1S94A

Crystal structure of the habc domain of neuronal syntaxin from the squid loligo pealei
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
121
structure length
109
Chain Sequence
b'GFMEEFFEQVEEIRAMIDKISDNVDAVKKKHSDILSMKEELEELMTDIKRTANKVRGKLKTIELNIEQEESADLRIRKTQYSTISRKFVEVMSDYNTTQIDYRDRCKAR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords s-syntaxin
publication title Crystal structure of the Habc domain of neuronal syntaxin from the squid Loligo pealei reveals conformational plasticity at its C-terminus
pubmed doi rcsb
source organism Loligo pealei
molecule tags Endocytosis/exocytosis
total genus 38
structure length 109
sequence length 121
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-02-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.70 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 1s94A00
1BR0A 2DNXA 5M4YA 1G73A 1S94A 1EZ3A 1HS7A 1FIOA 3LG7A 2XHEB 3C98B 4JEUB 5LG4A 1FEWA 4JEHB 4TX5A
chains in the Genus database with same CATH superfamily
3ZMSB 3JCFA 4TV8E 1OEDA 3K3QC 4B3MT 1FMWA 4DIDB 3Q5XA 2KNDA 4TWHA 1M62A 1ZKEA 1GQEA 4GK0E 4IHJE 3D0TA 2X9XA 4AISA 3SFDA 4JI4T 3OJAA 3SWHA 4Z91A 2UUCT 2PG8A 4DMVA 2XM2A 2WB5A 3MZKB 2Y48B 2OA5A 3KDSE 2V26A 5A1LA 5HCJA 4LFCT 2W63A 5LXTE 4YT0A 3B13A 3TLVA 3PV0F 1HNXT 1Y64B 2EHOD 2LKHA 1Z0PA 4XZCA 2WDRA 2E5LT 2SPCA 5LP6E 4HKAA 3PUZF 5L47A 2M6IA 1ZEEA 2E8IA 3FZMB 4AKLA 1HTJF 2VQFT 3FXDB 2KSRA 1FMVA 1Y01A 3A7MA 3VU7H 4JBWF 4TNVA 2QRXA 5LG3A 2CXFA 5LJNA 4GKKT 2X0HA 2MAWA 2LSKA 4WW0A 3K1SA 3Q9DA 2LLYA 4PK6A 1E1HB 3OBVE 2BG9A 4ZOLE 2D9DA 4CZZB 3IEEA 5LNKA 1D0ZA 4KX6A 1U4QA 3P8CD 3UFEA 4UIGA 2A3DA 3KV9A 3U3IA 2XAJB 3AEFA 1IAPA 3N9MA 5CA1E 1XZYA 3MACA 4DVDA 2XPKA 4KHZF 2V7KA 4MHCA 4IIJE 2KT9A 3P4PA 3ZCIA 4KHPT 4EZHA 2E9XC 4U7IA 5C2TA 2H3RA 4OFZA 2YOEA 3CIRA 4NUVA 4YSXA 5ADXL 2ODVA 3UU3A 2LSGA 4P09A 3Q5WA 3Q5EA 4A56A 2XQ7A 4QWNB 4LF6T 4E7ZA 5J2TE 3GN5B 2V8SV 4GKJT 1E2AA 4DV0T 3HA4A 2WWVA 2IC9A 5FXVA 3UTKA 3ABVA 4NIQA 2CXLA 5CB4E 1SUMB 3T1HT 5JRCB 2J62A 4AKRB 4P0BA 4KBMB 2BDEA 2XTLA 2VKJA 4PFOA 5H6RB 3L39A 2JMHA 3U78A 1BR1A 3HKBE 4DR2T 4ZZCA 2J4GA 4HFBA 2X0LB 3I0QA 5FMNA 3LK3B 1IBMT 4PFPA 5ABHA 4ILCA 2H89A 4EB6E 4GOUA 5FXWA 2WS3A 5JVDE 2ZM6T 4O4JE 3AE5A 4G63A 4O8SA 4EV6A 2X51A 1HCIA 1E7PA 1SHZC 2CM0A 3PUWF 2V7IA 2VASA 1QUUA 3NRYA 1FJGT 3NZQA 5LG4A 4PW8A 2XZEA 4AKIA 4GYRA 3ZC1A 4EGWA 2CHOA 2XSAA 4YY3T 4X65T 2YN6A 2BKOA 4JI2T 3TLTA 4IL9A 2JQ9A 3QC9A 5HXEA 1S35A 2W67A 3TKLB 5F8PA 4LF5T 2JMKA 2V5CA 2NW8A 3OKQA 1T98A 3NVOA 3FBLA 2LE8A 2C5IT 3RLFF 2PTFA 3C50A 2ACZA 3VR9A 3QOFA 5KMGP 4U31A 5AQNB 4AIUA 1UX4A 1Z8UA 3JAEA 2VVSA 5ABFB 2E9XB 2V6YA 4YXDA 1UURA 3JC6D 2XAFB 2WBLA 4ZXLA 2L8KA 4EIWA 3RIUA 4AKHA 3ZPOA 4K0KT 1UUSA 3AE6A 4H9SE 2J1DG 4DUZT 2KZ7B 3C98B 2VKOA 3EDUA 4HWCA 5DQVA 3EI0A 4TX5A 4YJ2E 3AE8A 3LBXA 4JI8T 1VCTA 1VCSA 4EXTA 4DV6T 3UUMA 4YHJA 2ZM0A 4EAHA 2QYWA 1HX8A 3PUYF 4DV2T 2C5KT 4ZI2C 2G0UA 2XAGB 4GYSA 2E9XA 4O4IE 3RIAA 2HPJA 3OPCA 3UULA 4LFBT 4JI5T 3AAAB 2BS3A 3RIFA 4JI7T 4MFRA 3FZKB 2VK9A 4M1PA 3UU5A 2XASB 3IF8B 2V7JA 2V1DB 1SE7A 3PTRB 5HAXA 1ZOYA 2RP4A 4I43B 1FEWA 4X1KE 3P4RA 3ZKRA 2X0YA 5J2UE 3ZT6A 5AQIB 1IJ6A 3NZPA 4JYAT 3IA3A 4ILBA 4EZ4A 1T7SA 4DR7T 5HWXA 3AEGA 1MMAA 4MALA 5FVLA 5EK4A 2W4XA 3AXJB 5LCYA 5LYJE 2NW9A 4A97A 4JI6T 3E0ZA 2N2NA 2AXDS 4B6XA 3GWHA 3BQLA 4QKNA 4C91A 2WSSV 2I0MA 3A5XA 4HWFA 3L09A 5AQJB 3NKZA 4IE4A 5FL1A 1YW0A 3AECA 2CHNA 2XQ8A 4TV9E 4IE7A 3KVBA 4IGUA 2Q9QB 4U33A 5L3FB 1LVFA 5FVKA 1IJ5A 2OV9A 3UQ7A 2EHOC 1W9RA 3I1AA 3AVSA 5AQVB 3AEAA 5LB7B 4A98A 4DBQA 2PBIA 5EK3A 5FYMA 1KFYA 4BA9A 4H63H 2HPLA 2W00A 4EEDA 1YKEB 2KMFA 3GA8A 5TAOA 2DNXA 3UU6A 3AXJA 1JNRA 5JQGE 5HXRA 4TUYE 2YKSA 4V1Av 1FIOA 3CPZA 4K0UA 2XAQB 2KLQA 2VKHA 4TWDA 4PJLA 2YDSA 2HN2A 1J1JA 3HI2A 4F6RC 3AEDA 3ZN0B 3A8YC 2YU1A 3TLSA 3ZSTA 3N9OA 2N9DA 5L3GB 2LOSA 3FBZA 4LF4T 4LFAT 3QUJA 3ZCJA 2UXCT 2IW5B 2Z6EA 3PE0A 3J7Yq 3I0OA 4C90A 3UU8A 3UUNA 3ZMTB 3ANWA 5L4HA 3AE1A 4O2AE 3AE9A 4AI6A 5J0ZA 4IE0A 1OXZA 5AQOB 5KXJA 5HCMA 3T1YT 1OWAA 1UK5A 3PU8A 3E08A 3C4XA 4F8HA 2WY2A 2UXBT 5LMNT 3M65A 3O9XA 4QXBB 1KEYA 1DU2A 2A72A 5AQRB 4DR6T 2BBHA 4TZ4C 4AQYT 2VURA 1VOMA 2K5BB 5IWAT 4QH1A 2H7OA 1V9DA 2W62A 3ONLC 3H3AA 3CX8B 2P9BA 3UUBA 4CI2B 5DJQC 3OYZA 1LKXA 3O1HA 3M3ZB 4X5TA 2VL8A 2M67A 4NPPA 2W0GA 5HEUA 2BVMA 3RC3A 3EAMA 4H9NC 2XQ9A 1MIVA 3LDQB 4UVAB 3N2OA 3PDYA 5LHGB 5J1GA 3LFMA 5L3BB 4PK4A 3RH3A 3W15B 2W2UA 2OLTA 3FZHB 3PUXF 2ZLYA 2EHOB 2D2SA 2WU2A 3TLWA 2VWAA 3WAKA 3VKGA 5LA6E 3LSVA 1M7KA 3RYFE 3KINB 1KNRA 1BR0A 3MKDA 3RPUA 4WBOA 3CQXC 1MIYA 3CQGB 3FHNA 3CKDA 4UELA 2WQYA 2KXPB 3MXZA 3KBUA 2VL0A 5JH7E 3PUVF 5AQFB 4YHHT 2W61A 1D1BA 2CCQA 2NR4A 5KX5E 3KV6A 5LMUT 4E7SA 4X66T 5HXHA 4UVBB 4IDNA 2A9UA 4DBRA 5JDNA 2BS4A 2DWKA 3TLUA 1R8IA 2XQAA 4DV5T 2F4VT 5C3JA 4WZXA 4Z90A 3LJCA 3JAFA 3JC6C 3PUGA 3I9WA 5DQWA 3ZMUB 2L3LA 4WBNE 3VRBA 4XAXB 3GN5A 3BQKA 2JQHA 3C51A 4X1IE 1HNWT 4KP3C 2VQET 3FB2A 3G06A 2X9YA 3R6NA 2ES0A 3HKCE 4ILUA 3N9QA 5JRCA 2CLYC 3K3NA 4ILAA 5EK2A 2JRKA 1YQ4A 4IDZA 2IAKA 3I9YA 4ZEYA 4IREA 4KUMB 4MLKA 4TN7B 3SFEA 2LHRA 1I94T 4HFCA 5LOVE 4UVCB 1UX5A 1WYCA 3UUXB 4IDOA 3C64A 3NBXX 3DP7A 4DR4T 4X62T 1BR2A 3P4QA 5L2LA 2YDQA 2DL1A 3EHZA 1QLBA 4H9OC 4DV4T 2CWOA 5LGUB 1UGOA 3ZMZB 4EYYR 1J5ET 2Q9QC 5M4YA 4WYVA 4LF7T 1EZ3A 4YTNA 2LSJA 4UV8B 1LRZA 2XQ6A 3RX6A 1D1CA 3O4XE 1OEDC 4ZS2A 4HN9A 3WAJA 3F31A 3RRWA 2HN1A 2BKNA 3AAIA 2HHHT 4HWHA 2V5DA 3DTOA 4UR9A 2XHEB 4I50E 5BMVE 4ZI3D 3RC8A 4X64T 3ETVA 5CJ5A 5JTGA 4O2BE 3ZJ2A 5AQUB 3ZEFB 2X66A 3ONXA 3HR0A 4OYKA 4U74A 1D0XA 1MNEA 3ZYMA 3GMIA 3PU3A 2HH7A 1NENA 5F3JA 2E2AA 4LMJA 4X1YE 2I59A 1UCUA 5FNVE 2NWBA 4DV3T 4X20E 4BJMA 2FUPA 1XNRT 1WYBA 1ZHCA 3AEEA 5JR9C 1W09A 5ABFA 3PJAA 2CWYA 5E0OA 2JQQA 2WU5A 4O4LE 3CX6B 3KV4A 3ZYLA 2BS2A 3F2EA 5JDFA 2JJ9A 3B57A 2CXDA 4GIWA 4NUUA 4MBQA 4FI5A 3IBPA 2J47A 4GK5E 4PAGA 2BG9C 4H9QC 5AQKB 5JDQA 3ZC0A 4U2YA 3VHLA 3DJBA 2WM9A 2XQ5A 4I55E 3KV5A 4B3RT 5BR8T 3EABA 2NW7A 5LBQB 2VKDA 3QNUA 2WMNA 3ZT5A 1XNQT 5L3EB 2H7VC 2CRBA 4QHOA 3AA0B 4HWDA 4DNDA 5ETWA 2CLYB 4ISSA 2N1GA 4FJOA 1XDPA 4QXHB 1BR4A 5C8YE 1KNZA 3ETUA 2UXXB 2B76A 2FBWA 3N9PA 4N78D 1MIWA 4EOZB 2ZMAA 3SS1A 4NXMT 3VR8A 2JPFA 2LSIA 2XM1A 2WDQA 1IBKT 2BBJA 3FZFB 2DHRA 4DV1T 1LVKA 3N9NA 4AKGA 4PJNA 5FXZA 1YQ3A 4COFA 1WR6A 3UU4A 1IZNB 5CFBA 1WLXA 4DV7T 1OEDB 5FXXA 4IL4A 4HWIB 1IBLT 4HTEA 5FY7A 2D5UA 2CPTA 4CN1A 4I4TE 2ODUA 2WAUA 2NOXA 4HGAA 2BZBA 2LT3A 4L9IA 1XDOA 1HFAA 3VRAA 1T8BA 3UT5E 5KDMC 4JI0T 3KVAA 2ZM8A 2VB6A 2XSBA 3ESLA 3N2GE 1KNPA 2D0UA 2X68A 2Q9QA 2Y8DA 4YSZA 1ZP0A 4HEAA 4UF0B 4YFSA 4A5XA 5JR9B 3OTOT 4NXNT 5HEOA 4I0UA 2MYSA 4JUYA 5AQHB 5HWYA 4BAYB 5AQGB 3P7IA 5FL0A 1XWMA 3O1IA 4CXYA 3RQUA 2DWGA 5F5WA 5GONE 4IE5A 4ISTA 3AA7B 1X9BA 2BG9B 2I6HA 2BVLA 5AQLB 3LK42 2W66A 4QX7B 5JREA 3N5LA 3OYXA 2NTXA 4IDPA 2CBJA 3CVRA 4TNWA 4JLEA 3BK9A 4EEBA 3J9X1 3UQ4A 4HFDA 5HEGA 3HKEE 4DO0A 3AA1B 4UF0A 5JR9A 3AE2A 1J5WA 3Q2MA 3RIUC 4WNKA 3MK7C 3MA9A 2MPKA 4BJNA 3HL6A 4DR5T 3AEBA 2RPAA 4H63V 3VKHA 3P4SA 4LMKA 4JV5T 2K9AA 2LSYA 2LJLA 4CI3B 3ZLIA 1G8XA 4CXWA 4LF9T 5LJMA 3O1JA 2V7MA 2XQ4A 4IDQA 2IMLA 2QA7A 1W0AA 3RI5A 4ADZA 2C5JA 1CUNA 3C4ZA 4QH4A 2MBGA 2X67A 3EDVA 4U3CA 3ZT7A 3ZYKA 2UXNB 2B1EA 2H88A 2WP9A 1HG2A 3BQIA 3RHWA 1O3XA 3RYCE 2CA5A 3EVYA 4YTPA 2KWHA 1SA0E 2IHR1 4PNIA 2FJEA 1OEDE 2UUAT 3ZMVB 2CEAA 4CQIA 1MMGA 5IUXA 2V7LA 3WI3A 3PUQA 2CMRA 4KMCA 4QH5A 1YD8G 2MTQA 4DMWA 2JQKA 5JDMA 3QK6A 3KBTA 4HE8A 3N9LA 4LMLA 2EHOA 3Q5DA 3B5MA 5IYZE 2UXDT 4Z8XA 4H9RC 2NP9A 1XMQT 4PJJA 3ZN1B 4OX9T 1WRDA 2AE9A 2KWIB 4DUYT 5AQTB 3PUAA 4OHFA 5AQSB 4IE6A 3PURA 4AXPA 3OVUA 1I6ZA 4ZI3C 5H6QB 1D1AA 3RF1A 3CK6A 4G2AA 2LRKA 4J2CA 2QVAA 2A2FX 1H7CA 4AQFC 1B7TA 2LEHA 2WZIA 4PJMA 2WWUA 1QSDA 1D0YA 5JDGA 5HYAA 4JI3T 3IHRA 2CBIA 2E9XD 2LM2A 4U7YA 4TWFA 4DR3T 2IIUA 3RRCA 2BG9E 2V6YB 4ASKA 3LG7A 4YSYA 4CN4A 1MNDA 2UU9T 4OK0A 4B3ST 2VVNA 2D0TA 3X1DA 3AAEB 3P50A 4ANJA 1ZV4X 2R6GF 5DABA 1HX1B 1VRBA 1HR0T 2IC6A 2LHNA 1HG5A 4PK5A 5LGTB 3R84B 3LBXB 5CA0E 5HXSA 4EYUA 1X79A 4Q25A 5AQQB 5HEHA 5L3CB 3AA6B 2V6XA 5LBMA 5ABGA 3LK2B 3CMLA 2K3WA 3AB3B 2FJDA 3UFGA 1WCRA 4CI1B 2IUBA 2WDVA 2DLRA 4UV9B 5FY0A 3E22E 2XQ3A 5JDLA 2L9QA 3CX7B 2FJAA 4ZZBA 1N32T 3ZJ1A 2ZM2A 1JNZA 3PJAJ 2DCFA 2K24A 2XUEA 1YXRA 3SRZA 3RYHE 4HFVA 2XJ7A 2YK0A 3ONJA 2GK9A 2JIWA 3CWZB 2KINB 3QB5A 3RGLA 1AJ3A 3H37A 4JEUB 3EUHA 2QGSA 4ZI7E 5IHYA 1U5PA 4IT4A 2K48A 3AE4A 1HNZT 2X9WA 3RKGA 3L3PA 2YDRA 4DR1T 3T8OA 4UXNB 4U72A 3RYIE 3SOLA 2YEVC 2X9HA 4P1NA 5L3DB 3P4WA 3MJXA 2WMOA 3K3OA 5HXCA 4ZS3A 3AVRA 5FKYA 1NEKA 4YLHA 4CXXA 2DI4A 4L0RA 2BKPA 2Q9QD 2ACXA 5FP3A 1HF8A 4OYJA 4JEHB 1T72A 3FZLB 1YKHB 1W0BA 3RKOA 4AQGA 4B3TT 3H3MA 4ZHQE 1KK7A 3V5SA 5FY1A 5LHIB 5L4EA 2LRLA 4YJ3E 1L0VA 5ABEA 4KI0F 1MMNA 3QB5K 4LF8T 3V5UA 3KFWX 3N2KE 2WCAA 4HFIA 3RQWA 3AE3A 4QX8B 3S4UA 2IDOB 2XQYA 5LHHB 1N34T 4HFHA 4L5GA 1NWMX 2RA1A 3C4WA 2FJBA 3AE7A 2XAHB 1N36T 2LKGA 2NTYA 2YINA 3PUSA 4CN6A 2XY8B 4HFEA 2C0SA 1WFDA 4AQFA 5JDHA 5AQMB 2Y6XA 4YTMA 4ZI2D 1CHUA 4UEMA 4U2ZA 1G73A 2YU2A 2LM9A 2UUBT 4O4HE 3F57A 4P0AA 1N33T 2PFVA 1S94A 2MOZA 1NAFA 3ANWB 1MMDA 1KF6A 1HS7A 2M6BA 5CGMA 5HEJA 3ZSSA 1WR0A 3L8RA 2PJQA 2LOPA 3FXEB 3JADA 1XMOT 5AFUL 5AQPB 3CQCB 3NRXA 5LGNB 4ERRA 4QXCB 4XBFB 5EZYE 4H9PC 3K8PC 3HKDE 1US7B 3NWIA 2E5VA 4JI1T 2WZHA 2CE7A
chains in the Genus database with same CATH topology
2RP4A 3ZMSB 3ZYKA 2UXNB 2B1EA 4TV8E 1BR2A 5L2LA 4I43B 1FEWA 4X1KE 4H9OC 1HG2A 3BQIA 3K3QC 1FMWA 2CWOA 5LGUB 3Q5XA 1O3XA 3RYCE 2CA5A 3EVYA 3ZMZB 2KNDA 4EYYR 2Q9QC 5M4YA 5J2UE 2KWHA 1EZ3A 1SA0E 1ZKEA 4GK0E 4PNIA 2LSJA 4IHJE 1IJ6A 3NZPA 3D0TA 4UV8B 4EZ4A 2X9XA 5HWXA 1LRZA 1MMAA 3OJAA 4MALA 3ZMVB 2CEAA 4CQIA 5EK4A 1MMGA 5LCYA 3SWHA 2PG8A 5LYJE 2NW9A 3RX6A 4DMVA 1D1CA 3O4XE 2V7LA 4ZS2A 3WI3A 4HN9A 3PUQA 3E0ZA 2N2NA 4B6XA 3WAJA 2CMRA 3F31A 3RRWA 4KMCA 3GWHA 3BQLA 3MZKB 3AAIA 1YD8G 2Y48B 2OA5A 3KDSE 2MTQA 2V26A 4QKNA 4DMWA 4C91A 5A1LA 2WSSV 3DTOA 5JDMA 2W63A 3QK6A 2XHEB 5LXTE 3A5XA 3KBTA 4HE8A 4I50E 3N9LA 3L09A 2EHOA 5IYZE 5BMVE 3B13A 4Z8XA 4ZI3D 3RC8A 4H9RC 3ETVA 2NP9A 4IE4A 1Y64B 4PJJA 3ZN1B 2EHOD 4O2BE 1WRDA 1Z0PA 3ZJ2A 3ZEFB 2X66A 1YW0A 2KWIB 3HR0A 3ONXA 1D0XA 1MNEA 4OYKA 4U74A 3PUAA 4OHFA 4XZCA 3ZYMA 3GMIA 3PURA 2SPCA 4IE6A 4IE7A 4TV9E 3KVBA 5LP6E 4IGUA 4HKAA 2Q9QB 4AXPA 1ZEEA 2E8IA 4AKLA 5L3FB 1HTJF 1LVFA 3PU3A 2HH7A 4ZI3C 5F3JA 1IJ5A 3FXDB 5H6QB 1FMVA 3VU7H 2EHOC 3I1AA 1D1AA 3AVSA 4X1YE 2CXFA 2I59A 5LJNA 2LSKA 4WW0A 1UCUA 4DBQA 4G2AA 2PBIA 4J2CA 5EK3A 5FYMA 5FNVE 3Q9DA 4BA9A 2NWBA 4PK6A 4H63H 1E1HB 4X20E 2A2FX 1H7CA 3OBVE 4BJMA 4AQFC 1WYBA 4ZOLE 1B7TA 2HPLA 1ZHCA 2LEHA 2W00A 1YKEB 3IEEA 4PJMA 2KMFA 4CZZB 3GA8A 2WWUA 1QSDA 1D0YA 5TAOA 5HYAA 5JDGA 5JR9C 5LNKA 3IHRA 2DNXA 5JQGE 1D0ZA 1U4QA 2CWYA 3P8CD 5E0OA 5HXRA 2JQQA 4O4LE 3CX6B 3UFEA 4TUYE 3KV4A 2E9XD 4V1Av 4UIGA 3ZYLA 1FIOA 3F2EA 5JDFA 2A3DA 3CPZA 3KV9A 4K0UA 3U3IA 2XAJB 2XAQB 2JJ9A 3B57A 2CXDA 3RRCA 2KLQA 1IAPA 2VKHA 3N9MA 4GIWA 4NUUA 5CA1E 4MBQA 4PJLA 4FI5A 3MACA 4DVDA 4ASKA 3IBPA 4GK5E 4PAGA 2V7KA 3LG7A 4MHCA 4IIJE 3HI2A 4H9QC 2KT9A 5JDQA 4F6RC 3ZC0A 3VHLA 3ZN0B 1MNDA 3DJBA 4OK0A 2YU1A 3ZCIA 2WM9A 4EZHA 2E9XC 4I55E 2D0TA 3KV5A 3N9OA 2H3RA 4OFZA 2N9DA 3AAEB 5L3GB 2LOSA 3FBZA 4ANJA 1ZV4X 4NUVA 5ADXL 5DABA 1VRBA 2IC6A 3QUJA 2ODVA 2NW7A 5LBQB 3ZCJA 2LHNA 2VKDA 2IW5B 2WMNA 2Z6EA 3PE0A 3J7Yq 2LSGA 1HG5A 3I0OA 4P09A 4PK5A 2H7VC 3Q5WA 4C90A 5L3EB 5LGTB 4A56A 4QHOA 4QWNB 3AA0B 3R84B 3LBXB 5CA0E 5HXSA 3UUNA 4EYUA 1X79A 4E7ZA 5J2TE 3ZMTB 4DNDA 5L3CB 5ETWA 3GN5B 2CLYB 3ANWA 4ISSA 2N1GA 4O2AE 4AI6A 3AA6B 5LBMA 3HA4A 3LK2B 4FJOA 3CMLA 2IC9A 4QXHB 4IE0A 3AB3B 1OXZA 5FXVA 1BR4A 5C8YE 1KNZA 3UTKA 3ETUA 2UXXB 2CXLA 5CB4E 3N9PA 4N78D 1OWAA 3PU8A 3E08A 4CI1B 2DLRA 3C4XA 4UV9B 5FY0A 1MIWA 3E22E 4EOZB 5JRCB 2ZMAA 3SS1A 3M65A 2JPFA 5JDLA 2LSIA 4AKRB 4P0BA 3O9XA 4QXBB 4KBMB 2L9QA 3CX7B 2BDEA 2XTLA 2A72A 3ZJ1A 2VKJA 2ZM2A 4TZ4C 4PFOA 1VOMA 2DCFA 2K24A 2K5BB 2XUEA 2H7OA 5H6RB 3SRZA 1V9DA 2DHRA 2W62A 3RYHE 2JMHA 1LVKA 3N9NA 3U78A 4AKGA 4HFVA 1BR1A 4PJNA 5FXZA 3H3AA 2YK0A 3HKBE 1WR6A 2GK9A 3CX8B 2P9BA 1IZNB 2X0LB 3I0QA 5FMNA 3LK3B 1WLXA 3CWZB 2KINB 1AJ3A 5FXXA 4PFPA 4CI2B 3H37A 4JEUB 5DJQC 3EUHA 2QGSA 3OYZA 4ZI7E 1LKXA 3O1HA 4EB6E 5IHYA 1U5PA 4HTEA 2VL8A 2K48A 2M67A 2W0GA 2BVMA 3RC3A 5FY7A 2D5UA 2X9WA 4H9NC 3L3PA 1MIVA 4GOUA 4I4TE 3T8OA 4UXNB 4U72A 5FXWA 4UVAB 3RYIE 2ODUA 5JVDE 2WAUA 2NOXA 3SOLA 2YEVC 2X9HA 4HGAA 3N2OA 2BZBA 4G63A 2LT3A 3PDYA 4O4JE 4L9IA 4O8SA 5J1GA 3LFMA 5LHGB 1HFAA 2X51A 5L3BB 4PK4A 5L3DB 1HCIA 3MJXA 2WMOA 3K3OA 5HXCA 3RH3A 3UT5E 3W15B 5KDMC 1SHZC 4ZS3A 2CM0A 3AVRA 2V7IA 3KVAA 2ZM8A 2VASA 2VB6A 3ESLA 1QUUA 3N2GE 3NRYA 3NZQA 5LG4A 4PW8A 4YLHA 4CXXA 2D0UA 2DI4A 2EHOB 2X68A 2ZLYA 2D2SA 2Q9QA 2Y8DA 4AKIA 4GYRA 4L0RA 3ZC1A 2Q9QD 2ACXA 5FP3A 1HF8A 4HEAA 4JEHB 4OYJA 2VWAA 3WAKA 3VKGA 4UF0B 5LA6E 4YFSA 5JR9B 1YKHB 3QC9A 5HXEA 2MYSA 3RYFE 3RKOA 1S35A 3KINB 4JUYA 1BR0A 4AQGA 3TKLB 3MKDA 5F8PA 3RPUA 5HWYA 4WBOA 3CQXC 2JMKA 4BAYB 1MIYA 3P7IA 4ZHQE 1KK7A 2NW8A 3CQGB 5FY1A 3V5SA 3OKQA 1T98A 5LHIB 3FHNA 3O1IA 3CKDA 4UELA 4CXYA 3FBLA 4YJ3E 2DWGA 2LE8A 2C5IT 2KXPB 5GONE 1MMNA 3KBUA 3MXZA 3C50A 4IE5A 3V5UA 5JH7E 3KFWX 4ISTA 3AA7B 5KMGP 2W61A 1UX4A 3N2KE 1D1BA 2CCQA 2E9XB 5KX5E 2BVLA 3KV6A 3LK42 3JC6D 2XAFB 4QX8B 3S4UA 2WBLA 4E7SA 4QX7B 2L8KA 5HXHA 2XQYA 4UVBB 4EIWA 5JREA 5LHHB 3N5LA 3ZPOA 4DBRA 5JDNA 4AKHA 2DWKA 3OYXA 2NTXA 4L5GA 4H9SE 1NWMX 2RA1A 2J1DG 3C4WA 2KZ7B 3CVRA 3C98B 4JLEA 3BK9A 2VKOA 2XAHB 3J9X1 3EDUA 3LJCA 2NTYA 2YINA 3PUSA 3HKEE 3JC6C 4DO0A 3AA1B 3PUGA 2C0SA 4AQFA 3I9WA 4UF0A 5DQVA 5DQWA 5JDHA 4TX5A 4YJ2E 5JR9A 2L3LA 3ZMUB 2Y6XA 3LBXA 4WBNE 4ZI2D 3Q2MA 4XAXB 3GN5A 4EXTA 3BQKA 4WNKA 3MK7C 4UEMA 1G73A 2YU2A 3MA9A 4BJNA 3UUMA 2LM9A 3C51A 3HL6A 4X1IE 4O4HE 4YHJA 4KP3C 3F57A 2ZM0A 4P0AA 2PFVA 1S94A 3FB2A 4EAHA 4H63V 2MOZA 1NAFA 3VKHA 3ANWB 1HX8A 1MMDA 2K9AA 2X9YA 3R6NA 2C5KT 2ES0A 4ZI2C 2LSYA 3HKCE 4ILUA 2G0UA 2XAGB 1HS7A 2LJLA 4CI3B 3ZLIA 3N9QA 4GYSA 2E9XA 5JRCA 1G8XA 2CLYC 4CXWA 3K3NA 5LJMA 5EK2A 3O1JA 2V7MA 2JRKA 2LOPA 2PJQA 3FXEB 4O4IE 2HPJA 5AFUL 4IDZA 3UULA 3CQCB 2IAKA 3NRXA 5LGNB 4ERRA 2QA7A 3I9YA 4QXCB 3AAAB 4XBFB 5EZYE 4ADZA 2C5JA 4KUMB 4MFRA 1CUNA 4MLKA 4H9PC 4TN7B 2VK9A 4M1PA 3K8PC 3HKDE 3C4ZA 2LHRA 1US7B 2XASB 5LOVE 3IF8B 2V7JA 2MBGA 2V1DB 1UX5A 4UVCB 1WYCA 2X67A 2CE7A 3UUXB 3PTRB 3C64A 3EDVA 5HAXA 3NBXX 3DP7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BR0 A;  2DNX A;  5M4Y A;  1G73 A;  1S94 A;  1EZ3 A;  1HS7 A;  1FIO A;  3LG7 A;  2XHE B;  3C98 B;  4JEU B;  5LG4 A;  1FEW A;  4JEH B;  4TX5 A; 
#chains in the Genus database with same CATH topology
 3ZMS B;  3JCF A;  4TV8 E;  1OED A;  3K3Q C;  4B3M T;  1FMW A;  4DID B;  3Q5X A;  2KND A;  4TWH A;  1M62 A;  1ZKE A;  1GQE A;  4GK0 E;  4IHJ E;  3D0T A;  2X9X A;  4AIS A;  3SFD A;  4JI4 T;  3OJA A;  3SWH A;  4Z91 A;  2UUC T;  2PG8 A;  4DMV A;  2XM2 A;  2WB5 A;  3MZK B;  2Y48 B;  2OA5 A;  3KDS E;  2V26 A;  5A1L A;  5HCJ A;  4LFC T;  2W63 A;  5LXT E;  4YT0 A;  3B13 A;  3TLV A;  3PV0 F;  1HNX T;  1Y64 B;  2EHO D;  2LKH A;  1Z0P A;  4XZC A;  2WDR A;  2E5L T;  2SPC A;  5LP6 E;  4HKA A;  3PUZ F;  5L47 A;  2M6I A;  1ZEE A;  2E8I A;  3FZM B;  4AKL A;  1HTJ F;  2VQF T;  3FXD B;  2KSR A;  1FMV A;  1Y01 A;  3A7M A;  3VU7 H;  4JBW F;  4TNV A;  2QRX A;  5LG3 A;  2CXF A;  5LJN A;  4GKK T;  2X0H A;  2MAW A;  2LSK A;  4WW0 A;  3K1S A;  3Q9D A;  2LLY A;  4PK6 A;  1E1H B;  3OBV E;  2BG9 A;  4ZOL E;  2D9D A;  4CZZ B;  3IEE A;  5LNK A;  1D0Z A;  4KX6 A;  1U4Q A;  3P8C D;  3UFE A;  4UIG A;  2A3D A;  3KV9 A;  3U3I A;  2XAJ B;  3AEF A;  1IAP A;  3N9M A;  5CA1 E;  1XZY A;  3MAC A;  4DVD A;  2XPK A;  4KHZ F;  2V7K A;  4MHC A;  4IIJ E;  2KT9 A;  3P4P A;  3ZCI A;  4KHP T;  4EZH A;  2E9X C;  4U7I A;  5C2T A;  2H3R A;  4OFZ A;  2YOE A;  3CIR A;  4NUV A;  4YSX A;  5ADX L;  2ODV A;  3UU3 A;  2LSG A;  4P09 A;  3Q5W A;  3Q5E A;  4A56 A;  2XQ7 A;  4QWN B;  4LF6 T;  4E7Z A;  5J2T E;  3GN5 B;  2V8S V;  4GKJ T;  1E2A A;  4DV0 T;  3HA4 A;  2WWV A;  2IC9 A;  5FXV A;  3UTK A;  3ABV A;  4NIQ A;  2CXL A;  5CB4 E;  1SUM B;  3T1H T;  5JRC B;  2J62 A;  4AKR B;  4P0B A;  4KBM B;  2BDE A;  2XTL A;  2VKJ A;  4PFO A;  5H6R B;  3L39 A;  2JMH A;  3U78 A;  1BR1 A;  3HKB E;  4DR2 T;  4ZZC A;  2J4G A;  4HFB A;  2X0L B;  3I0Q A;  5FMN A;  3LK3 B;  1IBM T;  4PFP A;  5ABH A;  4ILC A;  2H89 A;  4EB6 E;  4GOU A;  5FXW A;  2WS3 A;  5JVD E;  2ZM6 T;  4O4J E;  3AE5 A;  4G63 A;  4O8S A;  4EV6 A;  2X51 A;  1HCI A;  1E7P A;  1SHZ C;  2CM0 A;  3PUW F;  2V7I A;  2VAS A;  1QUU A;  3NRY A;  1FJG T;  3NZQ A;  5LG4 A;  4PW8 A;  2XZE A;  4AKI A;  4GYR A;  3ZC1 A;  4EGW A;  2CHO A;  2XSA A;  4YY3 T;  4X65 T;  2YN6 A;  2BKO A;  4JI2 T;  3TLT A;  4IL9 A;  2JQ9 A;  3QC9 A;  5HXE A;  1S35 A;  2W67 A;  3TKL B;  5F8P A;  4LF5 T;  2JMK A;  2V5C A;  2NW8 A;  3OKQ A;  1T98 A;  3NVO A;  3FBL A;  2LE8 A;  2C5I T;  3RLF F;  2PTF A;  3C50 A;  2ACZ A;  3VR9 A;  3QOF A;  5KMG P;  4U31 A;  5AQN B;  4AIU A;  1UX4 A;  1Z8U A;  3JAE A;  2VVS A;  5ABF B;  2E9X B;  2V6Y A;  4YXD A;  1UUR A;  3JC6 D;  2XAF B;  2WBL A;  4ZXL A;  2L8K A;  4EIW A;  3RIU A;  4AKH A;  3ZPO A;  4K0K T;  1UUS A;  3AE6 A;  4H9S E;  2J1D G;  4DUZ T;  2KZ7 B;  3C98 B;  2VKO A;  3EDU A;  4HWC A;  5DQV A;  3EI0 A;  4TX5 A;  4YJ2 E;  3AE8 A;  3LBX A;  4JI8 T;  1VCT A;  1VCS A;  4EXT A;  4DV6 T;  3UUM A;  4YHJ A;  2ZM0 A;  4EAH A;  2QYW A;  1HX8 A;  3PUY F;  4DV2 T;  2C5K T;  4ZI2 C;  2G0U A;  2XAG B;  4GYS A;  2E9X A;  4O4I E;  3RIA A;  2HPJ A;  3OPC A;  3UUL A;  4LFB T;  4JI5 T;  3AAA B;  2BS3 A;  3RIF A;  4JI7 T;  4MFR A;  3FZK B;  2VK9 A;  4M1P A;  3UU5 A;  2XAS B;  3IF8 B;  2V7J A;  2V1D B;  1SE7 A;  3PTR B;  5HAX A;  1ZOY A;  2RP4 A;  4I43 B;  1FEW A;  4X1K E;  3P4R A;  3ZKR A;  2X0Y A;  5J2U E;  3ZT6 A;  5AQI B;  1IJ6 A;  3NZP A;  4JYA T;  3IA3 A;  4ILB A;  4EZ4 A;  1T7S A;  4DR7 T;  5HWX A;  3AEG A;  1MMA A;  4MAL A;  5FVL A;  5EK4 A;  2W4X A;  3AXJ B;  5LCY A;  5LYJ E;  2NW9 A;  4A97 A;  4JI6 T;  3E0Z A;  2N2N A;  2AXD S;  4B6X A;  3GWH A;  3BQL A;  4QKN A;  4C91 A;  2WSS V;  2I0M A;  3A5X A;  4HWF A;  3L09 A;  5AQJ B;  3NKZ A;  4IE4 A;  5FL1 A;  1YW0 A;  3AEC A;  2CHN A;  2XQ8 A;  4TV9 E;  4IE7 A;  3KVB A;  4IGU A;  2Q9Q B;  4U33 A;  5L3F B;  1LVF A;  5FVK A;  1IJ5 A;  2OV9 A;  3UQ7 A;  2EHO C;  1W9R A;  3I1A A;  3AVS A;  5AQV B;  3AEA A;  5LB7 B;  4A98 A;  4DBQ A;  2PBI A;  5EK3 A;  5FYM A;  1KFY A;  4BA9 A;  4H63 H;  2HPL A;  2W00 A;  4EED A;  1YKE B;  2KMF A;  3GA8 A;  5TAO A;  2DNX A;  3UU6 A;  3AXJ A;  1JNR A;  5JQG E;  5HXR A;  4TUY E;  2YKS A;  4V1A v;  1FIO A;  3CPZ A;  4K0U A;  2XAQ B;  2KLQ A;  2VKH A;  4TWD A;  4PJL A;  2YDS A;  2HN2 A;  1J1J A;  3HI2 A;  4F6R C;  3AED A;  3ZN0 B;  3A8Y C;  2YU1 A;  3TLS A;  3ZST A;  3N9O A;  2N9D A;  5L3G B;  2LOS A;  3FBZ A;  4LF4 T;  4LFA T;  3QUJ A;  3ZCJ A;  2UXC T;  2IW5 B;  2Z6E A;  3PE0 A;  3J7Y q;  3I0O A;  4C90 A;  3UU8 A;  3UUN A;  3ZMT B;  3ANW A;  5L4H A;  3AE1 A;  4O2A E;  3AE9 A;  4AI6 A;  5J0Z A;  4IE0 A;  1OXZ A;  5AQO B;  5KXJ A;  5HCM A;  3T1Y T;  1OWA A;  1UK5 A;  3PU8 A;  3E08 A;  3C4X A;  4F8H A;  2WY2 A;  2UXB T;  5LMN T;  3M65 A;  3O9X A;  4QXB B;  1KEY A;  1DU2 A;  2A72 A;  5AQR B;  4DR6 T;  2BBH A;  4TZ4 C;  4AQY T;  2VUR A;  1VOM A;  2K5B B;  5IWA T;  4QH1 A;  2H7O A;  1V9D A;  2W62 A;  3ONL C;  3H3A A;  3CX8 B;  2P9B A;  3UUB A;  4CI2 B;  5DJQ C;  3OYZ A;  1LKX A;  3O1H A;  3M3Z B;  4X5T A;  2VL8 A;  2M67 A;  4NPP A;  2W0G A;  5HEU A;  2BVM A;  3RC3 A;  3EAM A;  4H9N C;  2XQ9 A;  1MIV A;  3LDQ B;  4UVA B;  3N2O A;  3PDY A;  5LHG B;  5J1G A;  3LFM A;  5L3B B;  4PK4 A;  3RH3 A;  3W15 B;  2W2U A;  2OLT A;  3FZH B;  3PUX F;  2ZLY A;  2EHO B;  2D2S A;  2WU2 A;  3TLW A;  2VWA A;  3WAK A;  3VKG A;  5LA6 E;  3LSV A;  1M7K A;  3RYF E;  3KIN B;  1KNR A;  1BR0 A;  3MKD A;  3RPU A;  4WBO A;  3CQX C;  1MIY A;  3CQG B;  3FHN A;  3CKD A;  4UEL A;  2WQY A;  2KXP B;  3MXZ A;  3KBU A;  2VL0 A;  5JH7 E;  3PUV F;  5AQF B;  4YHH T;  2W61 A;  1D1B A;  2CCQ A;  2NR4 A;  5KX5 E;  3KV6 A;  5LMU T;  4E7S A;  4X66 T;  5HXH A;  4UVB B;  4IDN A;  2A9U A;  4DBR A;  5JDN A;  2BS4 A;  2DWK A;  3TLU A;  1R8I A;  2XQA A;  4DV5 T;  2F4V T;  5C3J A;  4WZX A;  4Z90 A;  3LJC A;  3JAF A;  3JC6 C;  3PUG A;  3I9W A;  5DQW A;  3ZMU B;  2L3L A;  4WBN E;  3VRB A;  4XAX B;  3GN5 A;  3BQK A;  2JQH A;  3C51 A;  4X1I E;  1HNW T;  4KP3 C;  2VQE T;  3FB2 A;  3G06 A;  2X9Y A;  3R6N A;  2ES0 A;  3HKC E;  4ILU A;  3N9Q A;  5JRC A;  2CLY C;  3K3N A;  4ILA A;  5EK2 A;  2JRK A;  1YQ4 A;  4IDZ A;  2IAK A;  3I9Y A;  4ZEY A;  4IRE A;  4KUM B;  4MLK A;  4TN7 B;  3SFE A;  2LHR A;  1I94 T;  4HFC A;  5LOV E;  4UVC B;  1UX5 A;  1WYC A;  3UUX B;  4IDO A;  3C64 A;  3NBX X;  3DP7 A;  4DR4 T;  4X62 T;  1BR2 A;  3P4Q A;  5L2L A;  2YDQ A;  2DL1 A;  3EHZ A;  1QLB A;  4H9O C;  4DV4 T;  2CWO A;  5LGU B;  1UGO A;  3ZMZ B;  4EYY R;  1J5E T;  2Q9Q C;  5M4Y A;  4WYV A;  4LF7 T;  1EZ3 A;  4YTN A;  2LSJ A;  4UV8 B;  1LRZ A;  2XQ6 A;  3RX6 A;  1D1C A;  3O4X E;  1OED C;  4ZS2 A;  4HN9 A;  3WAJ A;  3F31 A;  3RRW A;  2HN1 A;  2BKN A;  3AAI A;  2HHH T;  4HWH A;  2V5D A;  3DTO A;  4UR9 A;  2XHE B;  4I50 E;  5BMV E;  4ZI3 D;  3RC8 A;  4X64 T;  3ETV A;  5CJ5 A;  5JTG A;  4O2B E;  3ZJ2 A;  5AQU B;  3ZEF B;  2X66 A;  3ONX A;  3HR0 A;  4OYK A;  4U74 A;  1D0X A;  1MNE A;  3ZYM A;  3GMI A;  3PU3 A;  2HH7 A;  1NEN A;  5F3J A;  2E2A A;  4LMJ A;  4X1Y E;  2I59 A;  1UCU A;  5FNV E;  2NWB A;  4DV3 T;  4X20 E;  4BJM A;  2FUP A;  1XNR T;  1WYB A;  1ZHC A;  3AEE A;  5JR9 C;  1W09 A;  5ABF A;  3PJA A;  2CWY A;  5E0O A;  2JQQ A;  2WU5 A;  4O4L E;  3CX6 B;  3KV4 A;  3ZYL A;  2BS2 A;  3F2E A;  5JDF A;  2JJ9 A;  3B57 A;  2CXD A;  4GIW A;  4NUU A;  4MBQ A;  4FI5 A;  3IBP A;  2J47 A;  4GK5 E;  4PAG A;  2BG9 C;  4H9Q C;  5AQK B;  5JDQ A;  3ZC0 A;  4U2Y A;  3VHL A;  3DJB A;  2WM9 A;  2XQ5 A;  4I55 E;  3KV5 A;  4B3R T;  5BR8 T;  3EAB A;  2NW7 A;  5LBQ B;  2VKD A;  3QNU A;  2WMN A;  3ZT5 A;  1XNQ T;  5L3E B;  2H7V C;  2CRB A;  4QHO A;  3AA0 B;  4HWD A;  4DND A;  5ETW A;  2CLY B;  4ISS A;  2N1G A;  4FJO A;  1XDP A;  4QXH B;  1BR4 A;  5C8Y E;  1KNZ A;  3ETU A;  2UXX B;  2B76 A;  2FBW A;  3N9P A;  4N78 D;  1MIW A;  4EOZ B;  2ZMA A;  3SS1 A;  4NXM T;  3VR8 A;  2JPF A;  2LSI A;  2XM1 A;  2WDQ A;  1IBK T;  2BBJ A;  3FZF B;  2DHR A;  4DV1 T;  1LVK A;  3N9N A;  4AKG A;  4PJN A;  5FXZ A;  1YQ3 A;  4COF A;  1WR6 A;  3UU4 A;  1IZN B;  5CFB A;  1WLX A;  4DV7 T;  1OED B;  5FXX A;  4IL4 A;  4HWI B;  1IBL T;  4HTE A;  5FY7 A;  2D5U A;  2CPT A;  4CN1 A;  4I4T E;  2ODU A;  2WAU A;  2NOX A;  4HGA A;  2BZB A;  2LT3 A;  4L9I A;  1XDO A;  1HFA A;  3VRA A;  1T8B A;  3UT5 E;  5KDM C;  4JI0 T;  3KVA A;  2ZM8 A;  2VB6 A;  2XSB A;  3ESL A;  3N2G E;  1KNP A;  2D0U A;  2X68 A;  2Q9Q A;  2Y8D A;  4YSZ A;  1ZP0 A;  4HEA A;  4UF0 B;  4YFS A;  4A5X A;  5JR9 B;  3OTO T;  4NXN T;  5HEO A;  4I0U A;  2MYS A;  4JUY A;  5AQH B;  5HWY A;  4BAY B;  5AQG B;  3P7I A;  5FL0 A;  1XWM A;  3O1I A;  4CXY A;  3RQU A;  2DWG A;  5F5W A;  5GON E;  4IE5 A;  4IST A;  3AA7 B;  1X9B A;  2BG9 B;  2I6H A;  2BVL A;  5AQL B;  3LK4 2;  2W66 A;  4QX7 B;  5JRE A;  3N5L A;  3OYX A;  2NTX A;  4IDP A;  2CBJ A;  3CVR A;  4TNW A;  4JLE A;  3BK9 A;  4EEB A;  3J9X 1;  3UQ4 A;  4HFD A;  5HEG A;  3HKE E;  4DO0 A;  3AA1 B;  4UF0 A;  5JR9 A;  3AE2 A;  1J5W A;  3Q2M A;  3RIU C;  4WNK A;  3MK7 C;  3MA9 A;  2MPK A;  4BJN A;  3HL6 A;  4DR5 T;  3AEB A;  2RPA A;  4H63 V;  3VKH A;  3P4S A;  4LMK A;  4JV5 T;  2K9A A;  2LSY A;  2LJL A;  4CI3 B;  3ZLI A;  1G8X A;  4CXW A;  4LF9 T;  5LJM A;  3O1J A;  2V7M A;  2XQ4 A;  4IDQ A;  2IML A;  2QA7 A;  1W0A A;  3RI5 A;  4ADZ A;  2C5J A;  1CUN A;  3C4Z A;  4QH4 A;  2MBG A;  2X67 A;  3EDV A;  4U3C A;  3ZT7 A;  3ZYK A;  2UXN B;  2B1E A;  2H88 A;  2WP9 A;  1HG2 A;  3BQI A;  3RHW A;  1O3X A;  3RYC E;  2CA5 A;  3EVY A;  4YTP A;  2KWH A;  1SA0 E;  2IHR 1;  4PNI A;  2FJE A;  1OED E;  2UUA T;  3ZMV B;  2CEA A;  4CQI A;  1MMG A;  5IUX A;  2V7L A;  3WI3 A;  3PUQ A;  2CMR A;  4KMC A;  4QH5 A;  1YD8 G;  2MTQ A;  4DMW A;  2JQK A;  5JDM A;  3QK6 A;  3KBT A;  4HE8 A;  3N9L A;  4LML A;  2EHO A;  3Q5D A;  3B5M A;  5IYZ E;  2UXD T;  4Z8X A;  4H9R C;  2NP9 A;  1XMQ T;  4PJJ A;  3ZN1 B;  4OX9 T;  1WRD A;  2AE9 A;  2KWI B;  4DUY T;  5AQT B;  3PUA A;  4OHF A;  5AQS B;  4IE6 A;  3PUR A;  4AXP A;  3OVU A;  1I6Z A;  4ZI3 C;  5H6Q B;  1D1A A;  3RF1 A;  3CK6 A;  4G2A A;  2LRK A;  4J2C A;  2QVA A;  2A2F X;  1H7C A;  4AQF C;  1B7T A;  2LEH A;  2WZI A;  4PJM A;  2WWU A;  1QSD A;  1D0Y A;  5JDG A;  5HYA A;  4JI3 T;  3IHR A;  2CBI A;  2E9X D;  2LM2 A;  4U7Y A;  4TWF A;  4DR3 T;  2IIU A;  3RRC A;  2BG9 E;  2V6Y B;  4ASK A;  3LG7 A;  4YSY A;  4CN4 A;  1MND A;  2UU9 T;  4OK0 A;  4B3S T;  2VVN A;  2D0T A;  3X1D A;  3AAE B;  3P50 A;  4ANJ A;  1ZV4 X;  2R6G F;  5DAB A;  1HX1 B;  1VRB A;  1HR0 T;  2IC6 A;  2LHN A;  1HG5 A;  4PK5 A;  5LGT B;  3R84 B;  3LBX B;  5CA0 E;  5HXS A;  4EYU A;  1X79 A;  4Q25 A;  5AQQ B;  5HEH A;  5L3C B;  3AA6 B;  2V6X A;  5LBM A;  5ABG A;  3LK2 B;  3CML A;  2K3W A;  3AB3 B;  2FJD A;  3UFG A;  1WCR A;  4CI1 B;  2IUB A;  2WDV A;  2DLR A;  4UV9 B;  5FY0 A;  3E22 E;  2XQ3 A;  5JDL A;  2L9Q A;  3CX7 B;  2FJA A;  4ZZB A;  1N32 T;  3ZJ1 A;  2ZM2 A;  1JNZ A;  3PJA J;  2DCF A;  2K24 A;  2XUE A;  1YXR A;  3SRZ A;  3RYH E;  4HFV A;  2XJ7 A;  2YK0 A;  3ONJ A;  2GK9 A;  2JIW A;  3CWZ B;  2KIN B;  3QB5 A;  3RGL A;  1AJ3 A;  3H37 A;  4JEU B;  3EUH A;  2QGS A;  4ZI7 E;  5IHY A;  1U5P A;  4IT4 A;  2K48 A;  3AE4 A;  1HNZ T;  2X9W A;  3RKG A;  3L3P A;  2YDR A;  4DR1 T;  3T8O A;  4UXN B;  4U72 A;  3RYI E;  3SOL A;  2YEV C;  2X9H A;  4P1N A;  5L3D B;  3P4W A;  3MJX A;  2WMO A;  3K3O A;  5HXC A;  4ZS3 A;  3AVR A;  5FKY A;  1NEK A;  4YLH A;  4CXX A;  2DI4 A;  4L0R A;  2BKP A;  2Q9Q D;  2ACX A;  5FP3 A;  1HF8 A;  4OYJ A;  4JEH B;  1T72 A;  3FZL B;  1YKH B;  1W0B A;  3RKO A;  4AQG A;  4B3T T;  3H3M A;  4ZHQ E;  1KK7 A;  3V5S A;  5FY1 A;  5LHI B;  5L4E A;  2LRL A;  4YJ3 E;  1L0V A;  5ABE A;  4KI0 F;  1MMN A;  3QB5 K;  4LF8 T;  3V5U A;  3KFW X;  3N2K E;  2WCA A;  4HFI A;  3RQW A;  3AE3 A;  4QX8 B;  3S4U A;  2IDO B;  2XQY A;  5LHH B;  1N34 T;  4HFH A;  4L5G A;  1NWM X;  2RA1 A;  3C4W A;  2FJB A;  3AE7 A;  2XAH B;  1N36 T;  2LKG A;  2NTY A;  2YIN A;  3PUS A;  4CN6 A;  2XY8 B;  4HFE A;  2C0S A;  1WFD A;  4AQF A;  5JDH A;  5AQM B;  2Y6X A;  4YTM A;  4ZI2 D;  1CHU A;  4UEM A;  4U2Z A;  1G73 A;  2YU2 A;  2LM9 A;  2UUB T;  4O4H E;  3F57 A;  4P0A A;  1N33 T;  2PFV A;  1S94 A;  2MOZ A;  1NAF A;  3ANW B;  1MMD A;  1KF6 A;  1HS7 A;  2M6B A;  5CGM A;  5HEJ A;  3ZSS A;  1WR0 A;  3L8R A;  2PJQ A;  2LOP A;  3FXE B;  3JAD A;  1XMO T;  5AFU L;  5AQP B;  3CQC B;  3NRX A;  5LGN B;  4ERR A;  4QXC B;  4XBF B;  5EZY E;  4H9P C;  3K8P C;  3HKD E;  1US7 B;  3NWI A;  2E5V A;  4JI1 T;  2WZH A;  2CE7 A; 
#chains in the Genus database with same CATH homology
 2RP4 A;  3ZMS B;  3ZYK A;  2UXN B;  2B1E A;  4TV8 E;  1BR2 A;  5L2L A;  4I43 B;  1FEW A;  4X1K E;  4H9O C;  1HG2 A;  3BQI A;  3K3Q C;  1FMW A;  2CWO A;  5LGU B;  3Q5X A;  1O3X A;  3RYC E;  2CA5 A;  3EVY A;  3ZMZ B;  2KND A;  4EYY R;  2Q9Q C;  5M4Y A;  5J2U E;  2KWH A;  1EZ3 A;  1SA0 E;  1ZKE A;  4GK0 E;  4PNI A;  2LSJ A;  4IHJ E;  1IJ6 A;  3NZP A;  3D0T A;  4UV8 B;  4EZ4 A;  2X9X A;  5HWX A;  1LRZ A;  1MMA A;  3OJA A;  4MAL A;  3ZMV B;  2CEA A;  4CQI A;  5EK4 A;  1MMG A;  5LCY A;  3SWH A;  2PG8 A;  5LYJ E;  2NW9 A;  3RX6 A;  4DMV A;  1D1C A;  3O4X E;  2V7L A;  4ZS2 A;  3WI3 A;  4HN9 A;  3PUQ A;  3E0Z A;  2N2N A;  4B6X A;  3WAJ A;  2CMR A;  3F31 A;  3RRW A;  4KMC A;  3GWH A;  3BQL A;  3MZK B;  3AAI A;  1YD8 G;  2Y48 B;  2OA5 A;  3KDS E;  2MTQ A;  2V26 A;  4QKN A;  4DMW A;  4C91 A;  5A1L A;  2WSS V;  3DTO A;  5JDM A;  2W63 A;  3QK6 A;  2XHE B;  5LXT E;  3A5X A;  3KBT A;  4HE8 A;  4I50 E;  3N9L A;  3L09 A;  2EHO A;  5IYZ E;  5BMV E;  3B13 A;  4Z8X A;  4ZI3 D;  3RC8 A;  4H9R C;  3ETV A;  2NP9 A;  4IE4 A;  1Y64 B;  4PJJ A;  3ZN1 B;  2EHO D;  4O2B E;  1WRD A;  1Z0P A;  3ZJ2 A;  3ZEF B;  2X66 A;  1YW0 A;  2KWI B;  3HR0 A;  3ONX A;  1D0X A;  1MNE A;  4OYK A;  4U74 A;  3PUA A;  4OHF A;  4XZC A;  3ZYM A;  3GMI A;  3PUR A;  2SPC A;  4IE6 A;  4IE7 A;  4TV9 E;  3KVB A;  5LP6 E;  4IGU A;  4HKA A;  2Q9Q B;  4AXP A;  1ZEE A;  2E8I A;  4AKL A;  5L3F B;  1HTJ F;  1LVF A;  3PU3 A;  2HH7 A;  4ZI3 C;  5F3J A;  1IJ5 A;  3FXD B;  5H6Q B;  1FMV A;  3VU7 H;  2EHO C;  3I1A A;  1D1A A;  3AVS A;  4X1Y E;  2CXF A;  2I59 A;  5LJN A;  2LSK A;  4WW0 A;  1UCU A;  4DBQ A;  4G2A A;  2PBI A;  4J2C A;  5EK3 A;  5FYM A;  5FNV E;  3Q9D A;  4BA9 A;  2NWB A;  4PK6 A;  4H63 H;  1E1H B;  4X20 E;  2A2F X;  1H7C A;  3OBV E;  4BJM A;  4AQF C;  1WYB A;  4ZOL E;  1B7T A;  2HPL A;  1ZHC A;  2LEH A;  2W00 A;  1YKE B;  3IEE A;  4PJM A;  2KMF A;  4CZZ B;  3GA8 A;  2WWU A;  1QSD A;  1D0Y A;  5TAO A;  5HYA A;  5JDG A;  5JR9 C;  5LNK A;  3IHR A;  2DNX A;  5JQG E;  1D0Z A;  1U4Q A;  2CWY A;  3P8C D;  5E0O A;  5HXR A;  2JQQ A;  4O4L E;  3CX6 B;  3UFE A;  4TUY E;  3KV4 A;  2E9X D;  4V1A v;  4UIG A;  3ZYL A;  1FIO A;  3F2E A;  5JDF A;  2A3D A;  3CPZ A;  3KV9 A;  4K0U A;  3U3I A;  2XAJ B;  2XAQ B;  2JJ9 A;  3B57 A;  2CXD A;  3RRC A;  2KLQ A;  1IAP A;  2VKH A;  3N9M A;  4GIW A;  4NUU A;  5CA1 E;  4MBQ A;  4PJL A;  4FI5 A;  3MAC A;  4DVD A;  4ASK A;  3IBP A;  4GK5 E;  4PAG A;  2V7K A;  3LG7 A;  4MHC A;  4IIJ E;  3HI2 A;  4H9Q C;  2KT9 A;  5JDQ A;  4F6R C;  3ZC0 A;  3VHL A;  3ZN0 B;  1MND A;  3DJB A;  4OK0 A;  2YU1 A;  3ZCI A;  2WM9 A;  4EZH A;  2E9X C;  4I55 E;  2D0T A;  3KV5 A;  3N9O A;  2H3R A;  4OFZ A;  2N9D A;  3AAE B;  5L3G B;  2LOS A;  3FBZ A;  4ANJ A;  1ZV4 X;  4NUV A;  5ADX L;  5DAB A;  1VRB A;  2IC6 A;  3QUJ A;  2ODV A;  2NW7 A;  5LBQ B;  3ZCJ A;  2LHN A;  2VKD A;  2IW5 B;  2WMN A;  2Z6E A;  3PE0 A;  3J7Y q;  2LSG A;  1HG5 A;  3I0O A;  4P09 A;  4PK5 A;  2H7V C;  3Q5W A;  4C90 A;  5L3E B;  5LGT B;  4A56 A;  4QHO A;  4QWN B;  3AA0 B;  3R84 B;  3LBX B;  5CA0 E;  5HXS A;  3UUN A;  4EYU A;  1X79 A;  4E7Z A;  5J2T E;  3ZMT B;  4DND A;  5L3C B;  5ETW A;  3GN5 B;  2CLY B;  3ANW A;  4ISS A;  2N1G A;  4O2A E;  4AI6 A;  3AA6 B;  5LBM A;  3HA4 A;  3LK2 B;  4FJO A;  3CML A;  2IC9 A;  4QXH B;  4IE0 A;  3AB3 B;  1OXZ A;  5FXV A;  1BR4 A;  5C8Y E;  1KNZ A;  3UTK A;  3ETU A;  2UXX B;  2CXL A;  5CB4 E;  3N9P A;  4N78 D;  1OWA A;  3PU8 A;  3E08 A;  4CI1 B;  2DLR A;  3C4X A;  4UV9 B;  5FY0 A;  1MIW A;  3E22 E;  4EOZ B;  5JRC B;  2ZMA A;  3SS1 A;  3M65 A;  2JPF A;  5JDL A;  2LSI A;  4AKR B;  4P0B A;  3O9X A;  4QXB B;  4KBM B;  2L9Q A;  3CX7 B;  2BDE A;  2XTL A;  2A72 A;  3ZJ1 A;  2VKJ A;  2ZM2 A;  4TZ4 C;  4PFO A;  1VOM A;  2DCF A;  2K24 A;  2K5B B;  2XUE A;  2H7O A;  5H6R B;  3SRZ A;  1V9D A;  2DHR A;  2W62 A;  3RYH E;  2JMH A;  1LVK A;  3N9N A;  3U78 A;  4AKG A;  4HFV A;  1BR1 A;  4PJN A;  5FXZ A;  3H3A A;  2YK0 A;  3HKB E;  1WR6 A;  2GK9 A;  3CX8 B;  2P9B A;  1IZN B;  2X0L B;  3I0Q A;  5FMN A;  3LK3 B;  1WLX A;  3CWZ B;  2KIN B;  1AJ3 A;  5FXX A;  4PFP A;  4CI2 B;  3H37 A;  4JEU B;  5DJQ C;  3EUH A;  2QGS A;  3OYZ A;  4ZI7 E;  1LKX A;  3O1H A;  4EB6 E;  5IHY A;  1U5P A;  4HTE A;  2VL8 A;  2K48 A;  2M67 A;  2W0G A;  2BVM A;  3RC3 A;  5FY7 A;  2D5U A;  2X9W A;  4H9N C;  3L3P A;  1MIV A;  4GOU A;  4I4T E;  3T8O A;  4UXN B;  4U72 A;  5FXW A;  4UVA B;  3RYI E;  2ODU A;  5JVD E;  2WAU A;  2NOX A;  3SOL A;  2YEV C;  2X9H A;  4HGA A;  3N2O A;  2BZB A;  4G63 A;  2LT3 A;  3PDY A;  4O4J E;  4L9I A;  4O8S A;  5J1G A;  3LFM A;  5LHG B;  1HFA A;  2X51 A;  5L3B B;  4PK4 A;  5L3D B;  1HCI A;  3MJX A;  2WMO A;  3K3O A;  5HXC A;  3RH3 A;  3UT5 E;  3W15 B;  5KDM C;  1SHZ C;  4ZS3 A;  2CM0 A;  3AVR A;  2V7I A;  3KVA A;  2ZM8 A;  2VAS A;  2VB6 A;  3ESL A;  1QUU A;  3N2G E;  3NRY A;  3NZQ A;  5LG4 A;  4PW8 A;  4YLH A;  4CXX A;  2D0U A;  2DI4 A;  2EHO B;  2X68 A;  2ZLY A;  2D2S A;  2Q9Q A;  2Y8D A;  4AKI A;  4GYR A;  4L0R A;  3ZC1 A;  2Q9Q D;  2ACX A;  5FP3 A;  1HF8 A;  4HEA A;  4JEH B;  4OYJ A;  2VWA A;  3WAK A;  3VKG A;  4UF0 B;  5LA6 E;  4YFS A;  5JR9 B;  1YKH B;  3QC9 A;  5HXE A;  2MYS A;  3RYF E;  3RKO A;  1S35 A;  3KIN B;  4JUY A;  1BR0 A;  4AQG A;  3TKL B;  3MKD A;  5F8P A;  3RPU A;  5HWY A;  4WBO A;  3CQX C;  2JMK A;  4BAY B;  1MIY A;  3P7I A;  4ZHQ E;  1KK7 A;  2NW8 A;  3CQG B;  5FY1 A;  3V5S A;  3OKQ A;  1T98 A;  5LHI B;  3FHN A;  3O1I A;  3CKD A;  4UEL A;  4CXY A;  3FBL A;  4YJ3 E;  2DWG A;  2LE8 A;  2C5I T;  2KXP B;  5GON E;  1MMN A;  3KBU A;  3MXZ A;  3C50 A;  4IE5 A;  3V5U A;  5JH7 E;  3KFW X;  4IST A;  3AA7 B;  5KMG P;  2W61 A;  1UX4 A;  3N2K E;  1D1B A;  2CCQ A;  2E9X B;  5KX5 E;  2BVL A;  3KV6 A;  3LK4 2;  3JC6 D;  2XAF B;  4QX8 B;  3S4U A;  2WBL A;  4E7S A;  4QX7 B;  2L8K A;  5HXH A;  2XQY A;  4UVB B;  4EIW A;  5JRE A;  5LHH B;  3N5L A;  3ZPO A;  4DBR A;  5JDN A;  4AKH A;  2DWK A;  3OYX A;  2NTX A;  4L5G A;  4H9S E;  1NWM X;  2RA1 A;  2J1D G;  3C4W A;  2KZ7 B;  3CVR A;  3C98 B;  4JLE A;  3BK9 A;  2VKO A;  2XAH B;  3J9X 1;  3EDU A;  3LJC A;  2NTY A;  2YIN A;  3PUS A;  3HKE E;  3JC6 C;  4DO0 A;  3AA1 B;  3PUG A;  2C0S A;  4AQF A;  3I9W A;  4UF0 A;  5DQV A;  5DQW A;  5JDH A;  4TX5 A;  4YJ2 E;  5JR9 A;  2L3L A;  3ZMU B;  2Y6X A;  3LBX A;  4WBN E;  4ZI2 D;  3Q2M A;  4XAX B;  3GN5 A;  4EXT A;  3BQK A;  4WNK A;  3MK7 C;  4UEM A;  1G73 A;  2YU2 A;  3MA9 A;  4BJN A;  3UUM A;  2LM9 A;  3C51 A;  3HL6 A;  4X1I E;  4O4H E;  4YHJ A;  4KP3 C;  3F57 A;  2ZM0 A;  4P0A A;  2PFV A;  1S94 A;  3FB2 A;  4EAH A;  4H63 V;  2MOZ A;  1NAF A;  3VKH A;  3ANW B;  1HX8 A;  1MMD A;  2K9A A;  2X9Y A;  3R6N A;  2C5K T;  2ES0 A;  4ZI2 C;  2LSY A;  3HKC E;  4ILU A;  2G0U A;  2XAG B;  1HS7 A;  2LJL A;  4CI3 B;  3ZLI A;  3N9Q A;  4GYS A;  2E9X A;  5JRC A;  1G8X A;  2CLY C;  4CXW A;  3K3N A;  5LJM A;  5EK2 A;  3O1J A;  2V7M A;  2JRK A;  2LOP A;  2PJQ A;  3FXE B;  4O4I E;  2HPJ A;  5AFU L;  4IDZ A;  3UUL A;  3CQC B;  2IAK A;  3NRX A;  5LGN B;  4ERR A;  2QA7 A;  3I9Y A;  4QXC B;  3AAA B;  4XBF B;  5EZY E;  4ADZ A;  2C5J A;  4KUM B;  4MFR A;  1CUN A;  4MLK A;  4H9P C;  4TN7 B;  2VK9 A;  4M1P A;  3K8P C;  3HKD E;  3C4Z A;  2LHR A;  1US7 B;  2XAS B;  5LOV E;  3IF8 B;  2V7J A;  2MBG A;  2V1D B;  1UX5 A;  4UVC B;  1WYC A;  2X67 A;  2CE7 A;  3UUX B;  3PTR B;  3C64 A;  3EDV A;  5HAX A;  3NBX X;  3DP7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...