA 3Q5DA 2CM0A 5HXHA 1BR2A 1Z0PA 3CPZA 4WNKA 2CBIA 3ZMTB 3PUQA 4HTEA 3N2OA 3P8CD 2WP9A 3DJBA 3MZKB 5AQTB 4TUYE 5HCMA 3BK9A 4YSXA 3X07A 2CHNA 5JR9C 2ES0A 4LF8T 2YU1A 5LBMA 2E9XB 3ANWB 4KP3C 1I6ZA 2WMOA 2WS3A 2K48A 2X67A 1D0YA 3PJAA 5DJQC 5LNKA 4LF5T 1BR4A 4UF0B 4U7YA 2BG9A 2ZM2A 3VHLA 5LGTB 2ZM8A 2VWAA 3NRXA 1IBKT 1Y01A 4HWCA 2N1GA 4LF4T 2CCQA 5L3GB 3HL6A 1UCUA 2DHRA 4UEMA 3AAAB 3SFEA 3ZSTA 3UFEA 2I6HA 3KINB 4AQFA 4AKIA 4EYUA 4AQYT 4H9OC 2KLQA 3N9LA 2LE8A 1WR6A 3AE2A 4IE0A 1MMDA 4TN7B 2IIUA 4UF0A 5AQVB 3AA1B 4XZCA 5LG4A 4ZOLE 4JI6T 5HWXA 1IJ5A 3OYXA 2FJDA 3L3PA 5L2LA 4QH5A 5F5WA 4WBNE 5JDLA 3UUXB 3AE8A 3TLTA 2XQ6A 3AE7A 2DWGA 2BS2A 3H37A 3KVBA 5HXCA 2WDQA 4LFAT 1HG5A 2HN1A 3AE1A 3ONXA 5L3CB 2DNXA 3CQCB 2LKHA 3CX8B 4TZ4C 3M3ZB 1IZNB 5ADXL 3X0BA 4HWDA 4GK0E 5F8PA 2WCAA 3C4ZA 4EZHA 2RP4A 4CN1A 2V26A 2IC9A 2E9XA 2NTYA 3ANWA 5HYAA 1N33T 3KVAA 2WDVA 4OX9T 3FZHB 5AQSB 3LK3B 4IDNA 1ZOYA 3PDYA 1LRZA 2D0UA 2W67A 2XQYA 2FJBA 2MTQA 3AE9A 4MALA 4U2YA 2IUBA 1YD8G 2X51A 4LMLA 4UR9A 2FUPA 4CZZB 3RC8A 5JDFA 1LVFA 3DTOA 4B3ST 2BKOA 3J9X1 5LB7B 4G63A 2LJLA 3AXJB 3C98B 2LM9A 3X1DA 4YTPA 5KDMC 2L8KA 2DLRA 2JJ9A 2A9UA 2YKSA 4FI5A 4JEHB 2YEVC 3RPUA 4AIUA 4CI1B 3GWHA 4AKGA 2WMNA 2XZEA 2EHOA 5J2TE 3KV5A 3RQUA 5HEOA 2DWKA 2JPFA 3X02A 3TLSA 3AVRA 3GMIA 2UXNB 3LDQB 3O4XE 4I55E 3ZT7A 2RPAA 4J2CA 3Q2MA 4H9SE 2KINB 4KI0F 4F8HA 3GN5A 2ZM0A 2SPCA 2E5VA 1KEYA 2N2NA 4PK4A 4EGWA 1HCIA 2NWBA 4B6XA 2EHOB 1ZV4X 4UVBB 2G0UA 1SE7A 3QUJA 2A72A 1XDOA 3WI3A 4JI4T 4ILCA 2K3WA 3JADA 1UX4A 4TV8E 3H3AA 2PG8A 5AQLB 4IDQA 4NXNT 2BZBA 2Q9QA 2K24A 4MLKA 5LA6E 4QX8B 1YQ4A 4OYKA 4TX5A 1OXZA 2LSYA 4I0UA 4PFPA 4HKAA 3RKGA 4QWNB 2YINA 1MMNA 2CA5A 5HEHA 3EDVA 4LMKA 3ZMSB 5CA0E 2LHNA 2ZLYA 3K3OA 4TV9E 2LT3A 3ZKRA 4DR3T 2ODVA 3N9NA 1LKXA 4I50E 3PURA 4IGUA 1UUSA 4ISSA 3P7IA 1VOMA 3FZKB 2YK0A 2ACZA 5AQIB 1U5PA 4UIGA 4GYSA 3P4WA 4JEUB 3GN5B 1VRBA 3O1HA 4JI5T 4YSZA 4X65T 5BR8T 2BG9C 3PU3A 3B5MA 1WCRA 3KV4A 2XQ9A 2C5KT 5ABFB 2NR4A 4HWIB 4Z90A 4ZS3A 2JQHA 3E22E 5GONE 3RYCE 3P4PA 2Y6XA 3ZCJA 2KWHA 4KHPT 2E2AA 3ONLC 1HX1B 4G2AA 5F3JA 5M4YA 3LK42 4ZI2C 5ABFA 1OEDE 2NW9A 2W00A 3LBXA 5AQGB 3RGLA 5LYJE 2V7KA 4X1KE 5C8YE 3MA9A 1HR0T 2V6YA 1YQ3A 3U78A 3JC6C 4UVCB 4ZI3D 3K8PC 2LOPA 3I9YA 1HX8A 3W15B 4GKJT 4ILBA 2DI4A 1KF6A 2VKJA 2XQAA 5AQFB 4IE4A 1JNRA 2OLTA 4Z91A 5DQVA 2XAQB 5JDGA 2VB6A 1D1CA 3N9PA 2IW5B 5AQMB 2C0SA 4PAGA 2XJ7A 1HNZT 4B3MT 1DU2A 5J0ZA 5JR9B 2OV9A 3N5LA 4ZEYA 3PUZF 2VQET 2V8SV 3CWZB 2BVMA 5FKYA 1GQEA 2UXBT 4AKHA 4HFCA 3VKGA 4DR1T 2YDQA 2V6XA 4HE8A 2KZ7B 2XM1A 3AVSA 2VKDA 3QK6A 2CLYB 4MFRA 4OFZA 2CMRA 3N9QA 3RF1A 1UGOA 4TWFA 2FJAA 5JDNA 3N2KE 1MMAA 4DMVA 2YU2A 1YKHB 3ETUA 1SHZC 3KDSE 1T98A 3S4UA 3TLUA 1IBLT 4K0UA 2H3RA 3IEEA 4DUYT 2JQ9A 5KMGP 2D5UA 4O4JE 2UXDT 1SA0E 3MJXA 2XSAA 5L3BB 3IA3A 1J5ET 4JI1T 4CXXA 4NUVA 4HGAA 4X62T 2K9AA 4DV6T 3EDUA 2FBWA 4JI7T 4CXYA 4EEDA 4LF6T 2W2UA 2XQ3A 4N78D 1D1BA 3IBPA 3SOLA 1SUMB 3NZQA 4ILAA 1MIWA 3Q9DA 3IF8B 3VU7H 5FXXA 2MAWA 1MIYA 2X0LB 1UX5A 1WYBA 2KXPB 2V7MA 2EHOD 1L0VA 4A56A 5HEGA 3PV0F 3TKLB 4HWHA 2UXCT 2KWIB 1WLXA 3IHRA 3MXZA 3PUVF 4ZXLA 1XNRT 2M6BA 5JRCA 3RC3A 3MKDA 3CKDA 2M67A 5DQWA 1U4QA 4AKLA 3AE5A 4ILUA 4KMCA 1UK5A 3UULA 4IHJE 4QXCB 4PJMA 4EAHA 4ZZCA 2WWUA 3FZMB 4IDZA 2R6GF 4HFDA 3AEEA 4X5TA 2I59A 2V1DB 1WRDA 4JLEA 4COFA 4YJ2E 4JV5T 2FJEA 1KFYA 2J47A 3PUGA 4OHFA 1QUUA 2M6IA 4JI2T 2D0TA 3PUXF 1XWMA 3PUWF 3AE6A 3I1AA 2C5JA 1T7SA 5LBQB 2HPLA 4QHOA 3D0TA 3O1JA 4ANJA 4IIJE 3A8YC 3ZMVB 2LSGA 4IE7A 5ETWA 5LHHB 1N32T 4TZ7A 2H7VC 2W61A 4DV7T 1AJ3A 3BQKA 1T72A 2E8IA 3L39A 4IDPA 2HH7A 3AE4A 3ZEFB 3RIUC 1IAPA 2X9YA 4C91A 3CQGB 3LJCA 4I43B 1E2AA 2CBJA 5CGMA 2VKHA 4B3RT 2KMFA 4O2AE 4ZS2A 5DABA 3CQXC 4Z8XA 5LMNT 1OWAA 3NKZA 4P0BA 2X9HA 3HR0A 2LEHA 5AQKB 1LVKA 3UU4A 2V5CA 2CWOA 1D0XA 4L0RA 2WAUA 1T8BA 2HPJA 5LGUB 3RI5A 4U2ZA 5FNVE 2KSRA 3PUAA 4CN4A 4NXMT 2CE7A 2YBXA 2LKGA 2MYSA 1CHUA 2XAFB 4UELA 3B57A 4O4IE 5FYMA 4IT4A 5FY1A 4ZI3C 4U74A 3OBVE 4K0KT 5AQJB 2XSBA 3HI2A 4X66T 3SRZA 3ZSSA 5C2TA 3C4XA 2D9DA 3OVUA 2XAJB 3NZPA 1HNWT 4P0AA 1HFAA 3JCFA 1D0ZA 2CWYA 3KV9A 3OYZA 5IYZE 3X0AA 2DCFA
chains in the Genus database with same CATH topology
2P9BA 3F57A 2WSSV 3RX6A 2JMHA 4HN9A 3B13A 4PJLA 1NAFA 3I9WA 3I0OA 4PW8A 1YKEB 5LXTE 1US7B 4UVAB 5FY0A 1BO1A 3Q5WA 5HXRA 2X9XA 3UTKA 2D2SA 5E3UA 3C50A 2PJQA 3KFWX 3PE0A 2A3DA 5LOVE 5HAXA 1G8XA 4GK5E 1FIOA 2OA5A 3NBXX 3C64A 2N9DA 1CUNA 3J7Yq 4YFSA 1HTJF 1D1AA 3FHNA 3KBTA 5EK3A 4GIWA 4PK5A 5A1LA 5E3TA 4YLHA 5E0OA 1E1HB 5L3EB 2L3LA 2ODUA 2NW8A 2MBGA 3MK7C 4O4HE 3FBLA 3GA8A 5FXWA 1ZEEA 2QA7A 4UV8B 3AAIA 4UV9B 4PFOA 4C90A 4O2BE 5FMNA 3LK2B 1HF8A 3E0ZA 1QSDA 2NOXA 3ZN0B 5JREA 2Y8DA 1YW0A 3CX7B 3RH3A 4AI6A 4FJOA 3BQIA 5FXVA 4PJJA 2UXXB 1BR0A 3AB3B 4GYRA 3CMLA 3X03A 4AQGA 2W62A 1KNZA 2VK9A 5JVDE 3PTRB 1V9DA 4M1PA 4IE6A 5FXZA 3UUNA 2VASA 3UUMA 1ZHCA 3HA4A 3QC9A 3BQLA 3M65A 3LG7A 2H7OA 4H9PC 4H63V 3FB2A 2CEAA 3C51A 4PJNA 3AAEB 3LFMA 4O8SA 2KNDA 3F2EA 3VKHA 3N9OA 2X9WA 2Q9QB 2V7JA 2Q9QC 1H7CA 3WZZA 3WAKA 4CQIA 4L5GA 4DMWA 2CLYC 2WM9A 4H63H 4KUMB 4U72A 2VL8A 3AA6B 5JDMA 2ACXA 4BA9A 2L9QA 3HKBE 2JQQA 3PUSA 3FXDB 5JH7E 5LP6E 2IAKA 4H9QC 4BJNA 1KK7A 4UXNB 2LSIA 4MBQA 4BJMA 2CXDA 2JRKA 4EXTA 4EB6E 5EK4A 4AXPA 2PBIA 4EOZB 2RA1A 4IE5A 1B7TA 5FP3A 3ZCIA 3N9MA 5EK2A 4OYJA 5FY7A 4NUUA 3UT5E 2W0GA 4QXBB 3MACA 2IC6A 3ZJ1A 2QGSA 5LHGB 3CVRA 4XBFB 1MIVA 4KBMB 4ZI7E 3ZYLA 1WYCA 3X01A 2E9XC 2JMKA 2LHRA 1Y64B 2KT9A 4BAYB 3X0CA 3RYIE 2WBLA 2BVLA 3DP7A 2ZMAA 3K3NA 5HWYA 1FMVA 2NW7A 3ZYKA 4JUYA 1S35A 3O1IA 5H6QB 4DBRA 4P09A 2X66A 1G73A 5LJMA 3ZLIA 3C4WA 4AKRB 4EIWA 2Y48B 2VKOA 2CXLA 4GOUA 2LOSA 2NTXA 4H9NC 4CXWA 4AQFC 4F6RC 3ZC1A 5CB4E 4QXHB 1HS7A 5LCYA 3RRWA 3NRYA 1IJ6A 1NWMX 2V7IA 2EHOC 3N2GE 4EZ4A 3Q5XA 2LSKA 3E08A 5JR9A 5E3SA 1X79A 2LSJA 3A5XA 2X68A 3O9XA 3LBXB 3ZN1B 4I4TE 4ASKA 3HKDE 3ZC0A 4DNDA 1BR1A 2K5BB 1MNDA 3FBZA 3HKEE 4DVDA 2C5IT 4WBOA 2J1DG 5H6RB 1O3XA 2V7LA 2A2FX 5L3DB 5LJNA 1EZ3A 2B1EA 3ZPOA 3KBUA 3WAJA 4ERRA 3X09A 3ETVA 4E7ZA 2XHEB 4DBQA 3SWHA 5JDHA 2XASB 3AA7B 4PNIA 5JQGE 3X05A 4X20E 4PK6A 4EYYR 5JDQA 3ESLA 2XAGB 5J2UE 3EUHA 3EVYA 3RKOA 3RYFE 3X04A 3PU8A 3R6NA 4ZHQE 4X1IE 4XAXB 5EZYE 2W63A 4DO0A 3U3IA 2PFVA 5HXEA 1MMGA 4HFVA 3V5SA 2GK9A 2NP9A 3JC6D 5BMVE 3RRCA 3R84B 4V1Av 4OK0A 3AA0B 3L09A 3X06A 4O4LE 1S94A 4ZI2D 1ZKEA 3HKCE 3ZMZB 2BDEA 5TAOA 2XAHB 3V5UA 3ZYMA 2E9XD 4YHJA 5J1GA 3ZJ2A 4ADZA 3FXEB 3OKQA 1HG2A 2Q9QD 1FMWA 3KV6A 3ZMUB 3CX6B 5KX5E 1FEWA 3T8OA 4YJ3E 4MHCA 2CXFA 4L9IA 5IHYA 3K3QC 2XUEA 4X1YE 4QKNA 5LHIB 4H9RC 1MNEA 3SS1A 2XTLA 3I0QA 4WW0A 5HXSA 5AFUL 4QX7B 5L3FB 4ISTA 5JRCB 3OJAA 3RYHE 4E7SA 3F31A 4HEAA 5LGNB 2Z6EA 4CI2B 2MOZA 5HXHA 2CM0A 1BR2A 1Z0PA 3CPZA 4WNKA 3ZMTB 3PUQA 4HTEA 3N2OA 3P8CD 4CI3B 3DJBA 3MZKB 3X08A 4TUYE 3X07A 3BK9A 5JR9C 2ES0A 2YU1A 5LBMA 2E9XB 3ANWB 4KP3C 2WMOA 2K48A 2X67A 1D0YA 5DJQC 5LNKA 1BR4A 4UF0B 2ZM2A 5LGTB 3VHLA 2ZM8A 2VWAA 3NRXA 2N1GA 2CCQA 5L3GB 3HL6A 1UCUA 2DHRA 4UEMA 3AAAB 3UFEA 3KINB 4AQFA 4AKIA 4EYUA 4H9OC 2KLQA 3N9LA 2LE8A 1WR6A 4IE0A 4TN7B 1MMDA 4UF0A 5LG4A 5JRCA 3AA1B 4XZCA 4ZOLE 5HWXA 1IJ5A 3OYXA 3L3PA 5L2LA 4WBNE 5JDLA 3UUXB 3H37A 2DWGA 3KVBA 5HXCA 1HG5A 3ONXA 5L3CB 2DNXA 3CQCB 3CX8B 4TZ4C 1IZNB 5ADXL 3X0BA 4GK0E 5F8PA 3C4ZA 4EZHA 2RP4A 2V26A 2IC9A 2E9XA 2NTYA 3ANWA 5HYAA 3KVAA 3LK3B 3PDYA 1LRZA 2D0UA 2XQYA 2MTQA 4MALA 1YD8G 2X51A 4CZZB 3RC8A 5JDFA 1LVFA 3DTOA 3J9X1 4G63A 2LJLA 3C98B 2LM9A 5KDMC 2L8KA 2DLRA 2JJ9A 4FI5A 4JEHB 3RPUA 4AKGA 2YEVC 4CI1B 3GWHA 2WMNA 2EHOA 5J2TE 3KV5A 2DWKA 2JPFA 3X02A 3AVRA 3GMIA 2UXNB 3O4XE 4I55E 4J2CA 3Q2MA 4H9SE 2KINB 3GN5A 2ZM0A 2SPCA 4PK4A 2N2NA 1HCIA 2NWBA 4B6XA 2EHOB 1ZV4X 4UVBB 2G0UA 3QUJA 2A72A 3WI3A 4TV8E 1UX4A 3H3AA 2PG8A 2BZBA 2Q9QA 2K24A 4MLKA 5LA6E 4QX8B 4OYKA 4TX5A 1OXZA 2LSYA 4PFPA 4HKAA 4QWNB 2YINA 1MMNA 2CA5A 3EDVA 3ZMSB 5CA0E 2ZLYA 2LHNA 3K3OA 4TV9E 2LT3A 2ODVA 3N9NA 1LKXA 4I50E 3PURA 4IGUA 4ISSA 3P7IA 1VOMA 2YK0A 1U5PA 4UIGA 4GYSA 4JEUB 3GN5B 1VRBA 3O1HA 3PU3A 3KV4A 2C5KT 4ZS3A 5GONE 3RYCE 3E22E 2Y6XA 3ZCJA 2KWHA 4G2AA 5F3JA 5M4YA 3LK42 4ZI2C 2NW9A 2W00A 3LBXA 5LYJE 2V7KA 4X1KE 5C8YE 3MA9A 3U78A 3JC6C 4UVCB 4ZI3D 3K8PC 2LOPA 3I9YA 1HX8A 3W15B 2DI4A 2VKJA 4IE4A 5DQVA 2XAQB 5JDGA 2VB6A 1D1CA 3N9PA 2IW5B 2C0SA 4PAGA 5JR9B 3N5LA 4AKHA 3CWZB 2BVMA 3VKGA 4HE8A 2KZ7B 3AVSA 2VKDA 3QK6A 2CLYB 4MFRA 4OFZA 2CMRA 3N9QA 5JDNA 3N2KE 1MMAA 4DMVA 2YU2A 1YKHB 3ETUA 1SHZC 3KDSE 1T98A 3S4UA 4K0UA 2H3RA 3IEEA 5KMGP 2D5UA 4O4JE 1SA0E 3MJXA 5L3BB 4CXXA 4NUVA 4HGAA 2K9AA 3EDUA 4CXYA 4N78D 1D1BA 3IBPA 3SOLA 3NZQA 1MIWA 3Q9DA 3IF8B 3VU7H 5FXXA 1MIYA 2X0LB 1UX5A 1WYBA 2KXPB 2V7MA 2EHOD 4A56A 3TKLB 2KWIB 1WLXA 3IHRA 3MXZA 3RC3A 3MKDA 3CKDA 2M67A 5DQWA 1U4QA 4AKLA 4ILUA 4KMCA 3UULA 5CA1E 4IHJE 4QXCB 4PJMA 4EAHA 2WWUA 4IDZA 2I59A 2V1DB 1WRDA 4JLEA 4YJ2E 3PUGA 4OHFA 1QUUA 2D0TA 3I1AA 2C5JA 5LBQB 2HPLA 4QHOA 3D0TA 3O1JA 4ANJA 4IIJE 3ZMVB 2LSGA 4IE7A 5ETWA 5LHHB 4TZ7A 2H7VC 2W61A 1AJ3A 3BQKA 2E8IA 2HH7A 3ZEFB 1IAPA 2X9YA 4C91A 3CQGB 3LJCA 4I43B 2VKHA 2KMFA 4O2AE 4ZS2A 5DABA 3CQXC 4Z8XA 1OWAA 4P0BA 2X9HA 3HR0A 2LEHA 1LVKA 4L0RA 2CWOA 1D0XA 2WAUA 2HPJA 5LGUB 5FNVE 3PUAA 2CE7A 2YBXA 4UELA 2MYSA 2XAFB 5FYMA 4ZI3C 3B57A 4O4IE 5FY1A 4U74A 3OBVE 3HI2A 3SRZA 3C4XA 2XAJB 3NZPA 4P0AA 1HFAA 1D0ZA 2CWYA 3KV9A 3OYZA 5IYZE 3X0AA 2DCFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3X02 A;  3WZZ A;  3X06 A;  3X09 A;  3X05 A;  5E3S A;  3X04 A;  2YBX A;  3X08 A;  1BO1 A;  3X01 A;  3X03 A;  2GK9 A;  3X07 A;  3X0C A;  4TZ7 A;  5E3U A;  3X0A A;  5E3T A;  3X0B A; 
#chains in the Genus database with same CATH topology
 2P9B A;  2QYW A;  3F57 A;  5AQP B;  3VRB A;  2WSS V;  3RX6 A;  2JMH A;  1W9R A;  3G06 A;  2BKN A;  3B13 A;  4HN9 A;  4PJL A;  1NAF A;  3I9W A;  3I0O A;  4PW8 A;  5L47 A;  4Q25 A;  2X0H A;  1YKE B;  4IL9 A;  5LXT E;  1UUR A;  2BG9 B;  5HEJ A;  1US7 B;  3LSV A;  4UVA B;  5FY0 A;  3Q5W A;  4DUZ T;  5HXR A;  2X9X A;  3UTK A;  3UU8 A;  1BO1 A;  2D2S A;  3ZT5 A;  3T1Y T;  5E3U A;  1XDP A;  3C50 A;  1XMQ T;  2XPK A;  5AQH B;  2PJQ A;  3CK6 A;  3KFW X;  1WFD A;  3PE0 A;  2A3D A;  3VRA A;  2BG9 E;  3VR9 A;  3ZT6 A;  2LRK A;  5LOV E;  5HAX A;  3UUB A;  1G8X A;  3OTO T;  3UU6 A;  4GK5 E;  1FIO A;  3FZF B;  2OA5 A;  2XQ8 A;  3NBX X;  3C64 A;  2N9D A;  1CUN A;  5CFB A;  4YFS A;  4YY3 T;  1HTJ F;  3AEF A;  1D1A A;  3FHN A;  3KBT A;  5EK3 A;  4DV4 T;  2F4V T;  4GIW A;  4PK5 A;  4HFH A;  5A1L A;  4YLH A;  5E0O A;  4JI3 T;  5E3T A;  2PTF A;  5ABH A;  1E1H B;  2UUA T;  5L3E B;  3AXJ A;  3AEC A;  2L3L A;  2ODU A;  5C3J A;  2IDO B;  2B76 A;  2NW8 A;  4LMJ A;  2MBG A;  3MK7 C;  4O4H E;  3FBL A;  2DL1 A;  3GA8 A;  4JBW F;  5FXW A;  1M7K A;  1ZEE A;  2QA7 A;  3AAI A;  4UV8 B;  4UV9 B;  5LMU T;  3VR8 A;  2W66 A;  4PFO A;  2IML A;  3RIA A;  4O2B E;  4P1N A;  3LK2 B;  1HF8 A;  4YTM A;  1W0A A;  5FMN A;  4C90 A;  4DR5 T;  3E0Z A;  1QSD A;  2NOX A;  3L8R A;  4HFE A;  3ZN0 B;  2I0M A;  5JRE A;  2Y8D A;  1YW0 A;  3CX7 B;  3RH3 A;  4AI6 A;  4FJO A;  3BQI A;  4X64 T;  1J1J A;  2WDR A;  3AEG A;  5FXV A;  4PJJ A;  2UXX B;  2V5D A;  3RQW A;  2J62 A;  5KXJ A;  1BR0 A;  3AB3 B;  2VVS A;  4B3T T;  4GYR A;  3CML A;  3ONJ A;  3X03 A;  4AQG A;  2W62 A;  1KNZ A;  2VK9 A;  2VUR A;  3QB5 A;  4U33 A;  3UQ7 A;  5JVD E;  4DV5 T;  3PTR B;  1V9D A;  4M1P A;  5IUX A;  2W4X A;  2BS4 A;  4IE6 A;  5FXZ A;  3UUN A;  2VAS A;  1Z8U A;  3AEB A;  3UUM A;  1ZHC A;  2H88 A;  3HA4 A;  3BQL A;  3QC9 A;  3M65 A;  3LG7 A;  2H7O A;  4H9P C;  1KNP A;  1VCT A;  4H63 V;  2QRX A;  3FB2 A;  2CEA A;  3C51 A;  4PJN A;  3SFD A;  3T1H T;  3AAE B;  3P50 A;  3LFM A;  4O8S A;  2KND A;  3CIR A;  3F2E A;  4IRE A;  3VKH A;  4GKK T;  3N9O A;  4EEB A;  4YTN A;  4TNV A;  2X9W A;  2Q9Q B;  2V7J A;  2Q9Q C;  1M62 A;  3AED A;  1H7C A;  4JI0 T;  3WZZ A;  3WAK A;  4CQI A;  4L5G A;  5AQN B;  2CLY C;  5AQR B;  4DMW A;  4TWD A;  5ABE A;  2WM9 A;  5L4E A;  4H63 H;  4KUM B;  4NPP A;  4U72 A;  2VL8 A;  3AA6 B;  2HN2 A;  5JDM A;  1JNZ A;  2ACX A;  1W09 A;  4BA9 A;  2HHH T;  2L9Q A;  3HKB E;  4LF9 T;  2JQQ A;  3X08 A;  3PUS A;  3FXD B;  5JH7 E;  2YOE A;  4KX6 A;  5LP6 E;  3EI0 A;  3UU5 A;  1HNX T;  5L4H A;  4DID B;  2IAK A;  1E7P A;  4H9Q C;  4BJN A;  1OED C;  2MPK A;  3Q5E A;  1KK7 A;  4UXN B;  2ZM6 T;  5FVK A;  2LSI A;  1W0B A;  4MBQ A;  4BJM A;  2CXD A;  2JRK A;  1XZY A;  4EXT A;  4U7I A;  4EB6 E;  4DR2 T;  5EK4 A;  4AXP A;  2PBI A;  4EOZ B;  2RA1 A;  4IE5 A;  1B7T A;  5FP3 A;  3ZCI A;  4ZZB A;  3N9M A;  5EK2 A;  1VCS A;  1XMO T;  4JI8 T;  3P4Q A;  4OYJ A;  2WY2 A;  5FY7 A;  4NUU A;  3UT5 E;  2W0G A;  2LM2 A;  4DR4 T;  4QXB B;  3MAC A;  2IC6 A;  3ZJ1 A;  4AIS A;  2QGS A;  5LHG B;  3CVR A;  4XBF B;  3UU3 A;  1N34 T;  1MIV A;  2JIW A;  4KBM B;  3H3M A;  2XQ4 A;  4ZI7 E;  1ZP0 A;  4HFB A;  3ZYL A;  1WR0 A;  1WYC A;  2V6Y B;  2J4G A;  2E9X C;  2JMK A;  4QH1 A;  4A97 A;  2LHR A;  1Y64 B;  3PJA J;  2KT9 A;  4BAY B;  1XNQ T;  3RYI E;  3X0C A;  2WBL A;  2BVL A;  3DP7 A;  3AEA A;  2UUC T;  3TLW A;  2ZMA A;  3K3N A;  5HWY A;  1FMV A;  5AQQ B;  2NW7 A;  3ZYK A;  4JUY A;  1S35 A;  3O1I A;  4JYA T;  2LRL A;  4EV6 A;  2YDS A;  5H6Q B;  4DBR A;  4TWH A;  4P09 A;  2WU5 A;  1QLB A;  4DV2 T;  2VL0 A;  2X66 A;  1G73 A;  5LJM A;  5HCJ A;  3A7M A;  3ZLI A;  2JQK A;  5CA1 E;  3C4W A;  2LLY A;  4AKR B;  2CPT A;  4EIW A;  4HWF A;  2Y48 B;  2VKO A;  2CXL A;  4GOU A;  2LOS A;  4KHZ F;  2NTX A;  2VVN A;  4H9N C;  2WB5 A;  4CXW A;  4AQF C;  3NWI A;  3ZC1 A;  4F6R C;  5CB4 E;  3RIF A;  4QXH B;  2BBJ A;  5HEU A;  1HS7 A;  1J5W A;  5LCY A;  4HFI A;  3RRW A;  4A98 A;  3NRY A;  1IJ6 A;  4QH4 A;  1NWM X;  5FVL A;  2V7I A;  2EHO C;  3N2G E;  4EZ4 A;  3Q5X A;  2LSK A;  2XQ5 A;  3ABV A;  3E08 A;  5JR9 A;  2BKP A;  1IBM T;  5E3S A;  2QVA A;  1X79 A;  2LSJ A;  3A5X A;  3P4S A;  2X68 A;  3O9X A;  3LBX B;  3ZN1 B;  4DV3 T;  2X0Y A;  2UUB T;  4I4T E;  4U3C A;  2BS3 A;  4ASK A;  2IHR 1;  3HKD E;  3ZC0 A;  2WQY A;  4DND A;  1BR1 A;  4WZX A;  2K5B B;  1MND A;  3FBZ A;  3RIU A;  3HKE E;  4DVD A;  2C5I T;  4WBO A;  2J1D G;  5H6R B;  1NEK A;  1O3X A;  2V7L A;  2A2F X;  1N36 T;  4IL4 A;  5FL0 A;  5L3D B;  1EZ3 A;  5LJN A;  2B1E A;  3ZPO A;  5IWA T;  2YDR A;  1I94 T;  3KBU A;  4CN6 A;  5FL1 A;  2CRB A;  3UQ4 A;  3AE3 A;  5AQU B;  1KNR A;  3ETV A;  1NEN A;  4ERR A;  3WAJ A;  2BBH A;  4E7Z A;  3X09 A;  4YHH T;  2XHE B;  3X01 A;  2WZH A;  4DBQ A;  5AQO B;  3SWH A;  2XAS B;  5JDH A;  3AA7 B;  4PNI A;  4A5X A;  5JQG E;  2CHO A;  5JTG A;  3TLV A;  2H89 A;  2UU9 T;  3X05 A;  1FJG T;  4X20 E;  3EAM A;  4PK6 A;  4EYY R;  3QNU A;  5JDQ A;  3ESL A;  4CI3 B;  2XAG B;  4YXD A;  5J2U E;  3EUH A;  3EVY A;  3RKO A;  2WZI A;  5ABG A;  3RYF E;  3X04 A;  2XQ7 A;  4YT0 A;  3RHW A;  4LFC T;  3PU8 A;  3R6N A;  4IDO A;  4ZHQ E;  2YN6 A;  4X1I E;  3K1S A;  4XAX B;  2W63 A;  5EZY E;  3U3I A;  4DO0 A;  2PFV A;  5HXE A;  1MMG A;  4HFV A;  3V5S A;  4YSY A;  4DR6 T;  2GK9 A;  4TNW A;  2NP9 A;  3JC6 D;  3EAB A;  5BMV E;  3RRC A;  4LF7 T;  5LG3 A;  1YXR A;  3R84 B;  4V1A v;  4OK0 A;  3AA0 B;  3L09 A;  3NVO A;  3P4R A;  2VQF T;  3X06 A;  4O4L E;  1S94 A;  4ZI2 D;  1ZKE A;  1OED B;  3HKC E;  2BDE A;  5TAO A;  2XAH B;  3V5U A;  3ZMZ B;  2AXD S;  2E9X D;  4YHJ A;  3ZYM A;  4DV1 T;  5J1G A;  3ZJ2 A;  2E5L T;  2XM2 A;  3OPC A;  4ADZ A;  2XY8 B;  3FXE B;  3OKQ A;  3QB5 K;  4U31 A;  2Q9Q D;  1HG2 A;  3J7Y q;  1X9B A;  1FMW A;  3JAE A;  3KV6 A;  3ZMU B;  3CX6 B;  3RLF F;  3UFG A;  1FEW A;  5KX5 E;  3T8O A;  4YJ3 E;  1OED A;  4MHC A;  3PUY F;  2CXF A;  4L9I A;  5IHY A;  3K3Q C;  2WWV A;  4DR7 T;  2XUE A;  3EHZ A;  4X1Y E;  3FZL B;  4QKN A;  2AE9 A;  4H9R C;  1MNE A;  5LHI B;  2WU2 A;  4NIQ A;  3SS1 A;  2XTL A;  4DV0 T;  3I0Q A;  1R8I A;  4WW0 A;  5HXS A;  5AFU L;  4QX7 B;  5CJ5 A;  5L3F B;  3QOF A;  4IST A;  3OJA A;  3RYH E;  4E7S A;  5JRC B;  3F31 A;  4LFB T;  4WYV A;  4HEA A;  5LGN B;  2Z6E A;  4CI2 B;  2MOZ A;  3JAF A;  3Q5D A;  2CM0 A;  5HXH A;  1BR2 A;  1Z0P A;  3CPZ A;  4WNK A;  2CBI A;  3ZMT B;  3PUQ A;  4HTE A;  3N2O A;  3P8C D;  2WP9 A;  3DJB A;  3MZK B;  5AQT B;  4TUY E;  5HCM A;  3BK9 A;  4YSX A;  3X07 A;  2CHN A;  5JR9 C;  2ES0 A;  4LF8 T;  2YU1 A;  5LBM A;  2E9X B;  3ANW B;  4KP3 C;  1I6Z A;  2WMO A;  2WS3 A;  2K48 A;  2X67 A;  1D0Y A;  3PJA A;  5DJQ C;  5LNK A;  4LF5 T;  1BR4 A;  4UF0 B;  4U7Y A;  2BG9 A;  2ZM2 A;  3VHL A;  5LGT B;  2ZM8 A;  2VWA A;  3NRX A;  1IBK T;  1Y01 A;  4HWC A;  2N1G A;  4LF4 T;  2CCQ A;  5L3G B;  3HL6 A;  1UCU A;  2DHR A;  4UEM A;  3AAA B;  3SFE A;  3ZST A;  3UFE A;  2I6H A;  3KIN B;  4AQF A;  4AKI A;  4EYU A;  4AQY T;  4H9O C;  2KLQ A;  3N9L A;  2LE8 A;  1WR6 A;  3AE2 A;  4IE0 A;  1MMD A;  4TN7 B;  2IIU A;  4UF0 A;  5AQV B;  3AA1 B;  4XZC A;  5LG4 A;  4ZOL E;  4JI6 T;  5HWX A;  1IJ5 A;  3OYX A;  2FJD A;  3L3P A;  5L2L A;  4QH5 A;  5F5W A;  4WBN E;  5JDL A;  3UUX B;  3AE8 A;  3TLT A;  2XQ6 A;  3AE7 A;  2DWG A;  2BS2 A;  3H37 A;  3KVB A;  5HXC A;  2WDQ A;  4LFA T;  1HG5 A;  2HN1 A;  3AE1 A;  3ONX A;  5L3C B;  2DNX A;  3CQC B;  2LKH A;  3CX8 B;  4TZ4 C;  3M3Z B;  1IZN B;  5ADX L;  3X0B A;  4HWD A;  4GK0 E;  5F8P A;  2WCA A;  3C4Z A;  4EZH A;  2RP4 A;  4CN1 A;  2V26 A;  2IC9 A;  2E9X A;  2NTY A;  3ANW A;  5HYA A;  1N33 T;  3KVA A;  2WDV A;  4OX9 T;  3FZH B;  5AQS B;  3LK3 B;  4IDN A;  1ZOY A;  3PDY A;  1LRZ A;  2D0U A;  2W67 A;  2XQY A;  2FJB A;  2MTQ A;  3AE9 A;  4MAL A;  4U2Y A;  2IUB A;  1YD8 G;  2X51 A;  4LML A;  4UR9 A;  2FUP A;  4CZZ B;  3RC8 A;  5JDF A;  1LVF A;  3DTO A;  4B3S T;  2BKO A;  3J9X 1;  5LB7 B;  4G63 A;  2LJL A;  3AXJ B;  3C98 B;  2LM9 A;  3X1D A;  4YTP A;  5KDM C;  2L8K A;  2DLR A;  2JJ9 A;  2A9U A;  2YKS A;  4FI5 A;  4JEH B;  2YEV C;  3RPU A;  4AIU A;  4CI1 B;  3GWH A;  4AKG A;  2WMN A;  2XZE A;  2EHO A;  5J2T E;  3KV5 A;  3RQU A;  5HEO A;  2DWK A;  2JPF A;  3X02 A;  3TLS A;  3AVR A;  3GMI A;  2UXN B;  3LDQ B;  3O4X E;  4I55 E;  3ZT7 A;  2RPA A;  4J2C A;  3Q2M A;  4H9S E;  2KIN B;  4KI0 F;  4F8H A;  3GN5 A;  2ZM0 A;  2SPC A;  2E5V A;  1KEY A;  2N2N A;  4PK4 A;  4EGW A;  1HCI A;  2NWB A;  4B6X A;  2EHO B;  1ZV4 X;  4UVB B;  2G0U A;  1SE7 A;  3QUJ A;  2A72 A;  1XDO A;  3WI3 A;  4JI4 T;  4ILC A;  2K3W A;  3JAD A;  1UX4 A;  4TV8 E;  3H3A A;  2PG8 A;  5AQL B;  4IDQ A;  4NXN T;  2BZB A;  2Q9Q A;  2K24 A;  4MLK A;  5LA6 E;  4QX8 B;  1YQ4 A;  4OYK A;  4TX5 A;  1OXZ A;  2LSY A;  4I0U A;  4PFP A;  4HKA A;  3RKG A;  4QWN B;  2YIN A;  1MMN A;  2CA5 A;  5HEH A;  3EDV A;  4LMK A;  3ZMS B;  5CA0 E;  2LHN A;  2ZLY A;  3K3O A;  4TV9 E;  2LT3 A;  3ZKR A;  4DR3 T;  2ODV A;  3N9N A;  1LKX A;  4I50 E;  3PUR A;  4IGU A;  1UUS A;  4ISS A;  3P7I A;  1VOM A;  3FZK B;  2YK0 A;  2ACZ A;  5AQI B;  1U5P A;  4UIG A;  4GYS A;  3P4W A;  4JEU B;  3GN5 B;  1VRB A;  3O1H A;  4JI5 T;  4YSZ A;  4X65 T;  5BR8 T;  2BG9 C;  3PU3 A;  3B5M A;  1WCR A;  3KV4 A;  2XQ9 A;  2C5K T;  5ABF B;  2NR4 A;  4HWI B;  4Z90 A;  4ZS3 A;  2JQH A;  3E22 E;  5GON E;  3RYC E;  3P4P A;  2Y6X A;  3ZCJ A;  2KWH A;  4KHP T;  2E2A A;  3ONL C;  1HX1 B;  4G2A A;  5F3J A;  5M4Y A;  3LK4 2;  4ZI2 C;  5ABF A;  1OED E;  2NW9 A;  2W00 A;  3LBX A;  5AQG B;  3RGL A;  5LYJ E;  2V7K A;  4X1K E;  5C8Y E;  3MA9 A;  1HR0 T;  2V6Y A;  1YQ3 A;  3U78 A;  3JC6 C;  4UVC B;  4ZI3 D;  3K8P C;  2LOP A;  3I9Y A;  1HX8 A;  3W15 B;  4GKJ T;  4ILB A;  2DI4 A;  1KF6 A;  2VKJ A;  2XQA A;  5AQF B;  4IE4 A;  1JNR A;  2OLT A;  4Z91 A;  5DQV A;  2XAQ B;  5JDG A;  2VB6 A;  1D1C A;  3N9P A;  2IW5 B;  5AQM B;  2C0S A;  4PAG A;  2XJ7 A;  1HNZ T;  4B3M T;  1DU2 A;  5J0Z A;  5JR9 B;  2OV9 A;  3N5L A;  4ZEY A;  3PUZ F;  2VQE T;  2V8S V;  3CWZ B;  2BVM A;  5FKY A;  1GQE A;  2UXB T;  4AKH A;  4HFC A;  3VKG A;  4DR1 T;  2YDQ A;  2V6X A;  4HE8 A;  2KZ7 B;  2XM1 A;  3AVS A;  2VKD A;  3QK6 A;  2CLY B;  4MFR A;  4OFZ A;  2CMR A;  3N9Q A;  3RF1 A;  1UGO A;  4TWF A;  2FJA A;  5JDN A;  3N2K E;  1MMA A;  4DMV A;  2YU2 A;  1YKH B;  3ETU A;  1SHZ C;  3KDS E;  1T98 A;  3S4U A;  3TLU A;  1IBL T;  4K0U A;  2H3R A;  3IEE A;  4DUY T;  2JQ9 A;  5KMG P;  2D5U A;  4O4J E;  2UXD T;  1SA0 E;  3MJX A;  2XSA A;  5L3B B;  3IA3 A;  1J5E T;  4JI1 T;  4CXX A;  4NUV A;  4HGA A;  4X62 T;  2K9A A;  4DV6 T;  3EDU A;  2FBW A;  4JI7 T;  4CXY A;  4EED A;  4LF6 T;  2W2U A;  2XQ3 A;  4N78 D;  1D1B A;  3IBP A;  3SOL A;  1SUM B;  3NZQ A;  4ILA A;  1MIW A;  3Q9D A;  3IF8 B;  3VU7 H;  5FXX A;  2MAW A;  1MIY A;  2X0L B;  1UX5 A;  1WYB A;  2KXP B;  2V7M A;  2EHO D;  1L0V A;  4A56 A;  5HEG A;  3PV0 F;  3TKL B;  4HWH A;  2UXC T;  2KWI B;  1WLX A;  3IHR A;  3MXZ A;  3PUV F;  4ZXL A;  1XNR T;  2M6B A;  5JRC A;  3RC3 A;  3MKD A;  3CKD A;  2M67 A;  5DQW A;  1U4Q A;  4AKL A;  3AE5 A;  4ILU A;  4KMC A;  1UK5 A;  3UUL A;  4IHJ E;  4QXC B;  4PJM A;  4EAH A;  4ZZC A;  2WWU A;  3FZM B;  4IDZ A;  2R6G F;  4HFD A;  3AEE A;  4X5T A;  2I59 A;  2V1D B;  1WRD A;  4JLE A;  4COF A;  4YJ2 E;  4JV5 T;  2FJE A;  1KFY A;  2J47 A;  3PUG A;  4OHF A;  1QUU A;  2M6I A;  4JI2 T;  2D0T A;  3PUX F;  1XWM A;  3PUW F;  3AE6 A;  3I1A A;  2C5J A;  1T7S A;  5LBQ B;  2HPL A;  4QHO A;  3D0T A;  3O1J A;  4ANJ A;  4IIJ E;  3A8Y C;  3ZMV B;  2LSG A;  4IE7 A;  5ETW A;  5LHH B;  1N32 T;  4TZ7 A;  2H7V C;  2W61 A;  4DV7 T;  1AJ3 A;  3BQK A;  1T72 A;  2E8I A;  3L39 A;  4IDP A;  2HH7 A;  3AE4 A;  3ZEF B;  3RIU C;  1IAP A;  2X9Y A;  4C91 A;  3CQG B;  3LJC A;  4I43 B;  1E2A A;  2CBJ A;  5CGM A;  2VKH A;  4B3R T;  2KMF A;  4O2A E;  4ZS2 A;  5DAB A;  3CQX C;  4Z8X A;  5LMN T;  1OWA A;  3NKZ A;  4P0B A;  2X9H A;  3HR0 A;  2LEH A;  5AQK B;  1LVK A;  3UU4 A;  2V5C A;  2CWO A;  1D0X A;  4L0R A;  2WAU A;  1T8B A;  2HPJ A;  5LGU B;  3RI5 A;  4U2Z A;  5FNV E;  2KSR A;  3PUA A;  4CN4 A;  4NXM T;  2CE7 A;  2YBX A;  2LKG A;  2MYS A;  1CHU A;  2XAF B;  4UEL A;  3B57 A;  4O4I E;  5FYM A;  4IT4 A;  5FY1 A;  4ZI3 C;  4U74 A;  3OBV E;  4K0K T;  5AQJ B;  2XSB A;  3HI2 A;  4X66 T;  3SRZ A;  3ZSS A;  5C2T A;  3C4X A;  2D9D A;  3OVU A;  2XAJ B;  3NZP A;  1HNW T;  4P0A A;  1HFA A;  3JCF A;  1D0Z A;  2CWY A;  3KV9 A;  3OYZ A;  5IYZ E;  3X0A A;  2DCF A; 
#chains in the Genus database with same CATH homology
 2P9B A;  3F57 A;  2WSS V;  3RX6 A;  2JMH A;  4HN9 A;  3B13 A;  4PJL A;  1NAF A;  3I9W A;  3I0O A;  4PW8 A;  1YKE B;  5LXT E;  1US7 B;  4UVA B;  5FY0 A;  1BO1 A;  3Q5W A;  5HXR A;  2X9X A;  3UTK A;  2D2S A;  5E3U A;  3C50 A;  2PJQ A;  3KFW X;  3PE0 A;  2A3D A;  5LOV E;  5HAX A;  1G8X A;  4GK5 E;  1FIO A;  2OA5 A;  3NBX X;  3C64 A;  2N9D A;  1CUN A;  3J7Y q;  4YFS A;  1HTJ F;  1D1A A;  3FHN A;  3KBT A;  5EK3 A;  4GIW A;  4PK5 A;  5A1L A;  5E3T A;  4YLH A;  5E0O A;  1E1H B;  5L3E B;  2L3L A;  2ODU A;  2NW8 A;  2MBG A;  3MK7 C;  4O4H E;  3FBL A;  3GA8 A;  5FXW A;  1ZEE A;  2QA7 A;  4UV8 B;  3AAI A;  4UV9 B;  4PFO A;  4C90 A;  4O2B E;  5FMN A;  3LK2 B;  1HF8 A;  3E0Z A;  1QSD A;  2NOX A;  3ZN0 B;  5JRE A;  2Y8D A;  1YW0 A;  3CX7 B;  3RH3 A;  4AI6 A;  4FJO A;  3BQI A;  5FXV A;  4PJJ A;  2UXX B;  1BR0 A;  3AB3 B;  4GYR A;  3CML A;  3X03 A;  4AQG A;  2W62 A;  1KNZ A;  2VK9 A;  5JVD E;  3PTR B;  1V9D A;  4M1P A;  4IE6 A;  5FXZ A;  3UUN A;  2VAS A;  3UUM A;  1ZHC A;  3HA4 A;  3QC9 A;  3BQL A;  3M65 A;  3LG7 A;  2H7O A;  4H9P C;  4H63 V;  3FB2 A;  2CEA A;  3C51 A;  4PJN A;  3AAE B;  3LFM A;  4O8S A;  2KND A;  3F2E A;  3VKH A;  3N9O A;  2X9W A;  2Q9Q B;  2V7J A;  2Q9Q C;  1H7C A;  3WZZ A;  3WAK A;  4CQI A;  4L5G A;  4DMW A;  2CLY C;  2WM9 A;  4H63 H;  4KUM B;  4U72 A;  2VL8 A;  3AA6 B;  5JDM A;  2ACX A;  4BA9 A;  2L9Q A;  3HKB E;  2JQQ A;  3PUS A;  3FXD B;  5JH7 E;  5LP6 E;  2IAK A;  4H9Q C;  4BJN A;  1KK7 A;  4UXN B;  2LSI A;  4MBQ A;  4BJM A;  2CXD A;  2JRK A;  4EXT A;  4EB6 E;  5EK4 A;  4AXP A;  2PBI A;  4EOZ B;  2RA1 A;  4IE5 A;  1B7T A;  5FP3 A;  3ZCI A;  3N9M A;  5EK2 A;  4OYJ A;  5FY7 A;  4NUU A;  3UT5 E;  2W0G A;  4QXB B;  3MAC A;  2IC6 A;  3ZJ1 A;  2QGS A;  5LHG B;  3CVR A;  4XBF B;  1MIV A;  4KBM B;  4ZI7 E;  3ZYL A;  1WYC A;  3X01 A;  2E9X C;  2JMK A;  2LHR A;  1Y64 B;  2KT9 A;  4BAY B;  3X0C A;  3RYI E;  2WBL A;  2BVL A;  3DP7 A;  2ZMA A;  3K3N A;  5HWY A;  1FMV A;  2NW7 A;  3ZYK A;  4JUY A;  1S35 A;  3O1I A;  5H6Q B;  4DBR A;  4P09 A;  2X66 A;  1G73 A;  5LJM A;  3ZLI A;  3C4W A;  4AKR B;  4EIW A;  2Y48 B;  2VKO A;  2CXL A;  4GOU A;  2LOS A;  2NTX A;  4H9N C;  4CXW A;  4AQF C;  4F6R C;  3ZC1 A;  5CB4 E;  4QXH B;  1HS7 A;  5LCY A;  3RRW A;  3NRY A;  1IJ6 A;  1NWM X;  2V7I A;  2EHO C;  3N2G E;  4EZ4 A;  3Q5X A;  2LSK A;  3E08 A;  5JR9 A;  5E3S A;  1X79 A;  2LSJ A;  3A5X A;  2X68 A;  3O9X A;  3LBX B;  3ZN1 B;  4I4T E;  4ASK A;  3HKD E;  3ZC0 A;  4DND A;  1BR1 A;  2K5B B;  1MND A;  3FBZ A;  3HKE E;  4DVD A;  2C5I T;  4WBO A;  2J1D G;  5H6R B;  1O3X A;  2V7L A;  2A2F X;  5L3D B;  5LJN A;  1EZ3 A;  2B1E A;  3ZPO A;  3KBU A;  3WAJ A;  4ERR A;  3X09 A;  3ETV A;  4E7Z A;  2XHE B;  4DBQ A;  3SWH A;  5JDH A;  2XAS B;  3AA7 B;  4PNI A;  5JQG E;  3X05 A;  4X20 E;  4PK6 A;  4EYY R;  5JDQ A;  3ESL A;  2XAG B;  5J2U E;  3EUH A;  3EVY A;  3RKO A;  3RYF E;  3X04 A;  3PU8 A;  3R6N A;  4ZHQ E;  4X1I E;  4XAX B;  5EZY E;  2W63 A;  4DO0 A;  3U3I A;  2PFV A;  5HXE A;  1MMG A;  4HFV A;  3V5S A;  2GK9 A;  2NP9 A;  3JC6 D;  5BMV E;  3RRC A;  3R84 B;  4V1A v;  4OK0 A;  3AA0 B;  3L09 A;  3X06 A;  4O4L E;  1S94 A;  4ZI2 D;  1ZKE A;  3HKC E;  3ZMZ B;  2BDE A;  5TAO A;  2XAH B;  3V5U A;  3ZYM A;  2E9X D;  4YHJ A;  5J1G A;  3ZJ2 A;  4ADZ A;  3FXE B;  3OKQ A;  1HG2 A;  2Q9Q D;  1FMW A;  3KV6 A;  3ZMU B;  3CX6 B;  5KX5 E;  1FEW A;  3T8O A;  4YJ3 E;  4MHC A;  2CXF A;  4L9I A;  5IHY A;  3K3Q C;  2XUE A;  4X1Y E;  4QKN A;  5LHI B;  4H9R C;  1MNE A;  3SS1 A;  2XTL A;  3I0Q A;  4WW0 A;  5HXS A;  5AFU L;  4QX7 B;  5L3F B;  4IST A;  5JRC B;  3OJA A;  3RYH E;  4E7S A;  3F31 A;  4HEA A;  5LGN B;  2Z6E A;  4CI2 B;  2MOZ A;  5HXH A;  2CM0 A;  1BR2 A;  1Z0P A;  3CPZ A;  4WNK A;  3ZMT B;  3PUQ A;  4HTE A;  3N2O A;  3P8C D;  4CI3 B;  3DJB A;  3MZK B;  3X08 A;  4TUY E;  3X07 A;  3BK9 A;  5JR9 C;  2ES0 A;  2YU1 A;  5LBM A;  2E9X B;  3ANW B;  4KP3 C;  2WMO A;  2K48 A;  2X67 A;  1D0Y A;  5DJQ C;  5LNK A;  1BR4 A;  4UF0 B;  2ZM2 A;  5LGT B;  3VHL A;  2ZM8 A;  2VWA A;  3NRX A;  2N1G A;  2CCQ A;  5L3G B;  3HL6 A;  1UCU A;  2DHR A;  4UEM A;  3AAA B;  3UFE A;  3KIN B;  4AQF A;  4AKI A;  4EYU A;  4H9O C;  2KLQ A;  3N9L A;  2LE8 A;  1WR6 A;  4IE0 A;  4TN7 B;  1MMD A;  4UF0 A;  5LG4 A;  5JRC A;  3AA1 B;  4XZC A;  4ZOL E;  5HWX A;  1IJ5 A;  3OYX A;  3L3P A;  5L2L A;  4WBN E;  5JDL A;  3UUX B;  3H37 A;  2DWG A;  3KVB A;  5HXC A;  1HG5 A;  3ONX A;  5L3C B;  2DNX A;  3CQC B;  3CX8 B;  4TZ4 C;  1IZN B;  5ADX L;  3X0B A;  4GK0 E;  5F8P A;  3C4Z A;  4EZH A;  2RP4 A;  2V26 A;  2IC9 A;  2E9X A;  2NTY A;  3ANW A;  5HYA A;  3KVA A;  3LK3 B;  3PDY A;  1LRZ A;  2D0U A;  2XQY A;  2MTQ A;  4MAL A;  1YD8 G;  2X51 A;  4CZZ B;  3RC8 A;  5JDF A;  1LVF A;  3DTO A;  3J9X 1;  4G63 A;  2LJL A;  3C98 B;  2LM9 A;  5KDM C;  2L8K A;  2DLR A;  2JJ9 A;  4FI5 A;  4JEH B;  3RPU A;  4AKG A;  2YEV C;  4CI1 B;  3GWH A;  2WMN A;  2EHO A;  5J2T E;  3KV5 A;  2DWK A;  2JPF A;  3X02 A;  3AVR A;  3GMI A;  2UXN B;  3O4X E;  4I55 E;  4J2C A;  3Q2M A;  4H9S E;  2KIN B;  3GN5 A;  2ZM0 A;  2SPC A;  4PK4 A;  2N2N A;  1HCI A;  2NWB A;  4B6X A;  2EHO B;  1ZV4 X;  4UVB B;  2G0U A;  3QUJ A;  2A72 A;  3WI3 A;  4TV8 E;  1UX4 A;  3H3A A;  2PG8 A;  2BZB A;  2Q9Q A;  2K24 A;  4MLK A;  5LA6 E;  4QX8 B;  4OYK A;  4TX5 A;  1OXZ A;  2LSY A;  4PFP A;  4HKA A;  4QWN B;  2YIN A;  1MMN A;  2CA5 A;  3EDV A;  3ZMS B;  5CA0 E;  2ZLY A;  2LHN A;  3K3O A;  4TV9 E;  2LT3 A;  2ODV A;  3N9N A;  1LKX A;  4I50 E;  3PUR A;  4IGU A;  4ISS A;  3P7I A;  1VOM A;  2YK0 A;  1U5P A;  4UIG A;  4GYS A;  4JEU B;  3GN5 B;  1VRB A;  3O1H A;  3PU3 A;  3KV4 A;  2C5K T;  4ZS3 A;  5GON E;  3RYC E;  3E22 E;  2Y6X A;  3ZCJ A;  2KWH A;  4G2A A;  5F3J A;  5M4Y A;  3LK4 2;  4ZI2 C;  2NW9 A;  2W00 A;  3LBX A;  5LYJ E;  2V7K A;  4X1K E;  5C8Y E;  3MA9 A;  3U78 A;  3JC6 C;  4UVC B;  4ZI3 D;  3K8P C;  2LOP A;  3I9Y A;  1HX8 A;  3W15 B;  2DI4 A;  2VKJ A;  4IE4 A;  5DQV A;  2XAQ B;  5JDG A;  2VB6 A;  1D1C A;  3N9P A;  2IW5 B;  2C0S A;  4PAG A;  5JR9 B;  3N5L A;  4AKH A;  3CWZ B;  2BVM A;  3VKG A;  4HE8 A;  2KZ7 B;  3AVS A;  2VKD A;  3QK6 A;  2CLY B;  4MFR A;  4OFZ A;  2CMR A;  3N9Q A;  5JDN A;  3N2K E;  1MMA A;  4DMV A;  2YU2 A;  1YKH B;  3ETU A;  1SHZ C;  3KDS E;  1T98 A;  3S4U A;  4K0U A;  2H3R A;  3IEE A;  5KMG P;  2D5U A;  4O4J E;  1SA0 E;  3MJX A;  5L3B B;  4CXX A;  4NUV A;  4HGA A;  2K9A A;  3EDU A;  4CXY A;  4N78 D;  1D1B A;  3IBP A;  3SOL A;  3NZQ A;  1MIW A;  3Q9D A;  3IF8 B;  3VU7 H;  5FXX A;  1MIY A;  2X0L B;  1UX5 A;  1WYB A;  2KXP B;  2V7M A;  2EHO D;  4A56 A;  3TKL B;  2KWI B;  1WLX A;  3IHR A;  3MXZ A;  3RC3 A;  3MKD A;  3CKD A;  2M67 A;  5DQW A;  1U4Q A;  4AKL A;  4ILU A;  4KMC A;  3UUL A;  5CA1 E;  4IHJ E;  4QXC B;  4PJM A;  4EAH A;  2WWU A;  4IDZ A;  2I59 A;  2V1D B;  1WRD A;  4JLE A;  4YJ2 E;  3PUG A;  4OHF A;  1QUU A;  2D0T A;  3I1A A;  2C5J A;  5LBQ B;  2HPL A;  4QHO A;  3D0T A;  3O1J A;  4ANJ A;  4IIJ E;  3ZMV B;  2LSG A;  4IE7 A;  5ETW A;  5LHH B;  4TZ7 A;  2H7V C;  2W61 A;  1AJ3 A;  3BQK A;  2E8I A;  2HH7 A;  3ZEF B;  1IAP A;  2X9Y A;  4C91 A;  3CQG B;  3LJC A;  4I43 B;  2VKH A;  2KMF A;  4O2A E;  4ZS2 A;  5DAB A;  3CQX C;  4Z8X A;  1OWA A;  4P0B A;  2X9H A;  3HR0 A;  2LEH A;  1LVK A;  4L0R A;  2CWO A;  1D0X A;  2WAU A;  2HPJ A;  5LGU B;  5FNV E;  3PUA A;  2CE7 A;  2YBX A;  4UEL A;  2MYS A;  2XAF B;  5FYM A;  4ZI3 C;  3B57 A;  4O4I E;  5FY1 A;  4U74 A;  3OBV E;  3HI2 A;  3SRZ A;  3C4X A;  2XAJ B;  3NZP A;  4P0A A;  1HFA A;  1D0Z A;  2CWY A;  3KV9 A;  3OYZ A;  5IYZ E;  3X0A A;  2DCF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...