1S94A

Crystal structure of the habc domain of neuronal syntaxin from the squid loligo pealei
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
121
structure length
109
Chain Sequence
GFMEEFFEQVEEIRAMIDKISDNVDAVKKKHSDILSMKEELEELMTDIKRTANKVRGKLKTIELNIEQEESADLRIRKTQYSTISRKFVEVMSDYNTTQIDYRDRCKAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Endocytosis/exocytosis
molecule keywords s-syntaxin
publication title Crystal structure of the Habc domain of neuronal syntaxin from the squid Loligo pealei reveals conformational plasticity at its C-terminus
pubmed doi rcsb
source organism Loligo pealei
total genus 38
structure length 109
sequence length 121
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-02-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.70 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 1s94A00
1HS7A 2XHEB 5LG4A 4JEUB 1FEWA 3LG7A 4TX5A 1EZ3A 3C98B 5M4YA 1FIOA 4JEHB 1BR0A 2DNXA 1S94A 1G73A
chains in the Genus database with same CATH superfamily
4ZS2A 2W2UA 5AQUB 3I0QA 2WDVA 2NOXA 5HXEA 4CQIA 1T8BA 5F5WA 4WYVA 5LGTB 3AAAB 2XM1A 2F4VT 1XDOA 4HFVA 1O3XA 4YTMA 5DQWA 3IBPA 1T72A 3RRCA 5HCMA 2UUAT 2N2NA 3PV0F 5AQRB 3AEFA 4UVAB 2XSBA 4TN7B 5FL1A 4ASKA 2D9DA 1MMNA 3MKDA 2KLQA 1IZNB 3DJBA 2D0UA 5JRCB 3T1YT 3LJCA 3ZMVB 3FXDB 4JI7T 4TV9E 3AE2A 4UEMA 4X1KE 4AISA 4O2AE 4AKGA 3IEEA 5LA6E 2XQ8A 1UX4A 4HN9A 1J5WA 3C4WA 2CHOA 2JJ9A 1HCIA 3TLWA 3C51A 3RYHE 4U2YA 5AQLB 2UXXB 3B13A 3HKDE 3KBUA 3RX6A 2W4XA 4PK4A 3FXEB 4M1PA 2VKDA 5FY1A 3C64A 4Z91A 2PJQA 2LSYA 4GK5E 2OA5A 3RI5A 3W15B 4PFPA 3WI3A 3AA1B 2YU2A 1VCSA 5TAOA 4TZ4C 4V1Av 4AKIA 5C3JA 3F31A 2JQHA 2YDQA 4DR2T 3TLTA 4JV5T 3RIAA 3UUNA 5AQFB 3UTKA 2X9YA 3CMLA 3LBXA 5ABFB 3RH3A 4BJNA 3VRBA 3A5XA 3NWIA 3CX7B 3GN5B 1BR0A 5FVKA 4PW8A 3ONJA 1KK7A 1HFAA 3JADA 4XBFB 2LOPA 1WYCA 3ETVA 4HFDA 5JVDE 3AVSA 4DV0T 2QGSA 1B7TA 4KUMB 2MBGA 2PTFA 2FJBA 4U7YA 4EZHA 4UF0A 5AFUL 3FHNA 2N9DA 5L2LA 2AXDS 3K8PC 4MFRA 3ZSSA 1U4QA 2YKSA 2ZM8A 3UUBA 4AKLA 3PUQA 3GMIA 5JR9C 4P1NA 2YOEA 5LJNA 2XAGB 3Q5WA 1W0BA 4JEHB 1ZHCA 4OYJA 4PK5A 3ZMSB 5L3EB 4BA9A 2H89A 2CHNA 3ZMZB 2LSGA 4H9SE 3FZFB 5J0ZA 3CWZB 2LSIA 3RHWA 2IC9A 2VASA 4HFEA 2YN6A 4H63H 5LMUT 2QRXA 1HNXT 2V5CA 5JH7E 4PFOA 1DU2A 5LB7B 5E0OA 1WLXA 4OFZA 3UFEA 3AE3A 3PJAJ 3ZLIA 2MOZA 3SRZA 3AEGA 2A72A 2SPCA 3FBLA 3AE5A 2V5DA 4QXCB 4AKRB 3PTRB 4EZ4A 3N9MA 3KVBA 4X64T 1ZKEA 2L9QA 3AE1A 3RQUA 3N9LA 5BR8T 4NIQA 5JDFA 2WB5A 2BBJA 2W00A 4CXXA 4B3TT 2BG9A 3VRAA 2J1DG 3I9WA 3CK6A 1W9RA 2LKHA 1HX1B 3AAIA 4ZHQE 4EXTA 3TLSA 5HEGA 4NPPA 4CXYA 2UXBT 2VKJA 1UCUA 4X66T 3HL6A 3N9OA 5ETWA 3H3AA 5AQPB 2BDEA 3MJXA 2E9XC 1H7CA 1QLBA 3J9X1 2CA5A 2WZIA 5ABEA 2Q9QC 4KP3C 2XJ7A 2W62A 2WU2A 1M7KA 4PJNA 4GKJT 1Z0PA 4EEDA 2JQQA 2XQ9A 4IGUA 3GA8A 2W63A 2ZM6T 3ZYKA 3AXJA 3QB5K 5LBMA 5IYZE 3UU4A 3ONXA 2K9AA 4U3CA 4BAYB 3LSVA 4TV8E 1D1AA 4ZI3D 1VCTA 2L8KA 1L0VA 4YSZA 4TWFA 3UU5A 4CZZB 4X1YE 5HEHA 4IE0A 3ESLA 2ZM2A 3ZPOA 5LCYA 2WWVA 3H37A 2NW9A 3GWHA 2BS2A 5IUXA 4HEAA 3HKBE 3M65A 3V5UA 1IBLT 3A7MA 3T1HT 5CB4E 3I0OA 1GQEA 3QOFA 1G8XA 1BR2A 4X1IE 1NEKA 5FKYA 4AQFA 2XQ7A 4L9IA 5F3JA 1LVFA 3UU6A 4YLHA 3EDVA 4QKNA 4LMKA 4I0UA 2WZHA 4GYRA 2LRKA 4AXPA 3O1IA 4X20E 3CQCB 4HWFA 2R6GF 1XZYA 5EZYE 5L3GB 2JIWA 2BZBA 2UXDT 4U33A 4AQGA 2WDRA 2CWOA 5IWAT 3K3QC 2BKNA 4P0BA 3FZKB 2WQYA 2MAWA 1WR0A 3OPCA 1LVKA 5HXSA 3O1JA 2DWKA 1XNQT 4O4JE 2X66A 4EB6E 4JYAT 2BKPA 2IHR1 3P4RA 5CFBA 3K1SA 3KV9A 4O4IE 3OKQA 3RRWA 3I9YA 2FUPA 3UQ7A 1X79A 2KT9A 4EIWA 3UU8A 3PUSA 5FY7A 3NRXA 1SUMB 3P7IA 3QUJA 4DVDA 2ODUA 2W67A 4TWDA 3X1DA 1UGOA 4H63V 3U78A 3QNUA 3CX6B 3FB2A 1LRZA 3RC3A 4YHHT 2P9BA 1MNDA 4LF9T 3CQGB 1ZV4X 5A1LA 1CUNA 2CLYB 1MIWA 1HNWT 3OYXA 5JDMA 3LK3B 2XQ4A 2H7OA 1OEDC 2VL0A 3N2OA 3ZSTA 3ZCJA 2XQ5A 5LG4A 4PJLA 3TLUA 2LM9A 3CX8B 3NRYA 4GKKT 5FXZA 3ZEFB 5ABFA 3AE9A 3OBVE 5JR9B 2J62A 5FXVA 5KX5E 2WDQA 3AEDA 3PUGA 3GN5A 2QYWA 2MTQA 2CPTA 5HEUA 2KMFA 3ZJ1A 4LMLA 2DWGA 5L4EA 3ZT7A 3ABVA 5J2UE 2IMLA 3ZT5A 4C90A 4JI6T 2VK9A 4CN4A 4KMCA 2A9UA 2VVNA 2YDSA 3MACA 4YSXA 3P4QA 4EAHA 3Q9DA 1KFYA 1KNPA 4MLKA 4DV4T 4DR6T 3C4XA 3J7Yq 4U74A 2WWUA 2LSKA 2XTLA 1VRBA 2WY2A 4GIWA 2LEHA 2JMKA 3F57A 4H9PC 1HR0T 3OVUA 1I6ZA 2BVLA 1ZP0A 5JDGA 3MA9A 4HFCA 3UUXB 1XMQT 3N2KE 3ZKRA 2YEVC 2DHRA 2E9XB 1G73A 1V9DA 2JQ9A 4L5GA 3AB3B 4IL4A 3PE0A 5LYJE 3QC9A 1OEDE 5AQQB 3EHZA 1FIOA 2CMRA 1CHUA 4HWCA 4Q25A 1HS7A 4DV7T 2XAQB 2UU9T 3O9XA 4U72A 3SFDA 4FI5A 4TX5A 2BS4A 1W0AA 2X9HA 5J2TE 2NP9A 4JEUB 4UVBB 2LJLA 4ZEYA 2XZEA 3EDUA 2HH7A 3Q2MA 5C2TA 5KMGP 1ZOYA 3FZHB 3KV5A 3IA3A 4JI0T 2V6YB 4IDPA 2JMHA 3AA0B 2B1EA 2RPAA 2V7LA 4UV9B 1FJGT 2X0YA 5HXRA 3AE7A 2E2AA 1IJ5A 3PURA 2CCQA 1J5ET 2XQAA 4UR9A 1JNZA 3ZMTB 2HN1A 3KV6A 2VL8A 2X9WA 5F8PA 1D1CA 3RYIE 4KHZF 2LHNA 2RA1A 2V8SV 3TLVA 4QXHB 4DR4T 2W0GA 1VOMA 2FJEA 1FMVA 1HNZT 1YQ4A 3A8YC 4DUYT 3UT5E 2XQYA 4AQFC 5LP6E 4ILCA 5JDQA 4YT0A 2ODVA 3EI0A 3C50A 3IHRA 2PG8A 3PU8A 2HPJA 2MPKA 3AAEB 2VKHA 2PFVA 4DR5T 3R6NA 3AECA 2V6XA 1SE7A 5AQIB 5FXWA 5FY0A 3RIUA 4DBQA 2NWBA 3WAKA 2HHHT 5IHYA 3ZT6A 3B5MA 2N1GA 4QH4A 3RC8A 4HFBA 3AA6B 2GK9A 5LHGB 3ZMUB 1YKEB 2YK0A 1OXZA 5LMNT 1W09A 3R84B 2I59A 5HEOA 2C5JA 2WMOA 2K24A 3AEEA 5FYMA 5LGNB 3AE8A 4WBOA 5L3FB 4JI5T 2EHOB 2L3LA 2WSSV 1UK5A 4GK0E 3HR0A 2X0HA 2XY8B 2V7IA 4ZZBA 4A97A 3RKOA 3N5LA 5HCJA 4HWIB 2IIUA 1OEDB 4G63A 3ONLC 4DR3T 5DABA 2C5KT 1SA0E 4IREA 2I6HA 1YQ3A 5LHIB 3VU7H 3K3OA 2WMNA 4EV6A 3KVAA 1I94T 3AE6A 2FBWA 5FL0A 1YXRA 4ZOLE 5AQGB 4ZI2D 4I50E 2CRBA 3ZYMA 2IC6A 4ILUA 1HF8A 5HXHA 4YJ2E 1MIYA 1ZEEA 2VQFT 3PUWF 2PBIA 3E22E 2CEAA 4H9OC 4B6XA 1QUUA 2JPFA 2WBLA 4IL9A 3SWHA 1IAPA 4NXNT 3EABA 4XZCA 4I43B 1HX8A 5JR9A 2D0TA 3WAJA 5LGUB 3L3PA 5HWYA 3I1AA 4HTEA 2ZLYA 1EZ3A 4GOUA 3PUXF 2XASB 2CXFA 4UIGA 2NTYA 3HKEE 3UFGA 1BR1A 4PK6A 2ACXA 2OLTA 5H6RB 4YY3T 3Q5DA 4MALA 2K48A 2XSAA 4A56A 4L0RA 4QXBB 4YFSA 3C98B 2XQ3A 1WRDA 4IT4A 4IDOA 3VKHA 5JRCA 2WAUA 4TUYE 2MYSA 4UVCB 1HTJF 2X0LB 3D0TA 2IW5B 2CXDA 2H3RA 1XMOT 3Q5XA 1D1BA 1US7B 3JAEA 5LXTE 4YHJA 2CM0A 2HN2A 3RF1A 5CA0E 4O2BE 2IAKA 1MMAA 1UUSA 3L39A 1MIVA 3IF8B 2ES0A 3TKLB 4ADZA 2KZ7B 4Z8XA 2V7KA 4OYKA 3RGLA 4DUZT 4IDQA 2C5IT 4CI2B 3EVYA 3Q5EA 5LHHB 4CN6A 1FEWA 4LFCT 2X9XA 4JBWF 2WM9A 4DV6T 4JI8T 2E9XA 2UUBT 2NW8A 5BMVE 4IDNA 1E1HB 4I55E 2YINA 4DR1T 4E7ZA 2ACZA 4O4LE 4X5TA 5L4HA 4U31A 3FBZA 4XAXB 3ZYLA 2E9XD 4ZS3A 4JI1T 4QWNB 4G2AA 4DR7T 4QHOA 1N36T 1T98A 2LHRA 4E7SA 4HFIA 5HAXA 4OX9T 3BQLA 4YXDA 4BJMA 2VQET 2DCFA 3CPZA 3JC6D 4PAGA 5GONE 4LFAT 3AEAA 2V6YA 4IHJE 2LLYA 2KWIB 2V7MA 3BQKA 2M6IA 4IE6A 3H3MA 4UV8B 3KBTA 2XUEA 2RP4A 5AQVB 3N9PA 4IE4A 5AQSB 3RYCE 5LOVE 1KNRA 3KFWX 5KDMC 2G0UA 3ANWB 3PUVF 2B76A 1UURA 3PDYA 4ANJA 5EK3A 3PUYF 4IE7A 5L3CB 3C4ZA 2J47A 3QK6A 4FJOA 4H9RC 2I0MA 5CJ5A 3CIRA 2JQKA 2Y6XA 1X9BA 4NUVA 3K3NA 3RKGA 3NBXX 4DIDB 4AI6A 2ZM0A 2A3DA 2VVSA 3RIUC 4DV5T 2D2SA 1FMWA 4DV2T 5AQNB 4U2ZA 4TNWA 4B3RT 2AE9A 2CXLA 5AQHB 4LF4T 2WP9A 4IE5A 4KHPT 3RIFA 4LF8T 3VHLA 5FXXA 2BG9C 4TNVA 2UXCT 2WU5A 2IDOB 3ZJ2A 4HWDA 4WNKA 2Q9QB 5CGMA 3E08A 4U7IA 1IBKT 2KXPB 3EAMA 5J1GA 4ERRA 4DMWA 1Z8UA 1YW0A 3RPUA 1OWAA 2V26A 4DV3T 5LBQB 3P4SA 2BVMA 3MK7C 3N2GE 4ZI2C 4YTNA 2DL1A 2DNXA 4QX8B 5HYAA 5JDLA 2EHOA 4X65T 4ZI3C 5AQJB 5DQVA 2XM2A 5JQGE 4IDZA 4JI2T 1N34T 2NTXA 5ABHA 5LG3A 3N9NA 3L09A 2Y8DA 1OEDA 4HFHA 4P09A 3VR9A 3MZKB 3PUAA 2M6BA 2X67A 2JRKA 2EHOD 2UXNB 3NKZA 3VKGA 1S35A 3NZPA 2CLYC 3JAFA 3UQ4A 4DO0A 4C91A 4DBRA 2XAJB 1E7PA 3P4WA 4TWHA 1D0ZA 4MBQA 2V1DB 3O4XE 2YDRA 4HGAA 1XWMA 5EK4A 5JTGA 4A5XA 3LDQB 4OHFA 4LF5T 1S94A 1WYBA 1WFDA 3E0ZA 4H9NC 5ADXL 1MMDA 4F8HA 4LMJA 2LE8A 3L8RA 3T8OA 1IJ6A 4ZZCA 4EOZB 4WBNE 4B3MT 3HA4A 1YKHB 1SHZC 1QSDA 3O1HA 4JLEA 2BG9E 3KV4A 2KSRA 3UULA 1BR4A 4K0UA 3PU3A 2LM2A 3KINB 3UU3A 2CBJA 1N32T 2CBIA 2DI4A 2H88A 1M62A 3AA7B 3B57A 5KXJA 4H9QC 4X62T 4EYYR 2VURA 2E8IA 4UXNB 1Y01A 2A2FX 1MNEA 2J4GA 2KWHA 3AEBA 2XQ6A 2K5BB 4O8SA 1E2AA 2LKGA 5FNVE 4I4TE 3LG7A 1U5PA 3DP7A 4YJ3E 4MHCA 3OTOT 4Z90A 4WW0A 3LBXB 4QH5A 4J2CA 4ZXLA 4LF6T 3FZLB 5H6QB 4CI1B 5LJMA 5AQOB 4EEBA 5L47A 4AIUA 3CKDA 2DLRA 2FJDA 1D0XA 2M67A 5HEJA 4YTPA 1HG5A 3M3ZB 4ILAA 5C8YE 2QA7A 4GYSA 2X51A 5FVLA 5M4YA 3VR8A 2UUCT 3LK42 3HKCE 3SS1A 4QH1A 5LNKA 3ZC0A 2LRLA 3CVRA 1HG2A 4UF0B 3F2EA 3RQWA 1R8IA 1LKXA 4IIJE 3P8CD 1D0YA 3JC6C 3DTOA 5FMNA 3N9QA 3NZQA 4COFA 4QX7B 2W66A 1Y64B 2LSJA 3HI2A 4ZI7E 3P4PA 4JI4T 4HWHA 4F6RC 3LK2B 4O4HE 4DNDA 4ILBA 2HPLA 2XAFB 4PJMA 2BBHA 4NXMT 1NWMX 3JCFA 4OK0A 3NVOA 3RLFF 4PJJA 5ABGA 4PNIA 3U3IA 1WR6A 1UX5A 2Z6EA 2D5UA 2IUBA 4ISTA 4CXWA 4KX6A 2CE7A 2XAHB 5AQTB 4HE8A 2ZMAA 3G06A 2XHEB 3QB5A 2KNDA 4AQYT 2BS3A 1J1JA 4JUYA 3OJAA 4NUUA 2H7VC 5L3BB 4CI3B 1WCRA 2VB6A 4JI3T 3BK9A 2LOSA 2WS3A 2YU1A 2QVAA 3ANWA 5CA1E 3ZN1B 3ETUA 3RYFE 5L3DB 4P0AA 1MMGA 2W61A 5DJQC 4AKHA 2C0SA 1YD8G 2BG9B 3KDSE 3S4UA 2LT3A 1JNRA 1XNRT 5FP3A 3SOLA 2E5LT 3P50A 3MXZA 3ZCIA 4UELA 1IBMT 3AVRA 4B3ST 4K0KT 3LFMA 2E5VA 5AQMB 3FZMB 3UUMA 2NW7A 2WCAA 1AJ3A 2K3WA 4DV1T 3ZN0B 3PUZF 2KINB 3SFEA 5AQKB 2OV9A 1XDPA 1N33T 4YSYA 1NENA 5EK2A 1T7SA 4A98A 4DMVA 2BKOA 1KEYA 4N78D 4EGWA 4HKAA 3V5SA 5JDNA 4LFBT 1KNZA 3AXJB 4ISSA 2Q9QA 3CQXC 2X68A 3AE4A 2XPKA 2VKOA 3OYZA 2EHOC 4LF7T 2VWAA 3BQIA 4WZXA 4EYUA 5JDHA 2Y48B 2V7JA 2CWYA 5HWXA 4KI0F 2FJAA 5JREA 4KBMB 5HXCA 4CN1A 2Q9QD 3PJAA 2NR4A 3EUHA 1KF6A 1NAFA 3ZC1A
chains in the Genus database with same CATH topology
3MK7C 3N2GE 4ZS2A 5CB4E 3I0OA 4ZI2C 3RC8A 1G8XA 3AA6B 1BR2A 2DNXA 3I0QA 4X1IE 2GK9A 4QX8B 2NOXA 4AQFA 5LHGB 3ZMUB 1YKEB 2YK0A 1OXZA 5HYAA 4L9IA 5F3JA 1LVFA 5JDLA 2EHOA 4ZI3C 5HXEA 3R84B 4YLHA 4CQIA 3EDVA 5DQVA 4QKNA 2I59A 5JQGE 5LGTB 4IDZA 2C5JA 4GYRA 2NTXA 2WMOA 3AAAB 2K24A 4AXPA 5FYMA 3N9NA 4WBOA 5LGNB 4HFVA 5L3FB 3L09A 3O1IA 2Y8DA 4X20E 3CQCB 2EHOB 1O3XA 2L3LA 2WSSV 5DQWA 5EZYE 5L3GB 4P09A 3IBPA 2BZBA 3HR0A 4GK0E 2V7IA 3MZKB 3RRCA 4AQGA 3PUAA 2N2NA 2X67A 2CWOA 3RKOA 3K3QC 4UVAB 2JRKA 2EHOD 2UXNB 4TN7B 3N5LA 3VKGA 1S35A 3NZPA 4ASKA 2CLYC 4P0BA 4G63A 1MMNA 3MKDA 4DO0A 5DABA 2KLQA 4C91A 2C5KT 1SA0E 4DBRA 1IZNB 2XAJB 1LVKA 5HXSA 3O1JA 2DWKA 4O4JE 3DJBA 5LHIB 2D0UA 3VU7H 2X66A 4EB6E 1D0ZA 4MBQA 5JRCB 2V1DB 3K3OA 2WMNA 3LJCA 3KVAA 3ZMVB 3FXDB 3O4XE 4HGAA 4TV9E 3KV9A 4UEMA 4O4IE 3OKQA 3RRWA 3I9YA 5EK4A 1X79A 4ZOLE 2KT9A 4OHFA 4X1KE 1S94A 4ZI2D 4EIWA 1WYBA 3PUSA 4I50E 3NRXA 4O2AE 5FY7A 3ZYMA 4AKGA 2IC6A 4ILUA 3P7IA 3IEEA 5LA6E 3QUJA 3E0ZA 1HF8A 4DVDA 1UX4A 2ODUA 4H63V 5HXHA 3U78A 4HN9A 4H9NC 4YJ2E 1MMDA 5ADXL 3C4WA 3CX6B 3FB2A 1LRZA 3RC3A 1MIYA 1ZEEA 2LE8A 1MNDA 2JJ9A 2P9BA 3T8OA 1IJ6A 1HCIA 3CQGB 4EOZB 3C51A 4WBNE 3RYHE 2PBIA 3HA4A 3E22E 1ZV4X 2CEAA 2UXXB 1YKHB 3B13A 1SHZC 3HKDE 3KBUA 3RX6A 4H9OC 1QSDA 3O1HA 4B6XA 4PK4A 4JLEA 3FXEB 4M1PA 5A1LA 1CUNA 2VKDA 5FY1A 3C64A 2CLYB 1QUUA 2PJQA 3KV4A 3UULA 1BR4A 1MIWA 2JPFA 2WBLA 4K0UA 2LSYA 3SWHA 3PU3A 3OYXA 1IAPA 5JDMA 3LK3B 4GK5E 2OA5A 2H7OA 4XZCA 4I43B 1HX8A 3W15B 3N2OA 3KINB 3ZCJA 4PFPA 5JR9A 2D0TA 3WI3A 3WAJA 5LG4A 5LGUB 3L3PA 3AA1B 4PJLA 2YU2A 2DI4A 2LM9A 5TAOA 5HWYA 3I1AA 4TZ4C 4V1Av 4AKIA 3CX8B 4HTEA 2ZLYA 3NRYA 3AA7B 3F31A 1EZ3A 3B57A 4GOUA 4H9QC 5FXZA 3ZEFB 4EYYR 3OBVE 5JR9B 2XASB 5FXVA 5KX5E 2CXFA 4UIGA 2NTYA 3HKEE 2E8IA 4UXNB 3PUGA 3GN5A 2MTQA 1BR1A 3UUNA 2KMFA 3ZJ1A 3UTKA 2X9YA 2A2FX 3CMLA 4PK6A 3LBXA 1MNEA 2ACXA 2DWGA 2KWHA 5H6RB 3RH3A 4BJNA 2K5BB 4O8SA 5J2UE 5FNVE 3A5XA 3CX7B 4MALA 2K48A 3GN5B 1BR0A 4I4TE 3LG7A 4PW8A 1U5PA 3DP7A 4YJ3E 4C90A 1KK7A 4MHCA 1HFAA 4XBFB 4A56A 2LOPA 4WW0A 3LBXB 1WYCA 3ETVA 4L0RA 4QXBB 5JVDE 3AVSA 4YFSA 3C98B 4J2CA 2VK9A 4KMCA 1WRDA 5H6QB 2QGSA 3VKHA 1B7TA 4CI1B 4KUMB 5JRCA 2WAUA 2MBGA 5LJMA 4TUYE 3MACA 2MYSA 4UVCB 1HTJF 2X0LB 4EAHA 3CKDA 3Q9DA 2DLRA 3D0TA 1D0XA 2M67A 4EZHA 2IW5B 2CXDA 4UF0A 2H3RA 5AFUL 3Q5XA 1HG5A 5C8YE 3FHNA 2N9DA 5L2LA 1D1BA 1US7B 2QA7A 4GYSA 2X51A 4MFRA 3K8PC 4YHJA 5LXTE 2CM0A 5M4YA 1U4QA 5CA0E 2ZM8A 4MLKA 4O2BE 3LK42 2IAKA 1MMAA 3HKCE 3SS1A 4AKLA 5LNKA 3C4XA 3ZC0A 3PUQA 3GMIA 1MIVA 3J7Yq 3CVRA 3IF8B 1HG2A 4U74A 4UF0B 2ES0A 2WWUA 5JR9C 3F2EA 3TKLB 5LJNA 2LSKA 2XAGB 1LKXA 4ADZA 2KZ7B 2XTLA 3P8CD 4IIJE 1VRBA 4Z8XA 2V7KA 1D0YA 3JC6C 3Q5WA 3DTOA 4OYKA 5FMNA 4JEHB 1ZHCA 3N9QA 4GIWA 4OYJA 2LEHA 2C5IT 3NZQA 2JMKA 4PK5A 3ZMSB 4CI2B 3EVYA 4QX7B 3F57A 4H9PC 5L3EB 4BA9A 5LHHB 1Y64B 1FEWA 3ZMZB 2LSJA 2BVLA 3HI2A 2LSGA 2X9XA 4ZI7E 5JDGA 4H9SE 2WM9A 3CWZB 2LSIA 2IC9A 2VASA 3MA9A 2E9XA 4F6RC 3LK2B 2NW8A 5BMVE 4O4HE 4DNDA 3UUXB 1E1HB 4H63H 4I55E 2HPLA 2YINA 2XAFB 3N2KE 2YEVC 4PJMA 2DHRA 4E7ZA 1NWMX 5JH7E 4PFOA 4OK0A 5E0OA 2E9XB 1G73A 1V9DA 1WLXA 4L5GA 3AB3B 4OFZA 3UFEA 3PE0A 4O4LE 4PJJA 5LYJE 3QC9A 4PNIA 3U3IA 3ZLIA 1WR6A 1UX5A 2MOZA 2Z6EA 2D5UA 4ISTA 3FBZA 1FIOA 2CMRA 4XAXB 4CXWA 3ZYLA 2E9XD 4ZS3A 3SRZA 4QWNB 2CE7A 2XAHB 4G2AA 2A72A 2SPCA 3FBLA 4HE8A 2ZMAA 4QHOA 1T98A 2XHEB 1HS7A 2LHRA 2XAQB 4E7SA 4QXCB 4AKRB 3PTRB 4EZ4A 3O9XA 4U72A 2KNDA 3KVBA 3N9MA 4FI5A 4TX5A 5HAXA 1ZKEA 2L9QA 4JUYA 3OJAA 4NUUA 2H7VC 3BQLA 2X9HA 4BJMA 3N9LA 5J2TE 2NP9A 2DCFA 5L3BB 3CPZA 5JDFA 3JC6D 4PAGA 5GONE 4CI3B 2W00A 4JEUB 4CXXA 2VB6A 4IHJE 4UVBB 2LJLA 3EDUA 3BK9A 2HH7A 2J1DG 2LOSA 3I9WA 3Q2MA 2YU1A 2KWIB 5KMGP 3KV5A 2V7MA 3BQKA 3ANWA 5CA1E 3ZN1B 3AAIA 3ETUA 3RYFE 5L3DB 4IE6A 4ZHQE 4P0AA 1MMGA 4EXTA 4UV8B 3KBTA 2W61A 5DJQC 2XUEA 2RP4A 4AKHA 3ZC1A 2C0SA 3N9PA 1YD8G 2JMHA 3AA0B 2B1EA 4IE4A 4CXYA 2V7LA 2VKJA 4UV9B 1UCUA 3KDSE 3RYCE 5LOVE 3HL6A 3N9OA 5ETWA 5HXRA 3KFWX 5KDMC 3H3AA 3S4UA 2G0UA 2LT3A 3ANWB 2BDEA 3MJXA 2E9XC 5FP3A 3SOLA 1H7CA 1IJ5A 3MXZA 3PURA 3J9X1 2CA5A 4UELA 3PDYA 3ZCIA 4ANJA 5EK3A 2Q9QC 2CCQA 3AVRA 4KP3C 4IE7A 5L3CB 3C4ZA 2W62A 3ZMTB 3QK6A 4FJOA 4H9RC 3LFMA 4PJNA 1Z0PA 2Y6XA 3UUMA 2JQQA 4IGUA 2NW7A 3GA8A 4NUVA 2W63A 3K3NA 3KV6A 3NBXX 1AJ3A 4AI6A 2VL8A 3ZN0B 2X9WA 5F8PA 1D1CA 2KINB 3RYIE 2ZM0A 2A3DA 2LHNA 2RA1A 3ZYKA 5LBMA 4QXHB 2D2SA 5EK2A 5IYZE 4DMVA 1FMWA 3ONXA 2W0GA 4N78D 1VOMA 2K9AA 1FMVA 4HKAA 3V5SA 2CXLA 5JDNA 4BAYB 1KNZA 4TV8E 1D1AA 4ZI3D 4ISSA 2L8KA 2Q9QA 3CQXC 4IE5A 3UT5E 2XQYA 2X68A 4AQFC 5LP6E 5JDQA 3VHLA 2VKOA 5FXXA 3OYZA 2EHOC 2ODVA 3ZJ2A 2VWAA 3BQIA 3C50A 3IHRA 4CZZB 4X1YE 2PG8A 4EYUA 5JDHA 3PU8A 2HPJA 4WNKA 2Q9QB 3AAEB 2Y48B 2VKHA 2PFVA 2CWYA 2V7JA 3E08A 3ESLA 4IE0A 3R6NA 2KXPB 5HWXA 5J1GA 2ZM2A 3ZPOA 5JREA 5LCYA 4ERRA 4KBMB 5HXCA 5FXWA 5FY0A 3H37A 2NW9A 4DMWA 2Q9QD 3GWHA 4DBQA 1YW0A 2NWBA 3RPUA 3EUHA 3WAKA 1OWAA 2V26A 5IHYA 4HEAA 3HKBE 3M65A 3V5UA 5LBQB 1NAFA 2N1GA 2BVMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HS7 A;  2XHE B;  5LG4 A;  4JEU B;  1FEW A;  3LG7 A;  4TX5 A;  1EZ3 A;  3C98 B;  5M4Y A;  1FIO A;  4JEH B;  1BR0 A;  2DNX A;  1S94 A;  1G73 A; 
#chains in the Genus database with same CATH topology
 4ZS2 A;  2W2U A;  5AQU B;  3I0Q A;  2WDV A;  2NOX A;  5HXE A;  4CQI A;  1T8B A;  5F5W A;  4WYV A;  5LGT B;  3AAA B;  2XM1 A;  2F4V T;  1XDO A;  4HFV A;  1O3X A;  4YTM A;  5DQW A;  3IBP A;  1T72 A;  3RRC A;  5HCM A;  2UUA T;  2N2N A;  3PV0 F;  5AQR B;  3AEF A;  4UVA B;  2XSB A;  4TN7 B;  5FL1 A;  4ASK A;  2D9D A;  1MMN A;  3MKD A;  2KLQ A;  1IZN B;  3DJB A;  2D0U A;  5JRC B;  3T1Y T;  3LJC A;  3ZMV B;  3FXD B;  4JI7 T;  4TV9 E;  3AE2 A;  4UEM A;  4X1K E;  4AIS A;  4O2A E;  4AKG A;  3IEE A;  5LA6 E;  2XQ8 A;  1UX4 A;  4HN9 A;  1J5W A;  3C4W A;  2CHO A;  2JJ9 A;  1HCI A;  3TLW A;  3C51 A;  3RYH E;  4U2Y A;  5AQL B;  2UXX B;  3B13 A;  3HKD E;  3KBU A;  3RX6 A;  2W4X A;  4PK4 A;  3FXE B;  4M1P A;  2VKD A;  5FY1 A;  3C64 A;  4Z91 A;  2PJQ A;  2LSY A;  4GK5 E;  2OA5 A;  3RI5 A;  3W15 B;  4PFP A;  3WI3 A;  3AA1 B;  2YU2 A;  1VCS A;  5TAO A;  4TZ4 C;  4V1A v;  4AKI A;  5C3J A;  3F31 A;  2JQH A;  2YDQ A;  4DR2 T;  3TLT A;  4JV5 T;  3RIA A;  3UUN A;  5AQF B;  3UTK A;  2X9Y A;  3CML A;  3LBX A;  5ABF B;  3RH3 A;  4BJN A;  3VRB A;  3A5X A;  3NWI A;  3CX7 B;  3GN5 B;  1BR0 A;  5FVK A;  4PW8 A;  3ONJ A;  1KK7 A;  1HFA A;  3JAD A;  4XBF B;  2LOP A;  1WYC A;  3ETV A;  4HFD A;  5JVD E;  3AVS A;  4DV0 T;  2QGS A;  1B7T A;  4KUM B;  2MBG A;  2PTF A;  2FJB A;  4U7Y A;  4EZH A;  4UF0 A;  5AFU L;  3FHN A;  2N9D A;  5L2L A;  2AXD S;  3K8P C;  4MFR A;  3ZSS A;  1U4Q A;  2YKS A;  2ZM8 A;  3UUB A;  4AKL A;  3PUQ A;  3GMI A;  5JR9 C;  4P1N A;  2YOE A;  5LJN A;  2XAG B;  3Q5W A;  1W0B A;  4JEH B;  1ZHC A;  4OYJ A;  4PK5 A;  3ZMS B;  5L3E B;  4BA9 A;  2H89 A;  2CHN A;  3ZMZ B;  2LSG A;  4H9S E;  3FZF B;  5J0Z A;  3CWZ B;  2LSI A;  3RHW A;  2IC9 A;  2VAS A;  4HFE A;  2YN6 A;  4H63 H;  5LMU T;  2QRX A;  1HNX T;  2V5C A;  5JH7 E;  4PFO A;  1DU2 A;  5LB7 B;  5E0O A;  1WLX A;  4OFZ A;  3UFE A;  3AE3 A;  3PJA J;  3ZLI A;  2MOZ A;  3SRZ A;  3AEG A;  2A72 A;  2SPC A;  3FBL A;  3AE5 A;  2V5D A;  4QXC B;  4AKR B;  3PTR B;  4EZ4 A;  3N9M A;  3KVB A;  4X64 T;  1ZKE A;  2L9Q A;  3AE1 A;  3RQU A;  3N9L A;  5BR8 T;  4NIQ A;  5JDF A;  2WB5 A;  2BBJ A;  2W00 A;  4CXX A;  4B3T T;  2BG9 A;  3VRA A;  2J1D G;  3I9W A;  3CK6 A;  1W9R A;  2LKH A;  1HX1 B;  3AAI A;  4ZHQ E;  4EXT A;  3TLS A;  5HEG A;  4NPP A;  4CXY A;  2UXB T;  2VKJ A;  1UCU A;  4X66 T;  3HL6 A;  3N9O A;  5ETW A;  3H3A A;  5AQP B;  2BDE A;  3MJX A;  2E9X C;  1H7C A;  1QLB A;  3J9X 1;  2CA5 A;  2WZI A;  5ABE A;  2Q9Q C;  4KP3 C;  2XJ7 A;  2W62 A;  2WU2 A;  1M7K A;  4PJN A;  4GKJ T;  1Z0P A;  4EED A;  2JQQ A;  2XQ9 A;  4IGU A;  3GA8 A;  2W63 A;  2ZM6 T;  3ZYK A;  3AXJ A;  3QB5 K;  5LBM A;  5IYZ E;  3UU4 A;  3ONX A;  2K9A A;  4U3C A;  4BAY B;  3LSV A;  4TV8 E;  1D1A A;  4ZI3 D;  1VCT A;  2L8K A;  1L0V A;  4YSZ A;  4TWF A;  3UU5 A;  4CZZ B;  4X1Y E;  5HEH A;  4IE0 A;  3ESL A;  2ZM2 A;  3ZPO A;  5LCY A;  2WWV A;  3H37 A;  2NW9 A;  3GWH A;  2BS2 A;  5IUX A;  4HEA A;  3HKB E;  3M65 A;  3V5U A;  1IBL T;  3A7M A;  3T1H T;  5CB4 E;  3I0O A;  1GQE A;  3QOF A;  1G8X A;  1BR2 A;  4X1I E;  1NEK A;  5FKY A;  4AQF A;  2XQ7 A;  4L9I A;  5F3J A;  1LVF A;  3UU6 A;  4YLH A;  3EDV A;  4QKN A;  4LMK A;  4I0U A;  2WZH A;  4GYR A;  2LRK A;  4AXP A;  3O1I A;  4X20 E;  3CQC B;  4HWF A;  2R6G F;  1XZY A;  5EZY E;  5L3G B;  2JIW A;  2BZB A;  2UXD T;  4U33 A;  4AQG A;  2WDR A;  2CWO A;  5IWA T;  3K3Q C;  2BKN A;  4P0B A;  3FZK B;  2WQY A;  2MAW A;  1WR0 A;  3OPC A;  1LVK A;  5HXS A;  3O1J A;  2DWK A;  1XNQ T;  4O4J E;  2X66 A;  4EB6 E;  4JYA T;  2BKP A;  2IHR 1;  3P4R A;  5CFB A;  3K1S A;  3KV9 A;  4O4I E;  3OKQ A;  3RRW A;  3I9Y A;  2FUP A;  3UQ7 A;  1X79 A;  2KT9 A;  4EIW A;  3UU8 A;  3PUS A;  5FY7 A;  3NRX A;  1SUM B;  3P7I A;  3QUJ A;  4DVD A;  2ODU A;  2W67 A;  4TWD A;  3X1D A;  1UGO A;  4H63 V;  3U78 A;  3QNU A;  3CX6 B;  3FB2 A;  1LRZ A;  3RC3 A;  4YHH T;  2P9B A;  1MND A;  4LF9 T;  3CQG B;  1ZV4 X;  5A1L A;  1CUN A;  2CLY B;  1MIW A;  1HNW T;  3OYX A;  5JDM A;  3LK3 B;  2XQ4 A;  2H7O A;  1OED C;  2VL0 A;  3N2O A;  3ZST A;  3ZCJ A;  2XQ5 A;  5LG4 A;  4PJL A;  3TLU A;  2LM9 A;  3CX8 B;  3NRY A;  4GKK T;  5FXZ A;  3ZEF B;  5ABF A;  3AE9 A;  3OBV E;  5JR9 B;  2J62 A;  5FXV A;  5KX5 E;  2WDQ A;  3AED A;  3PUG A;  3GN5 A;  2QYW A;  2MTQ A;  2CPT A;  5HEU A;  2KMF A;  3ZJ1 A;  4LML A;  2DWG A;  5L4E A;  3ZT7 A;  3ABV A;  5J2U E;  2IML A;  3ZT5 A;  4C90 A;  4JI6 T;  2VK9 A;  4CN4 A;  4KMC A;  2A9U A;  2VVN A;  2YDS A;  3MAC A;  4YSX A;  3P4Q A;  4EAH A;  3Q9D A;  1KFY A;  1KNP A;  4MLK A;  4DV4 T;  4DR6 T;  3C4X A;  3J7Y q;  4U74 A;  2WWU A;  2LSK A;  2XTL A;  1VRB A;  2WY2 A;  4GIW A;  2LEH A;  2JMK A;  3F57 A;  4H9P C;  1HR0 T;  3OVU A;  1I6Z A;  2BVL A;  1ZP0 A;  5JDG A;  3MA9 A;  4HFC A;  3UUX B;  1XMQ T;  3N2K E;  3ZKR A;  2YEV C;  2DHR A;  2E9X B;  1G73 A;  1V9D A;  2JQ9 A;  4L5G A;  3AB3 B;  4IL4 A;  3PE0 A;  5LYJ E;  3QC9 A;  1OED E;  5AQQ B;  3EHZ A;  1FIO A;  2CMR A;  1CHU A;  4HWC A;  4Q25 A;  1HS7 A;  4DV7 T;  2XAQ B;  2UU9 T;  3O9X A;  4U72 A;  3SFD A;  4FI5 A;  4TX5 A;  2BS4 A;  1W0A A;  2X9H A;  5J2T E;  2NP9 A;  4JEU B;  4UVB B;  2LJL A;  4ZEY A;  2XZE A;  3EDU A;  2HH7 A;  3Q2M A;  5C2T A;  5KMG P;  1ZOY A;  3FZH B;  3KV5 A;  3IA3 A;  4JI0 T;  2V6Y B;  4IDP A;  2JMH A;  3AA0 B;  2B1E A;  2RPA A;  2V7L A;  4UV9 B;  1FJG T;  2X0Y A;  5HXR A;  3AE7 A;  2E2A A;  1IJ5 A;  3PUR A;  2CCQ A;  1J5E T;  2XQA A;  4UR9 A;  1JNZ A;  3ZMT B;  2HN1 A;  3KV6 A;  2VL8 A;  2X9W A;  5F8P A;  1D1C A;  3RYI E;  4KHZ F;  2LHN A;  2RA1 A;  2V8S V;  3TLV A;  4QXH B;  4DR4 T;  2W0G A;  1VOM A;  2FJE A;  1FMV A;  1HNZ T;  1YQ4 A;  3A8Y C;  4DUY T;  3UT5 E;  2XQY A;  4AQF C;  5LP6 E;  4ILC A;  5JDQ A;  4YT0 A;  2ODV A;  3EI0 A;  3C50 A;  3IHR A;  2PG8 A;  3PU8 A;  2HPJ A;  2MPK A;  3AAE B;  2VKH A;  2PFV A;  4DR5 T;  3R6N A;  3AEC A;  2V6X A;  1SE7 A;  5AQI B;  5FXW A;  5FY0 A;  3RIU A;  4DBQ A;  2NWB A;  3WAK A;  2HHH T;  5IHY A;  3ZT6 A;  3B5M A;  2N1G A;  4QH4 A;  3RC8 A;  4HFB A;  3AA6 B;  2GK9 A;  5LHG B;  3ZMU B;  1YKE B;  2YK0 A;  1OXZ A;  5LMN T;  1W09 A;  3R84 B;  2I59 A;  5HEO A;  2C5J A;  2WMO A;  2K24 A;  3AEE A;  5FYM A;  5LGN B;  3AE8 A;  4WBO A;  5L3F B;  4JI5 T;  2EHO B;  2L3L A;  2WSS V;  1UK5 A;  4GK0 E;  3HR0 A;  2X0H A;  2XY8 B;  2V7I A;  4ZZB A;  4A97 A;  3RKO A;  3N5L A;  5HCJ A;  4HWI B;  2IIU A;  1OED B;  4G63 A;  3ONL C;  4DR3 T;  5DAB A;  2C5K T;  1SA0 E;  4IRE A;  2I6H A;  1YQ3 A;  5LHI B;  3VU7 H;  3K3O A;  2WMN A;  4EV6 A;  3KVA A;  1I94 T;  3AE6 A;  2FBW A;  5FL0 A;  1YXR A;  4ZOL E;  5AQG B;  4ZI2 D;  4I50 E;  2CRB A;  3ZYM A;  2IC6 A;  4ILU A;  1HF8 A;  5HXH A;  4YJ2 E;  1MIY A;  1ZEE A;  2VQF T;  3PUW F;  2PBI A;  3E22 E;  2CEA A;  4H9O C;  4B6X A;  1QUU A;  2JPF A;  2WBL A;  4IL9 A;  3SWH A;  1IAP A;  4NXN T;  3EAB A;  4XZC A;  4I43 B;  1HX8 A;  5JR9 A;  2D0T A;  3WAJ A;  5LGU B;  3L3P A;  5HWY A;  3I1A A;  4HTE A;  2ZLY A;  1EZ3 A;  4GOU A;  3PUX F;  2XAS B;  2CXF A;  4UIG A;  2NTY A;  3HKE E;  3UFG A;  1BR1 A;  4PK6 A;  2ACX A;  2OLT A;  5H6R B;  4YY3 T;  3Q5D A;  4MAL A;  2K48 A;  2XSA A;  4A56 A;  4L0R A;  4QXB B;  4YFS A;  3C98 B;  2XQ3 A;  1WRD A;  4IT4 A;  4IDO A;  3VKH A;  5JRC A;  2WAU A;  4TUY E;  2MYS A;  4UVC B;  1HTJ F;  2X0L B;  3D0T A;  2IW5 B;  2CXD A;  2H3R A;  1XMO T;  3Q5X A;  1D1B A;  1US7 B;  3JAE A;  5LXT E;  4YHJ A;  2CM0 A;  2HN2 A;  3RF1 A;  5CA0 E;  4O2B E;  2IAK A;  1MMA A;  1UUS A;  3L39 A;  1MIV A;  3IF8 B;  2ES0 A;  3TKL B;  4ADZ A;  2KZ7 B;  4Z8X A;  2V7K A;  4OYK A;  3RGL A;  4DUZ T;  4IDQ A;  2C5I T;  4CI2 B;  3EVY A;  3Q5E A;  5LHH B;  4CN6 A;  1FEW A;  4LFC T;  2X9X A;  4JBW F;  2WM9 A;  4DV6 T;  4JI8 T;  2E9X A;  2UUB T;  2NW8 A;  5BMV E;  4IDN A;  1E1H B;  4I55 E;  2YIN A;  4DR1 T;  4E7Z A;  2ACZ A;  4O4L E;  4X5T A;  5L4H A;  4U31 A;  3FBZ A;  4XAX B;  3ZYL A;  2E9X D;  4ZS3 A;  4JI1 T;  4QWN B;  4G2A A;  4DR7 T;  4QHO A;  1N36 T;  1T98 A;  2LHR A;  4E7S A;  4HFI A;  5HAX A;  4OX9 T;  3BQL A;  4YXD A;  4BJM A;  2VQE T;  2DCF A;  3CPZ A;  3JC6 D;  4PAG A;  5GON E;  4LFA T;  3AEA A;  2V6Y A;  4IHJ E;  2LLY A;  2KWI B;  2V7M A;  3BQK A;  2M6I A;  4IE6 A;  3H3M A;  4UV8 B;  3KBT A;  2XUE A;  2RP4 A;  5AQV B;  3N9P A;  4IE4 A;  5AQS B;  3RYC E;  5LOV E;  1KNR A;  3KFW X;  5KDM C;  2G0U A;  3ANW B;  3PUV F;  2B76 A;  1UUR A;  3PDY A;  4ANJ A;  5EK3 A;  3PUY F;  4IE7 A;  5L3C B;  3C4Z A;  2J47 A;  3QK6 A;  4FJO A;  4H9R C;  2I0M A;  5CJ5 A;  3CIR A;  2JQK A;  2Y6X A;  1X9B A;  4NUV A;  3K3N A;  3RKG A;  3NBX X;  4DID B;  4AI6 A;  2ZM0 A;  2A3D A;  2VVS A;  3RIU C;  4DV5 T;  2D2S A;  1FMW A;  4DV2 T;  5AQN B;  4U2Z A;  4TNW A;  4B3R T;  2AE9 A;  2CXL A;  5AQH B;  4LF4 T;  2WP9 A;  4IE5 A;  4KHP T;  3RIF A;  4LF8 T;  3VHL A;  5FXX A;  2BG9 C;  4TNV A;  2UXC T;  2WU5 A;  2IDO B;  3ZJ2 A;  4HWD A;  4WNK A;  2Q9Q B;  5CGM A;  3E08 A;  4U7I A;  1IBK T;  2KXP B;  3EAM A;  5J1G A;  4ERR A;  4DMW A;  1Z8U A;  1YW0 A;  3RPU A;  1OWA A;  2V26 A;  4DV3 T;  5LBQ B;  3P4S A;  2BVM A;  3MK7 C;  3N2G E;  4ZI2 C;  4YTN A;  2DL1 A;  2DNX A;  4QX8 B;  5HYA A;  5JDL A;  2EHO A;  4X65 T;  4ZI3 C;  5AQJ B;  5DQV A;  2XM2 A;  5JQG E;  4IDZ A;  4JI2 T;  1N34 T;  2NTX A;  5ABH A;  5LG3 A;  3N9N A;  3L09 A;  2Y8D A;  1OED A;  4HFH A;  4P09 A;  3VR9 A;  3MZK B;  3PUA A;  2M6B A;  2X67 A;  2JRK A;  2EHO D;  2UXN B;  3NKZ A;  3VKG A;  1S35 A;  3NZP A;  2CLY C;  3JAF A;  3UQ4 A;  4DO0 A;  4C91 A;  4DBR A;  2XAJ B;  1E7P A;  3P4W A;  4TWH A;  1D0Z A;  4MBQ A;  2V1D B;  3O4X E;  2YDR A;  4HGA A;  1XWM A;  5EK4 A;  5JTG A;  4A5X A;  3LDQ B;  4OHF A;  4LF5 T;  1S94 A;  1WYB A;  1WFD A;  3E0Z A;  4H9N C;  5ADX L;  1MMD A;  4F8H A;  4LMJ A;  2LE8 A;  3L8R A;  3T8O A;  1IJ6 A;  4ZZC A;  4EOZ B;  4WBN E;  4B3M T;  3HA4 A;  1YKH B;  1SHZ C;  1QSD A;  3O1H A;  4JLE A;  2BG9 E;  3KV4 A;  2KSR A;  3UUL A;  1BR4 A;  4K0U A;  3PU3 A;  2LM2 A;  3KIN B;  3UU3 A;  2CBJ A;  1N32 T;  2CBI A;  2DI4 A;  2H88 A;  1M62 A;  3AA7 B;  3B57 A;  5KXJ A;  4H9Q C;  4X62 T;  4EYY R;  2VUR A;  2E8I A;  4UXN B;  1Y01 A;  2A2F X;  1MNE A;  2J4G A;  2KWH A;  3AEB A;  2XQ6 A;  2K5B B;  4O8S A;  1E2A A;  2LKG A;  5FNV E;  4I4T E;  3LG7 A;  1U5P A;  3DP7 A;  4YJ3 E;  4MHC A;  3OTO T;  4Z90 A;  4WW0 A;  3LBX B;  4QH5 A;  4J2C A;  4ZXL A;  4LF6 T;  3FZL B;  5H6Q B;  4CI1 B;  5LJM A;  5AQO B;  4EEB A;  5L47 A;  4AIU A;  3CKD A;  2DLR A;  2FJD A;  1D0X A;  2M67 A;  5HEJ A;  4YTP A;  1HG5 A;  3M3Z B;  4ILA A;  5C8Y E;  2QA7 A;  4GYS A;  2X51 A;  5FVL A;  5M4Y A;  3VR8 A;  2UUC T;  3LK4 2;  3HKC E;  3SS1 A;  4QH1 A;  5LNK A;  3ZC0 A;  2LRL A;  3CVR A;  1HG2 A;  4UF0 B;  3F2E A;  3RQW A;  1R8I A;  1LKX A;  4IIJ E;  3P8C D;  1D0Y A;  3JC6 C;  3DTO A;  5FMN A;  3N9Q A;  3NZQ A;  4COF A;  4QX7 B;  2W66 A;  1Y64 B;  2LSJ A;  3HI2 A;  4ZI7 E;  3P4P A;  4JI4 T;  4HWH A;  4F6R C;  3LK2 B;  4O4H E;  4DND A;  4ILB A;  2HPL A;  2XAF B;  4PJM A;  2BBH A;  4NXM T;  1NWM X;  3JCF A;  4OK0 A;  3NVO A;  3RLF F;  4PJJ A;  5ABG A;  4PNI A;  3U3I A;  1WR6 A;  1UX5 A;  2Z6E A;  2D5U A;  2IUB A;  4IST A;  4CXW A;  4KX6 A;  2CE7 A;  2XAH B;  5AQT B;  4HE8 A;  2ZMA A;  3G06 A;  2XHE B;  3QB5 A;  2KND A;  4AQY T;  2BS3 A;  1J1J A;  4JUY A;  3OJA A;  4NUU A;  2H7V C;  5L3B B;  4CI3 B;  1WCR A;  2VB6 A;  4JI3 T;  3BK9 A;  2LOS A;  2WS3 A;  2YU1 A;  2QVA A;  3ANW A;  5CA1 E;  3ZN1 B;  3ETU A;  3RYF E;  5L3D B;  4P0A A;  1MMG A;  2W61 A;  5DJQ C;  4AKH A;  2C0S A;  1YD8 G;  2BG9 B;  3KDS E;  3S4U A;  2LT3 A;  1JNR A;  1XNR T;  5FP3 A;  3SOL A;  2E5L T;  3P50 A;  3MXZ A;  3ZCI A;  4UEL A;  1IBM T;  3AVR A;  4B3S T;  4K0K T;  3LFM A;  2E5V A;  5AQM B;  3FZM B;  3UUM A;  2NW7 A;  2WCA A;  1AJ3 A;  2K3W A;  4DV1 T;  3ZN0 B;  3PUZ F;  2KIN B;  3SFE A;  5AQK B;  2OV9 A;  1XDP A;  1N33 T;  4YSY A;  1NEN A;  5EK2 A;  1T7S A;  4A98 A;  4DMV A;  2BKO A;  1KEY A;  4N78 D;  4EGW A;  4HKA A;  3V5S A;  5JDN A;  4LFB T;  1KNZ A;  3AXJ B;  4ISS A;  2Q9Q A;  3CQX C;  2X68 A;  3AE4 A;  2XPK A;  2VKO A;  3OYZ A;  2EHO C;  4LF7 T;  2VWA A;  3BQI A;  4WZX A;  4EYU A;  5JDH A;  2Y48 B;  2V7J A;  2CWY A;  5HWX A;  4KI0 F;  2FJA A;  5JRE A;  4KBM B;  5HXC A;  4CN1 A;  2Q9Q D;  3PJA A;  2NR4 A;  3EUH A;  1KF6 A;  1NAF A;  3ZC1 A; 
#chains in the Genus database with same CATH homology
 3MK7 C;  3N2G E;  4ZS2 A;  5CB4 E;  3I0O A;  4ZI2 C;  3RC8 A;  1G8X A;  3AA6 B;  1BR2 A;  2DNX A;  3I0Q A;  4X1I E;  2GK9 A;  4QX8 B;  2NOX A;  4AQF A;  5LHG B;  3ZMU B;  1YKE B;  2YK0 A;  1OXZ A;  5HYA A;  4L9I A;  5F3J A;  1LVF A;  5JDL A;  2EHO A;  4ZI3 C;  5HXE A;  3R84 B;  4YLH A;  4CQI A;  3EDV A;  5DQV A;  4QKN A;  2I59 A;  5JQG E;  5LGT B;  4IDZ A;  2C5J A;  4GYR A;  2NTX A;  2WMO A;  3AAA B;  2K24 A;  4AXP A;  5FYM A;  3N9N A;  4WBO A;  5LGN B;  4HFV A;  5L3F B;  3L09 A;  3O1I A;  2Y8D A;  4X20 E;  3CQC B;  2EHO B;  1O3X A;  2L3L A;  2WSS V;  5DQW A;  5EZY E;  5L3G B;  4P09 A;  3IBP A;  2BZB A;  3HR0 A;  4GK0 E;  2V7I A;  3MZK B;  3RRC A;  4AQG A;  3PUA A;  2N2N A;  2X67 A;  2CWO A;  3RKO A;  3K3Q C;  4UVA B;  2JRK A;  2EHO D;  2UXN B;  4TN7 B;  3N5L A;  3VKG A;  1S35 A;  3NZP A;  4ASK A;  2CLY C;  4P0B A;  4G63 A;  1MMN A;  3MKD A;  4DO0 A;  5DAB A;  2KLQ A;  4C91 A;  2C5K T;  1SA0 E;  4DBR A;  1IZN B;  2XAJ B;  1LVK A;  5HXS A;  3O1J A;  2DWK A;  4O4J E;  3DJB A;  5LHI B;  2D0U A;  3VU7 H;  2X66 A;  4EB6 E;  1D0Z A;  4MBQ A;  5JRC B;  2V1D B;  3K3O A;  2WMN A;  3LJC A;  3KVA A;  3ZMV B;  3FXD B;  3O4X E;  4HGA A;  4TV9 E;  3KV9 A;  4UEM A;  4O4I E;  3OKQ A;  3RRW A;  3I9Y A;  5EK4 A;  1X79 A;  4ZOL E;  2KT9 A;  4OHF A;  4X1K E;  1S94 A;  4ZI2 D;  4EIW A;  1WYB A;  3PUS A;  4I50 E;  3NRX A;  4O2A E;  5FY7 A;  3ZYM A;  4AKG A;  2IC6 A;  4ILU A;  3P7I A;  3IEE A;  5LA6 E;  3QUJ A;  3E0Z A;  1HF8 A;  4DVD A;  1UX4 A;  2ODU A;  4H63 V;  5HXH A;  3U78 A;  4HN9 A;  4H9N C;  4YJ2 E;  1MMD A;  5ADX L;  3C4W A;  3CX6 B;  3FB2 A;  1LRZ A;  3RC3 A;  1MIY A;  1ZEE A;  2LE8 A;  1MND A;  2JJ9 A;  2P9B A;  3T8O A;  1IJ6 A;  1HCI A;  3CQG B;  4EOZ B;  3C51 A;  4WBN E;  3RYH E;  2PBI A;  3HA4 A;  3E22 E;  1ZV4 X;  2CEA A;  2UXX B;  1YKH B;  3B13 A;  1SHZ C;  3HKD E;  3KBU A;  3RX6 A;  4H9O C;  1QSD A;  3O1H A;  4B6X A;  4PK4 A;  4JLE A;  3FXE B;  4M1P A;  5A1L A;  1CUN A;  2VKD A;  5FY1 A;  3C64 A;  2CLY B;  1QUU A;  2PJQ A;  3KV4 A;  3UUL A;  1BR4 A;  1MIW A;  2JPF A;  2WBL A;  4K0U A;  2LSY A;  3SWH A;  3PU3 A;  3OYX A;  1IAP A;  5JDM A;  3LK3 B;  4GK5 E;  2OA5 A;  2H7O A;  4XZC A;  4I43 B;  1HX8 A;  3W15 B;  3N2O A;  3KIN B;  3ZCJ A;  4PFP A;  5JR9 A;  2D0T A;  3WI3 A;  3WAJ A;  5LG4 A;  5LGU B;  3L3P A;  3AA1 B;  4PJL A;  2YU2 A;  2DI4 A;  2LM9 A;  5TAO A;  5HWY A;  3I1A A;  4TZ4 C;  4V1A v;  4AKI A;  3CX8 B;  4HTE A;  2ZLY A;  3NRY A;  3AA7 B;  3F31 A;  1EZ3 A;  3B57 A;  4GOU A;  4H9Q C;  5FXZ A;  3ZEF B;  4EYY R;  3OBV E;  5JR9 B;  2XAS B;  5FXV A;  5KX5 E;  2CXF A;  4UIG A;  2NTY A;  3HKE E;  2E8I A;  4UXN B;  3PUG A;  3GN5 A;  2MTQ A;  1BR1 A;  3UUN A;  2KMF A;  3ZJ1 A;  3UTK A;  2X9Y A;  2A2F X;  3CML A;  4PK6 A;  3LBX A;  1MNE A;  2ACX A;  2DWG A;  2KWH A;  5H6R B;  3RH3 A;  4BJN A;  2K5B B;  4O8S A;  5J2U E;  5FNV E;  3A5X A;  3CX7 B;  4MAL A;  2K48 A;  3GN5 B;  1BR0 A;  4I4T E;  3LG7 A;  4PW8 A;  1U5P A;  3DP7 A;  4YJ3 E;  4C90 A;  1KK7 A;  4MHC A;  1HFA A;  4XBF B;  4A56 A;  2LOP A;  4WW0 A;  3LBX B;  1WYC A;  3ETV A;  4L0R A;  4QXB B;  5JVD E;  3AVS A;  4YFS A;  3C98 B;  4J2C A;  2VK9 A;  4KMC A;  1WRD A;  5H6Q B;  2QGS A;  3VKH A;  1B7T A;  4CI1 B;  4KUM B;  5JRC A;  2WAU A;  2MBG A;  5LJM A;  4TUY E;  3MAC A;  2MYS A;  4UVC B;  1HTJ F;  2X0L B;  4EAH A;  3CKD A;  3Q9D A;  2DLR A;  3D0T A;  1D0X A;  2M67 A;  4EZH A;  2IW5 B;  2CXD A;  4UF0 A;  2H3R A;  5AFU L;  3Q5X A;  1HG5 A;  5C8Y E;  3FHN A;  2N9D A;  5L2L A;  1D1B A;  1US7 B;  2QA7 A;  4GYS A;  2X51 A;  4MFR A;  3K8P C;  4YHJ A;  5LXT E;  2CM0 A;  5M4Y A;  1U4Q A;  5CA0 E;  2ZM8 A;  4MLK A;  4O2B E;  3LK4 2;  2IAK A;  1MMA A;  3HKC E;  3SS1 A;  4AKL A;  5LNK A;  3C4X A;  3ZC0 A;  3PUQ A;  3GMI A;  1MIV A;  3J7Y q;  3CVR A;  3IF8 B;  1HG2 A;  4U74 A;  4UF0 B;  2ES0 A;  2WWU A;  5JR9 C;  3F2E A;  3TKL B;  5LJN A;  2LSK A;  2XAG B;  1LKX A;  4ADZ A;  2KZ7 B;  2XTL A;  3P8C D;  4IIJ E;  1VRB A;  4Z8X A;  2V7K A;  1D0Y A;  3JC6 C;  3Q5W A;  3DTO A;  4OYK A;  5FMN A;  4JEH B;  1ZHC A;  3N9Q A;  4GIW A;  4OYJ A;  2LEH A;  2C5I T;  3NZQ A;  2JMK A;  4PK5 A;  3ZMS B;  4CI2 B;  3EVY A;  4QX7 B;  3F57 A;  4H9P C;  5L3E B;  4BA9 A;  5LHH B;  1Y64 B;  1FEW A;  3ZMZ B;  2LSJ A;  2BVL A;  3HI2 A;  2LSG A;  2X9X A;  4ZI7 E;  5JDG A;  4H9S E;  2WM9 A;  3CWZ B;  2LSI A;  2IC9 A;  2VAS A;  3MA9 A;  2E9X A;  4F6R C;  3LK2 B;  2NW8 A;  5BMV E;  4O4H E;  4DND A;  3UUX B;  1E1H B;  4H63 H;  4I55 E;  2HPL A;  2YIN A;  2XAF B;  3N2K E;  2YEV C;  4PJM A;  2DHR A;  4E7Z A;  1NWM X;  5JH7 E;  4PFO A;  4OK0 A;  5E0O A;  2E9X B;  1G73 A;  1V9D A;  1WLX A;  4L5G A;  3AB3 B;  4OFZ A;  3UFE A;  3PE0 A;  4O4L E;  4PJJ A;  5LYJ E;  3QC9 A;  4PNI A;  3U3I A;  3ZLI A;  1WR6 A;  1UX5 A;  2MOZ A;  2Z6E A;  2D5U A;  4IST A;  3FBZ A;  1FIO A;  2CMR A;  4XAX B;  4CXW A;  3ZYL A;  2E9X D;  4ZS3 A;  3SRZ A;  4QWN B;  2CE7 A;  2XAH B;  4G2A A;  2A72 A;  2SPC A;  3FBL A;  4HE8 A;  2ZMA A;  4QHO A;  1T98 A;  2XHE B;  1HS7 A;  2LHR A;  2XAQ B;  4E7S A;  4QXC B;  4AKR B;  3PTR B;  4EZ4 A;  3O9X A;  4U72 A;  2KND A;  3KVB A;  3N9M A;  4FI5 A;  4TX5 A;  5HAX A;  1ZKE A;  2L9Q A;  4JUY A;  3OJA A;  4NUU A;  2H7V C;  3BQL A;  2X9H A;  4BJM A;  3N9L A;  5J2T E;  2NP9 A;  2DCF A;  5L3B B;  3CPZ A;  5JDF A;  3JC6 D;  4PAG A;  5GON E;  4CI3 B;  2W00 A;  4JEU B;  4CXX A;  2VB6 A;  4IHJ E;  4UVB B;  2LJL A;  3EDU A;  3BK9 A;  2HH7 A;  2J1D G;  2LOS A;  3I9W A;  3Q2M A;  2YU1 A;  2KWI B;  5KMG P;  3KV5 A;  2V7M A;  3BQK A;  3ANW A;  5CA1 E;  3ZN1 B;  3AAI A;  3ETU A;  3RYF E;  5L3D B;  4IE6 A;  4ZHQ E;  4P0A A;  1MMG A;  4EXT A;  4UV8 B;  3KBT A;  2W61 A;  5DJQ C;  2XUE A;  2RP4 A;  4AKH A;  3ZC1 A;  2C0S A;  3N9P A;  1YD8 G;  2JMH A;  3AA0 B;  2B1E A;  4IE4 A;  4CXY A;  2V7L A;  2VKJ A;  4UV9 B;  1UCU A;  3KDS E;  3RYC E;  5LOV E;  3HL6 A;  3N9O A;  5ETW A;  5HXR A;  3KFW X;  5KDM C;  3H3A A;  3S4U A;  2G0U A;  2LT3 A;  3ANW B;  2BDE A;  3MJX A;  2E9X C;  5FP3 A;  3SOL A;  1H7C A;  1IJ5 A;  3MXZ A;  3PUR A;  3J9X 1;  2CA5 A;  4UEL A;  3PDY A;  3ZCI A;  4ANJ A;  5EK3 A;  2Q9Q C;  2CCQ A;  3AVR A;  4KP3 C;  4IE7 A;  5L3C B;  3C4Z A;  2W62 A;  3ZMT B;  3QK6 A;  4FJO A;  4H9R C;  3LFM A;  4PJN A;  1Z0P A;  2Y6X A;  3UUM A;  2JQQ A;  4IGU A;  2NW7 A;  3GA8 A;  4NUV A;  2W63 A;  3K3N A;  3KV6 A;  3NBX X;  1AJ3 A;  4AI6 A;  2VL8 A;  3ZN0 B;  2X9W A;  5F8P A;  1D1C A;  2KIN B;  3RYI E;  2ZM0 A;  2A3D A;  2LHN A;  2RA1 A;  3ZYK A;  5LBM A;  4QXH B;  2D2S A;  5EK2 A;  5IYZ E;  4DMV A;  1FMW A;  3ONX A;  2W0G A;  4N78 D;  1VOM A;  2K9A A;  1FMV A;  4HKA A;  3V5S A;  2CXL A;  5JDN A;  4BAY B;  1KNZ A;  4TV8 E;  1D1A A;  4ZI3 D;  4ISS A;  2L8K A;  2Q9Q A;  3CQX C;  4IE5 A;  3UT5 E;  2XQY A;  2X68 A;  4AQF C;  5LP6 E;  5JDQ A;  3VHL A;  2VKO A;  5FXX A;  3OYZ A;  2EHO C;  2ODV A;  3ZJ2 A;  2VWA A;  3BQI A;  3C50 A;  3IHR A;  4CZZ B;  4X1Y E;  2PG8 A;  4EYU A;  5JDH A;  3PU8 A;  2HPJ A;  4WNK A;  2Q9Q B;  3AAE B;  2Y48 B;  2VKH A;  2PFV A;  2CWY A;  2V7J A;  3E08 A;  3ESL A;  4IE0 A;  3R6N A;  2KXP B;  5HWX A;  5J1G A;  2ZM2 A;  3ZPO A;  5JRE A;  5LCY A;  4ERR A;  4KBM B;  5HXC A;  5FXW A;  5FY0 A;  3H37 A;  2NW9 A;  4DMW A;  2Q9Q D;  3GWH A;  4DBQ A;  1YW0 A;  2NWB A;  3RPU A;  3EUH A;  3WAK A;  1OWA A;  2V26 A;  5IHY A;  4HEA A;  3HKB E;  3M65 A;  3V5U A;  5LBQ B;  1NAF A;  2N1G A;  2BVM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...