2GK9A

Human phosphatidylinositol-4-phosphate 5-kinase, type ii, gamma
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
373
structure length
243
Chain Sequence
DPLVGVFLWGVAHSINELSQVPPPVMLLPDDFKASSKIKVNNHLFHRENLPSHFKFKEYCPQVFRNLRDRFGIDDQDYLVSLTRNPPSESEFLISYDRTLVIKEVSSEDIADMHSNLSNYHQYIVKCHGNTLLPQFLGMYRVSVDNEDSYMLVMRNMFSHRLPVHRKYDLKGTLRDMDNKNQKVYIKKIFLEKLKRDVEFLVQLKIMDYSLLLGIHDIEVYFMGLIDILHPEQYAKRFLDFIT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords phosphatidylinositol-4-phosphate 5-kinase, type II, gamma
publication title Structure of Human Phosphatidylinositol-4-phosphate 5-kinase, type II, gamma
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 57
structure length 243
sequence length 373
chains with identical sequence B, C, D
ec nomenclature ec 2.7.1.149: 1-phosphatidylinositol-5-phosphate 4-kinase.
pdb deposition date 2006-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01504 PIP5K Phosphatidylinositol-4-phosphate 5-Kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1870 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2gk9A02
3.30.800.10 Alpha Beta 2-Layer Sandwich Phosphatidylinositol Phosphate Kinase II Beta Phosphatidylinositol Phosphate Kinase II Beta 2gk9A01
3X05A 5E3SA 3X03A 1BO1A 2GK9A 5E3UA 3X02A 3X07A 3X0AA 4TZ7A 5E3TA 3X0BA 3X04A 2YBXA 3X01A 3X09A 3X06A 3X0CA 3WZZA 3X08A
chains in the Genus database with same CATH superfamily
4H9SE 3HL6A 3N2GE 2LSJA 4B3TT 5CGMA 5DQVA 2CHOA 2DI4A 2K3WA 3GA8A 5LP6E 4EEDA 2BKPA 3EDUA 2JQQA 5HXRA 4YTPA 2H7VC 2VK9A 4CXWA 1IBMT 1XZYA 3S4UA 2LOSA 3PJAJ 3J7Yq 3EHZA 3HKCE 4JUYA 2WY2A 4CI1B 4CZZB 4FI5A 4OHFA 4KBMB 2KSRA 2HHHT 3X02A 4AISA 2W61A 2BVMA 4PAGA 2V8SV 3OYXA 3OYZA 2WDQA 3IA3A 4U33A 4EYUA 2NW9A 4GK0E 4IHJE 3MA9A 3RIUC 5JRCB 3C4WA 2XQ7A 3N9NA 3PUZF 5C8YE 3WAJA 1SA0E 4HWHA 2JQ9A 3ZJ2A 5DABA 3RRCA 1SE7A 3FB2A 4H9PC 3PTRB 3N2OA 4EIWA 5L3CB 1N34T 3JAEA 4WBNE 2W00A 3H3MA 5EZYE 3AE9A 1YQ4A 3AEDA 2YEVC 1BO1A 4Z90A 2WM9A 4JV5T 5F5WA 5FY7A 2K24A 1G73A 4EAHA 4H63V 5JDLA 3OTOT 5FL0A 3FZKB 3K3OA 3ZEFB 3FHNA 5KDMC 3EI0A 2W63A 2LOPA 1QSDA 4YSXA 4PK5A 4F6RC 2NWBA 3E0ZA 4WYVA 4YJ2E 5JDNA 1I94T 4HFDA 4K0UA 5HAXA 3ZT7A 5JREA 3ZT6A 1V9DA 5HYAA 3L09A 5FYMA 4PW8A 4IE5A 5AQRB 3X03A 2UXDT 3KV6A 2LLYA 4KHZF 3BQKA 2H3RA 4O8SA 2XQ9A 3NVOA 4K0KT 3GN5B 4IE7A 3UFEA 2Y48B 1Y01A 3X08A 3AEGA 4CN4A 3U78A 5L2LA 1QUUA 3IF8B 4IIJE 3AVSA 3X07A 4TZ7A 2WMOA 2UUBT 4QXHB 2LSGA 2KXPB 5ABGA 2WB5A 3ZYKA 5JDMA 1VRBA 3ZCJA 4DR4T 2BS3A 2MTQA 2LJLA 5JRCA 3NZPA 5DJQC 1WRDA 4CN1A 4UV8B 4ZXLA 3ESLA 3PU8A 2MBGA 2IC9A 2BBHA 3VKGA 2WWVA 4XAXB 2X66A 3CQGB 3GMIA 3B5MA 5EK3A 2AXDS 2KLQA 1BR0A 3OPCA 3O4XE 5IYZE 4KHPT 5AQGB 1LKXA 5EK4A 3TKLB 2CEAA 4H9NC 4I0UA 5BR8T 2ZMAA 4H9QC 3CWZB 1O3XA 3NRYA 4A56A 1ZHCA 3D0TA 2B76A 3RIFA 4X1KE 2CLYB 3T8OA 3CVRA 4X5TA 3ABVA 2IAKA 2XPKA 2W62A 3RIUA 4CXYA 3R84B 5LA6E 4PFOA 4EZHA 4U7IA 3Q5WA 4DR6T 3JAFA 3ZN0B 3OVUA 1J1JA 4IDQA 2VURA 3QUJA 3VRBA 5L47A 4YHHT 2N2NA 4YXDA 1M7KA 4JBWF 5JDGA 3EVYA 4DIDB 5AQNB 4QWNB 2JMHA 2IHR1 2LSKA 2LRLA 4DNDA 1JNZA 3ANWB 2WSSV 1WCRA 3Q9DA 4ASKA 2ZLYA 3P4SA 2VKJA 2XJ7A 4CN6A 2DL1A 4AXPA 2XAJB 3AE5A 4TV9E 3FXDB 1IAPA 2CA5A 3P50A 2KZ7B 2JMKA 3QB5A 4AKHA 5L3GB 4ERRA 2XQYA 3PDYA 3EAMA 3RGLA 2CPTA 2XZEA 3UU3A 3Q2MA 1YD8G 5AQJB 4UR9A 4LF6T 4ZZBA 5LYJE 2DWGA 3TLVA 3E08A 3CX8B 3AEAA 3UUMA 3X0AA 4JI2T 5GONE 3UULA 4I50E 4DR1T 4LFBT 2DHRA 2VB6A 4HWCA 4TNWA 3N2KE 3RYCE 4HWFA 1UX5A 4GK5E 5H6RB 4JI7T 4OYJA 3AXJB 2VKOA 3RYIE 3W15B 4UXNB 1WR0A 1XNQT 3TLWA 3JADA 1E1HB 2RP4A 3ETUA 3AECA 5HEJA 1SHZC 5JQGE 5FXVA 3O1JA 1HX1B 5FMNA 1OWAA 1I6ZA 2P9BA 3K3QC 1NENA 2BDEA 4G2AA 4IREA 3FXEB 3UQ4A 2BKNA 2OLTA 3RH3A 3QK6A 4IT4A 3SFEA 1D1BA 4TNVA 1E7PA 3ONLC 3K8PC 1ZOYA 5L3BB 1N33T 3N5LA 2YU2A 4LFCT 4P0BA 5KXJA 4I55E 1EZ3A 4ADZA 1IJ6A 2XQ5A 2CRBA 4O2BE 3B13A 3AB3B 1T7SA 2WZHA 2E2AA 2V7IA 3LG7A 1UX4A 1H7CA 3H3AA 4LMKA 4JI8T 5CFBA 1KF6A 2J1DG 1D0YA 4DO0A 4QH1A 1BR1A 2D2SA 3B57A 3I9YA 2YN6A 2IIUA 2HN1A 2XHEB 4PJLA 1W9RA 4L0RA 2YINA 1HTJF 1IBLT 4OK0A 2NTYA 1D1CA 4UEMA 3LDQB 4X20E 4L9IA 3ZT5A 1WYBA 3V5UA 5HCJA 2H7OA 3ZC0A 1BR4A 2UUCT 4YTMA 3KV5A 2L9QA 2ZM0A 3AE7A 3Q5EA 4GYRA 3HR0A 3SRZA 5CB4E 2Q9QC 3RI5A 3HA4A 3HKDE 3X06A 5ABEA 3DTOA 2V7LA 2PJQA 5HEUA 5AQQB 5LMNT 2IW5B 2CCQA 2IDOB 3KVBA 4N78D 4JI4T 3RLFF 4KUMB 4IDZA 2V7MA 2WQYA 1L0VA 2E5LT 3Q5XA 3X09A 4DV2T 3P4RA 1NAFA 2NOXA 4KP3C 2NP9A 5LMUT 3CQCB 3P4QA 1HNWT 4DV1T 5L4HA 4TV8E 3UUBA 1OXZA 5A1LA 4BJMA 2W67A 1IBKT 2LKHA 1NEKA 2Y8DA 5AQKB 1S35A 2A2FX 4WBOA 3I9WA 5KMGP 4TUYE 3CX6B 2UXCT 2MYSA 2V6XA 2CBIA 3N9QA 2W4XA 3JC6D 3BK9A 2DWKA 3KBUA 2PBIA 4A97A 2CXLA 4EOZB 5AQTB 2JIWA 3C51A 3N9LA 2X68A 2XQ6A 4UVCB 4EEBA 2X9WA 2BS2A 4GOUA 5LXTE 5ETWA 2PFVA 2JQKA 1OEDE 2QRXA 3X0CA 4ZHQE 3DJBA 5ABFB 2NW8A 3FZLB 2LEHA 2ZM8A 3BQLA 3CK6A 2E5VA 5DQWA 3T1HT 4TN7B 1WLXA 3ZSTA 1ZEEA 4TWDA 1XDOA 3ZYLA 1W0AA 4LF5T 4B3ST 3CPZA 5JDQA 3L3PA 3ZYMA 1MIYA 2X0LB 1DU2A 4YT0A 1B7TA 4I43B 3JC6C 3PU3A 2VWAA 4DV0T 5HXHA 2IMLA 2UXBT 5LGNB 5LJMA 2IUBA 4ZS2A 3PV0F 3ZSSA 3A5XA 5LB7B 2J4GA 2CXFA 2XSAA 4YSYA 4IDNA 2QA7A 2OA5A 2WU5A 3NZQA 3RC8A 2N9DA 4AKLA 5FXZA 3AE4A 4EB6E 4JI5T 4AQFA 3AE1A 4IL4A 3IEEA 2C0SA 1Z0PA 2FUPA 4B6XA 4NPPA 5LHGB 2Q9QA 5FNVE 3AA1B 1XMQT 2VKDA 1US7B 4UIGA 3NBXX 4EZ4A 3H37A 4HWIB 2XAFB 3IHRA 2M6BA 4U3CA 3AEFA 5AQVB 5HWYA 5FP3A 1ZP0A 3PUYF 2OV9A 2WZIA 5JDHA 3FBZA 3N9OA 5AQOB 5ABFA 2XUEA 3PUVF 2WAUA 5CA0E 1KNZA 4BJNA 5TAOA 1MMGA 4DV5T 2WMNA 4X1IE 3UQ7A 5FVLA 4LF9T 3UU4A 3SFDA 5AFUL 3ZMVB 1KEYA 3GWHA 2UU9T 4HWDA 2HH7A 4ISTA 5L3EB 2NTXA 4ZS3A 3CX7B 4GKKT 2YBXA 2PTFA 3RQUA 2DNXA 2FJDA 4QXCB 4ILBA 3LJCA 3SOLA 2V5DA 3J9X1 2ACXA 3PUSA 3OBVE 3F31A 4HFBA 3QNUA 2UXNB 3EABA 5J2TE 1MNEA 4P1NA 2JPFA 4DR7T 2V1DB 4BA9A 3P4WA 4BAYB 4XZCA 1UURA 4HFVA 3LBXA 3ZN1B 2ZM6T 2UXXB 2K5BB 4O4JE 4F8HA 2VASA 2KMFA 5HCMA 3MXZA 5F8PA 5HEHA 1MMDA 4DR5T 3LFMA 4MBQA 2BG9C 1E2AA 2KT9A 1R8IA 4CXXA 4HFCA 5ADXL 4MHCA 1D0XA 3VHLA 4YTNA 4XBFB 4AKIA 3NRXA 5LG3A 3X0BA 1UK5A 4IE4A 4QX8B 4EYYR 2HPLA 2V5CA 1WR6A 1YW0A 5LJNA 5LOVE 3DP7A 3PJAA 2VVNA 2X67A 3A8YC 4PJJA 3RC3A 1WFDA 3ZCIA 5AQHB 3PUXF 3PURA 4IL9A 4UVBB 3FZMB 2VL0A 2EHOD 4FJOA 3AAAB 3X05A 2KWIB 5C2TA 2YDRA 4E7SA 3ZMZB 4GKJT 3FZFB 5E3UA 4DBRA 1IZNB 2CE7A 2BG9B 1Y64B 3AVRA 4HE8A 4PK6A 3Q5DA 3MZKB 3UUXB 1XDPA 3KV9A 4QKNA 4DUYT 3SS1A 1KK7A 2KINB 4O2AE 4TWFA 4ISSA 3UTKA 5FVKA 3I0OA 4MALA 5LBMA 4WNKA 1OEDC 1BR2A 2ES0A 2XQAA 3O1IA 2Q9QD 2IC6A 3MJXA 2BS4A 1G8XA 1LVFA 4QH5A 4AKRB 4AQYT 3ETVA 5FXWA 1MMAA 2D9DA 2EHOC 1HFAA 2H89A 5AQLB 2XY8B 4GYSA 4PFPA 4P0AA 2HN2A 4O4IE 1W09A 2MOZA 5AQIB 1QLBA 2CMRA 2YK0A 4KMCA 3OKQA 4E7ZA 2FJAA 1MNDA 3U3IA 2XASB 3IBPA 2XM1A 4DV4T 3KINB 4X1YE 5HXEA 5JTGA 4PJNA 3RPUA 4DR3T 2UUAT 2YKSA 1OEDB 3P4PA 3C64A 3WAKA 1X9BA 4HFHA 5AQUB 3FZHB 4CQIA 4U74A 3FBLA 4TX5A 1LRZA 2K9AA 5JDFA 3ZMTB 3ZJ1A 2LT3A 2V6YA 4JEUB 3MACA 4DVDA 4YY3T 4YJ3E 2EHOB 4QHOA 2I59A 5M4YA 4U7YA 4V1Av 5E3SA 2BG9A 1N36T 5LG4A 4COFA 1KFYA 3R6NA 1W0BA 2BBJA 2E9XD 4WZXA 2DCFA 3X04A 2DLRA 1CHUA 2YDSA 1FJGT 1MIWA 1ZKEA 2LKGA 3VRAA 4JI3T 4JI0T 2ACZA 3KVAA 4HKAA 3G06A 2W0GA 4KX6A 2J62A 4YFSA 1YQ3A 1CUNA 2Q9QB 1T98A 5L3FB 3RIAA 4ZEYA 2V26A 4AKGA 2CHNA 1N32T 4HGAA 4M1PA 4AI6A 1MMNA 5E0OA 2VVSA 3HKBE 2HPJA 3LK42 2I6HA 3C4ZA 2X0YA 1YKEB 4ILCA 2E9XC 5CA1E 4DV7T 2LRKA 4Z91A 4CI2B 2I0MA 2Y6XA 3RX6A 3VU7H 4YHJA 1IJ5A 3P7IA 1HS7A 5C3JA 4MFRA 1OEDA 5J0ZA 2JRKA 1HG2A 2XM2A 3QC9A 2XQ4A 3RKGA 1HNZT 2GK9A 2WS3A 5HXSA 2M67A 3TLSA 1JNRA 3LSVA 2K48A 2WDVA 3LK3B 2X51A 4Q25A 1UCUA 5F3JA 4TZ4C 1VCTA 2EHOA 2NW7A 4LFAT 3WI3A 2X9YA 4TWHA 3ONJA 4QX7B 4YLHA 4CI3B 1XWMA 3CQXC 3ONXA 3F57A 2L3LA 2C5KT 4UV9B 1KNPA 3C98B 5AQPB 2W2UA 3UUNA 2BKOA 3K3NA 1XNRT 2E9XB 2FJBA 3AA0B 3UT5E 3ZMSB 1MIVA 2BVLA 4HEAA 2X9HA 3LBXB 4C91A 2MPKA 2RPAA 3MKDA 5KX5E 2X0HA 4AIUA 4X65T 5HEGA 2KWHA 2CM0A 2F4VT 5EK2A 1J5WA 5JR9C 2WU2A 3SWHA 3TLTA 5JH7E 3ZC1A 2CWOA 2N1GA 1FEWA 5L4EA 3JCFA 2Z6EA 2CLYC 5AQSB 3BQIA 4LMLA 4C90A 2CBJA 4X64T 2CWYA 3L8RA 4NXNT 4ZI7E 4NXMT 1D1AA 4YSZA 2V7KA 4JI1T 2LSYA 1WYCA 4PNIA 1HX8A 5H6QB 2XAGB 3I0QA 2XAQB 2XSBA 2G0UA 5FY1A 2LHNA 2SPCA 4GIWA 2W66A 3KV4A 2X9XA 3VR9A 2QYWA 2B1EA 1Z8UA 3AE3A 4IDOA 4A5XA 4DMVA 4EGWA 1D0ZA 2H88A 4UELA 3PE0A 4PK4A 3X01A 4IE6A 1T8BA 3RQWA 5JR9B 1XMOT 4I4TE 1LVKA 2AE9A 4JLEA 4H63H 4U2YA 4EV6A 1FIOA 3RKOA 5FKYA 2WCAA 4DR2T 4B3MT 1KNRA 5LBQB 4IE0A 4UF0B 2LM2A 2BZBA 3UU8A 1S94A 3AE2A 4DMWA 3GN5A 4IGUA 1GQEA 3AA6B 5FY0A 2VKHA 4DBQA 2RA1A 5LCYA 4U31A 4LF7T 3E22E 5J1GA 3PUQA 3AAIA 2XQ8A 1AJ3A 5J2UE 3NWIA 1HG5A 1FMVA 2E9XA 3F2EA 2YU1A 5LGUB 3O9XA 3RHWA 1YKHB 1ZV4X 3AEEA 4NUVA 2LSIA 4LF8T 2YOEA 3CIRA 2MAWA 3TLUA 2JQHA 4QH4A 2J47A 3ZMUB 4JEHB 3C50A 5L3DB 4DV6T 1VCSA 3KFWX 2WBLA 5LHIB 4ZI2D 3AA7B 1UUSA 4U72A 4JYAT 5LHHB 3L39A 4L5GA 2QVAA 4NUUA 3AEBA 3RRWA 5JVDE 2LE8A 3CMLA 5CJ5A 2JJ9A 2LHRA 3K1SA 5HXCA 2ODUA 3M3ZB 2A9UA 4MLKA 2KNDA 4J2CA 3RF1A 4ZI3D 4O4HE 5FXXA 3RYHE 1U4QA 1HF8A 2CXDA 5HEOA 2V6YB 4OYKA 4EXTA 5IWAT 3HI2A 4IDPA 3UU6A 3N9PA 2PG8A 4HTEA 4A98A 3CKDA 2VQFT 5JR9A 2XQ3A 3MK7C 4KI0F 1J5ET 4G63A 2E8IA 2A72A 4ZI2C 3I1AA 2L8KA 2XTLA 3PUAA 4UVAB 1VOMA 4Z8XA 3HKEE 3O1HA 1HNXT 4B3RT 2FBWA 4UF0A 3UFGA 3N9MA 4H9RC 3ZLIA 3X1DA 3QOFA 5IHYA 5IUXA 3LK2B 2QGSA 3WZZA 3M65A 4LMJA 4O4LE 1YXRA 3QB5K 4ANJA 3NKZA 2VQET 4HN9A 3T1YT 4HFEA 2C5IT 3KBTA 4ZI3C 3EDVA 1HCIA 3PUWF 5LGTB 2C5JA 4OFZA 4JI6T 4PJMA 4AQGA 3ANWA 4H9OC 4ZZCA 4NIQA 2FJEA 2WDRA 4QXBB 3AE8A 4DUZT 2WP9A 3EUHA 4ILUA 5AQMB 3RYFE 2D0UA 3ZPOA 2A3DA 4U2ZA 5AQFB 3A7MA 5LNKA 3KDSE 4X66T 1UGOA 2R6GF 4HFIA 3VKHA 1M62A 2D5UA 2ZM2A 1X79A 3UU5A 4DV3T 2NR4A 3C4XA 5ABHA 4ILAA 3P8CD 4X62T 1HR0T 4AQFC 3AAEB 5HWXA 4WW0A 1U5PA 2VL8A 2LM9A 1T72A 4OX9T 1SUMB 4P09A 3ZKRA 2YDQA 4LF4T 2XAHB 3AE6A 1FMWA 5BMVE 2WWUA 2M6IA 3V5SA 5E3TA 4ZOLE 3OJAA 2V7JA 2BG9E 2ODVA 3PUGA 2D0TA 3AXJA 1NWMX 3VR8A 5FL1A
chains in the Genus database with same CATH topology
1UCUA 4H9SE 3HL6A 3N2GE 2LSJA 5FMNA 1OWAA 2HH7A 4TZ4C 5F3JA 5DQVA 2P9BA 2DI4A 4ISTA 3K3QC 2BDEA 5L3EB 2EHOA 3GA8A 2NW7A 4G2AA 3FXEB 5LP6E 3WI3A 3EDUA 2NTXA 4ZS3A 2JQQA 5HXRA 3CX7B 2H7VC 2YBXA 2X9YA 2VK9A 4QX7B 4YLHA 3RH3A 4CXWA 3QK6A 4CI3B 3CQXC 3ONXA 3S4UA 1D1BA 2DNXA 3F57A 4QXCB 2LOSA 3J7Yq 2L3LA 3LJCA 3HKCE 2C5KT 4UV9B 3SOLA 3C98B 4JUYA 3J9X1 3UUNA 4CI1B 2ACXA 3K3NA 3OBVE 3F31A 3K8PC 3PUSA 4FI5A 4CZZB 4OHFA 2E9XB 3AA0B 4KBMB 3UT5E 5L3BB 3ZMSB 1MIVA 2BVLA 2UXNB 3N5LA 4HEAA 3X02A 2W61A 2X9HA 2YU2A 3LBXB 2BVMA 4PAGA 4C91A 4P0BA 5J2TE 4I55E 3OYXA 1EZ3A 3OYZA 1MNEA 3MKDA 4ADZA 5KX5E 2JPFA 4EYUA 2V1DB 4BA9A 2NW9A 4GK0E 4IHJE 2KWHA 2CM0A 1IJ6A 3MA9A 4BAYB 5EK2A 4XZCA 5JR9C 4O2BE 3B13A 3SWHA 5JH7E 5JRCB 3C4WA 3AB3B 4HFVA 3LBXA 3ZN1B 3ZC1A 2UXXB 2CWOA 2N1GA 1FEWA 3N9NA 2K5BB 4O4JE 2Z6EA 2V7IA 5C8YE 3LG7A 2VASA 2CLYC 2KMFA 3WAJA 3MXZA 1UX4A 1SA0E 5F8PA 3BQIA 1H7CA 3H3AA 4C90A 1MMDA 3ZJ2A 2J1DG 1D0YA 2CWYA 3LFMA 4MBQA 4DO0A 1BR1A 4ZI7E 1D1AA 5DABA 3RRCA 2D2SA 3B57A 3I9YA 3FB2A 4H9PC 3PTRB 2KT9A 3N2OA 2V7KA 2XHEB 4EIWA 5L3CB 2LSYA 1WYCA 4PJLA 4PNIA 4WBNE 1HX8A 2W00A 4CXXA 5EZYE 4L0RA 5H6QB 2YINA 2XAGB 5ADXL 1HTJF 4MHCA 1D0XA 3VHLA 2YEVC 4OK0A 1BO1A 2NTYA 1D1CA 3I0QA 2WM9A 4XBFB 4UEMA 4AKIA 3NRXA 4X20E 2XAQB 4L9IA 5FY7A 2G0UA 5FY1A 3X0BA 2K24A 1G73A 1WYBA 4EAHA 2LHNA 4IE4A 4QX8B 3V5UA 2SPCA 4GIWA 2H7OA 3ZC0A 4H63V 4EYYR 5JDLA 1BR4A 2HPLA 3KV4A 2X9XA 1WR6A 3KV5A 2L9QA 1YW0A 2ZM0A 5LJNA 2B1EA 3K3OA 3ZEFB 5LOVE 3FHNA 3DP7A 5KDMC 2W63A 4DMVA 2LOPA 1QSDA 2X67A 1D0ZA 4GYRA 5FXVA 4PK5A 4UELA 3HR0A 3SRZA 5CB4E 4F6RC 2NWBA 3PE0A 2Q9QC 4PJJA 3RC3A 3E0ZA 3HA4A 4PK4A 3ZCIA 4YJ2E 3HKDE 4K0UA 5JDNA 3PURA 3X01A 3X06A 5HAXA 4IE6A 3DTOA 5JREA 4UVBB 2V7LA 1V9DA 2PJQA 5HYAA 5JR9B 2EHOD 3L09A 4FJOA 5FYMA 3AAAB 4PW8A 4IE5A 2IW5B 3X05A 2KWIB 4I4TE 2CCQA 3X03A 1LVKA 3KV6A 4E7SA 3KVBA 4N78D 3BQKA 4JLEA 4H63H 3ZMZB 5E3UA 4DBRA 2H3RA 1FIOA 3RKOA 4KUMB 4IDZA 2V7MA 1IZNB 4O8SA 3GN5B 3Q5XA 4IE7A 5LBQB 2CE7A 3X09A 4IE0A 1Y64B 3UFEA 4UF0B 3AVRA 1NAFA 2Y48B 4HE8A 4PK6A 3X08A 2BZBA 2NOXA 3MZKB 1S94A 4KP3C 3UUXB 3KV9A 4QKNA 4DMWA 3GN5A 3SS1A 3U78A 5L2LA 1QUUA 2NP9A 4IGUA 1KK7A 2KINB 3CQCB 4O2AE 3IF8B 3AA6B 5FY0A 4ISSA 2VKHA 3UTKA 2RA1A 4DBQA 4IIJE 5LCYA 3I0OA 3AVSA 4MALA 5LBMA 4WNKA 3X07A 3E22E 4TZ7A 5J1GA 2WMOA 3PUQA 1BR2A 3AAIA 4TV8E 1OXZA 2ES0A 4QXHB 5A1LA 3O1IA 2Q9QD 2IC6A 1AJ3A 5J2UE 4BJMA 2LSGA 3MJXA 1HG5A 1FMVA 2KXPB 2E9XA 2Y8DA 1G8XA 1LVFA 3F2EA 1S35A 2A2FX 3ZYKA 2YU1A 4WBOA 3I9WA 5JDMA 5KMGP 5LGUB 3O9XA 1VRBA 1YKHB 1ZV4X 4NUVA 3ZCJA 4TUYE 2LSIA 3CX6B 4AKRB 2MTQA 2LJLA 2MYSA 3ETVA 5FXWA 3ZMUB 1MMAA 4JEHB 3C50A 5L3DB 3NZPA 5JRCA 3N9QA 5DJQC 1WRDA 3JC6D 2EHOC 3BK9A 2DWKA 3KFWX 1HFAA 3KBUA 4UV8B 2PBIA 2WBLA 3ESLA 3PU8A 4GYSA 2CXLA 2MBGA 4EOZB 5LHIB 4PFPA 4P0AA 4ZI2D 3AA7B 3C51A 3N9LA 2IC9A 4O4IE 2X68A 4U72A 4UVCB 3VKGA 2X9WA 4GOUA 5LXTE 2MOZA 5LHHB 5ETWA 4L5GA 2CMRA 2PFVA 2YK0A 4KMCA 4XAXB 3OKQA 4E7ZA 4NUUA 1MNDA 3RRWA 3U3IA 2XASB 3IBPA 5JVDE 2X66A 3X0CA 2LE8A 3CMLA 4ZHQE 3DJBA 3CQGB 3KINB 4X1YE 2JJ9A 2LHRA 2NW8A 3GMIA 5HXEA 5EK3A 5HXCA 2LEHA 2ODUA 4MLKA 2KLQA 4PJNA 3RPUA 1BR0A 2ZM8A 2KNDA 5IYZE 3O4XE 3BQLA 4J2CA 1LKXA 3C64A 4ZI3D 4O4HE 5FXXA 3WAKA 5DQWA 5EK4A 3RYHE 3TKLB 1U4QA 2CEAA 4H9NC 2ZMAA 1HF8A 2CXDA 4H9QC 4TN7B 1WLXA 1ZEEA 4OYKA 3CWZB 4EXTA 4CQIA 4U74A 3FBLA 1O3XA 3ZYLA 3HI2A 3NRYA 4TX5A 4A56A 3N9PA 1LRZA 2K9AA 1ZHCA 3D0TA 5JDFA 2PG8A 3ZMTB 4HTEA 4X1KE 3CPZA 3ZJ1A 2CLYB 5JDQA 2LT3A 3L3PA 3T8OA 3CVRA 3ZYMA 1MIYA 2IAKA 3CKDA 2X0LB 2W62A 5JR9A 4JEUB 4CXYA 3MACA 3R84B 3MK7C 5LA6E 1B7TA 4I43B 4DVDA 3JC6C 4PFOA 4YJ3E 4EZHA 2EHOB 3PU3A 4G63A 4QHOA 2E8IA 2VWAA 2A72A 2I59A 5M4YA 3Q5WA 4V1Av 5HXHA 4ZI2C 3I1AA 2L8KA 2XTLA 3ZN0B 3PUAA 4UVAB 5LGNB 5LJMA 1VOMA 4Z8XA 5E3SA 3HKEE 3QUJA 3O1HA 4ZS2A 3A5XA 5LG4A 3R6NA 4UF0A 2CXFA 3N9MA 2E9XD 4H9RC 2N2NA 3ZLIA 2QA7A 2DCFA 3X04A 2OA5A 2DLRA 5JDGA 3EVYA 5IHYA 3LK2B 2QGSA 3WZZA 1MIWA 1ZKEA 3M65A 3NZQA 4QWNB 4O4LE 2JMHA 3KVAA 4HKAA 3RC8A 4ANJA 2N9DA 2W0GA 2LSKA 4HN9A 4AKLA 4DNDA 3ANWB 5FXZA 2C5IT 3KBTA 4YFSA 4ZI3C 2WSSV 4EB6E 3EDVA 4AQFA 1CUNA 2Q9QB 1HCIA 1T98A 5L3FB 3Q9DA 4ASKA 2ZLYA 5LGTB 2VKJA 2C5JA 3IEEA 4OFZA 2V26A 2C0SA 4AKGA 4AXPA 2XAJB 4PJMA 4HGAA 4TV9E 4M1PA 4AQGA 1Z0PA 3ANWA 4H9OC 3FXDB 1IAPA 2CA5A 4QXBB 4B6XA 5LHGB 2Q9QA 4AI6A 5FNVE 1MMNA 3AA1B 2VKDA 2KZ7B 5E0OA 1US7B 2JMKA 3EUHA 4UIGA 3NBXX 4ILUA 4EZ4A 4AKHA 5L3GB 3H37A 4ERRA 3RYFE 2D0UA 2XAFB 3IHRA 3ZPOA 2XQYA 2A3DA 3PDYA 5HWYA 5FP3A 3Q2MA 3HKBE 1YD8G 5LNKA 3KDSE 2HPJA 5LYJE 2DWGA 3LK42 3VKHA 3C4ZA 3E08A 3CX8B 1YKEB 5JDHA 3FBZA 2D5UA 2ZM2A 3UUMA 1X79A 2E9XC 3N9OA 5CA1E 3C4XA 3X0AA 5GONE 2XUEA 4CI2B 2WAUA 2Y6XA 3UULA 3RX6A 3VU7H 4I50E 4YHJA 5CA0E 1IJ5A 1KNZA 2DHRA 3P7IA 3P8CD 4BJNA 2VB6A 4AQFC 3AAEB 5TAOA 5HWXA 1HS7A 4WW0A 1U5PA 1MMGA 2LM9A 2VL8A 4MFRA 3N2KE 3RYCE 2WMNA 4P09A 1UX5A 2JRKA 4GK5E 5H6RB 4X1IE 4OYJA 2XAHB 1HG2A 3QC9A 2VKOA 2GK9A 3RYIE 1FMWA 5BMVE 3W15B 2WWUA 4UXNB 5HXSA 3V5SA 5E3TA 4ZOLE 3OJAA 2M67A 1E1HB 2V7JA 2K48A 2ODVA 2RP4A 3PUGA 2D0TA 3ETUA 5AFUL 3ZMVB 3LK3B 1SHZC 1NWMX 3GWHA 5JQGE 3O1JA 2X51A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3X05 A;  5E3S A;  3X03 A;  1BO1 A;  2GK9 A;  5E3U A;  3X02 A;  3X07 A;  3X0A A;  4TZ7 A;  5E3T A;  3X0B A;  3X04 A;  2YBX A;  3X01 A;  3X09 A;  3X06 A;  3X0C A;  3WZZ A;  3X08 A; 
#chains in the Genus database with same CATH topology
 4H9S E;  3HL6 A;  3N2G E;  2LSJ A;  4B3T T;  5CGM A;  5DQV A;  2CHO A;  2DI4 A;  2K3W A;  3GA8 A;  5LP6 E;  4EED A;  2BKP A;  3EDU A;  2JQQ A;  5HXR A;  4YTP A;  2H7V C;  2VK9 A;  4CXW A;  1IBM T;  1XZY A;  3S4U A;  2LOS A;  3PJA J;  3J7Y q;  3EHZ A;  3HKC E;  4JUY A;  2WY2 A;  4CI1 B;  4CZZ B;  4FI5 A;  4OHF A;  4KBM B;  2KSR A;  2HHH T;  3X02 A;  4AIS A;  2W61 A;  2BVM A;  4PAG A;  2V8S V;  3OYX A;  3OYZ A;  2WDQ A;  3IA3 A;  4U33 A;  4EYU A;  2NW9 A;  4GK0 E;  4IHJ E;  3MA9 A;  3RIU C;  5JRC B;  3C4W A;  2XQ7 A;  3N9N A;  3PUZ F;  5C8Y E;  3WAJ A;  1SA0 E;  4HWH A;  2JQ9 A;  3ZJ2 A;  5DAB A;  3RRC A;  1SE7 A;  3FB2 A;  4H9P C;  3PTR B;  3N2O A;  4EIW A;  5L3C B;  1N34 T;  3JAE A;  4WBN E;  2W00 A;  3H3M A;  5EZY E;  3AE9 A;  1YQ4 A;  3AED A;  2YEV C;  1BO1 A;  4Z90 A;  2WM9 A;  4JV5 T;  5F5W A;  5FY7 A;  2K24 A;  1G73 A;  4EAH A;  4H63 V;  5JDL A;  3OTO T;  5FL0 A;  3FZK B;  3K3O A;  3ZEF B;  3FHN A;  5KDM C;  3EI0 A;  2W63 A;  2LOP A;  1QSD A;  4YSX A;  4PK5 A;  4F6R C;  2NWB A;  3E0Z A;  4WYV A;  4YJ2 E;  5JDN A;  1I94 T;  4HFD A;  4K0U A;  5HAX A;  3ZT7 A;  5JRE A;  3ZT6 A;  1V9D A;  5HYA A;  3L09 A;  5FYM A;  4PW8 A;  4IE5 A;  5AQR B;  3X03 A;  2UXD T;  3KV6 A;  2LLY A;  4KHZ F;  3BQK A;  2H3R A;  4O8S A;  2XQ9 A;  3NVO A;  4K0K T;  3GN5 B;  4IE7 A;  3UFE A;  2Y48 B;  1Y01 A;  3X08 A;  3AEG A;  4CN4 A;  3U78 A;  5L2L A;  1QUU A;  3IF8 B;  4IIJ E;  3AVS A;  3X07 A;  4TZ7 A;  2WMO A;  2UUB T;  4QXH B;  2LSG A;  2KXP B;  5ABG A;  2WB5 A;  3ZYK A;  5JDM A;  1VRB A;  3ZCJ A;  4DR4 T;  2BS3 A;  2MTQ A;  2LJL A;  5JRC A;  3NZP A;  5DJQ C;  1WRD A;  4CN1 A;  4UV8 B;  4ZXL A;  3ESL A;  3PU8 A;  2MBG A;  2IC9 A;  2BBH A;  3VKG A;  2WWV A;  4XAX B;  2X66 A;  3CQG B;  3GMI A;  3B5M A;  5EK3 A;  2AXD S;  2KLQ A;  1BR0 A;  3OPC A;  3O4X E;  5IYZ E;  4KHP T;  5AQG B;  1LKX A;  5EK4 A;  3TKL B;  2CEA A;  4H9N C;  4I0U A;  5BR8 T;  2ZMA A;  4H9Q C;  3CWZ B;  1O3X A;  3NRY A;  4A56 A;  1ZHC A;  3D0T A;  2B76 A;  3RIF A;  4X1K E;  2CLY B;  3T8O A;  3CVR A;  4X5T A;  3ABV A;  2IAK A;  2XPK A;  2W62 A;  3RIU A;  4CXY A;  3R84 B;  5LA6 E;  4PFO A;  4EZH A;  4U7I A;  3Q5W A;  4DR6 T;  3JAF A;  3ZN0 B;  3OVU A;  1J1J A;  4IDQ A;  2VUR A;  3QUJ A;  3VRB A;  5L47 A;  4YHH T;  2N2N A;  4YXD A;  1M7K A;  4JBW F;  5JDG A;  3EVY A;  4DID B;  5AQN B;  4QWN B;  2JMH A;  2IHR 1;  2LSK A;  2LRL A;  4DND A;  1JNZ A;  3ANW B;  2WSS V;  1WCR A;  3Q9D A;  4ASK A;  2ZLY A;  3P4S A;  2VKJ A;  2XJ7 A;  4CN6 A;  2DL1 A;  4AXP A;  2XAJ B;  3AE5 A;  4TV9 E;  3FXD B;  1IAP A;  2CA5 A;  3P50 A;  2KZ7 B;  2JMK A;  3QB5 A;  4AKH A;  5L3G B;  4ERR A;  2XQY A;  3PDY A;  3EAM A;  3RGL A;  2CPT A;  2XZE A;  3UU3 A;  3Q2M A;  1YD8 G;  5AQJ B;  4UR9 A;  4LF6 T;  4ZZB A;  5LYJ E;  2DWG A;  3TLV A;  3E08 A;  3CX8 B;  3AEA A;  3UUM A;  3X0A A;  4JI2 T;  5GON E;  3UUL A;  4I50 E;  4DR1 T;  4LFB T;  2DHR A;  2VB6 A;  4HWC A;  4TNW A;  3N2K E;  3RYC E;  4HWF A;  1UX5 A;  4GK5 E;  5H6R B;  4JI7 T;  4OYJ A;  3AXJ B;  2VKO A;  3RYI E;  3W15 B;  4UXN B;  1WR0 A;  1XNQ T;  3TLW A;  3JAD A;  1E1H B;  2RP4 A;  3ETU A;  3AEC A;  5HEJ A;  1SHZ C;  5JQG E;  5FXV A;  3O1J A;  1HX1 B;  5FMN A;  1OWA A;  1I6Z A;  2P9B A;  3K3Q C;  1NEN A;  2BDE A;  4G2A A;  4IRE A;  3FXE B;  3UQ4 A;  2BKN A;  2OLT A;  3RH3 A;  3QK6 A;  4IT4 A;  3SFE A;  1D1B A;  4TNV A;  1E7P A;  3ONL C;  3K8P C;  1ZOY A;  5L3B B;  1N33 T;  3N5L A;  2YU2 A;  4LFC T;  4P0B A;  5KXJ A;  4I55 E;  1EZ3 A;  4ADZ A;  1IJ6 A;  2XQ5 A;  2CRB A;  4O2B E;  3B13 A;  3AB3 B;  1T7S A;  2WZH A;  2E2A A;  2V7I A;  3LG7 A;  1UX4 A;  1H7C A;  3H3A A;  4LMK A;  4JI8 T;  5CFB A;  1KF6 A;  2J1D G;  1D0Y A;  4DO0 A;  4QH1 A;  1BR1 A;  2D2S A;  3B57 A;  3I9Y A;  2YN6 A;  2IIU A;  2HN1 A;  2XHE B;  4PJL A;  1W9R A;  4L0R A;  2YIN A;  1HTJ F;  1IBL T;  4OK0 A;  2NTY A;  1D1C A;  4UEM A;  3LDQ B;  4X20 E;  4L9I A;  3ZT5 A;  1WYB A;  3V5U A;  5HCJ A;  2H7O A;  3ZC0 A;  1BR4 A;  2UUC T;  4YTM A;  3KV5 A;  2L9Q A;  2ZM0 A;  3AE7 A;  3Q5E A;  4GYR A;  3HR0 A;  3SRZ A;  5CB4 E;  2Q9Q C;  3RI5 A;  3HA4 A;  3HKD E;  3X06 A;  5ABE A;  3DTO A;  2V7L A;  2PJQ A;  5HEU A;  5AQQ B;  5LMN T;  2IW5 B;  2CCQ A;  2IDO B;  3KVB A;  4N78 D;  4JI4 T;  3RLF F;  4KUM B;  4IDZ A;  2V7M A;  2WQY A;  1L0V A;  2E5L T;  3Q5X A;  3X09 A;  4DV2 T;  3P4R A;  1NAF A;  2NOX A;  4KP3 C;  2NP9 A;  5LMU T;  3CQC B;  3P4Q A;  1HNW T;  4DV1 T;  5L4H A;  4TV8 E;  3UUB A;  1OXZ A;  5A1L A;  4BJM A;  2W67 A;  1IBK T;  2LKH A;  1NEK A;  2Y8D A;  5AQK B;  1S35 A;  2A2F X;  4WBO A;  3I9W A;  5KMG P;  4TUY E;  3CX6 B;  2UXC T;  2MYS A;  2V6X A;  2CBI A;  3N9Q A;  2W4X A;  3JC6 D;  3BK9 A;  2DWK A;  3KBU A;  2PBI A;  4A97 A;  2CXL A;  4EOZ B;  5AQT B;  2JIW A;  3C51 A;  3N9L A;  2X68 A;  2XQ6 A;  4UVC B;  4EEB A;  2X9W A;  2BS2 A;  4GOU A;  5LXT E;  5ETW A;  2PFV A;  2JQK A;  1OED E;  2QRX A;  3X0C A;  4ZHQ E;  3DJB A;  5ABF B;  2NW8 A;  3FZL B;  2LEH A;  2ZM8 A;  3BQL A;  3CK6 A;  2E5V A;  5DQW A;  3T1H T;  4TN7 B;  1WLX A;  3ZST A;  1ZEE A;  4TWD A;  1XDO A;  3ZYL A;  1W0A A;  4LF5 T;  4B3S T;  3CPZ A;  5JDQ A;  3L3P A;  3ZYM A;  1MIY A;  2X0L B;  1DU2 A;  4YT0 A;  1B7T A;  4I43 B;  3JC6 C;  3PU3 A;  2VWA A;  4DV0 T;  5HXH A;  2IML A;  2UXB T;  5LGN B;  5LJM A;  2IUB A;  4ZS2 A;  3PV0 F;  3ZSS A;  3A5X A;  5LB7 B;  2J4G A;  2CXF A;  2XSA A;  4YSY A;  4IDN A;  2QA7 A;  2OA5 A;  2WU5 A;  3NZQ A;  3RC8 A;  2N9D A;  4AKL A;  5FXZ A;  3AE4 A;  4EB6 E;  4JI5 T;  4AQF A;  3AE1 A;  4IL4 A;  3IEE A;  2C0S A;  1Z0P A;  2FUP A;  4B6X A;  4NPP A;  5LHG B;  2Q9Q A;  5FNV E;  3AA1 B;  1XMQ T;  2VKD A;  1US7 B;  4UIG A;  3NBX X;  4EZ4 A;  3H37 A;  4HWI B;  2XAF B;  3IHR A;  2M6B A;  4U3C A;  3AEF A;  5AQV B;  5HWY A;  5FP3 A;  1ZP0 A;  3PUY F;  2OV9 A;  2WZI A;  5JDH A;  3FBZ A;  3N9O A;  5AQO B;  5ABF A;  2XUE A;  3PUV F;  2WAU A;  5CA0 E;  1KNZ A;  4BJN A;  5TAO A;  1MMG A;  4DV5 T;  2WMN A;  4X1I E;  3UQ7 A;  5FVL A;  4LF9 T;  3UU4 A;  3SFD A;  5AFU L;  3ZMV B;  1KEY A;  3GWH A;  2UU9 T;  4HWD A;  2HH7 A;  4IST A;  5L3E B;  2NTX A;  4ZS3 A;  3CX7 B;  4GKK T;  2YBX A;  2PTF A;  3RQU A;  2DNX A;  2FJD A;  4QXC B;  4ILB A;  3LJC A;  3SOL A;  2V5D A;  3J9X 1;  2ACX A;  3PUS A;  3OBV E;  3F31 A;  4HFB A;  3QNU A;  2UXN B;  3EAB A;  5J2T E;  1MNE A;  4P1N A;  2JPF A;  4DR7 T;  2V1D B;  4BA9 A;  3P4W A;  4BAY B;  4XZC A;  1UUR A;  4HFV A;  3LBX A;  3ZN1 B;  2ZM6 T;  2UXX B;  2K5B B;  4O4J E;  4F8H A;  2VAS A;  2KMF A;  5HCM A;  3MXZ A;  5F8P A;  5HEH A;  1MMD A;  4DR5 T;  3LFM A;  4MBQ A;  2BG9 C;  1E2A A;  2KT9 A;  1R8I A;  4CXX A;  4HFC A;  5ADX L;  4MHC A;  1D0X A;  3VHL A;  4YTN A;  4XBF B;  4AKI A;  3NRX A;  5LG3 A;  3X0B A;  1UK5 A;  4IE4 A;  4QX8 B;  4EYY R;  2HPL A;  2V5C A;  1WR6 A;  1YW0 A;  5LJN A;  5LOV E;  3DP7 A;  3PJA A;  2VVN A;  2X67 A;  3A8Y C;  4PJJ A;  3RC3 A;  1WFD A;  3ZCI A;  5AQH B;  3PUX F;  3PUR A;  4IL9 A;  4UVB B;  3FZM B;  2VL0 A;  2EHO D;  4FJO A;  3AAA B;  3X05 A;  2KWI B;  5C2T A;  2YDR A;  4E7S A;  3ZMZ B;  4GKJ T;  3FZF B;  5E3U A;  4DBR A;  1IZN B;  2CE7 A;  2BG9 B;  1Y64 B;  3AVR A;  4HE8 A;  4PK6 A;  3Q5D A;  3MZK B;  3UUX B;  1XDP A;  3KV9 A;  4QKN A;  4DUY T;  3SS1 A;  1KK7 A;  2KIN B;  4O2A E;  4TWF A;  4ISS A;  3UTK A;  5FVK A;  3I0O A;  4MAL A;  5LBM A;  4WNK A;  1OED C;  1BR2 A;  2ES0 A;  2XQA A;  3O1I A;  2Q9Q D;  2IC6 A;  3MJX A;  2BS4 A;  1G8X A;  1LVF A;  4QH5 A;  4AKR B;  4AQY T;  3ETV A;  5FXW A;  1MMA A;  2D9D A;  2EHO C;  1HFA A;  2H89 A;  5AQL B;  2XY8 B;  4GYS A;  4PFP A;  4P0A A;  2HN2 A;  4O4I E;  1W09 A;  2MOZ A;  5AQI B;  1QLB A;  2CMR A;  2YK0 A;  4KMC A;  3OKQ A;  4E7Z A;  2FJA A;  1MND A;  3U3I A;  2XAS B;  3IBP A;  2XM1 A;  4DV4 T;  3KIN B;  4X1Y E;  5HXE A;  5JTG A;  4PJN A;  3RPU A;  4DR3 T;  2UUA T;  2YKS A;  1OED B;  3P4P A;  3C64 A;  3WAK A;  1X9B A;  4HFH A;  5AQU B;  3FZH B;  4CQI A;  4U74 A;  3FBL A;  4TX5 A;  1LRZ A;  2K9A A;  5JDF A;  3ZMT B;  3ZJ1 A;  2LT3 A;  2V6Y A;  4JEU B;  3MAC A;  4DVD A;  4YY3 T;  4YJ3 E;  2EHO B;  4QHO A;  2I59 A;  5M4Y A;  4U7Y A;  4V1A v;  5E3S A;  2BG9 A;  1N36 T;  5LG4 A;  4COF A;  1KFY A;  3R6N A;  1W0B A;  2BBJ A;  2E9X D;  4WZX A;  2DCF A;  3X04 A;  2DLR A;  1CHU A;  2YDS A;  1FJG T;  1MIW A;  1ZKE A;  2LKG A;  3VRA A;  4JI3 T;  4JI0 T;  2ACZ A;  3KVA A;  4HKA A;  3G06 A;  2W0G A;  4KX6 A;  2J62 A;  4YFS A;  1YQ3 A;  1CUN A;  2Q9Q B;  1T98 A;  5L3F B;  3RIA A;  4ZEY A;  2V26 A;  4AKG A;  2CHN A;  1N32 T;  4HGA A;  4M1P A;  4AI6 A;  1MMN A;  5E0O A;  2VVS A;  3HKB E;  2HPJ A;  3LK4 2;  2I6H A;  3C4Z A;  2X0Y A;  1YKE B;  4ILC A;  2E9X C;  5CA1 E;  4DV7 T;  2LRK A;  4Z91 A;  4CI2 B;  2I0M A;  2Y6X A;  3RX6 A;  3VU7 H;  4YHJ A;  1IJ5 A;  3P7I A;  1HS7 A;  5C3J A;  4MFR A;  1OED A;  5J0Z A;  2JRK A;  1HG2 A;  2XM2 A;  3QC9 A;  2XQ4 A;  3RKG A;  1HNZ T;  2GK9 A;  2WS3 A;  5HXS A;  2M67 A;  3TLS A;  1JNR A;  3LSV A;  2K48 A;  2WDV A;  3LK3 B;  2X51 A;  4Q25 A;  1UCU A;  5F3J A;  4TZ4 C;  1VCT A;  2EHO A;  2NW7 A;  4LFA T;  3WI3 A;  2X9Y A;  4TWH A;  3ONJ A;  4QX7 B;  4YLH A;  4CI3 B;  1XWM A;  3CQX C;  3ONX A;  3F57 A;  2L3L A;  2C5K T;  4UV9 B;  1KNP A;  3C98 B;  5AQP B;  2W2U A;  3UUN A;  2BKO A;  3K3N A;  1XNR T;  2E9X B;  2FJB A;  3AA0 B;  3UT5 E;  3ZMS B;  1MIV A;  2BVL A;  4HEA A;  2X9H A;  3LBX B;  4C91 A;  2MPK A;  2RPA A;  3MKD A;  5KX5 E;  2X0H A;  4AIU A;  4X65 T;  5HEG A;  2KWH A;  2CM0 A;  2F4V T;  5EK2 A;  1J5W A;  5JR9 C;  2WU2 A;  3SWH A;  3TLT A;  5JH7 E;  3ZC1 A;  2CWO A;  2N1G A;  1FEW A;  5L4E A;  3JCF A;  2Z6E A;  2CLY C;  5AQS B;  3BQI A;  4LML A;  4C90 A;  2CBJ A;  4X64 T;  2CWY A;  3L8R A;  4NXN T;  4ZI7 E;  4NXM T;  1D1A A;  4YSZ A;  2V7K A;  4JI1 T;  2LSY A;  1WYC A;  4PNI A;  1HX8 A;  5H6Q B;  2XAG B;  3I0Q A;  2XAQ B;  2XSB A;  2G0U A;  5FY1 A;  2LHN A;  2SPC A;  4GIW A;  2W66 A;  3KV4 A;  2X9X A;  3VR9 A;  2QYW A;  2B1E A;  1Z8U A;  3AE3 A;  4IDO A;  4A5X A;  4DMV A;  4EGW A;  1D0Z A;  2H88 A;  4UEL A;  3PE0 A;  4PK4 A;  3X01 A;  4IE6 A;  1T8B A;  3RQW A;  5JR9 B;  1XMO T;  4I4T E;  1LVK A;  2AE9 A;  4JLE A;  4H63 H;  4U2Y A;  4EV6 A;  1FIO A;  3RKO A;  5FKY A;  2WCA A;  4DR2 T;  4B3M T;  1KNR A;  5LBQ B;  4IE0 A;  4UF0 B;  2LM2 A;  2BZB A;  3UU8 A;  1S94 A;  3AE2 A;  4DMW A;  3GN5 A;  4IGU A;  1GQE A;  3AA6 B;  5FY0 A;  2VKH A;  4DBQ A;  2RA1 A;  5LCY A;  4U31 A;  4LF7 T;  3E22 E;  5J1G A;  3PUQ A;  3AAI A;  2XQ8 A;  1AJ3 A;  5J2U E;  3NWI A;  1HG5 A;  1FMV A;  2E9X A;  3F2E A;  2YU1 A;  5LGU B;  3O9X A;  3RHW A;  1YKH B;  1ZV4 X;  3AEE A;  4NUV A;  2LSI A;  4LF8 T;  2YOE A;  3CIR A;  2MAW A;  3TLU A;  2JQH A;  4QH4 A;  2J47 A;  3ZMU B;  4JEH B;  3C50 A;  5L3D B;  4DV6 T;  1VCS A;  3KFW X;  2WBL A;  5LHI B;  4ZI2 D;  3AA7 B;  1UUS A;  4U72 A;  4JYA T;  5LHH B;  3L39 A;  4L5G A;  2QVA A;  4NUU A;  3AEB A;  3RRW A;  5JVD E;  2LE8 A;  3CML A;  5CJ5 A;  2JJ9 A;  2LHR A;  3K1S A;  5HXC A;  2ODU A;  3M3Z B;  2A9U A;  4MLK A;  2KND A;  4J2C A;  3RF1 A;  4ZI3 D;  4O4H E;  5FXX A;  3RYH E;  1U4Q A;  1HF8 A;  2CXD A;  5HEO A;  2V6Y B;  4OYK A;  4EXT A;  5IWA T;  3HI2 A;  4IDP A;  3UU6 A;  3N9P A;  2PG8 A;  4HTE A;  4A98 A;  3CKD A;  2VQF T;  5JR9 A;  2XQ3 A;  3MK7 C;  4KI0 F;  1J5E T;  4G63 A;  2E8I A;  2A72 A;  4ZI2 C;  3I1A A;  2L8K A;  2XTL A;  3PUA A;  4UVA B;  1VOM A;  4Z8X A;  3HKE E;  3O1H A;  1HNX T;  4B3R T;  2FBW A;  4UF0 A;  3UFG A;  3N9M A;  4H9R C;  3ZLI A;  3X1D A;  3QOF A;  5IHY A;  5IUX A;  3LK2 B;  2QGS A;  3WZZ A;  3M65 A;  4LMJ A;  4O4L E;  1YXR A;  3QB5 K;  4ANJ A;  3NKZ A;  2VQE T;  4HN9 A;  3T1Y T;  4HFE A;  2C5I T;  3KBT A;  4ZI3 C;  3EDV A;  1HCI A;  3PUW F;  5LGT B;  2C5J A;  4OFZ A;  4JI6 T;  4PJM A;  4AQG A;  3ANW A;  4H9O C;  4ZZC A;  4NIQ A;  2FJE A;  2WDR A;  4QXB B;  3AE8 A;  4DUZ T;  2WP9 A;  3EUH A;  4ILU A;  5AQM B;  3RYF E;  2D0U A;  3ZPO A;  2A3D A;  4U2Z A;  5AQF B;  3A7M A;  5LNK A;  3KDS E;  4X66 T;  1UGO A;  2R6G F;  4HFI A;  3VKH A;  1M62 A;  2D5U A;  2ZM2 A;  1X79 A;  3UU5 A;  4DV3 T;  2NR4 A;  3C4X A;  5ABH A;  4ILA A;  3P8C D;  4X62 T;  1HR0 T;  4AQF C;  3AAE B;  5HWX A;  4WW0 A;  1U5P A;  2VL8 A;  2LM9 A;  1T72 A;  4OX9 T;  1SUM B;  4P09 A;  3ZKR A;  2YDQ A;  4LF4 T;  2XAH B;  3AE6 A;  1FMW A;  5BMV E;  2WWU A;  2M6I A;  3V5S A;  5E3T A;  4ZOL E;  3OJA A;  2V7J A;  2BG9 E;  2ODV A;  3PUG A;  2D0T A;  3AXJ A;  1NWM X;  3VR8 A;  5FL1 A; 
#chains in the Genus database with same CATH homology
 1UCU A;  4H9S E;  3HL6 A;  3N2G E;  2LSJ A;  5FMN A;  1OWA A;  2HH7 A;  4TZ4 C;  5F3J A;  5DQV A;  2P9B A;  2DI4 A;  4IST A;  3K3Q C;  2BDE A;  5L3E B;  2EHO A;  3GA8 A;  2NW7 A;  4G2A A;  3FXE B;  5LP6 E;  3WI3 A;  3EDU A;  2NTX A;  4ZS3 A;  2JQQ A;  5HXR A;  3CX7 B;  2H7V C;  2YBX A;  2X9Y A;  2VK9 A;  4QX7 B;  4YLH A;  3RH3 A;  4CXW A;  3QK6 A;  4CI3 B;  3CQX C;  3ONX A;  3S4U A;  1D1B A;  2DNX A;  3F57 A;  4QXC B;  2LOS A;  3J7Y q;  2L3L A;  3LJC A;  3HKC E;  2C5K T;  4UV9 B;  3SOL A;  3C98 B;  4JUY A;  3J9X 1;  3UUN A;  4CI1 B;  2ACX A;  3K3N A;  3OBV E;  3F31 A;  3K8P C;  3PUS A;  4FI5 A;  4CZZ B;  4OHF A;  2E9X B;  3AA0 B;  4KBM B;  3UT5 E;  5L3B B;  3ZMS B;  1MIV A;  2BVL A;  2UXN B;  3N5L A;  4HEA A;  3X02 A;  2W61 A;  2X9H A;  2YU2 A;  3LBX B;  2BVM A;  4PAG A;  4C91 A;  4P0B A;  5J2T E;  4I55 E;  3OYX A;  1EZ3 A;  3OYZ A;  1MNE A;  3MKD A;  4ADZ A;  5KX5 E;  2JPF A;  4EYU A;  2V1D B;  4BA9 A;  2NW9 A;  4GK0 E;  4IHJ E;  2KWH A;  2CM0 A;  1IJ6 A;  3MA9 A;  4BAY B;  5EK2 A;  4XZC A;  5JR9 C;  4O2B E;  3B13 A;  3SWH A;  5JH7 E;  5JRC B;  3C4W A;  3AB3 B;  4HFV A;  3LBX A;  3ZN1 B;  3ZC1 A;  2UXX B;  2CWO A;  2N1G A;  1FEW A;  3N9N A;  2K5B B;  4O4J E;  2Z6E A;  2V7I A;  5C8Y E;  3LG7 A;  2VAS A;  2CLY C;  2KMF A;  3WAJ A;  3MXZ A;  1UX4 A;  1SA0 E;  5F8P A;  3BQI A;  1H7C A;  3H3A A;  4C90 A;  1MMD A;  3ZJ2 A;  2J1D G;  1D0Y A;  2CWY A;  3LFM A;  4MBQ A;  4DO0 A;  1BR1 A;  4ZI7 E;  1D1A A;  5DAB A;  3RRC A;  2D2S A;  3B57 A;  3I9Y A;  3FB2 A;  4H9P C;  3PTR B;  2KT9 A;  3N2O A;  2V7K A;  2XHE B;  4EIW A;  5L3C B;  2LSY A;  1WYC A;  4PJL A;  4PNI A;  4WBN E;  1HX8 A;  2W00 A;  4CXX A;  5EZY E;  4L0R A;  5H6Q B;  2YIN A;  2XAG B;  5ADX L;  1HTJ F;  4MHC A;  1D0X A;  3VHL A;  2YEV C;  4OK0 A;  1BO1 A;  2NTY A;  1D1C A;  3I0Q A;  2WM9 A;  4XBF B;  4UEM A;  4AKI A;  3NRX A;  4X20 E;  2XAQ B;  4L9I A;  5FY7 A;  2G0U A;  5FY1 A;  3X0B A;  2K24 A;  1G73 A;  1WYB A;  4EAH A;  2LHN A;  4IE4 A;  4QX8 B;  3V5U A;  2SPC A;  4GIW A;  2H7O A;  3ZC0 A;  4H63 V;  4EYY R;  5JDL A;  1BR4 A;  2HPL A;  3KV4 A;  2X9X A;  1WR6 A;  3KV5 A;  2L9Q A;  1YW0 A;  2ZM0 A;  5LJN A;  2B1E A;  3K3O A;  3ZEF B;  5LOV E;  3FHN A;  3DP7 A;  5KDM C;  2W63 A;  4DMV A;  2LOP A;  1QSD A;  2X67 A;  1D0Z A;  4GYR A;  5FXV A;  4PK5 A;  4UEL A;  3HR0 A;  3SRZ A;  5CB4 E;  4F6R C;  2NWB A;  3PE0 A;  2Q9Q C;  4PJJ A;  3RC3 A;  3E0Z A;  3HA4 A;  4PK4 A;  3ZCI A;  4YJ2 E;  3HKD E;  4K0U A;  5JDN A;  3PUR A;  3X01 A;  3X06 A;  5HAX A;  4IE6 A;  3DTO A;  5JRE A;  4UVB B;  2V7L A;  1V9D A;  2PJQ A;  5HYA A;  5JR9 B;  2EHO D;  3L09 A;  4FJO A;  5FYM A;  3AAA B;  4PW8 A;  4IE5 A;  2IW5 B;  3X05 A;  2KWI B;  4I4T E;  2CCQ A;  3X03 A;  1LVK A;  3KV6 A;  4E7S A;  3KVB A;  4N78 D;  3BQK A;  4JLE A;  4H63 H;  3ZMZ B;  5E3U A;  4DBR A;  2H3R A;  1FIO A;  3RKO A;  4KUM B;  4IDZ A;  2V7M A;  1IZN B;  4O8S A;  3GN5 B;  3Q5X A;  4IE7 A;  5LBQ B;  2CE7 A;  3X09 A;  4IE0 A;  1Y64 B;  3UFE A;  4UF0 B;  3AVR A;  1NAF A;  2Y48 B;  4HE8 A;  4PK6 A;  3X08 A;  2BZB A;  2NOX A;  3MZK B;  1S94 A;  4KP3 C;  3UUX B;  3KV9 A;  4QKN A;  4DMW A;  3GN5 A;  3SS1 A;  3U78 A;  5L2L A;  1QUU A;  2NP9 A;  4IGU A;  1KK7 A;  2KIN B;  3CQC B;  4O2A E;  3IF8 B;  3AA6 B;  5FY0 A;  4ISS A;  2VKH A;  3UTK A;  2RA1 A;  4DBQ A;  4IIJ E;  5LCY A;  3I0O A;  3AVS A;  4MAL A;  5LBM A;  4WNK A;  3X07 A;  3E22 E;  4TZ7 A;  5J1G A;  2WMO A;  3PUQ A;  1BR2 A;  3AAI A;  4TV8 E;  1OXZ A;  2ES0 A;  4QXH B;  5A1L A;  3O1I A;  2Q9Q D;  2IC6 A;  1AJ3 A;  5J2U E;  4BJM A;  2LSG A;  3MJX A;  1HG5 A;  1FMV A;  2KXP B;  2E9X A;  2Y8D A;  1G8X A;  1LVF A;  3F2E A;  1S35 A;  2A2F X;  3ZYK A;  2YU1 A;  4WBO A;  3I9W A;  5JDM A;  5KMG P;  5LGU B;  3O9X A;  1VRB A;  1YKH B;  1ZV4 X;  4NUV A;  3ZCJ A;  4TUY E;  2LSI A;  3CX6 B;  4AKR B;  2MTQ A;  2LJL A;  2MYS A;  3ETV A;  5FXW A;  3ZMU B;  1MMA A;  4JEH B;  3C50 A;  5L3D B;  3NZP A;  5JRC A;  3N9Q A;  5DJQ C;  1WRD A;  3JC6 D;  2EHO C;  3BK9 A;  2DWK A;  3KFW X;  1HFA A;  3KBU A;  4UV8 B;  2PBI A;  2WBL A;  3ESL A;  3PU8 A;  4GYS A;  2CXL A;  2MBG A;  4EOZ B;  5LHI B;  4PFP A;  4P0A A;  4ZI2 D;  3AA7 B;  3C51 A;  3N9L A;  2IC9 A;  4O4I E;  2X68 A;  4U72 A;  4UVC B;  3VKG A;  2X9W A;  4GOU A;  5LXT E;  2MOZ A;  5LHH B;  5ETW A;  4L5G A;  2CMR A;  2PFV A;  2YK0 A;  4KMC A;  4XAX B;  3OKQ A;  4E7Z A;  4NUU A;  1MND A;  3RRW A;  3U3I A;  2XAS B;  3IBP A;  5JVD E;  2X66 A;  3X0C A;  2LE8 A;  3CML A;  4ZHQ E;  3DJB A;  3CQG B;  3KIN B;  4X1Y E;  2JJ9 A;  2LHR A;  2NW8 A;  3GMI A;  5HXE A;  5EK3 A;  5HXC A;  2LEH A;  2ODU A;  4MLK A;  2KLQ A;  4PJN A;  3RPU A;  1BR0 A;  2ZM8 A;  2KND A;  5IYZ E;  3O4X E;  3BQL A;  4J2C A;  1LKX A;  3C64 A;  4ZI3 D;  4O4H E;  5FXX A;  3WAK A;  5DQW A;  5EK4 A;  3RYH E;  3TKL B;  1U4Q A;  2CEA A;  4H9N C;  2ZMA A;  1HF8 A;  2CXD A;  4H9Q C;  4TN7 B;  1WLX A;  1ZEE A;  4OYK A;  3CWZ B;  4EXT A;  4CQI A;  4U74 A;  3FBL A;  1O3X A;  3ZYL A;  3HI2 A;  3NRY A;  4TX5 A;  4A56 A;  3N9P A;  1LRZ A;  2K9A A;  1ZHC A;  3D0T A;  5JDF A;  2PG8 A;  3ZMT B;  4HTE A;  4X1K E;  3CPZ A;  3ZJ1 A;  2CLY B;  5JDQ A;  2LT3 A;  3L3P A;  3T8O A;  3CVR A;  3ZYM A;  1MIY A;  2IAK A;  3CKD A;  2X0L B;  2W62 A;  5JR9 A;  4JEU B;  4CXY A;  3MAC A;  3R84 B;  3MK7 C;  5LA6 E;  1B7T A;  4I43 B;  4DVD A;  3JC6 C;  4PFO A;  4YJ3 E;  4EZH A;  2EHO B;  3PU3 A;  4G63 A;  4QHO A;  2E8I A;  2VWA A;  2A72 A;  2I59 A;  5M4Y A;  3Q5W A;  4V1A v;  5HXH A;  4ZI2 C;  3I1A A;  2L8K A;  2XTL A;  3ZN0 B;  3PUA A;  4UVA B;  5LGN B;  5LJM A;  1VOM A;  4Z8X A;  5E3S A;  3HKE E;  3QUJ A;  3O1H A;  4ZS2 A;  3A5X A;  5LG4 A;  3R6N A;  4UF0 A;  2CXF A;  3N9M A;  2E9X D;  4H9R C;  2N2N A;  3ZLI A;  2QA7 A;  2DCF A;  3X04 A;  2OA5 A;  2DLR A;  5JDG A;  3EVY A;  5IHY A;  3LK2 B;  2QGS A;  3WZZ A;  1MIW A;  1ZKE A;  3M65 A;  3NZQ A;  4QWN B;  4O4L E;  2JMH A;  3KVA A;  4HKA A;  3RC8 A;  4ANJ A;  2N9D A;  2W0G A;  2LSK A;  4HN9 A;  4AKL A;  4DND A;  3ANW B;  5FXZ A;  2C5I T;  3KBT A;  4YFS A;  4ZI3 C;  2WSS V;  4EB6 E;  3EDV A;  4AQF A;  1CUN A;  2Q9Q B;  1HCI A;  1T98 A;  5L3F B;  3Q9D A;  4ASK A;  2ZLY A;  5LGT B;  2VKJ A;  2C5J A;  3IEE A;  4OFZ A;  2V26 A;  2C0S A;  4AKG A;  4AXP A;  2XAJ B;  4PJM A;  4HGA A;  4TV9 E;  4M1P A;  4AQG A;  1Z0P A;  3ANW A;  4H9O C;  3FXD B;  1IAP A;  2CA5 A;  4QXB B;  4B6X A;  5LHG B;  2Q9Q A;  4AI6 A;  5FNV E;  1MMN A;  3AA1 B;  2VKD A;  2KZ7 B;  5E0O A;  1US7 B;  2JMK A;  3EUH A;  4UIG A;  3NBX X;  4ILU A;  4EZ4 A;  4AKH A;  5L3G B;  3H37 A;  4ERR A;  3RYF E;  2D0U A;  2XAF B;  3IHR A;  3ZPO A;  2XQY A;  2A3D A;  3PDY A;  5HWY A;  5FP3 A;  3Q2M A;  3HKB E;  1YD8 G;  5LNK A;  3KDS E;  2HPJ A;  5LYJ E;  2DWG A;  3LK4 2;  3VKH A;  3C4Z A;  3E08 A;  3CX8 B;  1YKE B;  5JDH A;  3FBZ A;  2D5U A;  2ZM2 A;  3UUM A;  1X79 A;  2E9X C;  3N9O A;  5CA1 E;  3C4X A;  3X0A A;  5GON E;  2XUE A;  4CI2 B;  2WAU A;  2Y6X A;  3UUL A;  3RX6 A;  3VU7 H;  4I50 E;  4YHJ A;  5CA0 E;  1IJ5 A;  1KNZ A;  2DHR A;  3P7I A;  3P8C D;  4BJN A;  2VB6 A;  4AQF C;  3AAE B;  5TAO A;  5HWX A;  1HS7 A;  4WW0 A;  1U5P A;  1MMG A;  2LM9 A;  2VL8 A;  4MFR A;  3N2K E;  3RYC E;  2WMN A;  4P09 A;  1UX5 A;  2JRK A;  4GK5 E;  5H6R B;  4X1I E;  4OYJ A;  2XAH B;  1HG2 A;  3QC9 A;  2VKO A;  2GK9 A;  3RYI E;  1FMW A;  5BMV E;  3W15 B;  2WWU A;  4UXN B;  5HXS A;  3V5S A;  5E3T A;  4ZOL E;  3OJA A;  2M67 A;  1E1H B;  2V7J A;  2K48 A;  2ODV A;  2RP4 A;  3PUG A;  2D0T A;  3ETU A;  5AFU L;  3ZMV B;  3LK3 B;  1SHZ C;  1NWM X;  3GWH A;  5JQG E;  3O1J A;  2X51 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...