1S94A

Crystal structure of the habc domain of neuronal syntaxin from the squid loligo pealei
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
121
structure length
109
Chain Sequence
GFMEEFFEQVEEIRAMIDKISDNVDAVKKKHSDILSMKEELEELMTDIKRTANKVRGKLKTIELNIEQEESADLRIRKTQYSTISRKFVEVMSDYNTTQIDYRDRCKAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the Habc domain of neuronal syntaxin from the squid Loligo pealei reveals conformational plasticity at its C-terminus
pubmed doi rcsb
source organism Loligo pealei
molecule tags Endocytosis/exocytosis
molecule keywords s-syntaxin
total genus 38
structure length 109
sequence length 121
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-02-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.70 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 1s94A00
1G73A 1FEWA 2DNXA 4JEUB 2XHEB 3LG7A 1HS7A 4JEHB 5LG4A 1S94A 1FIOA 4TX5A 3C98B 5M4YA 1BR0A 1EZ3A
chains in the Genus database with same CATH superfamily
4UF0B 3LBXA 4H9SE 4L5GA 4X1IE 2XHEB 1I94T 4IDZA 3G06A 3I0QA 3ZCIA 4JI8T 1W0BA 2QGSA 2BKPA 2MPKA 4TWHA 2WU5A 3UFGA 1XDOA 3C4XA 3F2EA 4M1PA 2VVSA 4TUYE 1DU2A 4Z90A 3RLFF 5LP6E 1SHZC 2QRXA 4NXNT 2VVNA 2X0HA 1QUUA 2XAFB 3KVBA 3ONLC 4TNWA 2EHOA 4QWNB 1VCSA 3ZT6A 5IUXA 4DO0A 4CI3B 2KMFA 2MAWA 2G0UA 3K3OA 1VCTA 3LK42 4OFZA 4YFSA 3R84B 5L3DB 3FBZA 1WYBA 4I43B 2D2SA 5KDMC 2B1EA 5GONE 2EHOB 5HXRA 1KNPA 2L9QA 4ZZCA 4DR6T 2IAKA 2OLTA 2Q9QD 2H7VC 3FBLA 4N78D 2DCFA 5AQTB 5KXJA 1AJ3A 4Z91A 2WDVA 3LK2B 1W0AA 1KF6A 3P4PA 5HWXA 3TLSA 2KZ7B 3AE6A 1BR0A 2HN2A 2GK9A 1N34T 4NXMT 2BG9E 3OPCA 1HCIA 4GIWA 4E7SA 4CXYA 4AI6A 2LRLA 1OXZA 4GYSA 2E5LT 4A98A 5FKYA 1WLXA 3O1HA 5HEGA 2X9YA 1UX4A 5BR8T 3OTOT 1HS7A 4UV9B 2UUCT 4UF0A 4CN4A 2WMNA 3EDVA 5JREA 2W66A 2YKSA 3RPUA 4B3TT 3M65A 2VKHA 4UVBB 2FJBA 3LSVA 3O1JA 5AQKB 4DBRA 5LJMA 5JDFA 3KV5A 4QH1A 4ZOLE 1I6ZA 3K1SA 2NP9A 5FVLA 2J4GA 4O4IE 3LG7A 2K3WA 5IYZE 2W67A 2XTLA 5FVKA 4EXTA 4ZI2C 3MXZA 1IZNB 4NPPA 2HH7A 5FXZA 4EIWA 1M62A 1VOMA 1XZYA 3KV4A 1MMNA 4EAHA 1LVKA 2CRBA 3PU8A 4X1YE 4IE0A 5LGNB 2BG9C 2X0YA 2XASB 4HWIB 4DR3T 1CHUA 5AQGB 4IDQA 2HPJA 3C4WA 4ILAA 4KUMB 5HCMA 4BA9A 3DP7A 3UU8A 4BJMA 4YSYA 5AQSB 4L0RA 3RH3A 3LJCA 5HXCA 2D9DA 3PV0F 4YTMA 4U7IA 5LOVE 4DUYT 4A5XA 1ZHCA 4F8HA 2RA1A 3NBXX 2WU2A 4HKAA 1D0XA 1MIVA 3RYFE 4ZI2D 4AKGA 2LM2A 4ZHQE 1UURA 3LFMA 2JJ9A 4IT4A 3PUZF 5JR9B 1J1JA 2UXNB 2LLYA 2V26A 2X9HA 3B13A 3CX6B 5DQVA 2BKOA 5F8PA 3ZT7A 4ZS3A 4YTNA 2ZMAA 3ZC0A 2C0SA 4I4TE 2JQQA 5LBMA 4MALA 2ACXA 1T7SA 3RQWA 2J47A 4QX7B 1D1BA 1MNDA 2LOSA 2XAJB 3IBPA 4EEBA 4XZCA 3AE9A 5J2TE 1HG2A 2WP9A 1G73A 3RC3A 2VKOA 3ZN1B 2B76A 3UU5A 4GYRA 2V5DA 3PUYF 2D0TA 4K0UA 5LHIB 5FYMA 3EABA 4GKJT 1HG5A 2W63A 2A2FX 2BG9A 2KWIB 5FP3A 4TV8E 5IHYA 2UXCT 3L3PA 5H6QB 2M6IA 2MBGA 3RF1A 4FJOA 5AQFB 2H88A 3CK6A 2XY8B 4IDNA 5AFUL 2E9XD 1D1AA 4GOUA 1O3XA 3IEEA 4HFIA 5L4HA 4YHHT 3O4XE 4TNVA 2UXBT 1KFYA 5L3BB 3AEBA 2DLRA 2W4XA 3EI0A 4JI3T 3SS1A 4PK4A 3ZMZB 2IUBA 4CN1A 2M6BA 1ZV4X 4PFPA 2A72A 2XJ7A 1G8XA 5ADXL 3JC6C 3RRCA 3CQGB 5F5WA 2XSAA 4NIQA 4LF9T 1T8BA 2CXLA 3NWIA 4TZ4C 3UUBA 5ABHA 3ZJ1A 2ZM2A 2XZEA 2YOEA 4DV7T 4LF7T 4ZXLA 1MMAA 2H3RA 4JEUB 2CLYC 3LBXB 3A7MA 1WR6A 1KNZA 2LSJA 3AAIA 2JQ9A 2BBHA 5ABEA 4AKIA 2V6YB 4X66T 4JI5T 1X79A 4YLHA 3ZCJA 2IDOB 1XWMA 2DI4A 3ZYLA 4YT0A 4H9PC 3HKCE 4DMWA 3NZQA 3AE7A 3N2KE 2E9XC 2V6YA 4UELA 2YDSA 5LGTB 3HL6A 3S4UA 3WI3A 4U2YA 3ZYMA 3D0TA 3RX6A 1U5PA 1ZOYA 2Q9QA 3U78A 3RHWA 2HN1A 3LDQB 4A97A 1T72A 2WQYA 2HHHT 2DWKA 2EHOC 2EHOD 4B3ST 2YINA 1BR1A 3L09A 1SUMB 4AQFC 1YXRA 2UU9T 1KEYA 1WR0A 4YY3T 3UQ4A 5L3CB 3ZMVB 2JPFA 2NW9A 2XQ7A 2KSRA 3PUWF 1S94A 2E5VA 5AQQB 5L4EA 1XMOT 4CXXA 2LRKA 3FXDB 4KHPT 2NTYA 5JRCA 4XAXB 5JR9C 4OK0A 1HF8A 4C90A 3RIUA 2YDQA 2SPCA 3C51A 3V5SA 4YTPA 1MIWA 5FL1A 3OYZA 5J0ZA 4EYUA 2M67A 4U31A 2H7OA 5AQHB 2PJQA 2XQYA 4U7YA 3TLWA 2BVLA 3HR0A 4AQYT 1JNZA 2E9XA 2I6HA 1KK7A 2LM9A 5FXVA 5DJQC 4IE7A 3TKLB 5CA1E 3T8OA 4DV6T 4UIGA 1E7PA 4LF6T 1S35A 2BBJA 2V1DB 3ANWB 3DTOA 1OEDA 3MK7C 3IA3A 3UUMA 4HTEA 4GK0E 1L0VA 2CCQA 3ZSTA 2IHR1 3FHNA 3ZYKA 4EYYR 5ABFB 2Z6EA 5LMUT 2CWYA 2IC9A 5JR9A 4JI2T 1NEKA 3CX7B 4KP3C 3N9PA 2CBJA 4WBOA 4HEAA 4TWFA 5KX5E 2WAUA 1HR0T 3Q5WA 2E8IA 1IBMT 4TN7B 5HCJA 3K3QC 5ETWA 2ACZA 3UULA 4UXNB 5LBQB 3ZEFB 3VKHA 3L39A 1YKHB 2I0MA 3UQ7A 2KLQA 4UVAB 3UFEA 1XNRT 1IJ5A 2FJEA 4TX5A 3P8CD 3N9MA 4ILBA 1ZP0A 1T98A 2CXDA 2OV9A 4IGUA 3SWHA 3AEDA 3AXJB 1US7B 2ZM8A 2CM0A 4KMCA 3VRBA 2V7IA 5C8YE 3MJXA 2WBLA 1J5WA 4MHCA 2IC6A 5JDHA 2C5KT 1WYCA 1E2AA 3I1AA 2WZHA 2XQ4A 2XPKA 2LKHA 3W15B 5HEHA 4JBWF 4LF4T 4EGWA 2LE8A 4AISA 4H63H 1Y64B 4V1Av 4OX9T 1BR2A 4I50E 4DNDA 2K24A 3FZHB 4AKHA 1FMVA 5FL0A 3QC9A 2HPLA 5L2LA 1W09A 4X20E 4LMLA 4DV2T 1UK5A 3AVRA 3FZLB 5EK3A 1N33T 1XMQT 2CPTA 3P4SA 4H9OC 5AQIB 2WB5A 1HFAA 5FY0A 3A5XA 5LHGB 3BQLA 3VU7H 1FMWA 2XAQB 3LK3B 2VWAA 3TLVA 3C4ZA 4KX6A 1WCRA 3AE2A 2V8SV 3NZPA 3AB3B 3JC6D 4O4HE 3H37A 4QKNA 3KBTA 1JNRA 4A56A 3RIFA 4CI1B 2ZLYA 2NTXA 2W0GA 2WS3A 3Q5XA 4FI5A 4PNIA 4PW8A 4YJ3E 5HXEA 3VKGA 2XSBA 3AA0B 2V7JA 3Q9DA 4HWHA 4CXWA 2BVMA 4WW0A 4IE6A 5HEJA 4OHFA 2WCAA 1NAFA 1KNRA 3N2GE 3N9LA 2JMHA 4QXCB 1UCUA 4F6RC 1E1HB 1UUSA 2LSYA 2P9BA 2X9XA 4E7ZA 3C64A 5FXWA 2FJAA 5AQPB 2VQET 1N32T 2VASA 3KV6A 3GA8A 2DNXA 3JCFA 4DIDB 2YN6A 2XM1A 4IDPA 2NR4A 4CZZB 4LF5T 4B6XA 2LT3A 3UU3A 4JI7T 3E08A 3ZSSA 1H7CA 2MTQA 4X1KE 2PTFA 3T1HT 2UUAT 4IL9A 5FMNA 5HEOA 3NVOA 1ZEEA 2QA7A 3M3ZB 1ZKEA 2BDEA 2C5JA 2CMRA 2XQ6A 5C2TA 3CX8B 3GMIA 4DV5T 3FZKB 4BJNA 5HYAA 4OYKA 5LJNA 4HFCA 3TLUA 4HGAA 4DV0T 5ABFA 2XM2A 4ILUA 4KBMB 3RYIE 4TWDA 3N2OA 3NRYA 2BS3A 3SFDA 3U3IA 4EEDA 3N5LA 1D0ZA 2CBIA 4K0KT 4ASKA 1N36T 3MZKB 3A8YC 4JI1T 1R8IA 2LHRA 5AQLB 4X62T 1Y01A 2CLYB 3AE4A 4P0BA 3UU4A 4PJLA 4HFEA 3ONXA 3VHLA 5EK4A 5LXTE 4MLKA 4ADZA 4P1NA 1V9DA 2QVAA 3KINB 4UR9A 2V5CA 3PURA 5AQMB 4U3CA 4X64T 2ES0A 4JYAT 5EK2A 3N9NA 4IHJE 3UUXB 3V5UA 2X68A 3CPZA 3KV9A 5TAOA 1YW0A 3OBVE 2WMOA 5AQUB 2BS2A 4O8SA 2YU2A 2W62A 3Q5EA 3ZJ2A 1MIYA 2W00A 3BQIA 3E0ZA 2FBWA 3PUQA 2IIUA 3CIRA 4O4LE 3F31A 5FY1A 3TLTA 3UT5E 2WWVA 3H3MA 4LFBT 2JQHA 1YQ4A 4IE5A 3P7IA 4HFDA 2MYSA 4ILCA 2RP4A 2KINB 5DQWA 4IREA 3X1DA 4CI2B 1SA0E 1XNQT 2V7LA 3DJBA 2MOZA 2N1GA 1LKXA 1QLBA 2VL0A 4YXDA 4QH5A 4EZHA 2KWHA 5JH7E 1UGOA 4Z8XA 3HKDE 2CEAA 3PUXF 3CQXC 4U74A 4X65T 4DV1T 4DV3T 4HN9A 2UUBT 2JRKA 2KNDA 5AQNB 3Q2MA 3QOFA 5DABA 4EB6E 4JV5T 4UV8B 4PJMA 2H89A 3C98B 5L47A 1IJ6A 1XDPA 2JQKA 2VURA 2X66A 3OYXA 4HWCA 5LG3A 3RC8A 3ABVA 2ODVA 3RKOA 4CN6A 3WAJA 2K5BB 4DR5T 3PUGA 3B5MA 3OJAA 1OWAA 2KXPB 4KI0F 3OKQA 4QX8B 3PE0A 3UUNA 5EZYE 3CVRA 5J2UE 5J1GA 4WBNE 4XBFB 1VRBA 4HFHA 4LMKA 4L9IA 1M7KA 1WFDA 3PUAA 4WYVA 1OEDC 2CHNA 1B7TA 3RRWA 4HWFA 3EVYA 2DWGA 3NKZA 2J1DG 2WSSV 3QNUA 3O9XA 2ODUA 2YDRA 4PJNA 5AQJB 4AKLA 2AXDS 2PFVA 2VL8A 2FJDA 3NRXA 3KDSE 5C3JA 3BK9A 4NUUA 2NW7A 3AA7B 2LSGA 3HKBE 1QSDA 3P4QA 4HE8A 5AQOB 2WZIA 5LNKA 3IF8B 4OYJA 4QHOA 2C5IT 4ERRA 5BMVE 4G63A 4QH4A 4C91A 5HXSA 1IBLT 3SOLA 1FJGT 4I0UA 3AAAB 2AE9A 5M4YA 4PFOA 2D0UA 4DMVA 4H9RC 2WY2A 2BKNA 3AEGA 4YHJA 5JDGA 2QYWA 4JUYA 3EDUA 3ZC1A 5KMGP 3PTRB 4HWDA 2E9XB 1LVFA 1MMGA 1NWMX 1SE7A 2K9AA 2XAGB 4H9QC 1HTJF 1WRDA 4ZI3C 2XQ8A 2Y8DA 5JDNA 4P0AA 4LFCT 3RQUA 2W61A 4DR4T 2VQFT 4HFBA 5A1LA 1OEDE 3PDYA 5LHHB 4U72A 3VRAA 3CWZB 3K3NA 3AVSA 2NWBA 4NUVA 2A9UA 5FXXA 3RGLA 2BS4A 3PJAJ 4YJ2E 5IWAT 3FB2A 4AIUA 3C50A 1W9RA 4H9NC 4IIJE 4PK5A 2LOPA 5HXHA 4DR2T 2N9DA 3QB5K 3CQCB 1D0YA 2K48A 5L3EB 4GKKT 4ZI3D 4LF8T 4JEHB 2PG8A 3AE5A 1MNEA 5AQRB 2IMLA 3ZMUB 3SRZA 3AEFA 2UXDT 4EOZB 3HI2A 3N9OA 4WZXA 4COFA 2YK0A 2JMKA 2ZM0A 3PJAA 4UEMA 2WWUA 3Q5DA 2RPAA 5E0OA 5LGUB 5CFBA 4MBQA 4ISSA 5LG4A 1HNZT 5ABGA 5HWYA 3RIUC 3L8RA 3CKDA 4YSXA 3AA1B 3KFWX 2X51A 2FUPA 3MKDA 3GN5A 2CE7A 4ANJA 2XQAA 1IAPA 2DHRA 2XQ5A 5FY7A 5F3JA 3P4RA 3RYCE 3AE1A 2X9WA 3ZN0B 3I0OA 4X5TA 2XQ9A 1YD8G 2WDQA 2YEVC 1U4QA 2V7KA 2Q9QC 2DL1A 4U33A 4WNKA 4UVCB 3ZT5A 4ZEYA 5CJ5A 4JI0T 1YQ3A 2F4VT 5JRCB 5JTGA 4DR7T 2W2UA 1Z0PA 1X9BA 2VB6A 2CHOA 3VR9A 3B57A 4ZZBA 2BG9B 2Y48B 3GN5B 5HAXA 1Z8UA 3K8PC 4BAYB 4O2AE 1HNWT 2I59A 4AQGA 1EZ3A 3EHZA 4O4JE 3IHRA 3HA4A 5JVDE 2WM9A 4HFVA 4P09A 5H6RB 5JDMA 4JI4T 4ZI7E 3E22E 1UX5A 3MA9A 5HEUA 3GWHA 4PJJA 1CUNA 3AEEA 3I9WA 3ETVA 4CQIA 3JADA 2E2AA 3RI5A 2N2NA 4AQFA 2PBIA 2VKJA 3N9QA 4LMJA 1FIOA 2JIWA 5CA0E 2NW8A 2CA5A 3BQKA 2LEHA 3UU6A 3PUSA 2VKDA 2LSIA 4GK5E 2LSKA 5JQGE 2LKGA 3ONJA 2ZM6T 2A3DA 4QXBB 1NENA 4ZS2A 2X67A 5FNVE 4H63V 3R6NA 3VR8A 4MFRA 3AAEB 3ZPOA 5LMNT 4B3RT 3P50A 3UTKA 4ISTA 4YSZA 4G2AA 3ANWA 2L3LA 4PAGA 3SFEA 4IL4A 4LFAT 4IE4A 3AXJA 4JLEA 1LRZA 5LB7B 1IBKT 3ZMSB 5LCYA 5L3FB 3EAMA 4Q25A 3WAKA 3ZMTB 5L3GB 3JAFA 4DV4T 1YKEB 2LJLA 3ESLA 3J9X1 2IW5B 3JAEA 3J7Yq 4EV6A 3AE3A 2Y6XA 3T1YT 3EUHA 3I9YA 2KT9A 2CXFA 2Q9QB 4J2CA 2V6XA 3AE8A 3ZKRA 4DBQA 5JDLA 3ETUA 2R6GF 4PK6A 4DUZT 2NOXA 5CB4E 1HX8A 2L8KA 2V7MA 3F57A 3QK6A 4AKRB 1GQEA 3FZFB 4KHZF 4AXPA 3FZMB 3PUVF 1D1CA 2LHNA 3RIAA 3FXEB 1FEWA 4I55E 4B3MT 1BR4A 5CGMA 3PU3A 4QXHB 2BZBA 4JI6T 2UXXB 4IDOA 2XUEA 3AEAA 3OVUA 4U2ZA 2D5UA 1OEDB 4O2BE 5JDQA 1HNXT 3QUJA 3O1IA 2X0LB 1MMDA 3KBUA 5LYJE 3KVAA 2XAHB 2XQ3A 2OA5A 3P4WA 4EZ4A 1HX1B 4TV9E 4DR1T 2CWOA 2VK9A 3AA6B 4DVDA 3H3AA 2WDRA 3CMLA 3ZLIA 1J5ET 3RKGA 2YU1A 3MACA 3HKEE 3QB5A 5AQVB 3RYHE 2J62A 5LA6E 3AECA
chains in the Genus database with same CATH topology
4UF0B 3LBXA 4H9SE 4L5GA 4X1IE 2XHEB 4IDZA 3I0QA 3ZCIA 2QGSA 3C4XA 3F2EA 4M1PA 4TUYE 5LP6E 1SHZC 3KVBA 1QUUA 2XAFB 2EHOA 4QWNB 1BR0A 4DO0A 4CI3B 2KMFA 3K3OA 2G0UA 4YFSA 3LK42 4OFZA 3R84B 5L3DB 3FBZA 1WYBA 4I43B 2D2SA 5KDMC 2B1EA 5GONE 2EHOB 5HXRA 2L9QA 2IAKA 2Q9QD 3FBLA 2H7VC 4N78D 2DCFA 1AJ3A 3LK2B 5HWXA 2KZ7B 5JRCA 2GK9A 1HCIA 4GIWA 4E7SA 4CXYA 1OXZA 4GYSA 1WLXA 3O1HA 2X9YA 1UX4A 4UV9B 4UF0A 2WMNA 3EDVA 5JREA 3RPUA 3M65A 2VKHA 4UVBB 3O1JA 4DBRA 5LJMA 5JDFA 3KV5A 4ZOLE 2NP9A 4O4IE 5IYZE 3LG7A 2XTLA 4ZI2C 4EXTA 3MXZA 1IZNB 2HH7A 5FXZA 4EIWA 1VOMA 3KV4A 1MMNA 4EAHA 1LVKA 3PU8A 4X1YE 4IE0A 5LGNB 2XASB 4KUMB 2HPJA 3C4WA 4BA9A 3DP7A 4BJMA 4L0RA 3RH3A 3LJCA 5HXCA 5LOVE 1ZHCA 2RA1A 3NBXX 4HKAA 1D0XA 1MIVA 3RYFE 4ZI2D 4AKGA 4ZHQE 3LFMA 2JJ9A 5JR9B 2UXNB 2V26A 3B13A 2X9HA 5DQVA 3CX6B 5F8PA 3ZC0A 4ZS3A 2ZMAA 2C0SA 4I4TE 2JQQA 5LBMA 4MALA 2ACXA 4QX7B 1D1BA 1MNDA 2LOSA 2XAJB 3IBPA 4XZCA 5J2TE 1HG2A 1G73A 3RC3A 2VKOA 3ZN1B 4GYRA 2D0TA 4K0UA 5LHIB 5FYMA 1HG5A 2W63A 2A2FX 2KWIB 5FP3A 4TV8E 5IHYA 3L3PA 5H6QB 2MBGA 4FJOA 5AFUL 2E9XD 1D1AA 4GOUA 1O3XA 3IEEA 3O4XE 5L3BB 2DLRA 3SS1A 4PK4A 3ZMZB 5ADXL 1ZV4X 4PFPA 2A72A 1G8XA 3JC6C 3RRCA 3CQGB 2CXLA 4TZ4C 3ZJ1A 2ZM2A 1MMAA 2H3RA 4JEUB 2CLYC 3LBXB 1WR6A 1KNZA 2LSJA 3AAIA 4AKIA 1X79A 4YLHA 3ZCJA 2DI4A 3ZYLA 4H9PC 3HKCE 4DMWA 3NZQA 3N2KE 2E9XC 4UELA 5LGTB 3HL6A 3S4UA 3WI3A 3ZYMA 3D0TA 3RX6A 1U5PA 2Q9QA 3U78A 2DWKA 2EHOC 2EHOD 2YINA 1BR1A 3L09A 4AQFC 5L3CB 2JPFA 2NW9A 1S94A 4CXXA 3FXDB 2NTYA 4XAXB 5JR9C 4OK0A 1HF8A 4C90A 2SPCA 3C51A 3V5SA 1MIWA 3OYZA 4EYUA 2M67A 2H7OA 2PJQA 2XQYA 2BVLA 3HR0A 2E9XA 1KK7A 2LM9A 5FXVA 5DJQC 4IE7A 3TKLB 5CA1E 3T8OA 4UIGA 1S35A 2V1DB 3DTOA 3ANWB 3MK7C 3UUMA 4HTEA 4GK0E 2CCQA 3FHNA 3ZYKA 4EYYR 2Z6EA 2CWYA 2IC9A 5JR9A 3CX7B 4KP3C 3N9PA 4WBOA 4HEAA 1HS7A 5KX5E 2WAUA 3Q5WA 2E8IA 4TN7B 3K3QC 5ETWA 3UULA 4UXNB 5LBQB 3ZEFB 3VKHA 1YKHB 2KLQA 4UVAB 3UFEA 1IJ5A 4TX5A 3P8CD 3N9MA 1T98A 2CXDA 4IGUA 3SWHA 1US7B 2ZM8A 2CM0A 4KMCA 5C8YE 2V7IA 3MJXA 2WBLA 4MHCA 2IC6A 5JDHA 2C5KT 1WYCA 3I1AA 3W15B 2LE8A 4H63H 1Y64B 4V1Av 1BR2A 4I50E 4DNDA 2K24A 4AKHA 1FMVA 3QC9A 2HPLA 5L2LA 4X20E 3AVRA 5EK3A 4H9OC 1HFAA 5FY0A 3A5XA 5LHGB 3BQLA 3VU7H 1FMWA 2XAQB 3LK3B 2VWAA 3C4ZA 3NZPA 3AB3B 3JC6D 4O4HE 3H37A 4QKNA 3KBTA 4A56A 4CI1B 2ZLYA 2NTXA 2W0GA 3Q5XA 4FI5A 4PNIA 4PW8A 5HXEA 4YJ3E 3VKGA 3AA0B 2V7JA 3Q9DA 4CXWA 2BVMA 4WW0A 4IE6A 4OHFA 4QXCB 1NAFA 3N2GE 3N9LA 2JMHA 4F6RC 1UCUA 1E1HB 2LSYA 2P9BA 2X9XA 4E7ZA 3C64A 5FXWA 2VASA 3KV6A 3GA8A 2DNXA 4CZZB 4B6XA 2LT3A 3E08A 1H7CA 2MTQA 4X1KE 5FMNA 1ZEEA 2QA7A 1ZKEA 2BDEA 2C5JA 2CMRA 3CX8B 3GMIA 5HYAA 4BJNA 4OYKA 5LJNA 4HGAA 4ILUA 4KBMB 3RYIE 3N2OA 3NRYA 3U3IA 3N5LA 1D0ZA 4ASKA 3MZKB 2LHRA 2CLYB 4P0BA 4PJLA 3ONXA 3VHLA 5EK4A 5LXTE 4MLKA 4ADZA 1V9DA 3KINB 3PURA 2ES0A 5EK2A 3N9NA 4IHJE 3UUXB 3V5UA 2X68A 3CPZA 3KV9A 5TAOA 1YW0A 3OBVE 2WMOA 3ZMVB 4O8SA 2YU2A 2W62A 3ZJ2A 1MIYA 2W00A 3BQIA 3E0ZA 3PUQA 4O4LE 5FY1A 3F31A 3UT5E 4IE5A 5DQWA 4AI6A 3P7IA 4CI2B 2MYSA 2RP4A 2KINB 1SA0E 2V7LA 3DJBA 2MOZA 2N1GA 1LKXA 4EZHA 2KWHA 5JH7E 4Z8XA 3HKDE 2CEAA 3CQXC 4U74A 4HN9A 2JRKA 2KNDA 4EB6E 3Q2MA 5DABA 4UV8B 4PJMA 3C98B 1IJ6A 3OYXA 2X66A 3RC8A 3RKOA 2ODVA 3WAJA 2K5BB 3PUGA 3OJAA 1OWAA 2KXPB 4QX8B 3OKQA 5J2UE 3PE0A 3UUNA 5EZYE 3CVRA 4XBFB 5J1GA 4WBNE 1VRBA 4L9IA 3PUAA 3RRWA 1B7TA 3EVYA 2DWGA 2J1DG 2WSSV 3O9XA 2ODUA 4PJNA 4AKLA 2PFVA 2VL8A 3NRXA 3KDSE 3BK9A 4NUUA 3AA7B 2NW7A 2LSGA 3HKBE 1QSDA 4HE8A 5LNKA 3IF8B 4OYJA 4QHOA 2C5IT 4ERRA 5BMVE 4G63A 4C91A 5HXSA 3SOLA 3AAAB 5M4YA 4PFOA 2D0UA 4DMVA 4H9RC 4YHJA 5JDGA 4JUYA 3EDUA 3ZC1A 5KMGP 3PTRB 2E9XB 1LVFA 1MMGA 1NWMX 2K9AA 2XAGB 4H9QC 1HTJF 1WRDA 4ZI3C 2Y8DA 5JDNA 4P0AA 2W61A 5A1LA 5LHHB 3PDYA 4U72A 3CWZB 3K3NA 3AVSA 2NWBA 4NUVA 5FXXA 4YJ2E 3FB2A 3C50A 4H9NC 4IIJE 4PK5A 2LOPA 5HXHA 2N9DA 3CQCB 1D0YA 2K48A 5L3EB 4ZI3D 4JEHB 2PG8A 1MNEA 3ZMUB 3SRZA 4EOZB 3HI2A 3N9OA 2YK0A 2JMKA 2ZM0A 4UEMA 2WWUA 5E0OA 5LGUB 4MBQA 4ISSA 5LG4A 5HWYA 3CKDA 3AA1B 3KFWX 2X51A 3MKDA 3GN5A 2CE7A 4ANJA 1IAPA 2DHRA 5FY7A 5F3JA 3RYCE 2X9WA 3ZN0B 3I0OA 2YEVC 1YD8G 4AQGA 1U4QA 2V7KA 2Q9QC 4WNKA 4UVCB 5JRCB 1Z0PA 2VB6A 3B57A 2Y48B 3GN5B 5HAXA 3K8PC 4BAYB 4O2AE 2I59A 1EZ3A 4O4JE 3IHRA 3HA4A 5JVDE 2WM9A 4HFVA 4P09A 5H6RB 5JDMA 4ZI7E 3E22E 1UX5A 3MA9A 3GWHA 4PJJA 1CUNA 3I9WA 3ETVA 4CQIA 4AQFA 2N2NA 2PBIA 2VKJA 3N9QA 1FIOA 5CA0E 2NW8A 2CA5A 3BQKA 2LEHA 3PUSA 2VKDA 2LSIA 4GK5E 2LSKA 5JQGE 2A3DA 4QXBB 4ZS2A 5FNVE 2X67A 3R6NA 4H63V 4MFRA 3AAEB 3ZPOA 3UTKA 4ISTA 4G2AA 3ANWA 2L3LA 4PAGA 4IE4A 4JLEA 1LRZA 3ZMSB 5LCYA 5L3FB 3WAKA 3ZMTB 5L3GB 1YKEB 2LJLA 3ESLA 3J9X1 2IW5B 3J7Yq 2Y6XA 3EUHA 3I9YA 2KT9A 2CXFA 2Q9QB 4J2CA 4DBQA 5JDLA 3ETUA 4PK6A 2NOXA 5CB4E 3F57A 1HX8A 2L8KA 2V7MA 3QK6A 4AKRB 4AXPA 1D1CA 2LHNA 3FXEB 1FEWA 4I55E 1BR4A 3PU3A 4QXHB 2BZBA 2UXXB 2XUEA 2D5UA 4O2BE 5JDQA 3QUJA 3O1IA 2X0LB 1MMDA 3KBUA 5LYJE 3KVAA 2XAHB 4EZ4A 2OA5A 4TV9E 2CWOA 2VK9A 3AA6B 4DVDA 3H3AA 3CMLA 3ZLIA 2YU1A 3MACA 3HKEE 3RYHE 5LA6E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1G73 A;  1FEW A;  2DNX A;  4JEU B;  2XHE B;  3LG7 A;  1HS7 A;  4JEH B;  5LG4 A;  1S94 A;  1FIO A;  4TX5 A;  3C98 B;  5M4Y A;  1BR0 A;  1EZ3 A; 
#chains in the Genus database with same CATH topology
 4UF0 B;  3LBX A;  4H9S E;  4L5G A;  4X1I E;  2XHE B;  1I94 T;  4IDZ A;  3G06 A;  3I0Q A;  3ZCI A;  4JI8 T;  1W0B A;  2QGS A;  2BKP A;  2MPK A;  4TWH A;  2WU5 A;  3UFG A;  1XDO A;  3C4X A;  3F2E A;  4M1P A;  2VVS A;  4TUY E;  1DU2 A;  4Z90 A;  3RLF F;  5LP6 E;  1SHZ C;  2QRX A;  4NXN T;  2VVN A;  2X0H A;  1QUU A;  2XAF B;  3KVB A;  3ONL C;  4TNW A;  2EHO A;  4QWN B;  1VCS A;  3ZT6 A;  5IUX A;  4DO0 A;  4CI3 B;  2KMF A;  2MAW A;  2G0U A;  3K3O A;  1VCT A;  3LK4 2;  4OFZ A;  4YFS A;  3R84 B;  5L3D B;  3FBZ A;  1WYB A;  4I43 B;  2D2S A;  5KDM C;  2B1E A;  5GON E;  2EHO B;  5HXR A;  1KNP A;  2L9Q A;  4ZZC A;  4DR6 T;  2IAK A;  2OLT A;  2Q9Q D;  2H7V C;  3FBL A;  4N78 D;  2DCF A;  5AQT B;  5KXJ A;  1AJ3 A;  4Z91 A;  2WDV A;  3LK2 B;  1W0A A;  1KF6 A;  3P4P A;  5HWX A;  3TLS A;  2KZ7 B;  3AE6 A;  1BR0 A;  2HN2 A;  2GK9 A;  1N34 T;  4NXM T;  2BG9 E;  3OPC A;  1HCI A;  4GIW A;  4E7S A;  4CXY A;  4AI6 A;  2LRL A;  1OXZ A;  4GYS A;  2E5L T;  4A98 A;  5FKY A;  1WLX A;  3O1H A;  5HEG A;  2X9Y A;  1UX4 A;  5BR8 T;  3OTO T;  1HS7 A;  4UV9 B;  2UUC T;  4UF0 A;  4CN4 A;  2WMN A;  3EDV A;  5JRE A;  2W66 A;  2YKS A;  3RPU A;  4B3T T;  3M65 A;  2VKH A;  4UVB B;  2FJB A;  3LSV A;  3O1J A;  5AQK B;  4DBR A;  5LJM A;  5JDF A;  3KV5 A;  4QH1 A;  4ZOL E;  1I6Z A;  3K1S A;  2NP9 A;  5FVL A;  2J4G A;  4O4I E;  3LG7 A;  2K3W A;  5IYZ E;  2W67 A;  2XTL A;  5FVK A;  4EXT A;  4ZI2 C;  3MXZ A;  1IZN B;  4NPP A;  2HH7 A;  5FXZ A;  4EIW A;  1M62 A;  1VOM A;  1XZY A;  3KV4 A;  1MMN A;  4EAH A;  1LVK A;  2CRB A;  3PU8 A;  4X1Y E;  4IE0 A;  5LGN B;  2BG9 C;  2X0Y A;  2XAS B;  4HWI B;  4DR3 T;  1CHU A;  5AQG B;  4IDQ A;  2HPJ A;  3C4W A;  4ILA A;  4KUM B;  5HCM A;  4BA9 A;  3DP7 A;  3UU8 A;  4BJM A;  4YSY A;  5AQS B;  4L0R A;  3RH3 A;  3LJC A;  5HXC A;  2D9D A;  3PV0 F;  4YTM A;  4U7I A;  5LOV E;  4DUY T;  4A5X A;  1ZHC A;  4F8H A;  2RA1 A;  3NBX X;  2WU2 A;  4HKA A;  1D0X A;  1MIV A;  3RYF E;  4ZI2 D;  4AKG A;  2LM2 A;  4ZHQ E;  1UUR A;  3LFM A;  2JJ9 A;  4IT4 A;  3PUZ F;  5JR9 B;  1J1J A;  2UXN B;  2LLY A;  2V26 A;  2X9H A;  3B13 A;  3CX6 B;  5DQV A;  2BKO A;  5F8P A;  3ZT7 A;  4ZS3 A;  4YTN A;  2ZMA A;  3ZC0 A;  2C0S A;  4I4T E;  2JQQ A;  5LBM A;  4MAL A;  2ACX A;  1T7S A;  3RQW A;  2J47 A;  4QX7 B;  1D1B A;  1MND A;  2LOS A;  2XAJ B;  3IBP A;  4EEB A;  4XZC A;  3AE9 A;  5J2T E;  1HG2 A;  2WP9 A;  1G73 A;  3RC3 A;  2VKO A;  3ZN1 B;  2B76 A;  3UU5 A;  4GYR A;  2V5D A;  3PUY F;  2D0T A;  4K0U A;  5LHI B;  5FYM A;  3EAB A;  4GKJ T;  1HG5 A;  2W63 A;  2A2F X;  2BG9 A;  2KWI B;  5FP3 A;  4TV8 E;  5IHY A;  2UXC T;  3L3P A;  5H6Q B;  2M6I A;  2MBG A;  3RF1 A;  4FJO A;  5AQF B;  2H88 A;  3CK6 A;  2XY8 B;  4IDN A;  5AFU L;  2E9X D;  1D1A A;  4GOU A;  1O3X A;  3IEE A;  4HFI A;  5L4H A;  4YHH T;  3O4X E;  4TNV A;  2UXB T;  1KFY A;  5L3B B;  3AEB A;  2DLR A;  2W4X A;  3EI0 A;  4JI3 T;  3SS1 A;  4PK4 A;  3ZMZ B;  2IUB A;  4CN1 A;  2M6B A;  1ZV4 X;  4PFP A;  2A72 A;  2XJ7 A;  1G8X A;  5ADX L;  3JC6 C;  3RRC A;  3CQG B;  5F5W A;  2XSA A;  4NIQ A;  4LF9 T;  1T8B A;  2CXL A;  3NWI A;  4TZ4 C;  3UUB A;  5ABH A;  3ZJ1 A;  2ZM2 A;  2XZE A;  2YOE A;  4DV7 T;  4LF7 T;  4ZXL A;  1MMA A;  2H3R A;  4JEU B;  2CLY C;  3LBX B;  3A7M A;  1WR6 A;  1KNZ A;  2LSJ A;  3AAI A;  2JQ9 A;  2BBH A;  5ABE A;  4AKI A;  2V6Y B;  4X66 T;  4JI5 T;  1X79 A;  4YLH A;  3ZCJ A;  2IDO B;  1XWM A;  2DI4 A;  3ZYL A;  4YT0 A;  4H9P C;  3HKC E;  4DMW A;  3NZQ A;  3AE7 A;  3N2K E;  2E9X C;  2V6Y A;  4UEL A;  2YDS A;  5LGT B;  3HL6 A;  3S4U A;  3WI3 A;  4U2Y A;  3ZYM A;  3D0T A;  3RX6 A;  1U5P A;  1ZOY A;  2Q9Q A;  3U78 A;  3RHW A;  2HN1 A;  3LDQ B;  4A97 A;  1T72 A;  2WQY A;  2HHH T;  2DWK A;  2EHO C;  2EHO D;  4B3S T;  2YIN A;  1BR1 A;  3L09 A;  1SUM B;  4AQF C;  1YXR A;  2UU9 T;  1KEY A;  1WR0 A;  4YY3 T;  3UQ4 A;  5L3C B;  3ZMV B;  2JPF A;  2NW9 A;  2XQ7 A;  2KSR A;  3PUW F;  1S94 A;  2E5V A;  5AQQ B;  5L4E A;  1XMO T;  4CXX A;  2LRK A;  3FXD B;  4KHP T;  2NTY A;  5JRC A;  4XAX B;  5JR9 C;  4OK0 A;  1HF8 A;  4C90 A;  3RIU A;  2YDQ A;  2SPC A;  3C51 A;  3V5S A;  4YTP A;  1MIW A;  5FL1 A;  3OYZ A;  5J0Z A;  4EYU A;  2M67 A;  4U31 A;  2H7O A;  5AQH B;  2PJQ A;  2XQY A;  4U7Y A;  3TLW A;  2BVL A;  3HR0 A;  4AQY T;  1JNZ A;  2E9X A;  2I6H A;  1KK7 A;  2LM9 A;  5FXV A;  5DJQ C;  4IE7 A;  3TKL B;  5CA1 E;  3T8O A;  4DV6 T;  4UIG A;  1E7P A;  4LF6 T;  1S35 A;  2BBJ A;  2V1D B;  3ANW B;  3DTO A;  1OED A;  3MK7 C;  3IA3 A;  3UUM A;  4HTE A;  4GK0 E;  1L0V A;  2CCQ A;  3ZST A;  2IHR 1;  3FHN A;  3ZYK A;  4EYY R;  5ABF B;  2Z6E A;  5LMU T;  2CWY A;  2IC9 A;  5JR9 A;  4JI2 T;  1NEK A;  3CX7 B;  4KP3 C;  3N9P A;  2CBJ A;  4WBO A;  4HEA A;  4TWF A;  5KX5 E;  2WAU A;  1HR0 T;  3Q5W A;  2E8I A;  1IBM T;  4TN7 B;  5HCJ A;  3K3Q C;  5ETW A;  2ACZ A;  3UUL A;  4UXN B;  5LBQ B;  3ZEF B;  3VKH A;  3L39 A;  1YKH B;  2I0M A;  3UQ7 A;  2KLQ A;  4UVA B;  3UFE A;  1XNR T;  1IJ5 A;  2FJE A;  4TX5 A;  3P8C D;  3N9M A;  4ILB A;  1ZP0 A;  1T98 A;  2CXD A;  2OV9 A;  4IGU A;  3SWH A;  3AED A;  3AXJ B;  1US7 B;  2ZM8 A;  2CM0 A;  4KMC A;  3VRB A;  2V7I A;  5C8Y E;  3MJX A;  2WBL A;  1J5W A;  4MHC A;  2IC6 A;  5JDH A;  2C5K T;  1WYC A;  1E2A A;  3I1A A;  2WZH A;  2XQ4 A;  2XPK A;  2LKH A;  3W15 B;  5HEH A;  4JBW F;  4LF4 T;  4EGW A;  2LE8 A;  4AIS A;  4H63 H;  1Y64 B;  4V1A v;  4OX9 T;  1BR2 A;  4I50 E;  4DND A;  2K24 A;  3FZH B;  4AKH A;  1FMV A;  5FL0 A;  3QC9 A;  2HPL A;  5L2L A;  1W09 A;  4X20 E;  4LML A;  4DV2 T;  1UK5 A;  3AVR A;  3FZL B;  5EK3 A;  1N33 T;  1XMQ T;  2CPT A;  3P4S A;  4H9O C;  5AQI B;  2WB5 A;  1HFA A;  5FY0 A;  3A5X A;  5LHG B;  3BQL A;  3VU7 H;  1FMW A;  2XAQ B;  3LK3 B;  2VWA A;  3TLV A;  3C4Z A;  4KX6 A;  1WCR A;  3AE2 A;  2V8S V;  3NZP A;  3AB3 B;  3JC6 D;  4O4H E;  3H37 A;  4QKN A;  3KBT A;  1JNR A;  4A56 A;  3RIF A;  4CI1 B;  2ZLY A;  2NTX A;  2W0G A;  2WS3 A;  3Q5X A;  4FI5 A;  4PNI A;  4PW8 A;  4YJ3 E;  5HXE A;  3VKG A;  2XSB A;  3AA0 B;  2V7J A;  3Q9D A;  4HWH A;  4CXW A;  2BVM A;  4WW0 A;  4IE6 A;  5HEJ A;  4OHF A;  2WCA A;  1NAF A;  1KNR A;  3N2G E;  3N9L A;  2JMH A;  4QXC B;  1UCU A;  4F6R C;  1E1H B;  1UUS A;  2LSY A;  2P9B A;  2X9X A;  4E7Z A;  3C64 A;  5FXW A;  2FJA A;  5AQP B;  2VQE T;  1N32 T;  2VAS A;  3KV6 A;  3GA8 A;  2DNX A;  3JCF A;  4DID B;  2YN6 A;  2XM1 A;  4IDP A;  2NR4 A;  4CZZ B;  4LF5 T;  4B6X A;  2LT3 A;  3UU3 A;  4JI7 T;  3E08 A;  3ZSS A;  1H7C A;  2MTQ A;  4X1K E;  2PTF A;  3T1H T;  2UUA T;  4IL9 A;  5FMN A;  5HEO A;  3NVO A;  1ZEE A;  2QA7 A;  3M3Z B;  1ZKE A;  2BDE A;  2C5J A;  2CMR A;  2XQ6 A;  5C2T A;  3CX8 B;  3GMI A;  4DV5 T;  3FZK B;  4BJN A;  5HYA A;  4OYK A;  5LJN A;  4HFC A;  3TLU A;  4HGA A;  4DV0 T;  5ABF A;  2XM2 A;  4ILU A;  4KBM B;  3RYI E;  4TWD A;  3N2O A;  3NRY A;  2BS3 A;  3SFD A;  3U3I A;  4EED A;  3N5L A;  1D0Z A;  2CBI A;  4K0K T;  4ASK A;  1N36 T;  3MZK B;  3A8Y C;  4JI1 T;  1R8I A;  2LHR A;  5AQL B;  4X62 T;  1Y01 A;  2CLY B;  3AE4 A;  4P0B A;  3UU4 A;  4PJL A;  4HFE A;  3ONX A;  3VHL A;  5EK4 A;  5LXT E;  4MLK A;  4ADZ A;  4P1N A;  1V9D A;  2QVA A;  3KIN B;  4UR9 A;  2V5C A;  3PUR A;  5AQM B;  4U3C A;  4X64 T;  2ES0 A;  4JYA T;  5EK2 A;  3N9N A;  4IHJ E;  3UUX B;  3V5U A;  2X68 A;  3CPZ A;  3KV9 A;  5TAO A;  1YW0 A;  3OBV E;  2WMO A;  5AQU B;  2BS2 A;  4O8S A;  2YU2 A;  2W62 A;  3Q5E A;  3ZJ2 A;  1MIY A;  2W00 A;  3BQI A;  3E0Z A;  2FBW A;  3PUQ A;  2IIU A;  3CIR A;  4O4L E;  3F31 A;  5FY1 A;  3TLT A;  3UT5 E;  2WWV A;  3H3M A;  4LFB T;  2JQH A;  1YQ4 A;  4IE5 A;  3P7I A;  4HFD A;  2MYS A;  4ILC A;  2RP4 A;  2KIN B;  5DQW A;  4IRE A;  3X1D A;  4CI2 B;  1SA0 E;  1XNQ T;  2V7L A;  3DJB A;  2MOZ A;  2N1G A;  1LKX A;  1QLB A;  2VL0 A;  4YXD A;  4QH5 A;  4EZH A;  2KWH A;  5JH7 E;  1UGO A;  4Z8X A;  3HKD E;  2CEA A;  3PUX F;  3CQX C;  4U74 A;  4X65 T;  4DV1 T;  4DV3 T;  4HN9 A;  2UUB T;  2JRK A;  2KND A;  5AQN B;  3Q2M A;  3QOF A;  5DAB A;  4EB6 E;  4JV5 T;  4UV8 B;  4PJM A;  2H89 A;  3C98 B;  5L47 A;  1IJ6 A;  1XDP A;  2JQK A;  2VUR A;  2X66 A;  3OYX A;  4HWC A;  5LG3 A;  3RC8 A;  3ABV A;  2ODV A;  3RKO A;  4CN6 A;  3WAJ A;  2K5B B;  4DR5 T;  3PUG A;  3B5M A;  3OJA A;  1OWA A;  2KXP B;  4KI0 F;  3OKQ A;  4QX8 B;  3PE0 A;  3UUN A;  5EZY E;  3CVR A;  5J2U E;  5J1G A;  4WBN E;  4XBF B;  1VRB A;  4HFH A;  4LMK A;  4L9I A;  1M7K A;  1WFD A;  3PUA A;  4WYV A;  1OED C;  2CHN A;  1B7T A;  3RRW A;  4HWF A;  3EVY A;  2DWG A;  3NKZ A;  2J1D G;  2WSS V;  3QNU A;  3O9X A;  2ODU A;  2YDR A;  4PJN A;  5AQJ B;  4AKL A;  2AXD S;  2PFV A;  2VL8 A;  2FJD A;  3NRX A;  3KDS E;  5C3J A;  3BK9 A;  4NUU A;  2NW7 A;  3AA7 B;  2LSG A;  3HKB E;  1QSD A;  3P4Q A;  4HE8 A;  5AQO B;  2WZI A;  5LNK A;  3IF8 B;  4OYJ A;  4QHO A;  2C5I T;  4ERR A;  5BMV E;  4G63 A;  4QH4 A;  4C91 A;  5HXS A;  1IBL T;  3SOL A;  1FJG T;  4I0U A;  3AAA B;  2AE9 A;  5M4Y A;  4PFO A;  2D0U A;  4DMV A;  4H9R C;  2WY2 A;  2BKN A;  3AEG A;  4YHJ A;  5JDG A;  2QYW A;  4JUY A;  3EDU A;  3ZC1 A;  5KMG P;  3PTR B;  4HWD A;  2E9X B;  1LVF A;  1MMG A;  1NWM X;  1SE7 A;  2K9A A;  2XAG B;  4H9Q C;  1HTJ F;  1WRD A;  4ZI3 C;  2XQ8 A;  2Y8D A;  5JDN A;  4P0A A;  4LFC T;  3RQU A;  2W61 A;  4DR4 T;  2VQF T;  4HFB A;  5A1L A;  1OED E;  3PDY A;  5LHH B;  4U72 A;  3VRA A;  3CWZ B;  3K3N A;  3AVS A;  2NWB A;  4NUV A;  2A9U A;  5FXX A;  3RGL A;  2BS4 A;  3PJA J;  4YJ2 E;  5IWA T;  3FB2 A;  4AIU A;  3C50 A;  1W9R A;  4H9N C;  4IIJ E;  4PK5 A;  2LOP A;  5HXH A;  4DR2 T;  2N9D A;  3QB5 K;  3CQC B;  1D0Y A;  2K48 A;  5L3E B;  4GKK T;  4ZI3 D;  4LF8 T;  4JEH B;  2PG8 A;  3AE5 A;  1MNE A;  5AQR B;  2IML A;  3ZMU B;  3SRZ A;  3AEF A;  2UXD T;  4EOZ B;  3HI2 A;  3N9O A;  4WZX A;  4COF A;  2YK0 A;  2JMK A;  2ZM0 A;  3PJA A;  4UEM A;  2WWU A;  3Q5D A;  2RPA A;  5E0O A;  5LGU B;  5CFB A;  4MBQ A;  4ISS A;  5LG4 A;  1HNZ T;  5ABG A;  5HWY A;  3RIU C;  3L8R A;  3CKD A;  4YSX A;  3AA1 B;  3KFW X;  2X51 A;  2FUP A;  3MKD A;  3GN5 A;  2CE7 A;  4ANJ A;  2XQA A;  1IAP A;  2DHR A;  2XQ5 A;  5FY7 A;  5F3J A;  3P4R A;  3RYC E;  3AE1 A;  2X9W A;  3ZN0 B;  3I0O A;  4X5T A;  2XQ9 A;  1YD8 G;  2WDQ A;  2YEV C;  1U4Q A;  2V7K A;  2Q9Q C;  2DL1 A;  4U33 A;  4WNK A;  4UVC B;  3ZT5 A;  4ZEY A;  5CJ5 A;  4JI0 T;  1YQ3 A;  2F4V T;  5JRC B;  5JTG A;  4DR7 T;  2W2U A;  1Z0P A;  1X9B A;  2VB6 A;  2CHO A;  3VR9 A;  3B57 A;  4ZZB A;  2BG9 B;  2Y48 B;  3GN5 B;  5HAX A;  1Z8U A;  3K8P C;  4BAY B;  4O2A E;  1HNW T;  2I59 A;  4AQG A;  1EZ3 A;  3EHZ A;  4O4J E;  3IHR A;  3HA4 A;  5JVD E;  2WM9 A;  4HFV A;  4P09 A;  5H6R B;  5JDM A;  4JI4 T;  4ZI7 E;  3E22 E;  1UX5 A;  3MA9 A;  5HEU A;  3GWH A;  4PJJ A;  1CUN A;  3AEE A;  3I9W A;  3ETV A;  4CQI A;  3JAD A;  2E2A A;  3RI5 A;  2N2N A;  4AQF A;  2PBI A;  2VKJ A;  3N9Q A;  4LMJ A;  1FIO A;  2JIW A;  5CA0 E;  2NW8 A;  2CA5 A;  3BQK A;  2LEH A;  3UU6 A;  3PUS A;  2VKD A;  2LSI A;  4GK5 E;  2LSK A;  5JQG E;  2LKG A;  3ONJ A;  2ZM6 T;  2A3D A;  4QXB B;  1NEN A;  4ZS2 A;  2X67 A;  5FNV E;  4H63 V;  3R6N A;  3VR8 A;  4MFR A;  3AAE B;  3ZPO A;  5LMN T;  4B3R T;  3P50 A;  3UTK A;  4IST A;  4YSZ A;  4G2A A;  3ANW A;  2L3L A;  4PAG A;  3SFE A;  4IL4 A;  4LFA T;  4IE4 A;  3AXJ A;  4JLE A;  1LRZ A;  5LB7 B;  1IBK T;  3ZMS B;  5LCY A;  5L3F B;  3EAM A;  4Q25 A;  3WAK A;  3ZMT B;  5L3G B;  3JAF A;  4DV4 T;  1YKE B;  2LJL A;  3ESL A;  3J9X 1;  2IW5 B;  3JAE A;  3J7Y q;  4EV6 A;  3AE3 A;  2Y6X A;  3T1Y T;  3EUH A;  3I9Y A;  2KT9 A;  2CXF A;  2Q9Q B;  4J2C A;  2V6X A;  3AE8 A;  3ZKR A;  4DBQ A;  5JDL A;  3ETU A;  2R6G F;  4PK6 A;  4DUZ T;  2NOX A;  5CB4 E;  1HX8 A;  2L8K A;  2V7M A;  3F57 A;  3QK6 A;  4AKR B;  1GQE A;  3FZF B;  4KHZ F;  4AXP A;  3FZM B;  3PUV F;  1D1C A;  2LHN A;  3RIA A;  3FXE B;  1FEW A;  4I55 E;  4B3M T;  1BR4 A;  5CGM A;  3PU3 A;  4QXH B;  2BZB A;  4JI6 T;  2UXX B;  4IDO A;  2XUE A;  3AEA A;  3OVU A;  4U2Z A;  2D5U A;  1OED B;  4O2B E;  5JDQ A;  1HNX T;  3QUJ A;  3O1I A;  2X0L B;  1MMD A;  3KBU A;  5LYJ E;  3KVA A;  2XAH B;  2XQ3 A;  2OA5 A;  3P4W A;  4EZ4 A;  1HX1 B;  4TV9 E;  4DR1 T;  2CWO A;  2VK9 A;  3AA6 B;  4DVD A;  3H3A A;  2WDR A;  3CML A;  3ZLI A;  1J5E T;  3RKG A;  2YU1 A;  3MAC A;  3HKE E;  3QB5 A;  5AQV B;  3RYH E;  2J62 A;  5LA6 E;  3AEC A; 
#chains in the Genus database with same CATH homology
 4UF0 B;  3LBX A;  4H9S E;  4L5G A;  4X1I E;  2XHE B;  4IDZ A;  3I0Q A;  3ZCI A;  2QGS A;  3C4X A;  3F2E A;  4M1P A;  4TUY E;  5LP6 E;  1SHZ C;  3KVB A;  1QUU A;  2XAF B;  2EHO A;  4QWN B;  1BR0 A;  4DO0 A;  4CI3 B;  2KMF A;  3K3O A;  2G0U A;  4YFS A;  3LK4 2;  4OFZ A;  3R84 B;  5L3D B;  3FBZ A;  1WYB A;  4I43 B;  2D2S A;  5KDM C;  2B1E A;  5GON E;  2EHO B;  5HXR A;  2L9Q A;  2IAK A;  2Q9Q D;  3FBL A;  2H7V C;  4N78 D;  2DCF A;  1AJ3 A;  3LK2 B;  5HWX A;  2KZ7 B;  5JRC A;  2GK9 A;  1HCI A;  4GIW A;  4E7S A;  4CXY A;  1OXZ A;  4GYS A;  1WLX A;  3O1H A;  2X9Y A;  1UX4 A;  4UV9 B;  4UF0 A;  2WMN A;  3EDV A;  5JRE A;  3RPU A;  3M65 A;  2VKH A;  4UVB B;  3O1J A;  4DBR A;  5LJM A;  5JDF A;  3KV5 A;  4ZOL E;  2NP9 A;  4O4I E;  5IYZ E;  3LG7 A;  2XTL A;  4ZI2 C;  4EXT A;  3MXZ A;  1IZN B;  2HH7 A;  5FXZ A;  4EIW A;  1VOM A;  3KV4 A;  1MMN A;  4EAH A;  1LVK A;  3PU8 A;  4X1Y E;  4IE0 A;  5LGN B;  2XAS B;  4KUM B;  2HPJ A;  3C4W A;  4BA9 A;  3DP7 A;  4BJM A;  4L0R A;  3RH3 A;  3LJC A;  5HXC A;  5LOV E;  1ZHC A;  2RA1 A;  3NBX X;  4HKA A;  1D0X A;  1MIV A;  3RYF E;  4ZI2 D;  4AKG A;  4ZHQ E;  3LFM A;  2JJ9 A;  5JR9 B;  2UXN B;  2V26 A;  3B13 A;  2X9H A;  5DQV A;  3CX6 B;  5F8P A;  3ZC0 A;  4ZS3 A;  2ZMA A;  2C0S A;  4I4T E;  2JQQ A;  5LBM A;  4MAL A;  2ACX A;  4QX7 B;  1D1B A;  1MND A;  2LOS A;  2XAJ B;  3IBP A;  4XZC A;  5J2T E;  1HG2 A;  1G73 A;  3RC3 A;  2VKO A;  3ZN1 B;  4GYR A;  2D0T A;  4K0U A;  5LHI B;  5FYM A;  1HG5 A;  2W63 A;  2A2F X;  2KWI B;  5FP3 A;  4TV8 E;  5IHY A;  3L3P A;  5H6Q B;  2MBG A;  4FJO A;  5AFU L;  2E9X D;  1D1A A;  4GOU A;  1O3X A;  3IEE A;  3O4X E;  5L3B B;  2DLR A;  3SS1 A;  4PK4 A;  3ZMZ B;  5ADX L;  1ZV4 X;  4PFP A;  2A72 A;  1G8X A;  3JC6 C;  3RRC A;  3CQG B;  2CXL A;  4TZ4 C;  3ZJ1 A;  2ZM2 A;  1MMA A;  2H3R A;  4JEU B;  2CLY C;  3LBX B;  1WR6 A;  1KNZ A;  2LSJ A;  3AAI A;  4AKI A;  1X79 A;  4YLH A;  3ZCJ A;  2DI4 A;  3ZYL A;  4H9P C;  3HKC E;  4DMW A;  3NZQ A;  3N2K E;  2E9X C;  4UEL A;  5LGT B;  3HL6 A;  3S4U A;  3WI3 A;  3ZYM A;  3D0T A;  3RX6 A;  1U5P A;  2Q9Q A;  3U78 A;  2DWK A;  2EHO C;  2EHO D;  2YIN A;  1BR1 A;  3L09 A;  4AQF C;  5L3C B;  2JPF A;  2NW9 A;  1S94 A;  4CXX A;  3FXD B;  2NTY A;  4XAX B;  5JR9 C;  4OK0 A;  1HF8 A;  4C90 A;  2SPC A;  3C51 A;  3V5S A;  1MIW A;  3OYZ A;  4EYU A;  2M67 A;  2H7O A;  2PJQ A;  2XQY A;  2BVL A;  3HR0 A;  2E9X A;  1KK7 A;  2LM9 A;  5FXV A;  5DJQ C;  4IE7 A;  3TKL B;  5CA1 E;  3T8O A;  4UIG A;  1S35 A;  2V1D B;  3DTO A;  3ANW B;  3MK7 C;  3UUM A;  4HTE A;  4GK0 E;  2CCQ A;  3FHN A;  3ZYK A;  4EYY R;  2Z6E A;  2CWY A;  2IC9 A;  5JR9 A;  3CX7 B;  4KP3 C;  3N9P A;  4WBO A;  4HEA A;  1HS7 A;  5KX5 E;  2WAU A;  3Q5W A;  2E8I A;  4TN7 B;  3K3Q C;  5ETW A;  3UUL A;  4UXN B;  5LBQ B;  3ZEF B;  3VKH A;  1YKH B;  2KLQ A;  4UVA B;  3UFE A;  1IJ5 A;  4TX5 A;  3P8C D;  3N9M A;  1T98 A;  2CXD A;  4IGU A;  3SWH A;  1US7 B;  2ZM8 A;  2CM0 A;  4KMC A;  5C8Y E;  2V7I A;  3MJX A;  2WBL A;  4MHC A;  2IC6 A;  5JDH A;  2C5K T;  1WYC A;  3I1A A;  3W15 B;  2LE8 A;  4H63 H;  1Y64 B;  4V1A v;  1BR2 A;  4I50 E;  4DND A;  2K24 A;  4AKH A;  1FMV A;  3QC9 A;  2HPL A;  5L2L A;  4X20 E;  3AVR A;  5EK3 A;  4H9O C;  1HFA A;  5FY0 A;  3A5X A;  5LHG B;  3BQL A;  3VU7 H;  1FMW A;  2XAQ B;  3LK3 B;  2VWA A;  3C4Z A;  3NZP A;  3AB3 B;  3JC6 D;  4O4H E;  3H37 A;  4QKN A;  3KBT A;  4A56 A;  4CI1 B;  2ZLY A;  2NTX A;  2W0G A;  3Q5X A;  4FI5 A;  4PNI A;  4PW8 A;  5HXE A;  4YJ3 E;  3VKG A;  3AA0 B;  2V7J A;  3Q9D A;  4CXW A;  2BVM A;  4WW0 A;  4IE6 A;  4OHF A;  4QXC B;  1NAF A;  3N2G E;  3N9L A;  2JMH A;  4F6R C;  1UCU A;  1E1H B;  2LSY A;  2P9B A;  2X9X A;  4E7Z A;  3C64 A;  5FXW A;  2VAS A;  3KV6 A;  3GA8 A;  2DNX A;  4CZZ B;  4B6X A;  2LT3 A;  3E08 A;  1H7C A;  2MTQ A;  4X1K E;  5FMN A;  1ZEE A;  2QA7 A;  1ZKE A;  2BDE A;  2C5J A;  2CMR A;  3CX8 B;  3GMI A;  5HYA A;  4BJN A;  4OYK A;  5LJN A;  4HGA A;  4ILU A;  4KBM B;  3RYI E;  3N2O A;  3NRY A;  3U3I A;  3N5L A;  1D0Z A;  4ASK A;  3MZK B;  2LHR A;  2CLY B;  4P0B A;  4PJL A;  3ONX A;  3VHL A;  5EK4 A;  5LXT E;  4MLK A;  4ADZ A;  1V9D A;  3KIN B;  3PUR A;  2ES0 A;  5EK2 A;  3N9N A;  4IHJ E;  3UUX B;  3V5U A;  2X68 A;  3CPZ A;  3KV9 A;  5TAO A;  1YW0 A;  3OBV E;  2WMO A;  3ZMV B;  4O8S A;  2YU2 A;  2W62 A;  3ZJ2 A;  1MIY A;  2W00 A;  3BQI A;  3E0Z A;  3PUQ A;  4O4L E;  5FY1 A;  3F31 A;  3UT5 E;  4IE5 A;  5DQW A;  4AI6 A;  3P7I A;  4CI2 B;  2MYS A;  2RP4 A;  2KIN B;  1SA0 E;  2V7L A;  3DJB A;  2MOZ A;  2N1G A;  1LKX A;  4EZH A;  2KWH A;  5JH7 E;  4Z8X A;  3HKD E;  2CEA A;  3CQX C;  4U74 A;  4HN9 A;  2JRK A;  2KND A;  4EB6 E;  3Q2M A;  5DAB A;  4UV8 B;  4PJM A;  3C98 B;  1IJ6 A;  3OYX A;  2X66 A;  3RC8 A;  3RKO A;  2ODV A;  3WAJ A;  2K5B B;  3PUG A;  3OJA A;  1OWA A;  2KXP B;  4QX8 B;  3OKQ A;  5J2U E;  3PE0 A;  3UUN A;  5EZY E;  3CVR A;  4XBF B;  5J1G A;  4WBN E;  1VRB A;  4L9I A;  3PUA A;  3RRW A;  1B7T A;  3EVY A;  2DWG A;  2J1D G;  2WSS V;  3O9X A;  2ODU A;  4PJN A;  4AKL A;  2PFV A;  2VL8 A;  3NRX A;  3KDS E;  3BK9 A;  4NUU A;  3AA7 B;  2NW7 A;  2LSG A;  3HKB E;  1QSD A;  4HE8 A;  5LNK A;  3IF8 B;  4OYJ A;  4QHO A;  2C5I T;  4ERR A;  5BMV E;  4G63 A;  4C91 A;  5HXS A;  3SOL A;  3AAA B;  5M4Y A;  4PFO A;  2D0U A;  4DMV A;  4H9R C;  4YHJ A;  5JDG A;  4JUY A;  3EDU A;  3ZC1 A;  5KMG P;  3PTR B;  2E9X B;  1LVF A;  1MMG A;  1NWM X;  2K9A A;  2XAG B;  4H9Q C;  1HTJ F;  1WRD A;  4ZI3 C;  2Y8D A;  5JDN A;  4P0A A;  2W61 A;  5A1L A;  5LHH B;  3PDY A;  4U72 A;  3CWZ B;  3K3N A;  3AVS A;  2NWB A;  4NUV A;  5FXX A;  4YJ2 E;  3FB2 A;  3C50 A;  4H9N C;  4IIJ E;  4PK5 A;  2LOP A;  5HXH A;  2N9D A;  3CQC B;  1D0Y A;  2K48 A;  5L3E B;  4ZI3 D;  4JEH B;  2PG8 A;  1MNE A;  3ZMU B;  3SRZ A;  4EOZ B;  3HI2 A;  3N9O A;  2YK0 A;  2JMK A;  2ZM0 A;  4UEM A;  2WWU A;  5E0O A;  5LGU B;  4MBQ A;  4ISS A;  5LG4 A;  5HWY A;  3CKD A;  3AA1 B;  3KFW X;  2X51 A;  3MKD A;  3GN5 A;  2CE7 A;  4ANJ A;  1IAP A;  2DHR A;  5FY7 A;  5F3J A;  3RYC E;  2X9W A;  3ZN0 B;  3I0O A;  2YEV C;  1YD8 G;  4AQG A;  1U4Q A;  2V7K A;  2Q9Q C;  4WNK A;  4UVC B;  5JRC B;  1Z0P A;  2VB6 A;  3B57 A;  2Y48 B;  3GN5 B;  5HAX A;  3K8P C;  4BAY B;  4O2A E;  2I59 A;  1EZ3 A;  4O4J E;  3IHR A;  3HA4 A;  5JVD E;  2WM9 A;  4HFV A;  4P09 A;  5H6R B;  5JDM A;  4ZI7 E;  3E22 E;  1UX5 A;  3MA9 A;  3GWH A;  4PJJ A;  1CUN A;  3I9W A;  3ETV A;  4CQI A;  4AQF A;  2N2N A;  2PBI A;  2VKJ A;  3N9Q A;  1FIO A;  5CA0 E;  2NW8 A;  2CA5 A;  3BQK A;  2LEH A;  3PUS A;  2VKD A;  2LSI A;  4GK5 E;  2LSK A;  5JQG E;  2A3D A;  4QXB B;  4ZS2 A;  5FNV E;  2X67 A;  3R6N A;  4H63 V;  4MFR A;  3AAE B;  3ZPO A;  3UTK A;  4IST A;  4G2A A;  3ANW A;  2L3L A;  4PAG A;  4IE4 A;  4JLE A;  1LRZ A;  3ZMS B;  5LCY A;  5L3F B;  3WAK A;  3ZMT B;  5L3G B;  1YKE B;  2LJL A;  3ESL A;  3J9X 1;  2IW5 B;  3J7Y q;  2Y6X A;  3EUH A;  3I9Y A;  2KT9 A;  2CXF A;  2Q9Q B;  4J2C A;  4DBQ A;  5JDL A;  3ETU A;  4PK6 A;  2NOX A;  5CB4 E;  3F57 A;  1HX8 A;  2L8K A;  2V7M A;  3QK6 A;  4AKR B;  4AXP A;  1D1C A;  2LHN A;  3FXE B;  1FEW A;  4I55 E;  1BR4 A;  3PU3 A;  4QXH B;  2BZB A;  2UXX B;  2XUE A;  2D5U A;  4O2B E;  5JDQ A;  3QUJ A;  3O1I A;  2X0L B;  1MMD A;  3KBU A;  5LYJ E;  3KVA A;  2XAH B;  4EZ4 A;  2OA5 A;  4TV9 E;  2CWO A;  2VK9 A;  3AA6 B;  4DVD A;  3H3A A;  3CML A;  3ZLI A;  2YU1 A;  3MAC A;  3HKE E;  3RYH E;  5LA6 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...