1S94A

Crystal structure of the habc domain of neuronal syntaxin from the squid loligo pealei
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
121
structure length
109
Chain Sequence
GFMEEFFEQVEEIRAMIDKISDNVDAVKKKHSDILSMKEELEELMTDIKRTANKVRGKLKTIELNIEQEESADLRIRKTQYSTISRKFVEVMSDYNTTQIDYRDRCKAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords s-syntaxin
publication title Crystal structure of the Habc domain of neuronal syntaxin from the squid Loligo pealei reveals conformational plasticity at its C-terminus
pubmed doi rcsb
source organism Loligo pealei
molecule tags Endocytosis/exocytosis
total genus 38
structure length 109
sequence length 121
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-02-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.70 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 1s94A00
4JEHB 2DNXA 5M4YA 1EZ3A 1S94A 1FIOA 3C98B 1HS7A 3LG7A 1BR0A 1FEWA 4JEUB 4TX5A 5LG4A 2XHEB 1G73A
chains in the Genus database with same CATH superfamily
4GKKT 4CI1B 4PJJA 1D0YA 4HE8A 5TAOA 5AQHB 2CA5A 3PUYF 3ONLC 5BMVE 4X65T 3EDVA 3ETUA 2NTXA 4HKAA 2XQ7A 2N9DA 4HFDA 3MACA 1W9RA 3N5LA 2VQFT 3ZC1A 3O1HA 2K24A 4JLEA 3L8RA 4H9OC 2H7OA 3HKBE 2BVMA 1WFDA 1OEDC 2E8IA 3CMLA 5L3EB 3ONJA 2XM1A 4QH4A 3FBZA 4HFIA 3KINB 5LYJE 1X9BA 3I0QA 2EHOD 2V7JA 3C50A 5LG3A 2A3DA 4YY3T 3K3NA 4CXXA 1FMWA 2VKOA 5L3BB 5H6RB 3CPZA 3QUJA 3RC3A 3FXEB 2LM9A 4B3TT 2UXXB 3KV6A 3ZT7A 1HX1B 3PE0A 3N2OA 4XZCA 3X1DA 2XQ3A 4ILAA 2ACXA 4ILUA 1UGOA 3I9WA 4JYAT 1YXRA 2YKSA 3ABVA 4X62T 4U3CA 5AQNB 2YOEA 3ZSTA 3WAKA 3L3PA 2DWKA 3CVRA 1QUUA 2LSJA 5AQJB 5AQGB 3RKGA 4EZ4A 2WZIA 2K48A 5F3JA 3AE6A 3CQXC 4U7YA 4KX6A 4CXWA 3AE7A 4ADZA 4Q25A 2VKHA 3OYXA 3U3IA 2V7KA 4HTEA 1Y01A 1XNRT 3ZMVB 1D0ZA 2XPKA 2IMLA 4ILBA 4EEDA 2UUBT 4E7ZA 5JDLA 2XJ7A 3UU4A 4LF4T 5L3FB 3Q5XA 4L9IA 2BG9C 3T1YT 1VOMA 5LJNA 5FMNA 2W2UA 4KHPT 3FZKB 4JI6T 5FKYA 3RQWA 4DV6T 3AAIA 3DJBA 5BR8T 5L3DB 5M4YA 2WBLA 4HGAA 4PJMA 2VK9A 5JREA 5FXXA 3VU7H 5HXHA 3WI3A 3J9X1 4U31A 3TLSA 5JDQA 2KLQA 2WWVA 4CN4A 3PU3A 4Z90A 2HN2A 3C98B 2ES0A 2M6BA 4DUZT 2QA7A 4NUUA 2V7LA 3PU8A 1CHUA 3PDYA 2JQKA 2PTFA 5ADXL 3CIRA 1UX4A 3NZQA 4I55E 1KNZA 2XASB 3O4XE 3RF1A 4QKNA 1HNZT 3N9PA 5FY0A 5AQIB 3AE5A 3Q9DA 1H7CA 3FBLA 2D0TA 5JRCB 2Q9QA 1MMDA 3KV4A 1WRDA 5JDGA 3J7Yq 5HEJA 4KP3C 4HN9A 3EVYA 5ABFB 5L2LA 2I0MA 4FI5A 2ZM8A 4H9PC 1MMGA 3P4PA 3AA6B 4A97A 1J5WA 1HCIA 2BS2A 3AEDA 2JIWA 4ZHQE 4OHFA 4MALA 5AQFB 2Y6XA 4NUVA 1WCRA 4UEMA 3RRWA 2YU2A 3C4ZA 2BZBA 5HWYA 2HH7A 4IHJE 3AE9A 3EHZA 1U4QA 4IE4A 5LBQB 4P0BA 2E9XC 4YSXA 3F31A 2HN1A 2W63A 1CUNA 4B6XA 2W00A 3AVRA 3ZT5A 1HNXT 2LHNA 2BBJA 5CGMA 4EGWA 5C3JA 2NR4A 1KNPA 4IDZA 4UV9B 5LCYA 4UF0B 1QLBA 4YHJA 3EABA 4PJNA 3P4WA 5IWAT 1T7SA 3DP7A 2JMHA 3LJCA 5IUXA 5HCJA 2X0HA 2XSBA 4P1NA 3UU6A 2V6YB 4DIDB 4YSZA 1W0AA 2Q9QD 3JADA 1N32T 1T8BA 4X64T 5FL0A 5LGUB 5LOVE 4DR5T 1OEDA 1WLXA 3QB5K 4TZ4C 3HA4A 2V6XA 3ZMSB 2J47A 5ETWA 2F4VT 4ANJA 1YKHB 2CM0A 2V8SV 4DR3T 3B13A 3HI2A 3GMIA 1Y64B 1YQ3A 2X9HA 3HL6A 5LHHB 3N9MA 3PUSA 2N1GA 4DBQA 4EXTA 1BR1A 3HKDE 2DL1A 3RI5A 2XSAA 3H3AA 4K0KT 4KHZF 2CMRA 3CX7B 5EK2A 4TWDA 2BKOA 3UU5A 3UUBA 1T72A 2W61A 3E22E 1LKXA 4IT4A 1FIOA 4LFBT 1X79A 5AQMB 2BDEA 3JCFA 3D0TA 4ISSA 1KK7A 1UCUA 4UVCB 3RLFF 2D5UA 4XBFB 3O9XA 2LJLA 4UV8B 3EAMA 4UIGA 3TLWA 3RYCE 3RC8A 2YDSA 1MIVA 5AQLB 3MA9A 2MYSA 5JVDE 2IAKA 3T8OA 4MFRA 4DR2T 2K9AA 4DV1T 4COFA 2LT3A 2LSYA 2UXBT 3AE3A 3QC9A 3VHLA 2RPAA 3L39A 3C4WA 2VURA 4CZZB 2EHOB 4DMVA 5HEUA 2VB6A 1IBMT 2CBJA 3P8CD 2BG9A 3AA1B 3SFDA 4HFEA 4F8HA 5ABHA 3NWIA 4GYSA 5E0OA 4TWHA 2UUCT 2QRXA 5IYZE 5LXTE 2XUEA 5JR9B 4BJMA 2YEVC 3SRZA 1XDOA 4P0AA 2PBIA 4J2CA 5HYAA 4F6RC 2W67A 4O4IE 3GN5B 4WYVA 1UUSA 3RKOA 2CHOA 3AXJB 2FJAA 3LBXB 1SUMB 3N9NA 3G06A 4DV0T 4B3MT 4IIJE 2X9WA 4KI0F 3RRCA 5C8YE 2YDRA 3JC6C 3ZYLA 3RQUA 5F8PA 2RA1A 2WAUA 2W66A 1VCSA 4TX5A 2KSRA 1J5ET 5J2UE 2IC9A 4YT0A 3PUXF 1XNQT 4JI0T 1IZNB 3O1JA 2CLYC 4FJOA 1ZEEA 2L8KA 2LSKA 2WCAA 1MMAA 3ZCJA 4I4TE 4O8SA 2XQAA 4AQGA 1Z8UA 4IGUA 4HFBA 5FXZA 2CWOA 2LOPA 1S35A 5LGTB 5EK4A 1E1HB 1ZV4X 1IBKT 2DLRA 2C0SA 5AQRB 4LF8T 2YDQA 4A5XA 2IC6A 2E9XA 3AE4A 2VQET 4LMJA 3CWZB 5LP6E 2LHRA 4LF7T 1US7B 4C90A 4DMWA 1B7TA 4IL9A 5AQPB 4NIQA 2R6GF 3MKDA 5HEHA 3K1SA 4IE5A 5FY1A 5KDMC 2XAHB 3TLTA 3RIFA 1I94T 3LG7A 4YXDA 4OK0A 3IBPA 4JI3T 2ODVA 2ODUA 4H9QC 5AFUL 3RIAA 1T98A 3N9LA 3CX8B 4IDNA 2FJBA 4KMCA 3NZPA 3IHRA 1BR4A 2L9QA 3HR0A 4QXCB 2UXCT 4ZS2A 2HPJA 1NAFA 4WZXA 4X20E 1AJ3A 4LFCT 5LB7B 5AQKB 3UUNA 2J62A 3DTOA 4DBRA 2CRBA 3OYZA 3ZMZB 4G2AA 4O2AE 5L4EA 1FJGT 2XAQB 4QX8B 2P9BA 3RGLA 1EZ3A 3BQLA 5HEGA 2B76A 4EZHA 3WAJA 3AEGA 1S94A 1WR0A 3IA3A 1NENA 3AEBA 4H9NC 4AKHA 4ZEYA 1WYBA 2E5LT 5DQVA 5LG4A 1XMQT 1XWMA 4V1Av 4YTMA 1N33T 2E9XD 3AA0B 3CX6B 1WR6A 4AQYT 2Q9QB 2XY8B 4IDOA 2WSSV 3RYFE 4YHHT 5KX5E 2IIUA 4ZI3C 5LGNB 3PUWF 2J4GA 4H9SE 4UVAB 2E5VA 3LK42 4PFPA 3TKLB 5FL1A 2PJQA 2JQQA 4UXNB 2N2NA 2MBGA 4PK6A 5AQSB 2AXDS 2V26A 1HF8A 5LHGB 1FMVA 4OYJA 5LMUT 3IEEA 4U7IA 1OWAA 3KVBA 1G73A 5HXCA 3A8YC 2M6IA 2YN6A 2ZM2A 3FZMB 3NRYA 3NRXA 3OVUA 1ZOYA 3K3QC 2LLYA 2A9UA 1L0VA 3QB5A 4L5GA 4CN6A 3AE1A 4I50E 4LF6T 3Q5WA 2LSGA 2LEHA 4NPPA 2UUAT 2NW8A 4JI2T 4IL4A 2OV9A 2KWHA 2X9XA 3FB2A 1V9DA 4IREA 2UXNB 3P4QA 4CN1A 5HXSA 4E7SA 2DWGA 1XZYA 3Q2MA 1D0XA 5LNKA 1UK5A 4MBQA 2GK9A 3SS1A 3UFEA 2JMKA 4X5TA 3ZKRA 1Z0PA 1OEDB 3LK2B 4EYUA 2NOXA 5J1GA 4O2BE 3ANWA 3QNUA 2JQHA 2XZEA 4ZOLE 5GONE 1UX5A 3N2GE 4ASKA 1R8IA 5DQWA 1IAPA 3V5SA 4H63H 2WB5A 5LBMA 4U2ZA 4B3RT 3FZFB 3R84B 3ZEFB 2WM9A 4AKIA 3F2EA 2CCQA 4GK0E 2X68A 2VKDA 4H9RC 4U33A 2UU9T 1HG2A 3P4RA 4JI8T 2WU2A 4DNDA 3RYHE 4TWFA 3IF8B 2QGSA 4IDQA 1MIYA 4CXYA 4IE0A 2OA5A 3LK3B 4HWIB 2L3LA 2JQ9A 4U72A 2IUBA 4QWNB 5AQUB 4OFZA 4LF9T 1LRZA 1IBLT 2IW5B 3C64A 1YW0A 5CB4E 4YLHA 4AISA 4EYYR 2LE8A 3JC6D 1W0BA 1XMOT 2LRLA 3PUVF 1OEDE 4ZI2C 1HS7A 4DV7T 1G8XA 4EV6A 4X66T 5LJMA 4YTPA 3AECA 3LSVA 5JQGE 3ZMTB 2VL0A 2BG9B 4AKLA 3VR8A 4ILCA 4AXPA 1D1CA 5JDHA 2BKNA 2SPCA 2CHNA 2XAFB 2Y8DA 4X1KE 3RX6A 3BQIA 5L4HA 4AKGA 5AQTB 4M1PA 2V7MA 3PUGA 3AE2A 3H3MA 1QSDA 2X9YA 3ONXA 2W0GA 1KF6A 1YD8G 2X0YA 1NWMX 2FUPA 2XQYA 4JV5T 1I6ZA 3M3ZB 5F5WA 3PV0F 2H88A 2WQYA 4JUYA 2WDVA 2WS3A 2Z6EA 1MIWA 2X67A 2CWYA 3I9YA 4X1YE 3ZSSA 4TN7B 1E2AA 4EIWA 1HTJF 3FZLB 3UUMA 4GIWA 2BBHA 3PJAA 2WY2A 2W4XA 2Y48B 4JBWF 4CQIA 2XM2A 3E0ZA 2W62A 5KXJA 3ZYMA 5JR9A 5J2TE 4C91A 4L0RA 1J1JA 2XAJB 4IE6A 1MNDA 3VR9A 4TNWA 4YFSA 4K0UA 2PFVA 4PW8A 2CPTA 2BVLA 2C5IT 3V5UA 2OLTA 2LRKA 3ZJ2A 3UQ4A 4LMKA 4JI7T 3JAEA 5HCMA 2CXDA 4DV4T 1VRBA 2BG9E 2WDRA 4NXNT 3LBXA 2BS4A 3MXZA 2VVSA 2NW9A 4N78D 3ZLIA 5FVLA 3AAAB 3CKDA 2V1DB 3QOFA 1SE7A 2NW7A 5J0ZA 3OKQA 3FXDB 4PK5A 3UTKA 1OXZA 1XDPA 2RP4A 3RHWA 4A56A 3KBUA 2E2AA 4Z91A 1YKEB 3VKHA 2NP9A 4BAYB 3VRAA 4AKRB 4ZZBA 2BS3A 2ZM0A 5L3GB 3A7MA 2E9XB 1N34T 4LFAT 4PAGA 5ABEA 1FEWA 3E08A 5LHIB 2KT9A 3AEFA 4AIUA 5CA0E 4LF5T 3NKZA 4EB6E 3NBXX 5JDMA 3UULA 2A72A 2HPLA 3KDSE 2BKPA 3RPUA 2WMNA 4KBMB 4KUMB 2MOZA 3I1AA 4DR4T 4ZI7E 4GKJT 5FY7A 4HFHA 2JRKA 4ISTA 3GWHA 4MHCA 1IJ5A 2VKJA 1JNRA 2ZM6T 4BJNA 4PNIA 5DABA 4JEHB 2YU1A 1HNWT 3P4SA 2XHEB 2V5CA 3RIUC 3LDQB 4JI1T 4ZI3D 4HWDA 3FHNA 2CEAA 2NWBA 5LMNT 3VKGA 2LKHA 5ABGA 2VL8A 4DV3T 5FXWA 3AVSA 3ZN0B 1U5PA 3QK6A 2WU5A 3RH3A 3S4UA 1VCTA 5AQOB 2X51A 3H37A 1D1BA 4G63A 3U78A 4GOUA 4QH1A 4X1IE 3ZC0A 4AQFA 4EEBA 2X0LB 4O4JE 3Q5EA 2EHOC 4I0UA 4ZZCA 4JI5T 3AE8A 4DV5T 2WP9A 3EUHA 2M67A 2DCFA 3SWHA 3SFEA 3CK6A 2XQ5A 4DVDA 2X66A 3P50A 4OYKA 2VWAA 2B1EA 4HEAA 2WWUA 4DO0A 3M65A 1HX8A 4TNVA 1W09A 2A2FX 5JR9C 1N36T 3W15B 2FJEA 5LA6E 1UURA 3PJAJ 4O4LE 4CI3B 2QYWA 3ZYKA 2KINB 4XAXB 5L3CB 1ZKEA 3UT5E 5L47A 3C4XA 3K8PC 1HFAA 3LFMA 2D9DA 2DI4A 5CFBA 2KZ7B 4I43B 5A1LA 2ACZA 4WNKA 3AAEB 4EOZB 1NEKA 3ZT6A 3PURA 5CA1E 5CJ5A 3BQKA 4YTNA 1ZHCA 2WMOA 3ZCIA 3PUAA 4PJLA 3UUXB 3HKEE 4HFCA 3ZPOA 5HAXA 5JRCA 2I6HA 4PK4A 4HWFA 4AI6A 3PUZF 1ZP0A 4BA9A 2FJDA 5KMGP 2K5BB 4UELA 3SOLA 3AB3B 5ABFA 3OTOT 2WDQA 2KWIB 4EAHA 1D1AA 2YK0A 2XQ6A 3UQ7A 3MK7C 3OPCA 3NVOA 2IDOB 5JDFA 5FNVE 1KEYA 4IDPA 3CQCB 5AQQB 2MTQA 4A98A 1JNZA 3GA8A 1E7PA 2C5KT 2XQ8A 4DUYT 2D2SA 3UU3A 1HG5A 4HFVA 4LMLA 2KNDA 3L09A 2VASA 4WW0A 3N2KE 3ANWB 5FP3A 3ZMUB 2H7VC 3OBVE 2CLYB 2H89A 3PUQA 4OX9T 1GQEA 2LOSA 4ZI2D 2K3WA 3TLUA 5C2TA 3KV5A 1BR0A 3F57A 4IE7A 2V7IA 3N9QA 2H3RA 1WYCA 4UF0A 4JEUB 3RYIE 2UXDT 3P7IA 4GK5E 3B5MA 3C51A 5JTGA 3EI0A 1LVKA 3I0OA 2LM2A 4P09A 4ZXLA 4DR7T 4YJ3E 2JJ9A 2V6YA 4DR6T 3VRBA 2G0UA 3Q5DA 4YSYA 2XAGB 4Z8XA 4AQFC 2VVNA 5DJQC 2DHRA 4ZS3A 2JPFA 2CBIA 3PTRB 2KMFA 1KFYA 2LSIA 1IJ6A 5FVKA 5EK3A 5H6QB 4HWHA 3KV9A 2XQ4A 5JH7E 1SHZC 4DR1T 3O1IA 1KNRA 5EZYE 4CI2B 3KFWX 2FBWA 5HEOA 4QHOA 4TV8E 3K3OA 4U74A 2CXLA 5JDNA 2DNXA 3RIUA 1O3XA 2QVAA 4QXBB 3CQGB 1HR0T 4TUYE 5FYMA 2YINA 4WBOA 4PFOA 2NTYA 3MZKB 4WBNE 2MAWA 4UR9A 5AQVB 5HXRA 4U2YA 4TV9E 2Q9QC 4UVBB 1MMNA 3ESLA 3ETVA 4YJ2E 2MPKA 4DV2T 3A5XA 5HWXA 1M7KA 2AE9A 4H63V 2CE7A 1DU2A 2C5JA 4MLKA 3HKCE 2XQ9A 2XTLA 3KVAA 3JAFA 5HXEA 4QH5A 3UFGA 2ZMAA 2ZLYA 4QX7B 3N9OA 2EHOA 2J1DG 2PG8A 1M62A 3AA7B 2HHHT 4ERRA 4HWCA 4NXMT 1BR2A 2D0UA 3BK9A 3ZN1B 2IHR1 4GYRA 4QXHB 4O4HE 5FXVA 3AEAA 1LVFA 1YQ4A 3OJAA 3B57A 5IHYA 3FZHB 3UU8A 3R6NA 3T1HT 3EDUA 2WZHA 4B3ST 2I59A 2LKGA 3ZJ1A 1MNEA 4JI4T 2V5DA 2CXFA 3MJXA 3TLVA 3KBTA 1SA0E 3GN5A 3AEEA 3AXJA 2KXPB
chains in the Genus database with same CATH topology
2VL8A 4CI1B 2ZM2A 4PJJA 1D0YA 2W61A 3AVSA 3E22E 5FXWA 1LKXA 3NRXA 3NRYA 4HE8A 5TAOA 3ZN0B 1FIOA 1U5PA 1X79A 2CA5A 3K3QC 3QK6A 5BMVE 2BDEA 4L5GA 3RH3A 3S4UA 2X51A 3H37A 1D1BA 4G63A 3U78A 4I50E 3EDVA 3D0TA 3ETUA 2NTXA 3Q5WA 4GOUA 4HKAA 4ISSA 2LSGA 2N9DA 1KK7A 1UCUA 4UVCB 4X1IE 2LEHA 3ZC0A 4AQFA 2NW8A 3MACA 2D5UA 3N5LA 4XBFB 2X0LB 2KWHA 3O9XA 4O4JE 2LJLA 4UV8B 2X9XA 3FB2A 3ZC1A 1V9DA 4UIGA 3RYCE 3RC8A 2EHOC 1MIVA 3O1HA 2K24A 3MA9A 2MYSA 2UXNB 5JVDE 2IAKA 4JLEA 3T8OA 4H9OC 3EUHA 2M67A 2H7OA 4MFRA 2DCFA 2K9AA 3HKBE 2BVMA 3SWHA 5HXSA 4E7SA 2DWGA 2LT3A 2LSYA 3QC9A 2E8IA 3CMLA 3VHLA 5L3EB 4DVDA 2X66A 4OYKA 3Q2MA 2VWAA 1D0XA 3C4WA 5LNKA 2B1EA 4HEAA 2WWUA 4DO0A 2EHOB 4MBQA 3FBZA 2GK9A 4CZZB 4DMVA 3M65A 2VB6A 1HX8A 3SS1A 3UFEA 2A2FX 5JR9C 2JMKA 3KINB 5LYJE 3I0QA 3W15B 2EHOD 2V7JA 3P8CD 1Z0PA 3AA1B 3C50A 3LK2B 2A3DA 5LA6E 4EYUA 2NOXA 3K3NA 5J1GA 4O4LE 4CI3B 4O2BE 4CXXA 1FMWA 2VKOA 3ZYKA 3ANWA 5L3BB 2KINB 4XAXB 5H6RB 5L3CB 1ZKEA 4GYSA 3UT5E 5E0OA 5IYZE 3CPZA 3QUJA 3C4XA 5LXTE 3K8PC 4ZOLE 1HFAA 3LFMA 2XUEA 5GONE 3RC3A 1UX5A 3N2GE 4BJMA 5JR9B 3FXEB 2YEVC 3SRZA 4ASKA 2LM9A 2DI4A 2UXXB 5DQWA 2KZ7B 4P0AA 3KV6A 2PBIA 4I43B 1IAPA 5A1LA 4WNKA 3AAEB 3PE0A 4J2CA 4EOZB 3V5SA 4F6RC 5HYAA 3N2OA 4XZCA 4H63H 3PURA 5CA1E 5LBMA 2ACXA 4O4IE 4ILUA 3GN5B 3RKOA 3BQKA 3I9WA 1ZHCA 2WMOA 3R84B 3ZCIA 3PUAA 3ZEFB 2WM9A 4PJLA 3UUXB 4AKIA 3HKEE 3F2EA 2CCQA 4GK0E 3LBXB 3WAKA 3ZPOA 2X68A 5HAXA 2VKDA 3L3PA 2DWKA 3CVRA 3N9NA 4PK4A 5JRCA 4H9RC 1QUUA 4AI6A 2LSJA 1HG2A 4IIJE 4BA9A 2X9WA 3RRCA 5C8YE 4DNDA 3RYHE 5KMGP 4EZ4A 2K5BB 2K48A 4UELA 3SOLA 3AB3B 5F3JA 3IF8B 3CQXC 4CXWA 3JC6C 2QGSA 3ZYLA 2KWIB 4EAHA 1D1AA 4ADZA 2YK0A 1MIYA 5F8PA 4CXYA 2VKHA 3OYXA 2OA5A 4IE0A 2RA1A 3U3IA 2V7KA 2WAUA 3LK3B 3MK7C 4HTEA 2L3LA 3ZMVB 1D0ZA 4U72A 4TX5A 5JDFA 4QWNB 5FNVE 4OFZA 5J2UE 1LRZA 4E7ZA 5JDLA 2IC9A 2IW5B 3C64A 3CQCB 5L3FB 3Q5XA 1YW0A 5CB4E 4L9IA 2MTQA 4YLHA 1VOMA 5LJNA 5FMNA 4EYYR 2LE8A 3GA8A 3JC6D 3AAIA 2C5KT 3DJBA 2D2SA 5L3DB 5M4YA 1IZNB 3O1JA 4ZI2C 2CLYC 4FJOA 1HS7A 2WBLA 4HGAA 4PJMA 1ZEEA 1HG5A 1G8XA 2VK9A 5JREA 2L8KA 4HFVA 5LJMA 5FXXA 5JQGE 3VU7H 2KNDA 2LSKA 5HXHA 3WI3A 3ZMTB 3L09A 1MMAA 3J9X1 3ZCJA 4AKLA 4I4TE 1D1CA 4AXPA 5JDHA 2VASA 5JDQA 2KLQA 4WW0A 4O8SA 2SPCA 2XAFB 2Y8DA 3PU3A 3N2KE 4AQGA 4X1KE 3ANWB 3RX6A 3C98B 2ES0A 5FP3A 3ZMUB 3BQIA 4IGUA 2H7VC 5FXZA 2QA7A 3OBVE 2CWOA 4AKGA 2CLYB 2LOPA 1S35A 5LGTB 3PUQA 4M1PA 5EK4A 2V7MA 3PUGA 4NUUA 2V7LA 1E1HB 1ZV4X 2LOSA 4ZI2D 1QSDA 2X9YA 2DLRA 2C0SA 3PU8A 3ONXA 3KV5A 2W0GA 1BR0A 3PDYA 1YD8G 2IC6A 2E9XA 1NWMX 2XQYA 3F57A 5ADXL 4IE7A 2V7IA 1UX4A 3N9QA 3NZQA 4I55E 1KNZA 3CWZB 5LP6E 2XASB 4JUYA 2H3RA 1WYCA 4UF0A 3O4XE 2LHRA 2Z6EA 4JEUB 3RYIE 1US7B 3P7IA 1MIWA 4QKNA 2X67A 4C90A 2CWYA 4GK5E 3N9PA 4DMWA 3I9YA 1B7TA 5FY0A 3C51A 4X1YE 1LVKA 3Q9DA 3I0OA 4TN7B 1H7CA 4P09A 3MKDA 3FBLA 2D0TA 4EIWA 5JRCB 1HTJF 2Q9QA 4IE5A 5FY1A 4YJ3E 2XAHB 5KDMC 2JJ9A 1MMDA 3LG7A 3KV4A 1WRDA 5JDGA 3J7Yq 2G0UA 3UUMA 4GIWA 4KP3C 4OK0A 4HN9A 3IBPA 3EVYA 2XAGB 2Y48B 4CQIA 4Z8XA 4AQFC 3E0ZA 5L2LA 2W62A 2ODVA 5DJQC 4FI5A 2ZM8A 4H9PC 2DHRA 4ZS3A 3ZYMA 1MMGA 2ODUA 2JPFA 3PTRB 4H9QC 5JR9A 3AA6B 5AFUL 5J2TE 4C91A 4L0RA 1T98A 2KMFA 1HCIA 2XAJB 3N9LA 3CX8B 4IE6A 1MNDA 1IJ6A 2LSIA 5EK3A 5H6QB 4KMCA 3NZPA 4YFSA 4ZHQE 3KV9A 4K0UA 2PFVA 3IHRA 4PW8A 2BVLA 4OHFA 2C5IT 3V5UA 4MALA 1BR4A 2L9QA 3HR0A 4QXCB 5JH7E 4ZS2A 2HPJA 3ZJ2A 1NAFA 1SHZC 2Y6XA 4NUVA 4UEMA 4X20E 3O1IA 1AJ3A 3RRWA 2CXDA 1VRBA 2YU2A 3C4ZA 5EZYE 3UUNA 4CI2B 2BZBA 3KFWX 3DTOA 5HWYA 4DBRA 3LBXA 4QHOA 4TV8E 2HH7A 3K3OA 4IHJE 3OYZA 4U74A 2CXLA 5JDNA 3ZMZB 2DNXA 4G2AA 3MXZA 1O3XA 4O2AE 2NW9A 4N78D 3ZLIA 4QXBB 3AAAB 3CKDA 2XAQB 2V1DB 4QX8B 1U4QA 2P9BA 3CQGB 4IE4A 1EZ3A 5LBQB 3BQLA 4P0BA 2E9XC 3F31A 2NW7A 3OKQA 2W63A 3FXDB 1CUNA 4B6XA 4PK5A 3UTKA 1OXZA 2W00A 4TUYE 4EZHA 2RP4A 5FYMA 3AVRA 2YINA 4A56A 4WBOA 3KBUA 3WAJA 1S94A 4PFOA 1YKEB 3VKHA 2NP9A 4BAYB 2LHNA 4H9NC 2NTYA 4AKRB 4AKHA 3MZKB 4WBNE 1WYBA 5DQVA 2ZM0A 5LG4A 5HXRA 5L3GB 2E9XB 4IDZA 4TV9E 2Q9QC 4PAGA 4UVBB 4UV9B 5LCYA 1FEWA 1MMNA 3E08A 3ESLA 5LHIB 4V1Av 3ETVA 4YJ2E 2E9XD 2KT9A 3A5XA 4UF0B 3AA0B 4YHJA 5HWXA 5CA0E 3CX6B 4PJNA 1WR6A 4H63V 2CE7A 4EB6E 3NBXX 5JDMA 3DP7A 2JMHA 2C5JA 4MLKA 3HKCE 3LJCA 3UULA 2XTLA 3KVAA 5HXEA 2A72A 2HPLA 2Q9QB 3KDSE 2ZMAA 3RPUA 2ZLYA 2WMNA 4KBMB 4KUMB 2MOZA 4QX7B 2WSSV 2Q9QD 3I1AA 3N9OA 3RYFE 4ZI7E 2EHOA 2J1DG 2PG8A 3AA7B 5KX5E 5FY7A 4ERRA 4ZI3C 1BR2A 5LGNB 2JRKA 4ISTA 3GWHA 5LOVE 5LGUB 2D0UA 3BK9A 3ZN1B 4MHCA 1IJ5A 2VKJA 4H9SE 4UVAB 1WLXA 4GYRA 4QXHB 4BJNA 3LK42 4PNIA 3HA4A 4O4HE 4PFPA 4TZ4C 5FXVA 3TKLB 3ZMSB 5ETWA 1LVFA 5DABA 1YKHB 2CM0A 4ANJA 4JEHB 2YU1A 2PJQA 2JQQA 3OJAA 4UXNB 3B13A 3B57A 5IHYA 2N2NA 3HI2A 3R6NA 3GMIA 1Y64B 2XHEB 3EDUA 2MBGA 4PK6A 2X9HA 3HL6A 5LHHB 2I59A 3N9MA 2V26A 3PUSA 1HF8A 2N1GA 5LHGB 1FMVA 3ZJ1A 4OYJA 4ZI3D 4DBQA 4EXTA 1BR1A 3HKDE 3FHNA 1MNEA 2CEAA 2NWBA 3VKGA 2CXFA 3IEEA 3MJXA 1OWAA 3H3AA 1G73A 3KVBA 3KBTA 5HXCA 1SA0E 2CMRA 3CX7B 3GN5A 5EK2A 2KXPB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JEH B;  2DNX A;  5M4Y A;  1EZ3 A;  1S94 A;  1FIO A;  3C98 B;  1HS7 A;  3LG7 A;  1BR0 A;  1FEW A;  4JEU B;  4TX5 A;  5LG4 A;  2XHE B;  1G73 A; 
#chains in the Genus database with same CATH topology
 4GKK T;  4CI1 B;  4PJJ A;  1D0Y A;  4HE8 A;  5TAO A;  5AQH B;  2CA5 A;  3PUY F;  3ONL C;  5BMV E;  4X65 T;  3EDV A;  3ETU A;  2NTX A;  4HKA A;  2XQ7 A;  2N9D A;  4HFD A;  3MAC A;  1W9R A;  3N5L A;  2VQF T;  3ZC1 A;  3O1H A;  2K24 A;  4JLE A;  3L8R A;  4H9O C;  2H7O A;  3HKB E;  2BVM A;  1WFD A;  1OED C;  2E8I A;  3CML A;  5L3E B;  3ONJ A;  2XM1 A;  4QH4 A;  3FBZ A;  4HFI A;  3KIN B;  5LYJ E;  1X9B A;  3I0Q A;  2EHO D;  2V7J A;  3C50 A;  5LG3 A;  2A3D A;  4YY3 T;  3K3N A;  4CXX A;  1FMW A;  2VKO A;  5L3B B;  5H6R B;  3CPZ A;  3QUJ A;  3RC3 A;  3FXE B;  2LM9 A;  4B3T T;  2UXX B;  3KV6 A;  3ZT7 A;  1HX1 B;  3PE0 A;  3N2O A;  4XZC A;  3X1D A;  2XQ3 A;  4ILA A;  2ACX A;  4ILU A;  1UGO A;  3I9W A;  4JYA T;  1YXR A;  2YKS A;  3ABV A;  4X62 T;  4U3C A;  5AQN B;  2YOE A;  3ZST A;  3WAK A;  3L3P A;  2DWK A;  3CVR A;  1QUU A;  2LSJ A;  5AQJ B;  5AQG B;  3RKG A;  4EZ4 A;  2WZI A;  2K48 A;  5F3J A;  3AE6 A;  3CQX C;  4U7Y A;  4KX6 A;  4CXW A;  3AE7 A;  4ADZ A;  4Q25 A;  2VKH A;  3OYX A;  3U3I A;  2V7K A;  4HTE A;  1Y01 A;  1XNR T;  3ZMV B;  1D0Z A;  2XPK A;  2IML A;  4ILB A;  4EED A;  2UUB T;  4E7Z A;  5JDL A;  2XJ7 A;  3UU4 A;  4LF4 T;  5L3F B;  3Q5X A;  4L9I A;  2BG9 C;  3T1Y T;  1VOM A;  5LJN A;  5FMN A;  2W2U A;  4KHP T;  3FZK B;  4JI6 T;  5FKY A;  3RQW A;  4DV6 T;  3AAI A;  3DJB A;  5BR8 T;  5L3D B;  5M4Y A;  2WBL A;  4HGA A;  4PJM A;  2VK9 A;  5JRE A;  5FXX A;  3VU7 H;  5HXH A;  3WI3 A;  3J9X 1;  4U31 A;  3TLS A;  5JDQ A;  2KLQ A;  2WWV A;  4CN4 A;  3PU3 A;  4Z90 A;  2HN2 A;  3C98 B;  2ES0 A;  2M6B A;  4DUZ T;  2QA7 A;  4NUU A;  2V7L A;  3PU8 A;  1CHU A;  3PDY A;  2JQK A;  2PTF A;  5ADX L;  3CIR A;  1UX4 A;  3NZQ A;  4I55 E;  1KNZ A;  2XAS B;  3O4X E;  3RF1 A;  4QKN A;  1HNZ T;  3N9P A;  5FY0 A;  5AQI B;  3AE5 A;  3Q9D A;  1H7C A;  3FBL A;  2D0T A;  5JRC B;  2Q9Q A;  1MMD A;  3KV4 A;  1WRD A;  5JDG A;  3J7Y q;  5HEJ A;  4KP3 C;  4HN9 A;  3EVY A;  5ABF B;  5L2L A;  2I0M A;  4FI5 A;  2ZM8 A;  4H9P C;  1MMG A;  3P4P A;  3AA6 B;  4A97 A;  1J5W A;  1HCI A;  2BS2 A;  3AED A;  2JIW A;  4ZHQ E;  4OHF A;  4MAL A;  5AQF B;  2Y6X A;  4NUV A;  1WCR A;  4UEM A;  3RRW A;  2YU2 A;  3C4Z A;  2BZB A;  5HWY A;  2HH7 A;  4IHJ E;  3AE9 A;  3EHZ A;  1U4Q A;  4IE4 A;  5LBQ B;  4P0B A;  2E9X C;  4YSX A;  3F31 A;  2HN1 A;  2W63 A;  1CUN A;  4B6X A;  2W00 A;  3AVR A;  3ZT5 A;  1HNX T;  2LHN A;  2BBJ A;  5CGM A;  4EGW A;  5C3J A;  2NR4 A;  1KNP A;  4IDZ A;  4UV9 B;  5LCY A;  4UF0 B;  1QLB A;  4YHJ A;  3EAB A;  4PJN A;  3P4W A;  5IWA T;  1T7S A;  3DP7 A;  2JMH A;  3LJC A;  5IUX A;  5HCJ A;  2X0H A;  2XSB A;  4P1N A;  3UU6 A;  2V6Y B;  4DID B;  4YSZ A;  1W0A A;  2Q9Q D;  3JAD A;  1N32 T;  1T8B A;  4X64 T;  5FL0 A;  5LGU B;  5LOV E;  4DR5 T;  1OED A;  1WLX A;  3QB5 K;  4TZ4 C;  3HA4 A;  2V6X A;  3ZMS B;  2J47 A;  5ETW A;  2F4V T;  4ANJ A;  1YKH B;  2CM0 A;  2V8S V;  4DR3 T;  3B13 A;  3HI2 A;  3GMI A;  1Y64 B;  1YQ3 A;  2X9H A;  3HL6 A;  5LHH B;  3N9M A;  3PUS A;  2N1G A;  4DBQ A;  4EXT A;  1BR1 A;  3HKD E;  2DL1 A;  3RI5 A;  2XSA A;  3H3A A;  4K0K T;  4KHZ F;  2CMR A;  3CX7 B;  5EK2 A;  4TWD A;  2BKO A;  3UU5 A;  3UUB A;  1T72 A;  2W61 A;  3E22 E;  1LKX A;  4IT4 A;  1FIO A;  4LFB T;  1X79 A;  5AQM B;  2BDE A;  3JCF A;  3D0T A;  4ISS A;  1KK7 A;  1UCU A;  4UVC B;  3RLF F;  2D5U A;  4XBF B;  3O9X A;  2LJL A;  4UV8 B;  3EAM A;  4UIG A;  3TLW A;  3RYC E;  3RC8 A;  2YDS A;  1MIV A;  5AQL B;  3MA9 A;  2MYS A;  5JVD E;  2IAK A;  3T8O A;  4MFR A;  4DR2 T;  2K9A A;  4DV1 T;  4COF A;  2LT3 A;  2LSY A;  2UXB T;  3AE3 A;  3QC9 A;  3VHL A;  2RPA A;  3L39 A;  3C4W A;  2VUR A;  4CZZ B;  2EHO B;  4DMV A;  5HEU A;  2VB6 A;  1IBM T;  2CBJ A;  3P8C D;  2BG9 A;  3AA1 B;  3SFD A;  4HFE A;  4F8H A;  5ABH A;  3NWI A;  4GYS A;  5E0O A;  4TWH A;  2UUC T;  2QRX A;  5IYZ E;  5LXT E;  2XUE A;  5JR9 B;  4BJM A;  2YEV C;  3SRZ A;  1XDO A;  4P0A A;  2PBI A;  4J2C A;  5HYA A;  4F6R C;  2W67 A;  4O4I E;  3GN5 B;  4WYV A;  1UUS A;  3RKO A;  2CHO A;  3AXJ B;  2FJA A;  3LBX B;  1SUM B;  3N9N A;  3G06 A;  4DV0 T;  4B3M T;  4IIJ E;  2X9W A;  4KI0 F;  3RRC A;  5C8Y E;  2YDR A;  3JC6 C;  3ZYL A;  3RQU A;  5F8P A;  2RA1 A;  2WAU A;  2W66 A;  1VCS A;  4TX5 A;  2KSR A;  1J5E T;  5J2U E;  2IC9 A;  4YT0 A;  3PUX F;  1XNQ T;  4JI0 T;  1IZN B;  3O1J A;  2CLY C;  4FJO A;  1ZEE A;  2L8K A;  2LSK A;  2WCA A;  1MMA A;  3ZCJ A;  4I4T E;  4O8S A;  2XQA A;  4AQG A;  1Z8U A;  4IGU A;  4HFB A;  5FXZ A;  2CWO A;  2LOP A;  1S35 A;  5LGT B;  5EK4 A;  1E1H B;  1ZV4 X;  1IBK T;  2DLR A;  2C0S A;  5AQR B;  4LF8 T;  2YDQ A;  4A5X A;  2IC6 A;  2E9X A;  3AE4 A;  2VQE T;  4LMJ A;  3CWZ B;  5LP6 E;  2LHR A;  4LF7 T;  1US7 B;  4C90 A;  4DMW A;  1B7T A;  4IL9 A;  5AQP B;  4NIQ A;  2R6G F;  3MKD A;  5HEH A;  3K1S A;  4IE5 A;  5FY1 A;  5KDM C;  2XAH B;  3TLT A;  3RIF A;  1I94 T;  3LG7 A;  4YXD A;  4OK0 A;  3IBP A;  4JI3 T;  2ODV A;  2ODU A;  4H9Q C;  5AFU L;  3RIA A;  1T98 A;  3N9L A;  3CX8 B;  4IDN A;  2FJB A;  4KMC A;  3NZP A;  3IHR A;  1BR4 A;  2L9Q A;  3HR0 A;  4QXC B;  2UXC T;  4ZS2 A;  2HPJ A;  1NAF A;  4WZX A;  4X20 E;  1AJ3 A;  4LFC T;  5LB7 B;  5AQK B;  3UUN A;  2J62 A;  3DTO A;  4DBR A;  2CRB A;  3OYZ A;  3ZMZ B;  4G2A A;  4O2A E;  5L4E A;  1FJG T;  2XAQ B;  4QX8 B;  2P9B A;  3RGL A;  1EZ3 A;  3BQL A;  5HEG A;  2B76 A;  4EZH A;  3WAJ A;  3AEG A;  1S94 A;  1WR0 A;  3IA3 A;  1NEN A;  3AEB A;  4H9N C;  4AKH A;  4ZEY A;  1WYB A;  2E5L T;  5DQV A;  5LG4 A;  1XMQ T;  1XWM A;  4V1A v;  4YTM A;  1N33 T;  2E9X D;  3AA0 B;  3CX6 B;  1WR6 A;  4AQY T;  2Q9Q B;  2XY8 B;  4IDO A;  2WSS V;  3RYF E;  4YHH T;  5KX5 E;  2IIU A;  4ZI3 C;  5LGN B;  3PUW F;  2J4G A;  4H9S E;  4UVA B;  2E5V A;  3LK4 2;  4PFP A;  3TKL B;  5FL1 A;  2PJQ A;  2JQQ A;  4UXN B;  2N2N A;  2MBG A;  4PK6 A;  5AQS B;  2AXD S;  2V26 A;  1HF8 A;  5LHG B;  1FMV A;  4OYJ A;  5LMU T;  3IEE A;  4U7I A;  1OWA A;  3KVB A;  1G73 A;  5HXC A;  3A8Y C;  2M6I A;  2YN6 A;  2ZM2 A;  3FZM B;  3NRY A;  3NRX A;  3OVU A;  1ZOY A;  3K3Q C;  2LLY A;  2A9U A;  1L0V A;  3QB5 A;  4L5G A;  4CN6 A;  3AE1 A;  4I50 E;  4LF6 T;  3Q5W A;  2LSG A;  2LEH A;  4NPP A;  2UUA T;  2NW8 A;  4JI2 T;  4IL4 A;  2OV9 A;  2KWH A;  2X9X A;  3FB2 A;  1V9D A;  4IRE A;  2UXN B;  3P4Q A;  4CN1 A;  5HXS A;  4E7S A;  2DWG A;  1XZY A;  3Q2M A;  1D0X A;  5LNK A;  1UK5 A;  4MBQ A;  2GK9 A;  3SS1 A;  3UFE A;  2JMK A;  4X5T A;  3ZKR A;  1Z0P A;  1OED B;  3LK2 B;  4EYU A;  2NOX A;  5J1G A;  4O2B E;  3ANW A;  3QNU A;  2JQH A;  2XZE A;  4ZOL E;  5GON E;  1UX5 A;  3N2G E;  4ASK A;  1R8I A;  5DQW A;  1IAP A;  3V5S A;  4H63 H;  2WB5 A;  5LBM A;  4U2Z A;  4B3R T;  3FZF B;  3R84 B;  3ZEF B;  2WM9 A;  4AKI A;  3F2E A;  2CCQ A;  4GK0 E;  2X68 A;  2VKD A;  4H9R C;  4U33 A;  2UU9 T;  1HG2 A;  3P4R A;  4JI8 T;  2WU2 A;  4DND A;  3RYH E;  4TWF A;  3IF8 B;  2QGS A;  4IDQ A;  1MIY A;  4CXY A;  4IE0 A;  2OA5 A;  3LK3 B;  4HWI B;  2L3L A;  2JQ9 A;  4U72 A;  2IUB A;  4QWN B;  5AQU B;  4OFZ A;  4LF9 T;  1LRZ A;  1IBL T;  2IW5 B;  3C64 A;  1YW0 A;  5CB4 E;  4YLH A;  4AIS A;  4EYY R;  2LE8 A;  3JC6 D;  1W0B A;  1XMO T;  2LRL A;  3PUV F;  1OED E;  4ZI2 C;  1HS7 A;  4DV7 T;  1G8X A;  4EV6 A;  4X66 T;  5LJM A;  4YTP A;  3AEC A;  3LSV A;  5JQG E;  3ZMT B;  2VL0 A;  2BG9 B;  4AKL A;  3VR8 A;  4ILC A;  4AXP A;  1D1C A;  5JDH A;  2BKN A;  2SPC A;  2CHN A;  2XAF B;  2Y8D A;  4X1K E;  3RX6 A;  3BQI A;  5L4H A;  4AKG A;  5AQT B;  4M1P A;  2V7M A;  3PUG A;  3AE2 A;  3H3M A;  1QSD A;  2X9Y A;  3ONX A;  2W0G A;  1KF6 A;  1YD8 G;  2X0Y A;  1NWM X;  2FUP A;  2XQY A;  4JV5 T;  1I6Z A;  3M3Z B;  5F5W A;  3PV0 F;  2H88 A;  2WQY A;  4JUY A;  2WDV A;  2WS3 A;  2Z6E A;  1MIW A;  2X67 A;  2CWY A;  3I9Y A;  4X1Y E;  3ZSS A;  4TN7 B;  1E2A A;  4EIW A;  1HTJ F;  3FZL B;  3UUM A;  4GIW A;  2BBH A;  3PJA A;  2WY2 A;  2W4X A;  2Y48 B;  4JBW F;  4CQI A;  2XM2 A;  3E0Z A;  2W62 A;  5KXJ A;  3ZYM A;  5JR9 A;  5J2T E;  4C91 A;  4L0R A;  1J1J A;  2XAJ B;  4IE6 A;  1MND A;  3VR9 A;  4TNW A;  4YFS A;  4K0U A;  2PFV A;  4PW8 A;  2CPT A;  2BVL A;  2C5I T;  3V5U A;  2OLT A;  2LRK A;  3ZJ2 A;  3UQ4 A;  4LMK A;  4JI7 T;  3JAE A;  5HCM A;  2CXD A;  4DV4 T;  1VRB A;  2BG9 E;  2WDR A;  4NXN T;  3LBX A;  2BS4 A;  3MXZ A;  2VVS A;  2NW9 A;  4N78 D;  3ZLI A;  5FVL A;  3AAA B;  3CKD A;  2V1D B;  3QOF A;  1SE7 A;  2NW7 A;  5J0Z A;  3OKQ A;  3FXD B;  4PK5 A;  3UTK A;  1OXZ A;  1XDP A;  2RP4 A;  3RHW A;  4A56 A;  3KBU A;  2E2A A;  4Z91 A;  1YKE B;  3VKH A;  2NP9 A;  4BAY B;  3VRA A;  4AKR B;  4ZZB A;  2BS3 A;  2ZM0 A;  5L3G B;  3A7M A;  2E9X B;  1N34 T;  4LFA T;  4PAG A;  5ABE A;  1FEW A;  3E08 A;  5LHI B;  2KT9 A;  3AEF A;  4AIU A;  5CA0 E;  4LF5 T;  3NKZ A;  4EB6 E;  3NBX X;  5JDM A;  3UUL A;  2A72 A;  2HPL A;  3KDS E;  2BKP A;  3RPU A;  2WMN A;  4KBM B;  4KUM B;  2MOZ A;  3I1A A;  4DR4 T;  4ZI7 E;  4GKJ T;  5FY7 A;  4HFH A;  2JRK A;  4IST A;  3GWH A;  4MHC A;  1IJ5 A;  2VKJ A;  1JNR A;  2ZM6 T;  4BJN A;  4PNI A;  5DAB A;  4JEH B;  2YU1 A;  1HNW T;  3P4S A;  2XHE B;  2V5C A;  3RIU C;  3LDQ B;  4JI1 T;  4ZI3 D;  4HWD A;  3FHN A;  2CEA A;  2NWB A;  5LMN T;  3VKG A;  2LKH A;  5ABG A;  2VL8 A;  4DV3 T;  5FXW A;  3AVS A;  3ZN0 B;  1U5P A;  3QK6 A;  2WU5 A;  3RH3 A;  3S4U A;  1VCT A;  5AQO B;  2X51 A;  3H37 A;  1D1B A;  4G63 A;  3U78 A;  4GOU A;  4QH1 A;  4X1I E;  3ZC0 A;  4AQF A;  4EEB A;  2X0L B;  4O4J E;  3Q5E A;  2EHO C;  4I0U A;  4ZZC A;  4JI5 T;  3AE8 A;  4DV5 T;  2WP9 A;  3EUH A;  2M67 A;  2DCF A;  3SWH A;  3SFE A;  3CK6 A;  2XQ5 A;  4DVD A;  2X66 A;  3P50 A;  4OYK A;  2VWA A;  2B1E A;  4HEA A;  2WWU A;  4DO0 A;  3M65 A;  1HX8 A;  4TNV A;  1W09 A;  2A2F X;  5JR9 C;  1N36 T;  3W15 B;  2FJE A;  5LA6 E;  1UUR A;  3PJA J;  4O4L E;  4CI3 B;  2QYW A;  3ZYK A;  2KIN B;  4XAX B;  5L3C B;  1ZKE A;  3UT5 E;  5L47 A;  3C4X A;  3K8P C;  1HFA A;  3LFM A;  2D9D A;  2DI4 A;  5CFB A;  2KZ7 B;  4I43 B;  5A1L A;  2ACZ A;  4WNK A;  3AAE B;  4EOZ B;  1NEK A;  3ZT6 A;  3PUR A;  5CA1 E;  5CJ5 A;  3BQK A;  4YTN A;  1ZHC A;  2WMO A;  3ZCI A;  3PUA A;  4PJL A;  3UUX B;  3HKE E;  4HFC A;  3ZPO A;  5HAX A;  5JRC A;  2I6H A;  4PK4 A;  4HWF A;  4AI6 A;  3PUZ F;  1ZP0 A;  4BA9 A;  2FJD A;  5KMG P;  2K5B B;  4UEL A;  3SOL A;  3AB3 B;  5ABF A;  3OTO T;  2WDQ A;  2KWI B;  4EAH A;  1D1A A;  2YK0 A;  2XQ6 A;  3UQ7 A;  3MK7 C;  3OPC A;  3NVO A;  2IDO B;  5JDF A;  5FNV E;  1KEY A;  4IDP A;  3CQC B;  5AQQ B;  2MTQ A;  4A98 A;  1JNZ A;  3GA8 A;  1E7P A;  2C5K T;  2XQ8 A;  4DUY T;  2D2S A;  3UU3 A;  1HG5 A;  4HFV A;  4LML A;  2KND A;  3L09 A;  2VAS A;  4WW0 A;  3N2K E;  3ANW B;  5FP3 A;  3ZMU B;  2H7V C;  3OBV E;  2CLY B;  2H89 A;  3PUQ A;  4OX9 T;  1GQE A;  2LOS A;  4ZI2 D;  2K3W A;  3TLU A;  5C2T A;  3KV5 A;  1BR0 A;  3F57 A;  4IE7 A;  2V7I A;  3N9Q A;  2H3R A;  1WYC A;  4UF0 A;  4JEU B;  3RYI E;  2UXD T;  3P7I A;  4GK5 E;  3B5M A;  3C51 A;  5JTG A;  3EI0 A;  1LVK A;  3I0O A;  2LM2 A;  4P09 A;  4ZXL A;  4DR7 T;  4YJ3 E;  2JJ9 A;  2V6Y A;  4DR6 T;  3VRB A;  2G0U A;  3Q5D A;  4YSY A;  2XAG B;  4Z8X A;  4AQF C;  2VVN A;  5DJQ C;  2DHR A;  4ZS3 A;  2JPF A;  2CBI A;  3PTR B;  2KMF A;  1KFY A;  2LSI A;  1IJ6 A;  5FVK A;  5EK3 A;  5H6Q B;  4HWH A;  3KV9 A;  2XQ4 A;  5JH7 E;  1SHZ C;  4DR1 T;  3O1I A;  1KNR A;  5EZY E;  4CI2 B;  3KFW X;  2FBW A;  5HEO A;  4QHO A;  4TV8 E;  3K3O A;  4U74 A;  2CXL A;  5JDN A;  2DNX A;  3RIU A;  1O3X A;  2QVA A;  4QXB B;  3CQG B;  1HR0 T;  4TUY E;  5FYM A;  2YIN A;  4WBO A;  4PFO A;  2NTY A;  3MZK B;  4WBN E;  2MAW A;  4UR9 A;  5AQV B;  5HXR A;  4U2Y A;  4TV9 E;  2Q9Q C;  4UVB B;  1MMN A;  3ESL A;  3ETV A;  4YJ2 E;  2MPK A;  4DV2 T;  3A5X A;  5HWX A;  1M7K A;  2AE9 A;  4H63 V;  2CE7 A;  1DU2 A;  2C5J A;  4MLK A;  3HKC E;  2XQ9 A;  2XTL A;  3KVA A;  3JAF A;  5HXE A;  4QH5 A;  3UFG A;  2ZMA A;  2ZLY A;  4QX7 B;  3N9O A;  2EHO A;  2J1D G;  2PG8 A;  1M62 A;  3AA7 B;  2HHH T;  4ERR A;  4HWC A;  4NXM T;  1BR2 A;  2D0U A;  3BK9 A;  3ZN1 B;  2IHR 1;  4GYR A;  4QXH B;  4O4H E;  5FXV A;  3AEA A;  1LVF A;  1YQ4 A;  3OJA A;  3B57 A;  5IHY A;  3FZH B;  3UU8 A;  3R6N A;  3T1H T;  3EDU A;  2WZH A;  4B3S T;  2I59 A;  2LKG A;  3ZJ1 A;  1MNE A;  4JI4 T;  2V5D A;  2CXF A;  3MJX A;  3TLV A;  3KBT A;  1SA0 E;  3GN5 A;  3AEE A;  3AXJ A;  2KXP B; 
#chains in the Genus database with same CATH homology
 2VL8 A;  4CI1 B;  2ZM2 A;  4PJJ A;  1D0Y A;  2W61 A;  3AVS A;  3E22 E;  5FXW A;  1LKX A;  3NRX A;  3NRY A;  4HE8 A;  5TAO A;  3ZN0 B;  1FIO A;  1U5P A;  1X79 A;  2CA5 A;  3K3Q C;  3QK6 A;  5BMV E;  2BDE A;  4L5G A;  3RH3 A;  3S4U A;  2X51 A;  3H37 A;  1D1B A;  4G63 A;  3U78 A;  4I50 E;  3EDV A;  3D0T A;  3ETU A;  2NTX A;  3Q5W A;  4GOU A;  4HKA A;  4ISS A;  2LSG A;  2N9D A;  1KK7 A;  1UCU A;  4UVC B;  4X1I E;  2LEH A;  3ZC0 A;  4AQF A;  2NW8 A;  3MAC A;  2D5U A;  3N5L A;  4XBF B;  2X0L B;  2KWH A;  3O9X A;  4O4J E;  2LJL A;  4UV8 B;  2X9X A;  3FB2 A;  3ZC1 A;  1V9D A;  4UIG A;  3RYC E;  3RC8 A;  2EHO C;  1MIV A;  3O1H A;  2K24 A;  3MA9 A;  2MYS A;  2UXN B;  5JVD E;  2IAK A;  4JLE A;  3T8O A;  4H9O C;  3EUH A;  2M67 A;  2H7O A;  4MFR A;  2DCF A;  2K9A A;  3HKB E;  2BVM A;  3SWH A;  5HXS A;  4E7S A;  2DWG A;  2LT3 A;  2LSY A;  3QC9 A;  2E8I A;  3CML A;  3VHL A;  5L3E B;  4DVD A;  2X66 A;  4OYK A;  3Q2M A;  2VWA A;  1D0X A;  3C4W A;  5LNK A;  2B1E A;  4HEA A;  2WWU A;  4DO0 A;  2EHO B;  4MBQ A;  3FBZ A;  2GK9 A;  4CZZ B;  4DMV A;  3M65 A;  2VB6 A;  1HX8 A;  3SS1 A;  3UFE A;  2A2F X;  5JR9 C;  2JMK A;  3KIN B;  5LYJ E;  3I0Q A;  3W15 B;  2EHO D;  2V7J A;  3P8C D;  1Z0P A;  3AA1 B;  3C50 A;  3LK2 B;  2A3D A;  5LA6 E;  4EYU A;  2NOX A;  3K3N A;  5J1G A;  4O4L E;  4CI3 B;  4O2B E;  4CXX A;  1FMW A;  2VKO A;  3ZYK A;  3ANW A;  5L3B B;  2KIN B;  4XAX B;  5H6R B;  5L3C B;  1ZKE A;  4GYS A;  3UT5 E;  5E0O A;  5IYZ E;  3CPZ A;  3QUJ A;  3C4X A;  5LXT E;  3K8P C;  4ZOL E;  1HFA A;  3LFM A;  2XUE A;  5GON E;  3RC3 A;  1UX5 A;  3N2G E;  4BJM A;  5JR9 B;  3FXE B;  2YEV C;  3SRZ A;  4ASK A;  2LM9 A;  2DI4 A;  2UXX B;  5DQW A;  2KZ7 B;  4P0A A;  3KV6 A;  2PBI A;  4I43 B;  1IAP A;  5A1L A;  4WNK A;  3AAE B;  3PE0 A;  4J2C A;  4EOZ B;  3V5S A;  4F6R C;  5HYA A;  3N2O A;  4XZC A;  4H63 H;  3PUR A;  5CA1 E;  5LBM A;  2ACX A;  4O4I E;  4ILU A;  3GN5 B;  3RKO A;  3BQK A;  3I9W A;  1ZHC A;  2WMO A;  3R84 B;  3ZCI A;  3PUA A;  3ZEF B;  2WM9 A;  4PJL A;  3UUX B;  4AKI A;  3HKE E;  3F2E A;  2CCQ A;  4GK0 E;  3LBX B;  3WAK A;  3ZPO A;  2X68 A;  5HAX A;  2VKD A;  3L3P A;  2DWK A;  3CVR A;  3N9N A;  4PK4 A;  5JRC A;  4H9R C;  1QUU A;  4AI6 A;  2LSJ A;  1HG2 A;  4IIJ E;  4BA9 A;  2X9W A;  3RRC A;  5C8Y E;  4DND A;  3RYH E;  5KMG P;  4EZ4 A;  2K5B B;  2K48 A;  4UEL A;  3SOL A;  3AB3 B;  5F3J A;  3IF8 B;  3CQX C;  4CXW A;  3JC6 C;  2QGS A;  3ZYL A;  2KWI B;  4EAH A;  1D1A A;  4ADZ A;  2YK0 A;  1MIY A;  5F8P A;  4CXY A;  2VKH A;  3OYX A;  2OA5 A;  4IE0 A;  2RA1 A;  3U3I A;  2V7K A;  2WAU A;  3LK3 B;  3MK7 C;  4HTE A;  2L3L A;  3ZMV B;  1D0Z A;  4U72 A;  4TX5 A;  5JDF A;  4QWN B;  5FNV E;  4OFZ A;  5J2U E;  1LRZ A;  4E7Z A;  5JDL A;  2IC9 A;  2IW5 B;  3C64 A;  3CQC B;  5L3F B;  3Q5X A;  1YW0 A;  5CB4 E;  4L9I A;  2MTQ A;  4YLH A;  1VOM A;  5LJN A;  5FMN A;  4EYY R;  2LE8 A;  3GA8 A;  3JC6 D;  3AAI A;  2C5K T;  3DJB A;  2D2S A;  5L3D B;  5M4Y A;  1IZN B;  3O1J A;  4ZI2 C;  2CLY C;  4FJO A;  1HS7 A;  2WBL A;  4HGA A;  4PJM A;  1ZEE A;  1HG5 A;  1G8X A;  2VK9 A;  5JRE A;  2L8K A;  4HFV A;  5LJM A;  5FXX A;  5JQG E;  3VU7 H;  2KND A;  2LSK A;  5HXH A;  3WI3 A;  3ZMT B;  3L09 A;  1MMA A;  3J9X 1;  3ZCJ A;  4AKL A;  4I4T E;  1D1C A;  4AXP A;  5JDH A;  2VAS A;  5JDQ A;  2KLQ A;  4WW0 A;  4O8S A;  2SPC A;  2XAF B;  2Y8D A;  3PU3 A;  3N2K E;  4AQG A;  4X1K E;  3ANW B;  3RX6 A;  3C98 B;  2ES0 A;  5FP3 A;  3ZMU B;  3BQI A;  4IGU A;  2H7V C;  5FXZ A;  2QA7 A;  3OBV E;  2CWO A;  4AKG A;  2CLY B;  2LOP A;  1S35 A;  5LGT B;  3PUQ A;  4M1P A;  5EK4 A;  2V7M A;  3PUG A;  4NUU A;  2V7L A;  1E1H B;  1ZV4 X;  2LOS A;  4ZI2 D;  1QSD A;  2X9Y A;  2DLR A;  2C0S A;  3PU8 A;  3ONX A;  3KV5 A;  2W0G A;  1BR0 A;  3PDY A;  1YD8 G;  2IC6 A;  2E9X A;  1NWM X;  2XQY A;  3F57 A;  5ADX L;  4IE7 A;  2V7I A;  1UX4 A;  3N9Q A;  3NZQ A;  4I55 E;  1KNZ A;  3CWZ B;  5LP6 E;  2XAS B;  4JUY A;  2H3R A;  1WYC A;  4UF0 A;  3O4X E;  2LHR A;  2Z6E A;  4JEU B;  3RYI E;  1US7 B;  3P7I A;  1MIW A;  4QKN A;  2X67 A;  4C90 A;  2CWY A;  4GK5 E;  3N9P A;  4DMW A;  3I9Y A;  1B7T A;  5FY0 A;  3C51 A;  4X1Y E;  1LVK A;  3Q9D A;  3I0O A;  4TN7 B;  1H7C A;  4P09 A;  3MKD A;  3FBL A;  2D0T A;  4EIW A;  5JRC B;  1HTJ F;  2Q9Q A;  4IE5 A;  5FY1 A;  4YJ3 E;  2XAH B;  5KDM C;  2JJ9 A;  1MMD A;  3LG7 A;  3KV4 A;  1WRD A;  5JDG A;  3J7Y q;  2G0U A;  3UUM A;  4GIW A;  4KP3 C;  4OK0 A;  4HN9 A;  3IBP A;  3EVY A;  2XAG B;  2Y48 B;  4CQI A;  4Z8X A;  4AQF C;  3E0Z A;  5L2L A;  2W62 A;  2ODV A;  5DJQ C;  4FI5 A;  2ZM8 A;  4H9P C;  2DHR A;  4ZS3 A;  3ZYM A;  1MMG A;  2ODU A;  2JPF A;  3PTR B;  4H9Q C;  5JR9 A;  3AA6 B;  5AFU L;  5J2T E;  4C91 A;  4L0R A;  1T98 A;  2KMF A;  1HCI A;  2XAJ B;  3N9L A;  3CX8 B;  4IE6 A;  1MND A;  1IJ6 A;  2LSI A;  5EK3 A;  5H6Q B;  4KMC A;  3NZP A;  4YFS A;  4ZHQ E;  3KV9 A;  4K0U A;  2PFV A;  3IHR A;  4PW8 A;  2BVL A;  4OHF A;  2C5I T;  3V5U A;  4MAL A;  1BR4 A;  2L9Q A;  3HR0 A;  4QXC B;  5JH7 E;  4ZS2 A;  2HPJ A;  3ZJ2 A;  1NAF A;  1SHZ C;  2Y6X A;  4NUV A;  4UEM A;  4X20 E;  3O1I A;  1AJ3 A;  3RRW A;  2CXD A;  1VRB A;  2YU2 A;  3C4Z A;  5EZY E;  3UUN A;  4CI2 B;  2BZB A;  3KFW X;  3DTO A;  5HWY A;  4DBR A;  3LBX A;  4QHO A;  4TV8 E;  2HH7 A;  3K3O A;  4IHJ E;  3OYZ A;  4U74 A;  2CXL A;  5JDN A;  3ZMZ B;  2DNX A;  4G2A A;  3MXZ A;  1O3X A;  4O2A E;  2NW9 A;  4N78 D;  3ZLI A;  4QXB B;  3AAA B;  3CKD A;  2XAQ B;  2V1D B;  4QX8 B;  1U4Q A;  2P9B A;  3CQG B;  4IE4 A;  1EZ3 A;  5LBQ B;  3BQL A;  4P0B A;  2E9X C;  3F31 A;  2NW7 A;  3OKQ A;  2W63 A;  3FXD B;  1CUN A;  4B6X A;  4PK5 A;  3UTK A;  1OXZ A;  2W00 A;  4TUY E;  4EZH A;  2RP4 A;  5FYM A;  3AVR A;  2YIN A;  4A56 A;  4WBO A;  3KBU A;  3WAJ A;  1S94 A;  4PFO A;  1YKE B;  3VKH A;  2NP9 A;  4BAY B;  2LHN A;  4H9N C;  2NTY A;  4AKR B;  4AKH A;  3MZK B;  4WBN E;  1WYB A;  5DQV A;  2ZM0 A;  5LG4 A;  5HXR A;  5L3G B;  2E9X B;  4IDZ A;  4TV9 E;  2Q9Q C;  4PAG A;  4UVB B;  4UV9 B;  5LCY A;  1FEW A;  1MMN A;  3E08 A;  3ESL A;  5LHI B;  4V1A v;  3ETV A;  4YJ2 E;  2E9X D;  2KT9 A;  3A5X A;  4UF0 B;  3AA0 B;  4YHJ A;  5HWX A;  5CA0 E;  3CX6 B;  4PJN A;  1WR6 A;  4H63 V;  2CE7 A;  4EB6 E;  3NBX X;  5JDM A;  3DP7 A;  2JMH A;  2C5J A;  4MLK A;  3HKC E;  3LJC A;  3UUL A;  2XTL A;  3KVA A;  5HXE A;  2A72 A;  2HPL A;  2Q9Q B;  3KDS E;  2ZMA A;  3RPU A;  2ZLY A;  2WMN A;  4KBM B;  4KUM B;  2MOZ A;  4QX7 B;  2WSS V;  2Q9Q D;  3I1A A;  3N9O A;  3RYF E;  4ZI7 E;  2EHO A;  2J1D G;  2PG8 A;  3AA7 B;  5KX5 E;  5FY7 A;  4ERR A;  4ZI3 C;  1BR2 A;  5LGN B;  2JRK A;  4IST A;  3GWH A;  5LOV E;  5LGU B;  2D0U A;  3BK9 A;  3ZN1 B;  4MHC A;  1IJ5 A;  2VKJ A;  4H9S E;  4UVA B;  1WLX A;  4GYR A;  4QXH B;  4BJN A;  3LK4 2;  4PNI A;  3HA4 A;  4O4H E;  4PFP A;  4TZ4 C;  5FXV A;  3TKL B;  3ZMS B;  5ETW A;  1LVF A;  5DAB A;  1YKH B;  2CM0 A;  4ANJ A;  4JEH B;  2YU1 A;  2PJQ A;  2JQQ A;  3OJA A;  4UXN B;  3B13 A;  3B57 A;  5IHY A;  2N2N A;  3HI2 A;  3R6N A;  3GMI A;  1Y64 B;  2XHE B;  3EDU A;  2MBG A;  4PK6 A;  2X9H A;  3HL6 A;  5LHH B;  2I59 A;  3N9M A;  2V26 A;  3PUS A;  1HF8 A;  2N1G A;  5LHG B;  1FMV A;  3ZJ1 A;  4OYJ A;  4ZI3 D;  4DBQ A;  4EXT A;  1BR1 A;  3HKD E;  3FHN A;  1MNE A;  2CEA A;  2NWB A;  3VKG A;  2CXF A;  3IEE A;  3MJX A;  1OWA A;  3H3A A;  1G73 A;  3KVB A;  3KBT A;  5HXC A;  1SA0 E;  2CMR A;  3CX7 B;  3GN5 A;  5EK2 A;  2KXP B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...