2GK9A

Human phosphatidylinositol-4-phosphate 5-kinase, type ii, gamma
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
373
structure length
243
Chain Sequence
DPLVGVFLWGVAHSINELSQVPPPVMLLPDDFKASSKIKVNNHLFHRENLPSHFKFKEYCPQVFRNLRDRFGIDDQDYLVSLTRNPPSESEFLISYDRTLVIKEVSSEDIADMHSNLSNYHQYIVKCHGNTLLPQFLGMYRVSVDNEDSYMLVMRNMFSHRLPVHRKYDLKGTLRDMDNKNQKVYIKKIFLEKLKRDVEFLVQLKIMDYSLLLGIHDIEVYFMGLIDILHPEQYAKRFLDFIT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords phosphatidylinositol-4-phosphate 5-kinase, type II, gamma
publication title Structure of Human Phosphatidylinositol-4-phosphate 5-kinase, type II, gamma
rcsb
source organism Homo sapiens
total genus 57
structure length 243
sequence length 373
chains with identical sequence B, C, D
ec nomenclature ec 2.7.1.149: 1-phosphatidylinositol-5-phosphate 4-kinase.
pdb deposition date 2006-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01504 PIP5K Phosphatidylinositol-4-phosphate 5-Kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1870 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2gk9A02
3.30.800.10 Alpha Beta 2-Layer Sandwich Phosphatidylinositol Phosphate Kinase II Beta Phosphatidylinositol Phosphate Kinase II Beta 2gk9A01
3X04A 2YBXA 3X08A 4TZ7A 3X06A 3X0BA 1BO1A 3X01A 5E3UA 3X0CA 3X07A 3X03A 5E3TA 3X09A 3X05A 3X02A 2GK9A 5E3SA 3X0AA 3WZZA
chains in the Genus database with same CATH superfamily
2WMNA 4TNVA 1ZV4X 3P50A 4FJOA 3PE0A 3J9X1 3AE9A 2BS4A 2XQYA 4JI0T 4CQIA 1MNDA 2OV9A 3NWIA 3QK6A 2NOXA 4TWHA 2E9XA 5LHGB 2VKDA 1J5WA 5H6RB 5GONE 4WYVA 5LYJE 1MIWA 3B13A 4J2CA 2AXDS 3PJAA 5DABA 3CQCB 2UXBT 3AEDA 4HFIA 4NUUA 4LF4T 2V7JA 3WZZA 1D0YA 2XAGB 2X9YA 5HEGA 4QX8B 1WR0A 3K3OA 3NRXA 3RX6A 2KLQA 3LBXB 3X07A 2LOPA 4ZI7E 2XQ6A 4KHZF 2IC6A 2CXDA 4TZ4C 4DV0T 5CB4E 3HI2A 3RHWA 4TN7B 3CWZB 4C90A 5IHYA 2A3DA 3OKQA 2IW5B 2B76A 1NEKA 3D0TA 2ACXA 5FXZA 2VQET 2XSBA 3AE5A 4HFVA 5LXTE 2AE9A 3LSVA 2VQFT 3VR9A 2WDRA 5AQNB 2JQHA 3V5UA 1BR1A 4U2YA 3AA7B 3ZJ1A 4O2BE 2WWVA 1G73A 2XQAA 3ZC1A 2E9XC 3X02A 2PJQA 1G8XA 5E3SA 2BG9E 4DR7T 5FL1A 3X08A 4H9SE 4I43B 4ZS3A 2HPLA 5ABFA 4P0AA 3N2KE 1FMVA 3ONLC 2JMKA 1W0BA 2JMHA 2W4XA 4HFHA 2LSKA 3MZKB 3M65A 1L0VA 3JAFA 3FBZA 5C3JA 2W61A 3AA6B 1UK5A 3ZPOA 5AQFB 2XJ7A 1NENA 3BQLA 4ZHQE 2OLTA 4DR5T 4H9NC 4EOZB 4DV1T 2UU9T 1ZOYA 3B5MA 5JDLA 4TX5A 3ZN1B 4GIWA 5FXVA 3PUSA 2KWIB 1WR6A 2NR4A 2W00A 2YDSA 2CWYA 1MIVA 4AKRB 3QUJA 4YHHT 4TV9E 4QH1A 3P4RA 2E9XB 1Y64B 3CKDA 5J1GA 3VKHA 4B6XA 3HKBE 4PK5A 3H3MA 5FY1A 2LT3A 2A2FX 3GWHA 2WSSV 5KMGP 1I6ZA 2D0UA 2DWGA 3PUVF 5CJ5A 1H7CA 2G0UA 3PUXF 4OYJA 1IJ5A 4X5TA 4IE6A 5HEUA 5CA1E 5A1LA 4L5GA 3ZYMA 5HWXA 3VRAA 4EAHA 4HKAA 4OX9T 4DR1T 3P8CD 3AE1A 1YD8G 1HTJF 4EIWA 3PURA 2K3WA 1Z0PA 2LKGA 4DV4T 2KINB 4NXMT 3N9LA 4X1KE 2NW9A 3T8OA 4AIUA 1UUSA 3CQXC 5AQMB 2ZMAA 3RRWA 2D5UA 1KNPA 2XQ3A 3JCFA 3N9QA 4HE8A 3CX6B 3C98B 3PUYF 5E3TA 2W63A 4DUYT 1T72A 4WNKA 5LGNB 1E7PA 4MHCA 3E08A 5JRCA 3FXEB 5HXRA 4DR4T 3EAMA 1E2AA 2ZM6T 3KV9A 2HN1A 5AQPB 3UUXB 1D0ZA 2XY8B 5L4EA 3OPCA 5ABFB 3UUMA 3AXJA 2CWOA 2E5LT 2E5VA 4H9RC 1T8BA 3PDYA 2NP9A 4IDOA 3EABA 3ETVA 5F5WA 3L39A 1KF6A 2LHNA 3O1JA 1O3XA 4ZOLE 1VCTA 5ABHA 3O4XE 4Z90A 4CXXA 3CK6A 1HG5A 2FJEA 2XPKA 3N2OA 4JI7T 4K0UA 1AJ3A 4X20E 2VASA 3BK9A 2V1DB 1MIYA 1HX8A 2YDRA 4ASKA 4EB6E 3PUWF 2XM1A 1JNZA 3AE4A 4ILCA 3VHLA 2PFVA 2H7VC 4KX6A 5J0ZA 4X62T 5BMVE 1HNWT 4JI8T 2CLYC 5KX5E 1BR2A 2LKHA 3IEEA 5LGTB 5JH7E 3ESLA 5EZYE 1US7B 4HWHA 1IBMT 4O8SA 3UQ4A 4HWCA 3EUHA 5JDNA 2CHNA 3C4WA 2BBJA 1WRDA 5BR8T 3KFWX 4DR2T 4M1PA 5LHIB 4TWFA 3NKZA 4PFOA 3ZEFB 4YSYA 3I1AA 3P7IA 1J1JA 3RIAA 1D1CA 2EHOD 1NAFA 3JC6C 3SRZA 3LG7A 3Q5EA 3V5SA 5L2LA 1U4QA 3C64A 4X1YE 3R6NA 3TLVA 5JRCB 5L3GB 2IC9A 3OYXA 4FI5A 4PJNA 2XAQB 4QXBB 4AKHA 2Z6EA 2HH7A 2XQ9A 4MALA 1KK7A 2V26A 3SWHA 5LG4A 3AVRA 2XQ7A 2IHR1 4P0BA 3LK2B 2B1EA 2LEHA 3AXJB 4BA9A 5ABEA 3ONJA 3RC3A 2ZM0A 4IREA 4HEAA 3O1HA 4PNIA 3UTKA 5AQKB 3ZMUB 1X79A 3A7MA 4ISTA 4QWNB 3AEFA 4DIDB 2FJAA 1BR4A 2XAJB 4G2AA 3NZQA 5C8YE 4ERRA 4U3CA 1XNRT 4KI0F 2WDQA 3LK3B 2V5CA 4JLEA 2K9AA 4HFDA 1FIOA 1CHUA 2A9UA 3I9WA 3I0OA 3RLFF 1VCSA 2ODUA 3EDVA 4MLKA 5IYZE 5LBQB 3P4SA 4PK4A 4X65T 5FL0A 3A5XA 2KSRA 2VL8A 1HG2A 2K48A 5LJNA 2UXXB 3RF1A 3PJAJ 4DV3T 2ODVA 4BAYB 3AE2A 3EDUA 3RYFE 4NUVA 4YT0A 2H3RA 2GK9A 3MXZA 2ZLYA 1QSDA 4MBQA 3AAEB 4WW0A 4BJMA 2K24A 3UU4A 4LF9T 4LMJA 3AECA 5JREA 3CPZA 1W09A 3PV0F 2MOZA 5L3EB 3X05A 2BZBA 4IDQA 4QHOA 3RKOA 2E8IA 4ADZA 1SE7A 3TLTA 2YOEA 4DVDA 4DBQA 2FJBA 3HR0A 3ZSTA 5LG3A 4B3ST 2MYSA 3ETUA 3FZLB 4NPPA 1T7SA 3AEGA 4A5XA 4L0RA 2V6XA 4L9IA 5AQTB 5J2UE 3CMLA 4NIQA 3F2EA 3MJXA 3ZYKA 2DL1A 2X66A 1W0AA 3AE3A 2X68A 1KNRA 4UR9A 5HWYA 5FYMA 3P4QA 2NW7A 2V5DA 1D1BA 3AAAB 3E0ZA 4TUYE 4AQFC 2IIUA 1E1HB 3KBUA 4JI1T 4N78D 5FMNA 3HKEE 5L3BB 3GA8A 2I59A 2HPJA 3UU8A 3RRCA 1YW0A 3AEAA 1IAPA 4TV8E 3HA4A 2XZEA 4ZZBA 4U2ZA 3KVBA 1ZKEA 4QH5A 4CI1B 4H9QC 2L3LA 2P9BA 1ZHCA 4YJ2E 4JI6T 3PUZF 2C5IT 3HKDE 1UURA 3X09A 2LLYA 1OEDC 2VL0A 2WWUA 2C5JA 1LVKA 2PBIA 2CPTA 5HYAA 3X04A 4H63V 3LFMA 5FXXA 3ZT7A 4CXYA 2A72A 4O4LE 3K3NA 5HXHA 2V6YA 3N9NA 4AQGA 4DMVA 2BKPA 3ZSSA 2CA5A 5E0OA 4U7IA 4CI2B 4IE7A 4F8HA 3KINB 3KV5A 4WZXA 5HEOA 3FXDB 3MKDA 4LF6T 4COFA 5IUXA 4DV2T 4JYAT 4U33A 2QGSA 5CGMA 3MACA 4OHFA 3WAKA 2X67A 3CX7B 3AE6A 1HFAA 1MMNA 2D9DA 4IT4A 5LMUT 4EYUA 1MMDA 4YTNA 4E7ZA 4KHPT 2IDOB 4XBFB 2DWKA 3GMIA 2YU1A 4GYRA 1FMWA 4KP3C 4OK0A 2CEAA 2CHOA 3TLUA 4DMWA 1HCIA 4QXCB 5AQUB 4JI4T 1MMGA 3K3QC 3QOFA 5AQJB 2WCAA 2XASB 5JVDE 2YBXA 3BQIA 4LMKA 4ZI2C 1NWMX 5LMNT 4LFCT 2F4VT 3ZT5A 5EK3A 4EV6A 4HTEA 5J2TE 4ZI2D 2XHEB 4LFBT 4K0KT 2YU2A 1KNZA 3C4ZA 4UELA 2KZ7B 1CUNA 3ZYLA 4I55E 3AE8A 2LRKA 3O1IA 2Q9QC 3UQ7A 4ILAA 1D1AA 2EHOA 4U74A 5DQVA 3KV4A 5L3FB 2Q9QD 3IHRA 2QYWA 3BQKA 3RH3A 2WB5A 5LJMA 4Z91A 5LB7B 1D0XA 5EK2A 4O2AE 2H89A 2VK9A 3ABVA 1N36T 4HFBA 2BG9C 4JEHB 4XAXB 2ACZA 1MMAA 3Q5XA 4P1NA 4UV9B 2HN2A 3CVRA 2XM2A 2YDQA 1J5ET 1HF8A 3GN5A 2WM9A 2V6YB 1HNZT 1B7TA 4G63A 3ZMVB 4TNWA 1Z8UA 3ANWA 4ZI3C 2NTYA 3UUNA 5ADXL 4UVBB 1DU2A 3RPUA 3OYZA 2VVSA 3QNUA 5FKYA 3RIUC 4ZI3D 5HEHA 4H9OC 5HXEA 1KFYA 2R6GF 3L8RA 5ABGA 3H3AA 5FVKA 2CXLA 5AQIB 3FHNA 4GYSA 3FB2A 4UVAB 2BBHA 3DJBA 3RQWA 3H37A 3RYCE 2BVMA 2VKHA 2X9HA 2WAUA 2EHOC 2V7IA 2ES0A 2LSYA 5KXJA 4KBMB 5LBMA 2UXCT 2WU2A 1R8IA 1M7KA 3AA1B 4HWIB 4DR6T 3KDSE 2DHRA 3QB5A 2WU5A 3FZMB 2J1DG 2NWBA 3ZMTB 3JAEA 1XDPA 3Q9DA 5HAXA 4O4JE 4A97A 2J4GA 5L3CB 2JQQA 3KV6A 2CLYB 2LSIA 2JQ9A 4YTPA 2NTXA 2W67A 3NZPA 2K5BB 4UF0A 1QLBA 5JR9C 2Y48B 1IBLT 5LCYA 2VB6A 4JEUB 4AXPA 3ZCIA 3RQUA 1YKEB 5HCMA 1HR0T 2RPAA 3RI5A 4PFPA 5FY7A 4GOUA 2JPFA 4U72A 2Y8DA 3F57A 3UULA 3PUAA 2QVAA 3N9MA 2XTLA 5HCJA 4DUZT 2M67A 3DTOA 2IUBA 4DV7T 5JDQA 1WFDA 2MBGA 4YSXA 4LF5T 5L4HA 2JQKA 4CN6A 3X06A 5HXCA 4DBRA 4IDZA 3X0CA 3AEEA 1YXRA 1WCRA 3GN5B 2C0SA 3HKCE 5EK4A 4BJNA 3X0AA 4HN9A 3OVUA 5C2TA 4I4TE 3ANWB 2J47A 3N5LA 2D2SA 3PUQA 4X64T 3ZLIA 2CM0A 1IZNB 5JDHA 2JIWA 1KEYA 2YN6A 4PJMA 4H63H 4ZS2A 2LRLA 4ANJA 3RIFA 4AQFA 4HGAA 3KBTA 5F8PA 4IDPA 2M6IA 2DI4A 5AQOB 1LKXA 2L9QA 4IL4A 3ZT6A 2CBJA 1SUMB 3X0BA 4O4IE 4V1Av 4TWDA 2YK0A 4YLHA 4QKNA 2N9DA 3ZJ2A 2UUCT 1WLXA 5LP6E 3O9XA 4LF7T 4HFCA 1S94A 2WY2A 4EZHA 2WDVA 4UEMA 1OEDA 2CBIA 3NRYA 3IA3A 3ZMSB 4JV5T 3X01A 4AKGA 4QXHB 4P09A 4IDNA 4UF0B 3MA9A 5JDFA 1IJ6A 5FVLA 3PU3A 5IWAT 1VRBA 3SS1A 3C4XA 3Q5WA 2LSJA 2PTFA 2VURA 4AI6A 1ZEEA 2MPKA 3CQGB 4ILUA 3AE7A 4A56A 2XSAA 1UX4A 4YFSA 4CI3B 2XUEA 4CN4A 2LSGA 2UXDT 4CN1A 4UIGA 2UUAT 2X9XA 3VKGA 1WYBA 1HS7A 5AFUL 3DP7A 2BS3A 3ZN0B 4GK0E 2ZM8A 1BR0A 2E9XD 2V7MA 4CXWA 4GKKT 5CA0E 4YSZA 4IE0A 1SA0E 4NXNT 1UCUA 3AB3B 3UFEA 2H7OA 1YKHB 3R84B 3F31A 3FZKB 4IE5A 1S35A 2LHRA 2YINA 2FUPA 3NBXX 5AQHB 4A98A 3M3ZB 3N2GE 1UGOA 4JI2T 4IGUA 4UVCB 3W15B 3SFDA 4DV5T 2RA1A 5FXWA 4ISSA 2BKOA 5AQLB 5LHHB 2HHHT 2VWAA 2IMLA 3TLWA 2N2NA 2MAWA 4EXTA 5KDMC 1OXZA 1FEWA 3RGLA 5LOVE 2BS2A 5HXSA 3EVYA 4AQYT 4XZCA 4B3TT 2BKNA 4E7SA 2WZHA 2LJLA 2M6BA 2W0GA 2X0YA 2XAFB 4YY3T 4U7YA 2Q9QA 1X9BA 3SFEA 2UUBT 3CX8B 1HX1B 5M4YA 2MTQA 2VKOA 4JI5T 3UUBA 1XMQT 1WYCA 4H9PC 1UX5A 2YEVC 3U78A 4X66T 3TKLB 1OEDB 2KMFA 4IE4A 2BG9A 2WS3A 2SPCA 4GKJT 2V7KA 1MNEA 4ZXLA 1W9RA 4X1IE 3RC8A 2LM9A 3LJCA 3CIRA 4O4HE 3U3IA 3A8YC 4U31A 3VU7H 4QH4A 4IHJE 5LA6E 3ZC0A 1GQEA 1XNQT 3OTOT 3J7Yq 2W62A 3X1DA 4WBNE 3N9PA 3RIUA 4EZ4A 3OBVE 2KT9A 4YHJA 4PW8A 2PG8A 4PAGA 4ZZCA 2XQ8A 5TAOA 3E22E 3EI0A 3T1HT 4PK6A 4WBOA 4DV6T 4UV8B 3AEBA 4LMLA 2QA7A 4QX7B 3S4UA 2LOSA 5FNVE 2X9WA 2CE7A 1XMOT 3X03A 4LFAT 2X0HA 3IF8B 1T98A 3SOLA 4PJLA 2N1GA 4YXDA 4JBWF 2CXFA 4C91A 1FJGT 1U5PA 2KWHA 4GK5E 2BVLA 2KXPB 4MFRA 3AAIA 3OJAA 3AVSA 4HWFA 2YKSA 2BDEA 3K8PC 1LRZA 3PUGA 2VVNA 4Q25A 1IBKT 2LM2A 5CFBA 3B57A 1HNXT 2CMRA 5HEJA 4KUMB 3PU8A 3NVOA 5FY0A 3LK42 5JR9A 5LNKA 1ZP0A 3Q2MA 3IBPA 2I6HA 2DLRA 2XQ5A 1N33T 2CRBA 3ZMZB 3I9YA 4AISA 2KNDA 3AA0B 2Q9QB 5JTGA 2NW8A 4HWDA 4HFEA 2XAHB 2C5KT 4ILBA 4IL9A 3G06A 3L3PA 4Z8XA 2J62A 5JQGE 2W66A 4TZ7A 2H88A 2W2UA 2WZIA 3JADA 5AQVB 2QRXA 2BG9B 1I94T 3QB5K 1LVFA 5AQSB 5JDGA 1V9DA 2V7LA 2DCFA 3ZKRA 2LE8A 5AQQB 4OYKA 4DR3T 2CCQA 4F6RC 4YTMA 4B3RT 3VR8A 5AQGB 2X51A 3L09A 3UT5E 4KMCA 3TLSA 4EYYR 3FZFB 1N32T 2Y6XA 3LBXA 4I0UA 2XQ4A 2UXNB 3N9OA 3UU3A 4LF8T 3ONXA 2FBWA 1EZ3A 4OFZA 2DNXA 3JC6D 2IAKA 1Y01A 5AQRB 5E3UA 3UU6A 2WBLA 5FP3A 3C51A 4JI3T 1VOMA 2OA5A 2ZM2A 2WMOA 4UXNB 3C50A 3MK7C 2RP4A 3P4PA 2JRKA 3I0QA 2E2AA 3ZCJA 5ETWA 4ZEYA 3K1SA 1BO1A 3P4WA 4IIJE 2EHOB 4DNDA 4I50E 3RKGA 5JDMA 5F3JA 1SHZC 4YJ3E 3VRBA 1XDOA 1XZYA 2I0MA 4EEBA 1N34T 3LDQB 3QC9A 1OEDE 2WQYA 2FJDA 2L8KA 5DJQC 3UU5A 2V8SV 2X0LB 4B3MT 3KVAA 2WP9A 3FZHB 1OWAA 4AKIA 1YQ3A 5H6QB 3RYHE 3T1YT 3Q5DA 3FBLA 2D0TA 4CZZB 2JJ9A 4JUYA 5JR9B 4AKLA 3WAJA 5DQWA 3PTRB 3RYIE 4EEDA 1JNRA 3EHZA 1QUUA 4DO0A 2VKJA 1M62A 5L47A 3UFGA 1YQ4A 4EGWA 1XWMA 3WI3A 3HL6A 4PJJA 5LGUB 5L3DB
chains in the Genus database with same CATH topology
1BR0A 2E9XD 2YBXA 3KFWX 2V7MA 2WMNA 3BQIA 4M1PA 4CXWA 1NWMX 4ZI2C 5CA0E 5LHIB 1ZV4X 4FJOA 4PFOA 4IE0A 3ZEFB 5EK3A 3PE0A 3J9X1 1SA0E 4HTEA 5J2TE 1UCUA 3AB3B 3UFEA 2H7OA 4ZI2D 1YKHB 3I1AA 3R84B 2XHEB 2XQYA 3P7IA 2YU2A 3F31A 4IE5A 1KNZA 1S35A 4CQIA 2LHRA 1D1CA 2EHOD 1MNDA 2YINA 1NAFA 3JC6C 3QK6A 3NBXX 2NOXA 5LHGB 2E9XA 3C4ZA 2VKDA 3SRZA 4UELA 2KZ7B 3LG7A 5GONE 5H6RB 1CUNA 5LYJE 3ZYLA 3N2GE 4I55E 1MIWA 3V5SA 3B13A 4IGUA 4J2CA 4UVCB 3W15B 5L2LA 1U4QA 3O1IA 2RA1A 3C64A 3CQCB 4X1YE 2Q9QC 5DABA 3R6NA 5JRCB 5L3GB 5FXWA 2IC9A 3OYXA 4FI5A 4PJNA 2XAQB 1D1AA 4QXBB 4AKHA 4ISSA 2Z6EA 5LHHB 2EHOA 2VWAA 4U74A 4NUUA 5DQVA 2HH7A 2N2NA 2V7JA 4MALA 3KV4A 1KK7A 5L3FB 2V26A 2Q9QD 3WZZA 3SWHA 4EXTA 3IHRA 3RH3A 3BQKA 5LG4A 3AVRA 1D0YA 5KDMC 5LJMA 1OXZA 2XAGB 1D0XA 1FEWA 2X9YA 4QX8B 4P0BA 5LOVE 5EK2A 4O2AE 3K3OA 3NRXA 3RX6A 3LK2B 5HXSA 3EVYA 2KLQA 2B1EA 2VK9A 3LBXB 4XZCA 2LEHA 3X07A 2LOPA 4BA9A 4ZI7E 4E7SA 4JEHB 4XAXB 2LJLA 2XAFB 2W0GA 1MMAA 3Q5XA 4UV9B 2IC6A 3RC3A 2CXDA 2ZM0A 4TZ4C 2Q9QA 4HEAA 3CVRA 5CB4E 3CX8B 3O1HA 5M4YA 3HI2A 2MTQA 2VKOA 1HF8A 3GN5A 2WM9A 4PNIA 3UTKA 3ZMUB 4TN7B 3CWZB 1WYCA 1X79A 4H9PC 1UX5A 2A3DA 5IHYA 2YEVC 4C90A 3U78A 4ISTA 4QWNB 3OKQA 1B7TA 4G63A 2IW5B 3TKLB 3D0TA 2ACXA 3ZMVB 2KMFA 4ZI3C 3ANWA 5FXZA 1BR4A 2NTYA 3UUNA 2XAJB 5ADXL 4G2AA 4IE4A 3NZQA 5C8YE 4UVBB 4HFVA 4ERRA 2SPCA 5LXTE 3RPUA 2V7KA 3OYZA 1MNEA 4ZI3D 3LK3B 4H9OC 5HXEA 4X1IE 3RC8A 4JLEA 2LM9A 3H3AA 2K9AA 3V5UA 3LJCA 1BR1A 2CXLA 3FHNA 3AA7B 4GYSA 3ZJ1A 4O2BE 4O4HE 1FIOA 1G73A 3U3IA 3I9WA 3ZC1A 3I0OA 2E9XC 3VU7H 4IHJE 3FB2A 4UVAB 3DJBA 2ODUA 3EDVA 3X02A 2PJQA 1G8XA 3H37A 5LA6E 5E3SA 3ZC0A 4MLKA 5IYZE 5LBQB 3RYCE 4PK4A 3X08A 4H9SE 4I43B 2BVMA 2VKHA 2X9HA 3A5XA 2VL8A 2WAUA 1HG2A 2K48A 5LJNA 4ZS3A 3J7Yq 2HPLA 2UXXB 2W62A 4P0AA 3N2KE 2ODVA 4WBNE 2EHOC 1FMVA 3N9PA 2V7IA 4EZ4A 4BAYB 2JMKA 3OBVE 2KT9A 2JMHA 3EDUA 2ES0A 2LSYA 3RYFE 4YHJA 4NUVA 4KBMB 2LSKA 5LBMA 3MZKB 2H3RA 2GK9A 4PW8A 3M65A 3MXZA 2ZLYA 2PG8A 1QSDA 4MBQA 4PAGA 3AA1B 3AAEB 4WW0A 3FBZA 5TAOA 3E22E 2W61A 3AA6B 4BJMA 4PK6A 4WBOA 4UV8B 2K24A 3ZPOA 4ZHQE 2QA7A 3BQLA 4QX7B 3S4UA 3KDSE 2DHRA 4H9NC 4EOZB 5JDLA 2LOSA 5FNVE 4TX5A 2J1DG 5JREA 2X9WA 3ZN1B 2CE7A 3X03A 2NWBA 3CPZA 4GIWA 5FXVA 3ZMTB 3PUSA 2MOZA 5L3EB 2KWIB 3IF8B 3X05A 2BZBA 3Q9DA 5HAXA 1T98A 1WR6A 4O4JE 3SOLA 2W00A 5L3CB 2JQQA 2N1GA 3KV6A 4PJLA 2CLYB 2LSIA 2CWYA 2NTXA 3NZPA 2K5BB 1MIVA 4QHOA 2CXFA 4UF0A 4AKRB 4C91A 3QUJA 3RKOA 2E8IA 5JR9C 1U5PA 4TV9E 2Y48B 2KWHA 4ADZA 4GK5E 5LCYA 2BVLA 2KXPB 2VB6A 4JEUB 2E9XB 1Y64B 3CKDA 5J1GA 4AXPA 3HR0A 4DVDA 4DBQA 3ZCIA 3HKBE 4B6XA 4MFRA 1YKEB 4PK5A 3AAIA 2MYSA 3OJAA 5FY1A 3AVSA 2LT3A 2A2FX 3GWHA 2WSSV 3VKHA 4PFPA 5FY7A 3ETUA 5KMGP 5L3DB 2D0UA 2BDEA 4GOUA 2DWGA 1LRZA 3K8PC 3PUGA 1H7CA 2G0UA 2JPFA 4U72A 3B57A 4L0RA 4OYJA 1IJ5A 2Y8DA 2CMRA 3F57A 4IE6A 3UULA 3PUAA 4KUMB 4L9IA 3PU8A 5CA1E 5A1LA 4L5GA 3ZYMA 5FY0A 3LK42 5J2UE 3N9MA 2XTLA 5HWXA 3CMLA 4EAHA 5JR9A 3F2EA 2M67A 3DTOA 3MJXA 5LNKA 3Q2MA 4HKAA 5JDQA 3ZYKA 3IBPA 2DLRA 2X66A 3P8CD 2MBGA 2X68A 3ZMZB 3I9YA 1YD8G 1HTJF 4EIWA 3X06A 5HWYA 5HXCA 5FYMA 3PURA 4DBRA 2KNDA 4IDZA 3AA0B 2Q9QB 2NW8A 3X0CA 1Z0PA 2XAHB 2NW7A 2C5KT 3GN5B 2KINB 2C0SA 3HKCE 3N9LA 5EK4A 4BJNA 3L3PA 1D1BA 3AAAB 3E0ZA 4TUYE 3X0AA 4HN9A 4AQFC 4X1KE 2NW9A 1E1HB 3T8OA 4Z8XA 3KBUA 3CQXC 4N78D 5JQGE 2ZMAA 4I4TE 3RRWA 5FMNA 2D5UA 4TZ7A 3ANWB 3HKEE 5L3BB 3GA8A 3N9QA 3N5LA 2I59A 4HE8A 2D2SA 3CX6B 3PUQA 3C98B 3ZLIA 2HPJA 2W63A 2CM0A 5E3TA 1IZNB 5JDHA 4WNKA 3RRCA 1LVFA 5JDGA 5LGNB 1YW0A 4MHCA 1V9DA 4TV8E 1IAPA 3HA4A 2V7LA 3E08A 2DCFA 4PJMA 5JRCA 3FXEB 2LE8A 4H63H 3KVBA 1ZKEA 4ZS2A 4CI1B 4OYKA 5HXRA 4H9QC 2L3LA 2CCQA 4F6RC 4ANJA 4AQFA 4HGAA 2P9BA 1ZHCA 4YJ2E 2C5IT 2X51A 3HKDE 3L09A 3UT5E 3KBTA 3KV9A 5F8PA 4KMCA 3X09A 4EYYR 3UUXB 2DI4A 1LKXA 2Y6XA 3LBXA 2WWUA 1D0ZA 2C5JA 2UXNB 3N9OA 1LVKA 3ONXA 3UUMA 2PBIA 2L9QA 5HYAA 3X04A 1EZ3A 4OFZA 2CWOA 4H63V 3LFMA 4H9RC 5FXXA 2DNXA 3PDYA 4CXYA 3JC6D 2IAKA 2NP9A 2A72A 4O4LE 3X0BA 4O4IE 4V1Av 3K3NA 5E3UA 2YK0A 4YLHA 4QKNA 2N9DA 2WBLA 5FP3A 5HXHA 3C51A 3ZJ2A 3N9NA 4AQGA 3ETVA 1VOMA 2OA5A 2ZM2A 2WMOA 4DMVA 4UXNB 1WLXA 2LHNA 3C50A 3MK7C 5LP6E 2RP4A 3O9XA 3O1JA 1O3XA 1S94A 4ZOLE 2CA5A 5E0OA 4EZHA 4UEMA 2JRKA 3I0QA 3ZCJA 4CI2B 5ETWA 4IE7A 3O4XE 4CXXA 3KINB 1HG5A 3NRYA 3ZMSB 1BO1A 3X01A 4IIJE 4AKGA 2EHOB 3KV5A 4DNDA 4I50E 4QXHB 4P09A 5JDMA 5F3JA 3N2OA 3FXDB 3MKDA 4UF0B 1SHZC 4YJ3E 4K0UA 1AJ3A 3MA9A 5JDFA 4X20E 2QGSA 2VASA 3BK9A 3MACA 2V1DB 1IJ6A 3PU3A 1MIYA 1HX8A 4ASKA 3QC9A 4EB6E 1VRBA 3SS1A 3C4XA 4OHFA 3Q5WA 3WAKA 2LSJA 2X67A 2L8KA 5DJQC 3CX7B 4AI6A 1HFAA 2X0LB 1ZEEA 3KVAA 1MMNA 3VHLA 3CQGB 1OWAA 2PFVA 4AKIA 2H7VC 5H6QB 4EYUA 3RYHE 1MMDA 4E7ZA 4ILUA 4A56A 5BMVE 4XBFB 2DWKA 3GMIA 1UX4A 3FBLA 4YFSA 2D0TA 2CLYC 4CI3B 2XUEA 5KX5E 2YU1A 1BR2A 2JJ9A 4JUYA 4CZZB 2LSGA 5JR9B 3IEEA 4AKLA 4GYRA 5LGTB 3WAJA 5DQWA 3PTRB 1FMWA 3RYIE 3ESLA 5EZYE 5JH7E 4UIGA 1US7B 4KP3C 4OK0A 2CEAA 2X9XA 1QUUA 4DO0A 2VKJA 3VKGA 1WYBA 4DMWA 1HS7A 1HCIA 4QXCB 5AFUL 4O8SA 3DP7A 3ZN0B 1MMGA 4GK0E 3EUHA 3K3QC 3HL6A 3WI3A 5JDNA 2ZM8A 2XASB 5JVDE 4PJJA 5LGUB 3C4WA 1WRDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3X04 A;  2YBX A;  3X08 A;  4TZ7 A;  3X06 A;  3X0B A;  1BO1 A;  3X01 A;  5E3U A;  3X0C A;  3X07 A;  3X03 A;  5E3T A;  3X09 A;  3X05 A;  3X02 A;  2GK9 A;  5E3S A;  3X0A A;  3WZZ A; 
#chains in the Genus database with same CATH topology
 2WMN A;  4TNV A;  1ZV4 X;  3P50 A;  4FJO A;  3PE0 A;  3J9X 1;  3AE9 A;  2BS4 A;  2XQY A;  4JI0 T;  4CQI A;  1MND A;  2OV9 A;  3NWI A;  3QK6 A;  2NOX A;  4TWH A;  2E9X A;  5LHG B;  2VKD A;  1J5W A;  5H6R B;  5GON E;  4WYV A;  5LYJ E;  1MIW A;  3B13 A;  4J2C A;  2AXD S;  3PJA A;  5DAB A;  3CQC B;  2UXB T;  3AED A;  4HFI A;  4NUU A;  4LF4 T;  2V7J A;  3WZZ A;  1D0Y A;  2XAG B;  2X9Y A;  5HEG A;  4QX8 B;  1WR0 A;  3K3O A;  3NRX A;  3RX6 A;  2KLQ A;  3LBX B;  3X07 A;  2LOP A;  4ZI7 E;  2XQ6 A;  4KHZ F;  2IC6 A;  2CXD A;  4TZ4 C;  4DV0 T;  5CB4 E;  3HI2 A;  3RHW A;  4TN7 B;  3CWZ B;  4C90 A;  5IHY A;  2A3D A;  3OKQ A;  2IW5 B;  2B76 A;  1NEK A;  3D0T A;  2ACX A;  5FXZ A;  2VQE T;  2XSB A;  3AE5 A;  4HFV A;  5LXT E;  2AE9 A;  3LSV A;  2VQF T;  3VR9 A;  2WDR A;  5AQN B;  2JQH A;  3V5U A;  1BR1 A;  4U2Y A;  3AA7 B;  3ZJ1 A;  4O2B E;  2WWV A;  1G73 A;  2XQA A;  3ZC1 A;  2E9X C;  3X02 A;  2PJQ A;  1G8X A;  5E3S A;  2BG9 E;  4DR7 T;  5FL1 A;  3X08 A;  4H9S E;  4I43 B;  4ZS3 A;  2HPL A;  5ABF A;  4P0A A;  3N2K E;  1FMV A;  3ONL C;  2JMK A;  1W0B A;  2JMH A;  2W4X A;  4HFH A;  2LSK A;  3MZK B;  3M65 A;  1L0V A;  3JAF A;  3FBZ A;  5C3J A;  2W61 A;  3AA6 B;  1UK5 A;  3ZPO A;  5AQF B;  2XJ7 A;  1NEN A;  3BQL A;  4ZHQ E;  2OLT A;  4DR5 T;  4H9N C;  4EOZ B;  4DV1 T;  2UU9 T;  1ZOY A;  3B5M A;  5JDL A;  4TX5 A;  3ZN1 B;  4GIW A;  5FXV A;  3PUS A;  2KWI B;  1WR6 A;  2NR4 A;  2W00 A;  2YDS A;  2CWY A;  1MIV A;  4AKR B;  3QUJ A;  4YHH T;  4TV9 E;  4QH1 A;  3P4R A;  2E9X B;  1Y64 B;  3CKD A;  5J1G A;  3VKH A;  4B6X A;  3HKB E;  4PK5 A;  3H3M A;  5FY1 A;  2LT3 A;  2A2F X;  3GWH A;  2WSS V;  5KMG P;  1I6Z A;  2D0U A;  2DWG A;  3PUV F;  5CJ5 A;  1H7C A;  2G0U A;  3PUX F;  4OYJ A;  1IJ5 A;  4X5T A;  4IE6 A;  5HEU A;  5CA1 E;  5A1L A;  4L5G A;  3ZYM A;  5HWX A;  3VRA A;  4EAH A;  4HKA A;  4OX9 T;  4DR1 T;  3P8C D;  3AE1 A;  1YD8 G;  1HTJ F;  4EIW A;  3PUR A;  2K3W A;  1Z0P A;  2LKG A;  4DV4 T;  2KIN B;  4NXM T;  3N9L A;  4X1K E;  2NW9 A;  3T8O A;  4AIU A;  1UUS A;  3CQX C;  5AQM B;  2ZMA A;  3RRW A;  2D5U A;  1KNP A;  2XQ3 A;  3JCF A;  3N9Q A;  4HE8 A;  3CX6 B;  3C98 B;  3PUY F;  5E3T A;  2W63 A;  4DUY T;  1T72 A;  4WNK A;  5LGN B;  1E7P A;  4MHC A;  3E08 A;  5JRC A;  3FXE B;  5HXR A;  4DR4 T;  3EAM A;  1E2A A;  2ZM6 T;  3KV9 A;  2HN1 A;  5AQP B;  3UUX B;  1D0Z A;  2XY8 B;  5L4E A;  3OPC A;  5ABF B;  3UUM A;  3AXJ A;  2CWO A;  2E5L T;  2E5V A;  4H9R C;  1T8B A;  3PDY A;  2NP9 A;  4IDO A;  3EAB A;  3ETV A;  5F5W A;  3L39 A;  1KF6 A;  2LHN A;  3O1J A;  1O3X A;  4ZOL E;  1VCT A;  5ABH A;  3O4X E;  4Z90 A;  4CXX A;  3CK6 A;  1HG5 A;  2FJE A;  2XPK A;  3N2O A;  4JI7 T;  4K0U A;  1AJ3 A;  4X20 E;  2VAS A;  3BK9 A;  2V1D B;  1MIY A;  1HX8 A;  2YDR A;  4ASK A;  4EB6 E;  3PUW F;  2XM1 A;  1JNZ A;  3AE4 A;  4ILC A;  3VHL A;  2PFV A;  2H7V C;  4KX6 A;  5J0Z A;  4X62 T;  5BMV E;  1HNW T;  4JI8 T;  2CLY C;  5KX5 E;  1BR2 A;  2LKH A;  3IEE A;  5LGT B;  5JH7 E;  3ESL A;  5EZY E;  1US7 B;  4HWH A;  1IBM T;  4O8S A;  3UQ4 A;  4HWC A;  3EUH A;  5JDN A;  2CHN A;  3C4W A;  2BBJ A;  1WRD A;  5BR8 T;  3KFW X;  4DR2 T;  4M1P A;  5LHI B;  4TWF A;  3NKZ A;  4PFO A;  3ZEF B;  4YSY A;  3I1A A;  3P7I A;  1J1J A;  3RIA A;  1D1C A;  2EHO D;  1NAF A;  3JC6 C;  3SRZ A;  3LG7 A;  3Q5E A;  3V5S A;  5L2L A;  1U4Q A;  3C64 A;  4X1Y E;  3R6N A;  3TLV A;  5JRC B;  5L3G B;  2IC9 A;  3OYX A;  4FI5 A;  4PJN A;  2XAQ B;  4QXB B;  4AKH A;  2Z6E A;  2HH7 A;  2XQ9 A;  4MAL A;  1KK7 A;  2V26 A;  3SWH A;  5LG4 A;  3AVR A;  2XQ7 A;  2IHR 1;  4P0B A;  3LK2 B;  2B1E A;  2LEH A;  3AXJ B;  4BA9 A;  5ABE A;  3ONJ A;  3RC3 A;  2ZM0 A;  4IRE A;  4HEA A;  3O1H A;  4PNI A;  3UTK A;  5AQK B;  3ZMU B;  1X79 A;  3A7M A;  4IST A;  4QWN B;  3AEF A;  4DID B;  2FJA A;  1BR4 A;  2XAJ B;  4G2A A;  3NZQ A;  5C8Y E;  4ERR A;  4U3C A;  1XNR T;  4KI0 F;  2WDQ A;  3LK3 B;  2V5C A;  4JLE A;  2K9A A;  4HFD A;  1FIO A;  1CHU A;  2A9U A;  3I9W A;  3I0O A;  3RLF F;  1VCS A;  2ODU A;  3EDV A;  4MLK A;  5IYZ E;  5LBQ B;  3P4S A;  4PK4 A;  4X65 T;  5FL0 A;  3A5X A;  2KSR A;  2VL8 A;  1HG2 A;  2K48 A;  5LJN A;  2UXX B;  3RF1 A;  3PJA J;  4DV3 T;  2ODV A;  4BAY B;  3AE2 A;  3EDU A;  3RYF E;  4NUV A;  4YT0 A;  2H3R A;  2GK9 A;  3MXZ A;  2ZLY A;  1QSD A;  4MBQ A;  3AAE B;  4WW0 A;  4BJM A;  2K24 A;  3UU4 A;  4LF9 T;  4LMJ A;  3AEC A;  5JRE A;  3CPZ A;  1W09 A;  3PV0 F;  2MOZ A;  5L3E B;  3X05 A;  2BZB A;  4IDQ A;  4QHO A;  3RKO A;  2E8I A;  4ADZ A;  1SE7 A;  3TLT A;  2YOE A;  4DVD A;  4DBQ A;  2FJB A;  3HR0 A;  3ZST A;  5LG3 A;  4B3S T;  2MYS A;  3ETU A;  3FZL B;  4NPP A;  1T7S A;  3AEG A;  4A5X A;  4L0R A;  2V6X A;  4L9I A;  5AQT B;  5J2U E;  3CML A;  4NIQ A;  3F2E A;  3MJX A;  3ZYK A;  2DL1 A;  2X66 A;  1W0A A;  3AE3 A;  2X68 A;  1KNR A;  4UR9 A;  5HWY A;  5FYM A;  3P4Q A;  2NW7 A;  2V5D A;  1D1B A;  3AAA B;  3E0Z A;  4TUY E;  4AQF C;  2IIU A;  1E1H B;  3KBU A;  4JI1 T;  4N78 D;  5FMN A;  3HKE E;  5L3B B;  3GA8 A;  2I59 A;  2HPJ A;  3UU8 A;  3RRC A;  1YW0 A;  3AEA A;  1IAP A;  4TV8 E;  3HA4 A;  2XZE A;  4ZZB A;  4U2Z A;  3KVB A;  1ZKE A;  4QH5 A;  4CI1 B;  4H9Q C;  2L3L A;  2P9B A;  1ZHC A;  4YJ2 E;  4JI6 T;  3PUZ F;  2C5I T;  3HKD E;  1UUR A;  3X09 A;  2LLY A;  1OED C;  2VL0 A;  2WWU A;  2C5J A;  1LVK A;  2PBI A;  2CPT A;  5HYA A;  3X04 A;  4H63 V;  3LFM A;  5FXX A;  3ZT7 A;  4CXY A;  2A72 A;  4O4L E;  3K3N A;  5HXH A;  2V6Y A;  3N9N A;  4AQG A;  4DMV A;  2BKP A;  3ZSS A;  2CA5 A;  5E0O A;  4U7I A;  4CI2 B;  4IE7 A;  4F8H A;  3KIN B;  3KV5 A;  4WZX A;  5HEO A;  3FXD B;  3MKD A;  4LF6 T;  4COF A;  5IUX A;  4DV2 T;  4JYA T;  4U33 A;  2QGS A;  5CGM A;  3MAC A;  4OHF A;  3WAK A;  2X67 A;  3CX7 B;  3AE6 A;  1HFA A;  1MMN A;  2D9D A;  4IT4 A;  5LMU T;  4EYU A;  1MMD A;  4YTN A;  4E7Z A;  4KHP T;  2IDO B;  4XBF B;  2DWK A;  3GMI A;  2YU1 A;  4GYR A;  1FMW A;  4KP3 C;  4OK0 A;  2CEA A;  2CHO A;  3TLU A;  4DMW A;  1HCI A;  4QXC B;  5AQU B;  4JI4 T;  1MMG A;  3K3Q C;  3QOF A;  5AQJ B;  2WCA A;  2XAS B;  5JVD E;  2YBX A;  3BQI A;  4LMK A;  4ZI2 C;  1NWM X;  5LMN T;  4LFC T;  2F4V T;  3ZT5 A;  5EK3 A;  4EV6 A;  4HTE A;  5J2T E;  4ZI2 D;  2XHE B;  4LFB T;  4K0K T;  2YU2 A;  1KNZ A;  3C4Z A;  4UEL A;  2KZ7 B;  1CUN A;  3ZYL A;  4I55 E;  3AE8 A;  2LRK A;  3O1I A;  2Q9Q C;  3UQ7 A;  4ILA A;  1D1A A;  2EHO A;  4U74 A;  5DQV A;  3KV4 A;  5L3F B;  2Q9Q D;  3IHR A;  2QYW A;  3BQK A;  3RH3 A;  2WB5 A;  5LJM A;  4Z91 A;  5LB7 B;  1D0X A;  5EK2 A;  4O2A E;  2H89 A;  2VK9 A;  3ABV A;  1N36 T;  4HFB A;  2BG9 C;  4JEH B;  4XAX B;  2ACZ A;  1MMA A;  3Q5X A;  4P1N A;  4UV9 B;  2HN2 A;  3CVR A;  2XM2 A;  2YDQ A;  1J5E T;  1HF8 A;  3GN5 A;  2WM9 A;  2V6Y B;  1HNZ T;  1B7T A;  4G63 A;  3ZMV B;  4TNW A;  1Z8U A;  3ANW A;  4ZI3 C;  2NTY A;  3UUN A;  5ADX L;  4UVB B;  1DU2 A;  3RPU A;  3OYZ A;  2VVS A;  3QNU A;  5FKY A;  3RIU C;  4ZI3 D;  5HEH A;  4H9O C;  5HXE A;  1KFY A;  2R6G F;  3L8R A;  5ABG A;  3H3A A;  5FVK A;  2CXL A;  5AQI B;  3FHN A;  4GYS A;  3FB2 A;  4UVA B;  2BBH A;  3DJB A;  3RQW A;  3H37 A;  3RYC E;  2BVM A;  2VKH A;  2X9H A;  2WAU A;  2EHO C;  2V7I A;  2ES0 A;  2LSY A;  5KXJ A;  4KBM B;  5LBM A;  2UXC T;  2WU2 A;  1R8I A;  1M7K A;  3AA1 B;  4HWI B;  4DR6 T;  3KDS E;  2DHR A;  3QB5 A;  2WU5 A;  3FZM B;  2J1D G;  2NWB A;  3ZMT B;  3JAE A;  1XDP A;  3Q9D A;  5HAX A;  4O4J E;  4A97 A;  2J4G A;  5L3C B;  2JQQ A;  3KV6 A;  2CLY B;  2LSI A;  2JQ9 A;  4YTP A;  2NTX A;  2W67 A;  3NZP A;  2K5B B;  4UF0 A;  1QLB A;  5JR9 C;  2Y48 B;  1IBL T;  5LCY A;  2VB6 A;  4JEU B;  4AXP A;  3ZCI A;  3RQU A;  1YKE B;  5HCM A;  1HR0 T;  2RPA A;  3RI5 A;  4PFP A;  5FY7 A;  4GOU A;  2JPF A;  4U72 A;  2Y8D A;  3F57 A;  3UUL A;  3PUA A;  2QVA A;  3N9M A;  2XTL A;  5HCJ A;  4DUZ T;  2M67 A;  3DTO A;  2IUB A;  4DV7 T;  5JDQ A;  1WFD A;  2MBG A;  4YSX A;  4LF5 T;  5L4H A;  2JQK A;  4CN6 A;  3X06 A;  5HXC A;  4DBR A;  4IDZ A;  3X0C A;  3AEE A;  1YXR A;  1WCR A;  3GN5 B;  2C0S A;  3HKC E;  5EK4 A;  4BJN A;  3X0A A;  4HN9 A;  3OVU A;  5C2T A;  4I4T E;  3ANW B;  2J47 A;  3N5L A;  2D2S A;  3PUQ A;  4X64 T;  3ZLI A;  2CM0 A;  1IZN B;  5JDH A;  2JIW A;  1KEY A;  2YN6 A;  4PJM A;  4H63 H;  4ZS2 A;  2LRL A;  4ANJ A;  3RIF A;  4AQF A;  4HGA A;  3KBT A;  5F8P A;  4IDP A;  2M6I A;  2DI4 A;  5AQO B;  1LKX A;  2L9Q A;  4IL4 A;  3ZT6 A;  2CBJ A;  1SUM B;  3X0B A;  4O4I E;  4V1A v;  4TWD A;  2YK0 A;  4YLH A;  4QKN A;  2N9D A;  3ZJ2 A;  2UUC T;  1WLX A;  5LP6 E;  3O9X A;  4LF7 T;  4HFC A;  1S94 A;  2WY2 A;  4EZH A;  2WDV A;  4UEM A;  1OED A;  2CBI A;  3NRY A;  3IA3 A;  3ZMS B;  4JV5 T;  3X01 A;  4AKG A;  4QXH B;  4P09 A;  4IDN A;  4UF0 B;  3MA9 A;  5JDF A;  1IJ6 A;  5FVL A;  3PU3 A;  5IWA T;  1VRB A;  3SS1 A;  3C4X A;  3Q5W A;  2LSJ A;  2PTF A;  2VUR A;  4AI6 A;  1ZEE A;  2MPK A;  3CQG B;  4ILU A;  3AE7 A;  4A56 A;  2XSA A;  1UX4 A;  4YFS A;  4CI3 B;  2XUE A;  4CN4 A;  2LSG A;  2UXD T;  4CN1 A;  4UIG A;  2UUA T;  2X9X A;  3VKG A;  1WYB A;  1HS7 A;  5AFU L;  3DP7 A;  2BS3 A;  3ZN0 B;  4GK0 E;  2ZM8 A;  1BR0 A;  2E9X D;  2V7M A;  4CXW A;  4GKK T;  5CA0 E;  4YSZ A;  4IE0 A;  1SA0 E;  4NXN T;  1UCU A;  3AB3 B;  3UFE A;  2H7O A;  1YKH B;  3R84 B;  3F31 A;  3FZK B;  4IE5 A;  1S35 A;  2LHR A;  2YIN A;  2FUP A;  3NBX X;  5AQH B;  4A98 A;  3M3Z B;  3N2G E;  1UGO A;  4JI2 T;  4IGU A;  4UVC B;  3W15 B;  3SFD A;  4DV5 T;  2RA1 A;  5FXW A;  4ISS A;  2BKO A;  5AQL B;  5LHH B;  2HHH T;  2VWA A;  2IML A;  3TLW A;  2N2N A;  2MAW A;  4EXT A;  5KDM C;  1OXZ A;  1FEW A;  3RGL A;  5LOV E;  2BS2 A;  5HXS A;  3EVY A;  4AQY T;  4XZC A;  4B3T T;  2BKN A;  4E7S A;  2WZH A;  2LJL A;  2M6B A;  2W0G A;  2X0Y A;  2XAF B;  4YY3 T;  4U7Y A;  2Q9Q A;  1X9B A;  3SFE A;  2UUB T;  3CX8 B;  1HX1 B;  5M4Y A;  2MTQ A;  2VKO A;  4JI5 T;  3UUB A;  1XMQ T;  1WYC A;  4H9P C;  1UX5 A;  2YEV C;  3U78 A;  4X66 T;  3TKL B;  1OED B;  2KMF A;  4IE4 A;  2BG9 A;  2WS3 A;  2SPC A;  4GKJ T;  2V7K A;  1MNE A;  4ZXL A;  1W9R A;  4X1I E;  3RC8 A;  2LM9 A;  3LJC A;  3CIR A;  4O4H E;  3U3I A;  3A8Y C;  4U31 A;  3VU7 H;  4QH4 A;  4IHJ E;  5LA6 E;  3ZC0 A;  1GQE A;  1XNQ T;  3OTO T;  3J7Y q;  2W62 A;  3X1D A;  4WBN E;  3N9P A;  3RIU A;  4EZ4 A;  3OBV E;  2KT9 A;  4YHJ A;  4PW8 A;  2PG8 A;  4PAG A;  4ZZC A;  2XQ8 A;  5TAO A;  3E22 E;  3EI0 A;  3T1H T;  4PK6 A;  4WBO A;  4DV6 T;  4UV8 B;  3AEB A;  4LML A;  2QA7 A;  4QX7 B;  3S4U A;  2LOS A;  5FNV E;  2X9W A;  2CE7 A;  1XMO T;  3X03 A;  4LFA T;  2X0H A;  3IF8 B;  1T98 A;  3SOL A;  4PJL A;  2N1G A;  4YXD A;  4JBW F;  2CXF A;  4C91 A;  1FJG T;  1U5P A;  2KWH A;  4GK5 E;  2BVL A;  2KXP B;  4MFR A;  3AAI A;  3OJA A;  3AVS A;  4HWF A;  2YKS A;  2BDE A;  3K8P C;  1LRZ A;  3PUG A;  2VVN A;  4Q25 A;  1IBK T;  2LM2 A;  5CFB A;  3B57 A;  1HNX T;  2CMR A;  5HEJ A;  4KUM B;  3PU8 A;  3NVO A;  5FY0 A;  3LK4 2;  5JR9 A;  5LNK A;  1ZP0 A;  3Q2M A;  3IBP A;  2I6H A;  2DLR A;  2XQ5 A;  1N33 T;  2CRB A;  3ZMZ B;  3I9Y A;  4AIS A;  2KND A;  3AA0 B;  2Q9Q B;  5JTG A;  2NW8 A;  4HWD A;  4HFE A;  2XAH B;  2C5K T;  4ILB A;  4IL9 A;  3G06 A;  3L3P A;  4Z8X A;  2J62 A;  5JQG E;  2W66 A;  4TZ7 A;  2H88 A;  2W2U A;  2WZI A;  3JAD A;  5AQV B;  2QRX A;  2BG9 B;  1I94 T;  3QB5 K;  1LVF A;  5AQS B;  5JDG A;  1V9D A;  2V7L A;  2DCF A;  3ZKR A;  2LE8 A;  5AQQ B;  4OYK A;  4DR3 T;  2CCQ A;  4F6R C;  4YTM A;  4B3R T;  3VR8 A;  5AQG B;  2X51 A;  3L09 A;  3UT5 E;  4KMC A;  3TLS A;  4EYY R;  3FZF B;  1N32 T;  2Y6X A;  3LBX A;  4I0U A;  2XQ4 A;  2UXN B;  3N9O A;  3UU3 A;  4LF8 T;  3ONX A;  2FBW A;  1EZ3 A;  4OFZ A;  2DNX A;  3JC6 D;  2IAK A;  1Y01 A;  5AQR B;  5E3U A;  3UU6 A;  2WBL A;  5FP3 A;  3C51 A;  4JI3 T;  1VOM A;  2OA5 A;  2ZM2 A;  2WMO A;  4UXN B;  3C50 A;  3MK7 C;  2RP4 A;  3P4P A;  2JRK A;  3I0Q A;  2E2A A;  3ZCJ A;  5ETW A;  4ZEY A;  3K1S A;  1BO1 A;  3P4W A;  4IIJ E;  2EHO B;  4DND A;  4I50 E;  3RKG A;  5JDM A;  5F3J A;  1SHZ C;  4YJ3 E;  3VRB A;  1XDO A;  1XZY A;  2I0M A;  4EEB A;  1N34 T;  3LDQ B;  3QC9 A;  1OED E;  2WQY A;  2FJD A;  2L8K A;  5DJQ C;  3UU5 A;  2V8S V;  2X0L B;  4B3M T;  3KVA A;  2WP9 A;  3FZH B;  1OWA A;  4AKI A;  1YQ3 A;  5H6Q B;  3RYH E;  3T1Y T;  3Q5D A;  3FBL A;  2D0T A;  4CZZ B;  2JJ9 A;  4JUY A;  5JR9 B;  4AKL A;  3WAJ A;  5DQW A;  3PTR B;  3RYI E;  4EED A;  1JNR A;  3EHZ A;  1QUU A;  4DO0 A;  2VKJ A;  1M62 A;  5L47 A;  3UFG A;  1YQ4 A;  4EGW A;  1XWM A;  3WI3 A;  3HL6 A;  4PJJ A;  5LGU B;  5L3D B; 
#chains in the Genus database with same CATH homology
 1BR0 A;  2E9X D;  2YBX A;  3KFW X;  2V7M A;  2WMN A;  3BQI A;  4M1P A;  4CXW A;  1NWM X;  4ZI2 C;  5CA0 E;  5LHI B;  1ZV4 X;  4FJO A;  4PFO A;  4IE0 A;  3ZEF B;  5EK3 A;  3PE0 A;  3J9X 1;  1SA0 E;  4HTE A;  5J2T E;  1UCU A;  3AB3 B;  3UFE A;  2H7O A;  4ZI2 D;  1YKH B;  3I1A A;  3R84 B;  2XHE B;  2XQY A;  3P7I A;  2YU2 A;  3F31 A;  4IE5 A;  1KNZ A;  1S35 A;  4CQI A;  2LHR A;  1D1C A;  2EHO D;  1MND A;  2YIN A;  1NAF A;  3JC6 C;  3QK6 A;  3NBX X;  2NOX A;  5LHG B;  2E9X A;  3C4Z A;  2VKD A;  3SRZ A;  4UEL A;  2KZ7 B;  3LG7 A;  5GON E;  5H6R B;  1CUN A;  5LYJ E;  3ZYL A;  3N2G E;  4I55 E;  1MIW A;  3V5S A;  3B13 A;  4IGU A;  4J2C A;  4UVC B;  3W15 B;  5L2L A;  1U4Q A;  3O1I A;  2RA1 A;  3C64 A;  3CQC B;  4X1Y E;  2Q9Q C;  5DAB A;  3R6N A;  5JRC B;  5L3G B;  5FXW A;  2IC9 A;  3OYX A;  4FI5 A;  4PJN A;  2XAQ B;  1D1A A;  4QXB B;  4AKH A;  4ISS A;  2Z6E A;  5LHH B;  2EHO A;  2VWA A;  4U74 A;  4NUU A;  5DQV A;  2HH7 A;  2N2N A;  2V7J A;  4MAL A;  3KV4 A;  1KK7 A;  5L3F B;  2V26 A;  2Q9Q D;  3WZZ A;  3SWH A;  4EXT A;  3IHR A;  3RH3 A;  3BQK A;  5LG4 A;  3AVR A;  1D0Y A;  5KDM C;  5LJM A;  1OXZ A;  2XAG B;  1D0X A;  1FEW A;  2X9Y A;  4QX8 B;  4P0B A;  5LOV E;  5EK2 A;  4O2A E;  3K3O A;  3NRX A;  3RX6 A;  3LK2 B;  5HXS A;  3EVY A;  2KLQ A;  2B1E A;  2VK9 A;  3LBX B;  4XZC A;  2LEH A;  3X07 A;  2LOP A;  4BA9 A;  4ZI7 E;  4E7S A;  4JEH B;  4XAX B;  2LJL A;  2XAF B;  2W0G A;  1MMA A;  3Q5X A;  4UV9 B;  2IC6 A;  3RC3 A;  2CXD A;  2ZM0 A;  4TZ4 C;  2Q9Q A;  4HEA A;  3CVR A;  5CB4 E;  3CX8 B;  3O1H A;  5M4Y A;  3HI2 A;  2MTQ A;  2VKO A;  1HF8 A;  3GN5 A;  2WM9 A;  4PNI A;  3UTK A;  3ZMU B;  4TN7 B;  3CWZ B;  1WYC A;  1X79 A;  4H9P C;  1UX5 A;  2A3D A;  5IHY A;  2YEV C;  4C90 A;  3U78 A;  4IST A;  4QWN B;  3OKQ A;  1B7T A;  4G63 A;  2IW5 B;  3TKL B;  3D0T A;  2ACX A;  3ZMV B;  2KMF A;  4ZI3 C;  3ANW A;  5FXZ A;  1BR4 A;  2NTY A;  3UUN A;  2XAJ B;  5ADX L;  4G2A A;  4IE4 A;  3NZQ A;  5C8Y E;  4UVB B;  4HFV A;  4ERR A;  2SPC A;  5LXT E;  3RPU A;  2V7K A;  3OYZ A;  1MNE A;  4ZI3 D;  3LK3 B;  4H9O C;  5HXE A;  4X1I E;  3RC8 A;  4JLE A;  2LM9 A;  3H3A A;  2K9A A;  3V5U A;  3LJC A;  1BR1 A;  2CXL A;  3FHN A;  3AA7 B;  4GYS A;  3ZJ1 A;  4O2B E;  4O4H E;  1FIO A;  1G73 A;  3U3I A;  3I9W A;  3ZC1 A;  3I0O A;  2E9X C;  3VU7 H;  4IHJ E;  3FB2 A;  4UVA B;  3DJB A;  2ODU A;  3EDV A;  3X02 A;  2PJQ A;  1G8X A;  3H37 A;  5LA6 E;  5E3S A;  3ZC0 A;  4MLK A;  5IYZ E;  5LBQ B;  3RYC E;  4PK4 A;  3X08 A;  4H9S E;  4I43 B;  2BVM A;  2VKH A;  2X9H A;  3A5X A;  2VL8 A;  2WAU A;  1HG2 A;  2K48 A;  5LJN A;  4ZS3 A;  3J7Y q;  2HPL A;  2UXX B;  2W62 A;  4P0A A;  3N2K E;  2ODV A;  4WBN E;  2EHO C;  1FMV A;  3N9P A;  2V7I A;  4EZ4 A;  4BAY B;  2JMK A;  3OBV E;  2KT9 A;  2JMH A;  3EDU A;  2ES0 A;  2LSY A;  3RYF E;  4YHJ A;  4NUV A;  4KBM B;  2LSK A;  5LBM A;  3MZK B;  2H3R A;  2GK9 A;  4PW8 A;  3M65 A;  3MXZ A;  2ZLY A;  2PG8 A;  1QSD A;  4MBQ A;  4PAG A;  3AA1 B;  3AAE B;  4WW0 A;  3FBZ A;  5TAO A;  3E22 E;  2W61 A;  3AA6 B;  4BJM A;  4PK6 A;  4WBO A;  4UV8 B;  2K24 A;  3ZPO A;  4ZHQ E;  2QA7 A;  3BQL A;  4QX7 B;  3S4U A;  3KDS E;  2DHR A;  4H9N C;  4EOZ B;  5JDL A;  2LOS A;  5FNV E;  4TX5 A;  2J1D G;  5JRE A;  2X9W A;  3ZN1 B;  2CE7 A;  3X03 A;  2NWB A;  3CPZ A;  4GIW A;  5FXV A;  3ZMT B;  3PUS A;  2MOZ A;  5L3E B;  2KWI B;  3IF8 B;  3X05 A;  2BZB A;  3Q9D A;  5HAX A;  1T98 A;  1WR6 A;  4O4J E;  3SOL A;  2W00 A;  5L3C B;  2JQQ A;  2N1G A;  3KV6 A;  4PJL A;  2CLY B;  2LSI A;  2CWY A;  2NTX A;  3NZP A;  2K5B B;  1MIV A;  4QHO A;  2CXF A;  4UF0 A;  4AKR B;  4C91 A;  3QUJ A;  3RKO A;  2E8I A;  5JR9 C;  1U5P A;  4TV9 E;  2Y48 B;  2KWH A;  4ADZ A;  4GK5 E;  5LCY A;  2BVL A;  2KXP B;  2VB6 A;  4JEU B;  2E9X B;  1Y64 B;  3CKD A;  5J1G A;  4AXP A;  3HR0 A;  4DVD A;  4DBQ A;  3ZCI A;  3HKB E;  4B6X A;  4MFR A;  1YKE B;  4PK5 A;  3AAI A;  2MYS A;  3OJA A;  5FY1 A;  3AVS A;  2LT3 A;  2A2F X;  3GWH A;  2WSS V;  3VKH A;  4PFP A;  5FY7 A;  3ETU A;  5KMG P;  5L3D B;  2D0U A;  2BDE A;  4GOU A;  2DWG A;  1LRZ A;  3K8P C;  3PUG A;  1H7C A;  2G0U A;  2JPF A;  4U72 A;  3B57 A;  4L0R A;  4OYJ A;  1IJ5 A;  2Y8D A;  2CMR A;  3F57 A;  4IE6 A;  3UUL A;  3PUA A;  4KUM B;  4L9I A;  3PU8 A;  5CA1 E;  5A1L A;  4L5G A;  3ZYM A;  5FY0 A;  3LK4 2;  5J2U E;  3N9M A;  2XTL A;  5HWX A;  3CML A;  4EAH A;  5JR9 A;  3F2E A;  2M67 A;  3DTO A;  3MJX A;  5LNK A;  3Q2M A;  4HKA A;  5JDQ A;  3ZYK A;  3IBP A;  2DLR A;  2X66 A;  3P8C D;  2MBG A;  2X68 A;  3ZMZ B;  3I9Y A;  1YD8 G;  1HTJ F;  4EIW A;  3X06 A;  5HWY A;  5HXC A;  5FYM A;  3PUR A;  4DBR A;  2KND A;  4IDZ A;  3AA0 B;  2Q9Q B;  2NW8 A;  3X0C A;  1Z0P A;  2XAH B;  2NW7 A;  2C5K T;  3GN5 B;  2KIN B;  2C0S A;  3HKC E;  3N9L A;  5EK4 A;  4BJN A;  3L3P A;  1D1B A;  3AAA B;  3E0Z A;  4TUY E;  3X0A A;  4HN9 A;  4AQF C;  4X1K E;  2NW9 A;  1E1H B;  3T8O A;  4Z8X A;  3KBU A;  3CQX C;  4N78 D;  5JQG E;  2ZMA A;  4I4T E;  3RRW A;  5FMN A;  2D5U A;  4TZ7 A;  3ANW B;  3HKE E;  5L3B B;  3GA8 A;  3N9Q A;  3N5L A;  2I59 A;  4HE8 A;  2D2S A;  3CX6 B;  3PUQ A;  3C98 B;  3ZLI A;  2HPJ A;  2W63 A;  2CM0 A;  5E3T A;  1IZN B;  5JDH A;  4WNK A;  3RRC A;  1LVF A;  5JDG A;  5LGN B;  1YW0 A;  4MHC A;  1V9D A;  4TV8 E;  1IAP A;  3HA4 A;  2V7L A;  3E08 A;  2DCF A;  4PJM A;  5JRC A;  3FXE B;  2LE8 A;  4H63 H;  3KVB A;  1ZKE A;  4ZS2 A;  4CI1 B;  4OYK A;  5HXR A;  4H9Q C;  2L3L A;  2CCQ A;  4F6R C;  4ANJ A;  4AQF A;  4HGA A;  2P9B A;  1ZHC A;  4YJ2 E;  2C5I T;  2X51 A;  3HKD E;  3L09 A;  3UT5 E;  3KBT A;  3KV9 A;  5F8P A;  4KMC A;  3X09 A;  4EYY R;  3UUX B;  2DI4 A;  1LKX A;  2Y6X A;  3LBX A;  2WWU A;  1D0Z A;  2C5J A;  2UXN B;  3N9O A;  1LVK A;  3ONX A;  3UUM A;  2PBI A;  2L9Q A;  5HYA A;  3X04 A;  1EZ3 A;  4OFZ A;  2CWO A;  4H63 V;  3LFM A;  4H9R C;  5FXX A;  2DNX A;  3PDY A;  4CXY A;  3JC6 D;  2IAK A;  2NP9 A;  2A72 A;  4O4L E;  3X0B A;  4O4I E;  4V1A v;  3K3N A;  5E3U A;  2YK0 A;  4YLH A;  4QKN A;  2N9D A;  2WBL A;  5FP3 A;  5HXH A;  3C51 A;  3ZJ2 A;  3N9N A;  4AQG A;  3ETV A;  1VOM A;  2OA5 A;  2ZM2 A;  2WMO A;  4DMV A;  4UXN B;  1WLX A;  2LHN A;  3C50 A;  3MK7 C;  5LP6 E;  2RP4 A;  3O9X A;  3O1J A;  1O3X A;  1S94 A;  4ZOL E;  2CA5 A;  5E0O A;  4EZH A;  4UEM A;  2JRK A;  3I0Q A;  3ZCJ A;  4CI2 B;  5ETW A;  4IE7 A;  3O4X E;  4CXX A;  3KIN B;  1HG5 A;  3NRY A;  3ZMS B;  1BO1 A;  3X01 A;  4IIJ E;  4AKG A;  2EHO B;  3KV5 A;  4DND A;  4I50 E;  4QXH B;  4P09 A;  5JDM A;  5F3J A;  3N2O A;  3FXD B;  3MKD A;  4UF0 B;  1SHZ C;  4YJ3 E;  4K0U A;  1AJ3 A;  3MA9 A;  5JDF A;  4X20 E;  2QGS A;  2VAS A;  3BK9 A;  3MAC A;  2V1D B;  1IJ6 A;  3PU3 A;  1MIY A;  1HX8 A;  4ASK A;  3QC9 A;  4EB6 E;  1VRB A;  3SS1 A;  3C4X A;  4OHF A;  3Q5W A;  3WAK A;  2LSJ A;  2X67 A;  2L8K A;  5DJQ C;  3CX7 B;  4AI6 A;  1HFA A;  2X0L B;  1ZEE A;  3KVA A;  1MMN A;  3VHL A;  3CQG B;  1OWA A;  2PFV A;  4AKI A;  2H7V C;  5H6Q B;  4EYU A;  3RYH E;  1MMD A;  4E7Z A;  4ILU A;  4A56 A;  5BMV E;  4XBF B;  2DWK A;  3GMI A;  1UX4 A;  3FBL A;  4YFS A;  2D0T A;  2CLY C;  4CI3 B;  2XUE A;  5KX5 E;  2YU1 A;  1BR2 A;  2JJ9 A;  4JUY A;  4CZZ B;  2LSG A;  5JR9 B;  3IEE A;  4AKL A;  4GYR A;  5LGT B;  3WAJ A;  5DQW A;  3PTR B;  1FMW A;  3RYI E;  3ESL A;  5EZY E;  5JH7 E;  4UIG A;  1US7 B;  4KP3 C;  4OK0 A;  2CEA A;  2X9X A;  1QUU A;  4DO0 A;  2VKJ A;  3VKG A;  1WYB A;  4DMW A;  1HS7 A;  1HCI A;  4QXC B;  5AFU L;  4O8S A;  3DP7 A;  3ZN0 B;  1MMG A;  4GK0 E;  3EUH A;  3K3Q C;  3HL6 A;  3WI3 A;  5JDN A;  2ZM8 A;  2XAS B;  5JVD E;  4PJJ A;  5LGU B;  3C4W A;  1WRD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...