1S94A

Crystal structure of the habc domain of neuronal syntaxin from the squid loligo pealei
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
121
structure length
109
Chain Sequence
GFMEEFFEQVEEIRAMIDKISDNVDAVKKKHSDILSMKEELEELMTDIKRTANKVRGKLKTIELNIEQEESADLRIRKTQYSTISRKFVEVMSDYNTTQIDYRDRCKAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords s-syntaxin
publication title Crystal structure of the Habc domain of neuronal syntaxin from the squid Loligo pealei reveals conformational plasticity at its C-terminus
pubmed doi rcsb
source organism Loligo pealei
molecule tags Endocytosis/exocytosis
total genus 38
structure length 109
sequence length 121
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-02-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.70 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 1s94A00
1HS7A 3LG7A 2XHEB 1EZ3A 4JEHB 5LG4A 1BR0A 1S94A 1FEWA 1G73A 2DNXA 4JEUB 5M4YA 1FIOA 4TX5A 3C98B
chains in the Genus database with same CATH superfamily
2BZBA 1VCTA 2ODUA 4QXHB 5AQNB 1G8XA 4EEDA 3Q5DA 3FBZA 1WFDA 3OVUA 4TWHA 4TN7B 5FXVA 5LMNT 4K0UA 2VVNA 4HN9A 4I0UA 5IHYA 1KNZA 2MYSA 3CPZA 2ZM0A 3HKBE 1ZP0A 4PK4A 5ETWA 3SOLA 3AAAB 3ZC0A 3ZC1A 5LOVE 4H9NC 3O9XA 3C4XA 2BS3A 1DU2A 2WM9A 4A98A 2E9XC 2WS3A 2DHRA 4LFBT 2X0YA 4I55E 4DR4T 5LB7B 4AIUA 5LBMA 4EIWA 4O4LE 3RX6A 2NOXA 4PNIA 5HWXA 3ANWB 2V7MA 2YU1A 3KDSE 2BBJA 2LM9A 3ZN1B 2W63A 4EXTA 4H63H 3WAJA 2H89A 3ZEFB 2NTYA 1YQ4A 4HFHA 2VK9A 3P8CD 2DWKA 4H9PC 2NW9A 2XSBA 4EB6E 5C8YE 2WDVA 2MPKA 4CI2B 1U5PA 3PU8A 1T8BA 3PUSA 2SPCA 4UVCB 3JCFA 4K0KT 4HTEA 3OJAA 2KXPB 4CXXA 4J2CA 4NPPA 4COFA 2E9XA 2OV9A 4DNDA 3L09A 4JI3T 2VB6A 1KNRA 2MTQA 4UVBB 2LHRA 5DQWA 3CX7B 2V7JA 4DV7T 3UU8A 4U3CA 4IL9A 3C51A 5FVKA 3J9X1 4YY3T 3JAEA 4PFOA 3MKDA 5EK4A 3NWIA 3PUAA 4JI0T 1LVFA 3BQKA 5LNKA 2WDRA 3EDVA 2XQ3A 4FJOA 5CA0E 1S35A 4HWIB 3AEEA 4EAHA 3MJXA 2GK9A 3CQXC 2D9DA 4PJLA 5JRCA 1AJ3A 3RLFF 3K1SA 2CHOA 4X1IE 4A97A 4O4JE 2X68A 4YT0A 3VRAA 3PUVF 4HWDA 4X62T 3UTKA 4AKHA 4H9OC 1FJGT 4UR9A 4IDZA 5DABA 3GMIA 1ZV4X 2Q9QA 2YOEA 2D2SA 2HN2A 3UUXB 3NVOA 4DR2T 5KXJA 4U7YA 5L3GB 4OYKA 5AQKB 2HHHT 2E8IA 4JI1T 3HL6A 4IE4A 5ABGA 3BK9A 1FEWA 3ONXA 1YD8G 3OTOT 3U3IA 3CQCB 4ILUA 4JI4T 2FUPA 5C2TA 3LBXB 1QUUA 1W9RA 2MAWA 2XSAA 3ANWA 3ETVA 3QB5K 1YKHB 1NAFA 4ZEYA 3QC9A 2WMOA 3ZYLA 2FJEA 1YXRA 2JMKA 4CI3B 4DIDB 3P7IA 1CUNA 4WYVA 2W4XA 3LFMA 2YU2A 4IGUA 3UU4A 5AQFB 1R8IA 4B3TT 4ZI3D 4EOZB 1WCRA 3RQWA 3AA0B 3N5LA 4ZXLA 3ZCJA 3UU3A 5J1GA 2A9UA 1M7KA 2K3WA 1VCSA 2HPJA 2M6BA 3CKDA 3RYIE 2HN1A 4DV2T 3K3QC 5DJQC 5HXEA 3VKHA 4JLEA 5JH7E 4GYSA 5FMNA 1MIWA 4IE5A 3UFEA 1HG2A 3UULA 2KINB 2A2FX 4KBMB 2V5CA 2VWAA 4JI8T 4JEUB 2UXDT 2X67A 1HX8A 2IDOB 4OX9T 1HS7A 4G63A 2BKOA 2XTLA 5KX5E 4OFZA 4UIGA 3RC3A 2V7IA 1WYBA 4IHJE 2X9YA 1XMOT 4DBRA 5C3JA 4LFAT 5A1LA 4QH1A 4ZI2D 4AKGA 3TLSA 2P9BA 4U31A 3AEAA 4UF0B 3PU3A 3CVRA 2L9QA 2XQ5A 2VKHA 5AQHB 1X9BA 4ZI7E 3QUJA 1OEDA 1G73A 3MXZA 3GWHA 4EYYR 3VRBA 3TLVA 2V7LA 4DV1T 1FMVA 2LEHA 1KFYA 1WRDA 4Q25A 3P4QA 1N32T 2EHOB 3HR0A 5AQUB 1UX4A 2QGSA 4AI6A 4MALA 3VU7H 3UQ7A 3RIUC 3AAIA 1J5ET 2YN6A 1O3XA 2ACXA 4YXDA 3JADA 2C5KT 3MA9A 4LF8T 4KX6A 2E5VA 4ZI2C 3ZT7A 2UXCT 3AEGA 3N9MA 2BS2A 4MBQA 1S94A 4YLHA 2V6YB 3RRWA 2ZLYA 1UX5A 1SE7A 3LK3B 4ADZA 4MLKA 2Y8DA 1IBKT 1D0ZA 4UV8B 1GQEA 1MNEA 3AAEB 2JQQA 3ETUA 3LK42 5L3FB 3RYHE 1XDPA 4QH4A 3IHRA 2X51A 1W0BA 1EZ3A 3KV5A 2LOPA 3FXDB 2WY2A 2CMRA 1N34T 2FBWA 3LSVA 1NENA 5HEUA 2YKSA 1KK7A 1Z0PA 5HCJA 4B3RT 5ABFA 3AECA 1MMDA 4A56A 5AQTB 2IAKA 4JUYA 4H9SE 4CN6A 3Q5EA 1IJ5A 3AA6B 5LJNA 2CEAA 2DNXA 3PUWF 2N9DA 4LMLA 2M6IA 3KBUA 5BR8T 3KFWX 3UT5E 1IJ6A 5FL1A 2BS4A 2IUBA 1D1AA 1N36T 3N9OA 1Y64B 4P1NA 1FIOA 2LT3A 4LF6T 4PJJA 3CQGB 4GOUA 2WQYA 5FL0A 4CZZB 4YJ3E 2V7KA 4ERRA 2CPTA 5LHIB 5EZYE 2UU9T 3UU5A 4I4TE 4E7SA 3C50A 3HKDE 5AQPB 4DV4T 3ZJ2A 3NKZA 4L5GA 4QH5A 4X1KE 2LRKA 2V8SV 5L4EA 1OXZA 1XNQT 2I6HA 3EUHA 1ZEEA 4TV9E 3K3NA 2DWGA 2H7VC 1BR4A 2L8KA 2FJDA 3NRYA 3I9YA 3PUZF 4XAXB 4GYRA 3RC8A 4NIQA 3RGLA 3EABA 5F8PA 4IL4A 3ZMSB 2WMNA 3MZKB 3T1HT 4ZS3A 4DR6T 1MIYA 2LSGA 5FY1A 2VL0A 2A72A 2Q9QD 3ZSSA 3OPCA 4OYJA 2A3DA 2WBLA 3HKEE 2HPLA 1X79A 3PUXF 4YTPA 5JDMA 4X66T 4C91A 5CJ5A 2D0UA 2LKHA 4JI7T 3CK6A 2D0TA 3ZJ1A 4YHJA 3FZMB 2N2NA 5KDMC 2VKDA 2X9HA 4CXYA 1UURA 2DLRA 5HAXA 5FXZA 3JAFA 5KMGP 4Z8XA 2V6YA 2ES0A 2UUAT 3X1DA 2QA7A 1JNZA 4IDQA 4UEMA 2VQFT 3FZFB 1YW0A 2NTXA 4QXCB 2XZEA 3ZCIA 1FMWA 4CN4A 2V5DA 3R84B 5F3JA 2LSKA 4DMWA 1NEKA 4H9QC 2Q9QC 4ZS2A 4JI5T 4PK6A 3ESLA 4KHZF 5E0OA 4B3ST 3O4XE 2J1DG 5HXHA 3LJCA 2XPKA 1LRZA 2Y6XA 3KVAA 1T98A 5LCYA 2XUEA 1OWAA 4YSXA 4P0BA 2X0LB 3I9WA 1WR6A 2Z6EA 1JNRA 1IAPA 2CXDA 3L8RA 2KLQA 3NZPA 2ZM2A 4TV8E 1MNDA 5FXWA 5LBQB 5AQRB 5HXCA 2I59A 3RIFA 3P4PA 3QB5A 4GK0E 3DJBA 3KV4A 3IF8B 2UUCT 3PTRB 3P4WA 2UXNB 3SWHA 4BJNA 1D1BA 3QK6A 4CN1A 5JDHA 3CX6B 4XBFB 2JIWA 2WU5A 1WLXA 3VKGA 4IE0A 2AXDS 3WAKA 5J2UE 2KNDA 3ONLC 5GONE 2CLYC 4ISSA 4JI6T 2JPFA 3AE2A 4DV6T 2YDRA 4YTNA 5CA1E 2WP9A 2DCFA 4LFCT 2RPAA 3SRZA 5LGTB 3E0ZA 4YTMA 3ONJA 4ASKA 1I94T 2XAJB 4HKAA 5LGNB 2WZIA 3AB3B 5LG4A 2YINA 3RH3A 2CRBA 2W62A 4GK5E 4AQGA 4LMJA 1MMAA 4QHOA 2XAHB 1MMGA 3LK2B 2XQAA 4HEAA 1T7SA 3BQIA 1WYCA 4U74A 4YSZA 4HFDA 4KI0F 2CXLA 4KUMB 1KEYA 4WZXA 3FHNA 3AA1B 4KP3C 3C4ZA 2KMFA 1XMQT 5FY7A 3FXEB 4JYAT 3EI0A 2VASA 1ZKEA 5LMUT 3PJAA 3R6NA 3AE5A 2H7OA 3K8PC 5JR9B 4TNWA 1BR2A 4X20E 1HR0T 3L39A 5CFBA 3BQLA 2ZM8A 1OEDC 4YHHT 4QX8B 2DI4A 3AE3A 5LHGB 2B1EA 3ZYMA 3AVRA 2BG9B 3N9QA 3PE0A 3ZSTA 4X1YE 3P4SA 1HX1B 3AE4A 2RP4A 2JQ9A 3UU6A 2CHNA 4ILCA 3EHZA 4ZHQE 4AKRB 4ZZCA 4YJ2E 3D0TA 4HWCA 4UV9B 2JQKA 2QYWA 4AQFC 4BJMA 3FZHB 4FI5A 2W61A 4TWFA 2JJ9A 4OHFA 2WZHA 4OK0A 1W09A 4O2AE 3W15B 2IHR1 3WI3A 2RA1A 4I50E 3N2GE 2XAFB 4PK5A 5LGUB 3MK7C 5CGMA 4AQYT 4LF5T 4PJMA 3Q5WA 1HF8A 5TAOA 3RYCE 3H3MA 3A8YC 2LJLA 4H9RC 2PTFA 4DR5T 2NWBA 1SA0E 5JDNA 2NP9A 2V26A 2ZM6T 2BVMA 2W66A 4CI1B 4IE7A 4EGWA 4ZOLE 1I6ZA 4EZHA 1LVKA 4UVAB 3K3OA 3GN5B 3E08A 3N9LA 4AQFA 2BKPA 3LBXA 2UXBT 3OBVE 5ABHA 3A5XA 4B6XA 4MFRA 4U7IA 2FJAA 2YEVC 2XAGB 4PW8A 2XY8B 3NRXA 4LF7T 2J4GA 2H88A 2MOZA 3DTOA 1IBLT 4N78D 3ZMTB 1N33T 3EAMA 3ZMZB 4HFCA 2HH7A 4PAGA 3EDUA 2E9XB 4KMCA 5EK2A 2BG9E 2VURA 3I0OA 5JDQA 3AE6A 3B13A 5AQGB 3ZMVB 5JREA 4MHCA 4CXWA 3T8OA 4P09A 1M62A 3IBPA 2MBGA 1YQ3A 4XZCA 4DMVA 3SFEA 3RKGA 3DP7A 2QVAA 2X9XA 4ISTA 1J1JA 3RKOA 5HEGA 5L4HA 3TLWA 3N2KE 3CX8B 2F4VT 3PUGA 4JBWF 3KINB 5FP3A 4HE8A 4WNKA 4HFIA 3ZLIA 5L47A 4F6RC 3V5SA 1L0VA 4E7ZA 3F57A 5AQIB 5AQQB 1E7PA 5LA6E 2XAQB 3C98B 5JRCB 5IUXA 1YKEB 3AA7B 2QRXA 4ILAA 3RQUA 3FZLB 1Z8UA 4Z91A 1IZNB 2W67A 2WCAA 4PJNA 1SHZC 1US7B 1BR0A 2YDSA 4WBOA 3KV6A 4TUYE 1XZYA 4L0RA 1SUMB 4UXNB 4I43B 2LOSA 4GKJT 1UCUA 2NR4A 3HA4A 2Q9QB 5AQVB 3JC6D 5L3BB 4UF0A 2LSYA 1ZHCA 4IDNA 5HXSA 2VVSA 1WR0A 1HG5A 2VKJA 2VQET 4LF4T 4QWNB 2R6GF 2EHOA 3L3PA 3V5UA 4WBNE 3KVBA 5AQJB 2C5JA 4PFPA 3QOFA 4HGAA 5JDFA 1W0AA 3GN5A 2M67A 2W00A 4WW0A 2CE7A 3M65A 2C5IT 4NUUA 1BR1A 3B5MA 2CBJA 3RF1A 2UUBT 3AEDA 2XJ7A 3FZKB 4DV5T 5JDGA 3RPUA 1MIVA 2BBHA 4QX7B 3JC6C 4IDOA 4DUYT 4HWFA 2IC9A 3I1AA 3O1HA 4F8HA 4IDPA 4Z90A 3CMLA 4YSYA 5J0ZA 4X64T 4B3MT 2X0HA 2H3RA 4NUVA 4C90A 3CWZB 3LDQB 2JMHA 2CLYB 5FY0A 3PUYF 1UK5A 1D1CA 4AISA 1UUSA 4JI2T 4ANJA 2CM0A 5HWYA 3AXJB 1HNXT 3G06A 3H37A 4DR3T 1D0XA 4L9IA 3TLTA 5FVLA 4IE6A 2KWHA 2E2AA 4U33A 3ZN0B 3LG7A 5LYJE 3N9PA 4O2BE 4IREA 5FNVE 3RYFE 2WB5A 2LHNA 2VL8A 1HCIA 5LP6E 3F2EA 3UUMA 1B7TA 2B76A 2W2UA 4BAYB 2IW5B 2K24A 2UXXB 5L3CB 3SS1A 2V1DB 3E22E 4GKKT 3Q5XA 2K9AA 1LKXA 4TX5A 4O4HE 1HTJF 2VKOA 3CIRA 4UELA 4DO0A 5ABEA 3NBXX 3GA8A 2NW7A 4AKIA 2XASB 4HWHA 4O8SA 3U78A 2XQ7A 3Q9DA 3QNUA 5EK3A 3KBTA 2IC6A 4LMKA 2OLTA 2D5UA 1UGOA 5IYZE 1E2AA 5ADXL 3RRCA 2V6XA 2WDQA 3H3AA 3UQ4A 3IEEA 1HFAA 1KNPA 1OEDB 5JQGE 5LXTE 2C0SA 3ZT5A 4KHPT 4BA9A 1XDOA 5L2LA 4IIJE 1XNRT 3PUQA 3P50A 3AEBA 5AQOB 4JEHB 1ZOYA 5HEOA 2ODVA 2JQHA 2OA5A 3VHLA 1KF6A 3P4RA 3PJAJ 5AQLB 5LG3A 4HFBA 2J47A 2XQ8A 5HEJA 5FYMA 1MMNA 3M3ZB 3UUNA 5H6QB 2BKNA 3O1JA 3S4UA 3UFGA 5JDLA 3OYZA 3AE1A 4QXBB 3UUBA 2KZ7B 3FBLA 4U2ZA 1H7CA 2I0MA 3ZT6A 3IA3A 2XQ6A 3ZPOA 3J7Yq 3PDYA 5AQSB 3Q2MA 2FJBA 3F31A 4ZZBA 4DUZT 3ZMUB 5ABFB 1XWMA 4TZ4C 4V1Av 3AE7A 3RHWA 4X5TA 2CA5A 3I0QA 4IT4A 1D0YA 2WAUA 3AXJA 4EEBA 4DBQA 1NWMX 2CCQA 2LRLA 2LSIA 5LHHB 2X9WA 5LJMA 2WWUA 2BVLA 5L3DB 2X66A 1VRBA 4O4IE 5H6RB 2IIUA 2LM2A 2LLYA 1T72A 2PJQA 1U4QA 2CBIA 3TKLB 2J62A 3A7MA 3FB2A 4EV6A 1OEDE 3OYXA 4YFSA 5DQVA 4ZI3C 2WU2A 4DV0T 2PFVA 4EZ4A 2KWIB 3AE9A 2XHEB 2XQ4A 5M4YA 1QSDA 3C64A 5BMVE 1CHUA 3AVSA 3AEFA 2YDQA 2G0UA 3AE8A 1J5WA 3TLUA 4NXMT 4HFVA 3RI5A 4AKLA 4CQIA 3EVYA 1VOMA 5CB4E 4EYUA 5IWAT 4LF9T 4TNVA 5FKYA 1HNWT 5HYAA 2PBIA 4X65T 5JR9C 4DVDA 2KT9A 5HEHA 5FXXA 4DR1T 3RIAA 2BDEA 1HNZT 2XM1A 4NXNT 3ZYKA 3B57A 1QLBA 4G2AA 2BG9C 3PV0F 2CWYA 2XQ9A 4DR7T 3PURA 1Y01A 2NW8A 4P0AA 2EHOD 3KV9A 5L3EB 3VR9A 2JRKA 4U2YA 2DL1A 5HXRA 2L3LA 2ACZA 1IBMT 3C4WA 3O1IA 2XQYA 2WSSV 4U72A 2AE9A 2CWOA 3ZKRA 4TWDA 3HI2A 4QKNA 2LE8A 2IMLA 3SFDA 2N1GA 2ZMAA 4DV3T 4ILBA 5F5WA 3MACA 3N9NA 5JR9A 3OKQA 2K48A 4JV5T 2W0GA 3NZQA 2LKGA 3RIUA 2Y48B 4HFEA 4AXPA 5J2TE 3VR8A 2CXFA 3ABVA 4A5XA 3T1YT 1E1HB 2PG8A 2BG9A 2KSRA 5JVDE 4M1PA 2E9XD 4GIWA 3N2OA 2K5BB 4H63V 2YK0A 2EHOC 3HKCE 5AQMB 5AFUL 2XM2A 2E5LT 5HCMA 2WWVA 5JTGA 2LSJA 1V9DA
chains in the Genus database with same CATH topology
3QUJA 2BZBA 3AB3B 5LG4A 2ODUA 2YINA 3RH3A 1G73A 4ANJA 2CM0A 3MXZA 4QXHB 3GWHA 4EYYR 2W62A 4GK5E 5HWYA 2V7LA 4AQGA 1FMVA 1MMAA 4QHOA 1G8XA 2XAHB 1MMGA 3LK2B 2LEHA 3FBZA 4HEAA 3H37A 1WRDA 3BQIA 1WYCA 1D0XA 4L9IA 4TN7B 4U74A 2EHOB 5FXVA 4IE6A 2KWHA 4K0UA 4KUMB 2CXLA 3HR0A 3ZN0B 4EIWA 4HN9A 3LG7A 5LYJE 1UX4A 2QGSA 3N9PA 4O2BE 5IHYA 1KNZA 4AI6A 2MYSA 4MALA 3CPZA 3VU7H 2ZM0A 3FHNA 3AA1B 4KP3C 5FNVE 3C4ZA 3RYFE 2KMFA 3HKBE 3AAIA 4PK4A 2LHNA 2VL8A 5FY7A 1HCIA 3FXEB 5ETWA 3SOLA 1O3XA 5LP6E 2ACXA 2VASA 3AAAB 3F2EA 3ZC0A 3UUMA 1B7TA 4BAYB 2IW5B 2K24A 3ZC1A 2UXXB 2C5KT 3MA9A 1ZKEA 5LOVE 5L3CB 4H9NC 3O9XA 3SS1A 3C4XA 2V1DB 3E22E 4ZI2C 3R6NA 3K8PC 2H7OA 5JR9B 3Q5XA 2WM9A 2K9AA 3N9MA 2E9XC 1BR2A 4X20E 4MBQA 1S94A 2DHRA 4YLHA 3RRWA 1LKXA 3BQLA 4TX5A 4O4HE 1HTJF 2VKOA 1UX5A 2ZLYA 2ZM8A 4DO0A 4UELA 4I55E 3LK3B 4QX8B 3NBXX 4ADZA 4MLKA 2DI4A 2Y8DA 3GA8A 1D0ZA 2NW7A 4O4LE 4UV8B 5LBMA 2B1EA 2NOXA 2XASB 3AVRA 3RX6A 4PNIA 3ZYMA 5LHGB 5HWXA 4O8SA 3ANWB 1MNEA 2V7MA 2YU1A 2JQQA 3AAEB 3ETUA 3KDSE 3LK42 3N9QA 3PE0A 3RYHE 5L3FB 2LM9A 4X1YE 5EK3A 3IHRA 3ZN1B 3KBTA 2IC6A 2W63A 2X51A 2RP4A 2D5UA 4EXTA 1EZ3A 3KV5A 2LOPA 3FXDB 5IYZE 4H63H 5ADXL 3RRCA 2CMRA 4ZHQE 4AKRB 3WAJA 4YJ2E 3ZEFB 3H3AA 2NTYA 3IEEA 2VK9A 3P8CD 1HFAA 2DWKA 4H9PC 3D0TA 5JQGE 5LXTE 4UV9B 1KK7A 1Z0PA 2C0SA 4AQFC 4BA9A 4BJMA 4FI5A 2W61A 2NW9A 2JJ9A 4OHFA 4EB6E 5C8YE 4OK0A 5L2LA 4IIJE 4O2AE 3W15B 1MMDA 4A56A 2IAKA 3PUQA 4CI2B 4JUYA 1U5PA 3PU8A 4H9SE 2RA1A 3WI3A 3PUSA 4I50E 2SPCA 2XAFB 3N2GE 4PK5A 5LGUB 1IJ5A 3AA6B 5LJNA 3MK7C 4JEHB 2CEAA 4AKIA 4UVCB 2DNXA 2ODVA 2N9DA 4PJMA 4HTEA 3OJAA 2OA5A 1HF8A 2KXPB 3Q5WA 3VHLA 4CXXA 4J2CA 5TAOA 3RYCE 2E9XA 3KBUA 3KFWX 4DNDA 3L09A 3UT5E 1IJ6A 2LJLA 1D1AA 4H9RC 5FYMA 1MMNA 2VB6A 3N9OA 1Y64B 3UUNA 5H6QB 1FIOA 2LT3A 2NWBA 3O1JA 3S4UA 1SA0E 2MTQA 4UVBB 4PJJA 5JDNA 2NP9A 2V26A 3CQGB 4GOUA 5JDLA 3OYZA 2LHRA 5DQWA 2BVMA 4QXBB 3CX7B 2V7JA 4YJ3E 4CZZB 2V7KA 2KZ7B 4ERRA 3C51A 5LHIB 3J9X1 3FBLA 4CI1B 4IE7A 5EZYE 4ZOLE 4PFOA 4EZHA 3MKDA 1LVKA 1H7CA 4UVAB 4I4TE 5EK4A 4E7SA 3PUAA 3K3OA 3C50A 1LVFA 3HKDE 3BQKA 3GN5B 3E08A 5LNKA 3EDVA 3N9LA 4AQFA 3ZJ2A 3ZPOA 4FJOA 3J7Yq 3LBXA 3OBVE 4L5GA 5CA0E 3A5XA 1S35A 4B6XA 4X1KE 3PDYA 4MFRA 1OXZA 3MJXA 4EAHA 2GK9A 3CQXC 3Q2MA 4PJLA 3EUHA 5JRCA 1ZEEA 2YEVC 4TV9E 3F31A 2DWGA 3K3NA 1AJ3A 2XAGB 4PW8A 2H7VC 3NRXA 1BR4A 2L8KA 3ZMUB 4TZ4C 4V1Av 3NRYA 3I9YA 4X1IE 2MOZA 2CA5A 3DTOA 4O4JE 2X68A 3I0QA 4XAXB 1D0YA 2WAUA 4GYRA 3RC8A 5F8PA 4N78D 3UTKA 3ZMTB 3ZMSB 4AKHA 4H9OC 2WMNA 1NWMX 4DBQA 3ZMZB 2CCQA 3MZKB 2HH7A 2LSIA 5LHHB 2X9WA 4IDZA 4PAGA 5DABA 4ZS3A 3EDUA 2E9XB 4KMCA 5EK2A 5LJMA 3GMIA 1MIYA 2LSGA 5FY1A 3I0OA 5JDQA 2WWUA 2BVLA 3B13A 2A72A 5L3DB 2Q9QD 4OYJA 2X66A 2A3DA 3ZMVB 5JREA 2WBLA 1VRBA 3HKEE 2HPLA 4MHCA 4CXWA 1X79A 3T8OA 1ZV4X 5JDMA 2Q9QA 4O4IE 5H6RB 4P09A 3IBPA 4C91A 2MBGA 2D2SA 2D0UA 2D0TA 2PJQA 3UUXB 1U4QA 4XZCA 4YHJA 3ZJ1A 4DMVA 3TKLB 3U78A 3FB2A 2N2NA 3DP7A 3Q9DA 5KDMC 4OYKA 2X9XA 5L3GB 2VKDA 3OYXA 4YFSA 4ISTA 5DQVA 2X9HA 2E8IA 3RKOA 4ZI3C 3HL6A 4IE4A 4CXYA 3BK9A 2DLRA 1FEWA 5HAXA 3N2KE 3CX8B 3PUGA 5FXZA 3ONXA 5KMGP 1YD8G 3KINB 5FP3A 4HE8A 4WNKA 3ZLIA 4Z8XA 2PFVA 2ES0A 4EZ4A 3U3IA 4F6RC 2KWIB 3V5SA 2QA7A 3CQCB 4ILUA 2XHEB 4E7ZA 3F57A 5M4YA 1QSDA 3C64A 3LBXB 1QUUA 4UEMA 5BMVE 3AVSA 2G0UA 3ANWA 3ETVA 1YKHB 1NAFA 5LA6E 2XAQB 3C98B 3QC9A 4HFVA 2WMOA 5JRCB 1YW0A 2NTXA 4QXCB 1YKEB 3AA7B 4AKLA 4CQIA 3ZCIA 1FMWA 3EVYA 1VOMA 5CB4E 4EYUA 3R84B 5F3JA 2LSKA 4DMWA 3ZYLA 4H9QC 2Q9QC 4ZS2A 1IZNB 2JMKA 4PK6A 3ESLA 4CI3B 4PJNA 5E0OA 1SHZC 1US7B 3O4XE 3P7IA 1BR0A 1CUNA 2J1DG 5HXHA 3LJCA 4WBOA 5HYAA 3KV6A 3LFMA 1LRZA 2YU2A 4TUYE 2PBIA 2Y6XA 3KVAA 4IGUA 1T98A 5LCYA 2XUEA 4L0RA 5JR9C 4UXNB 1OWAA 4I43B 2KT9A 4DVDA 2LOSA 4ZI3D 4EOZB 4P0BA 5FXXA 1UCUA 2BDEA 2X0LB 3HA4A 3I9WA 1WR6A 2Q9QB 3JC6D 5L3BB 4UF0A 3AA0B 2Z6EA 3N5LA 2LSYA 3ZCJA 3ZYKA 1ZHCA 3B57A 1IAPA 5J1GA 2CXDA 4G2AA 2CWYA 5HXSA 2KLQA 1HG5A 2VKJA 3NZPA 3PURA 2HPJA 3CKDA 2ZM2A 4TV8E 2NW8A 1MNDA 3RYIE 5FXWA 5LBQB 5HXCA 4P0AA 2EHOD 2I59A 4QWNB 3KV9A 5L3EB 2JRKA 3K3QC 5DJQC 5HXEA 4GK0E 3VKHA 3DJBA 2EHOA 3IF8B 3KV4A 4JLEA 4GYSA 3L3PA 3V5UA 4WBNE 3PTRB 5JH7E 5FMNA 5HXRA 3KVBA 1MIWA 4IE5A 3UFEA 1HG2A 2UXNB 2C5JA 2L3LA 4PFPA 3C4WA 3O1IA 3UULA 2KINB 3SWHA 2A2FX 4HGAA 5JDFA 2XQYA 4KBMB 2WSSV 4U72A 4BJNA 1D1BA 3GN5A 2VWAA 2CWOA 3QK6A 2M67A 2W00A 4JEUB 4WW0A 2X67A 2CE7A 1HX8A 5JDHA 3M65A 2C5IT 3HI2A 4QKNA 2LE8A 4NUUA 1BR1A 3CX6B 4XBFB 2N1GA 2ZMAA 1HS7A 1WLXA 3VKGA 4G63A 4IE0A 3MACA 3N9NA 5JR9A 3WAKA 5J2UE 3OKQA 2K48A 2KNDA 2XTLA 5KX5E 5JDGA 2W0GA 3RPUA 5GONE 1MIVA 4OFZA 3NZQA 4QX7B 2CLYC 3JC6C 4ISSA 2Y48B 4UIGA 4AXPA 3RC3A 5J2TE 2JPFA 2V7IA 2IC9A 1WYBA 2CXFA 3I1AA 4IHJE 3O1HA 2X9YA 5CA1E 4DBRA 1E1HB 2PG8A 3CMLA 2DCFA 5A1LA 4ZI2D 5JVDE 3SRZA 5LGTB 4M1PA 4AKGA 2E9XD 3E0ZA 4GIWA 3N2OA 2K5BB 4H63V 2YK0A 2P9BA 2EHOC 3HKCE 5AFUL 4ASKA 4UF0B 3PU3A 2H3RA 4NUVA 4C90A 3CWZB 3CVRA 2L9QA 2JMHA 2CLYB 2LSJA 2XAJB 4HKAA 5FY0A 2VKHA 1V9DA 5LGNB 1D1CA 4ZI7E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HS7 A;  3LG7 A;  2XHE B;  1EZ3 A;  4JEH B;  5LG4 A;  1BR0 A;  1S94 A;  1FEW A;  1G73 A;  2DNX A;  4JEU B;  5M4Y A;  1FIO A;  4TX5 A;  3C98 B; 
#chains in the Genus database with same CATH topology
 2BZB A;  1VCT A;  2ODU A;  4QXH B;  5AQN B;  1G8X A;  4EED A;  3Q5D A;  3FBZ A;  1WFD A;  3OVU A;  4TWH A;  4TN7 B;  5FXV A;  5LMN T;  4K0U A;  2VVN A;  4HN9 A;  4I0U A;  5IHY A;  1KNZ A;  2MYS A;  3CPZ A;  2ZM0 A;  3HKB E;  1ZP0 A;  4PK4 A;  5ETW A;  3SOL A;  3AAA B;  3ZC0 A;  3ZC1 A;  5LOV E;  4H9N C;  3O9X A;  3C4X A;  2BS3 A;  1DU2 A;  2WM9 A;  4A98 A;  2E9X C;  2WS3 A;  2DHR A;  4LFB T;  2X0Y A;  4I55 E;  4DR4 T;  5LB7 B;  4AIU A;  5LBM A;  4EIW A;  4O4L E;  3RX6 A;  2NOX A;  4PNI A;  5HWX A;  3ANW B;  2V7M A;  2YU1 A;  3KDS E;  2BBJ A;  2LM9 A;  3ZN1 B;  2W63 A;  4EXT A;  4H63 H;  3WAJ A;  2H89 A;  3ZEF B;  2NTY A;  1YQ4 A;  4HFH A;  2VK9 A;  3P8C D;  2DWK A;  4H9P C;  2NW9 A;  2XSB A;  4EB6 E;  5C8Y E;  2WDV A;  2MPK A;  4CI2 B;  1U5P A;  3PU8 A;  1T8B A;  3PUS A;  2SPC A;  4UVC B;  3JCF A;  4K0K T;  4HTE A;  3OJA A;  2KXP B;  4CXX A;  4J2C A;  4NPP A;  4COF A;  2E9X A;  2OV9 A;  4DND A;  3L09 A;  4JI3 T;  2VB6 A;  1KNR A;  2MTQ A;  4UVB B;  2LHR A;  5DQW A;  3CX7 B;  2V7J A;  4DV7 T;  3UU8 A;  4U3C A;  4IL9 A;  3C51 A;  5FVK A;  3J9X 1;  4YY3 T;  3JAE A;  4PFO A;  3MKD A;  5EK4 A;  3NWI A;  3PUA A;  4JI0 T;  1LVF A;  3BQK A;  5LNK A;  2WDR A;  3EDV A;  2XQ3 A;  4FJO A;  5CA0 E;  1S35 A;  4HWI B;  3AEE A;  4EAH A;  3MJX A;  2GK9 A;  3CQX C;  2D9D A;  4PJL A;  5JRC A;  1AJ3 A;  3RLF F;  3K1S A;  2CHO A;  4X1I E;  4A97 A;  4O4J E;  2X68 A;  4YT0 A;  3VRA A;  3PUV F;  4HWD A;  4X62 T;  3UTK A;  4AKH A;  4H9O C;  1FJG T;  4UR9 A;  4IDZ A;  5DAB A;  3GMI A;  1ZV4 X;  2Q9Q A;  2YOE A;  2D2S A;  2HN2 A;  3UUX B;  3NVO A;  4DR2 T;  5KXJ A;  4U7Y A;  5L3G B;  4OYK A;  5AQK B;  2HHH T;  2E8I A;  4JI1 T;  3HL6 A;  4IE4 A;  5ABG A;  3BK9 A;  1FEW A;  3ONX A;  1YD8 G;  3OTO T;  3U3I A;  3CQC B;  4ILU A;  4JI4 T;  2FUP A;  5C2T A;  3LBX B;  1QUU A;  1W9R A;  2MAW A;  2XSA A;  3ANW A;  3ETV A;  3QB5 K;  1YKH B;  1NAF A;  4ZEY A;  3QC9 A;  2WMO A;  3ZYL A;  2FJE A;  1YXR A;  2JMK A;  4CI3 B;  4DID B;  3P7I A;  1CUN A;  4WYV A;  2W4X A;  3LFM A;  2YU2 A;  4IGU A;  3UU4 A;  5AQF B;  1R8I A;  4B3T T;  4ZI3 D;  4EOZ B;  1WCR A;  3RQW A;  3AA0 B;  3N5L A;  4ZXL A;  3ZCJ A;  3UU3 A;  5J1G A;  2A9U A;  1M7K A;  2K3W A;  1VCS A;  2HPJ A;  2M6B A;  3CKD A;  3RYI E;  2HN1 A;  4DV2 T;  3K3Q C;  5DJQ C;  5HXE A;  3VKH A;  4JLE A;  5JH7 E;  4GYS A;  5FMN A;  1MIW A;  4IE5 A;  3UFE A;  1HG2 A;  3UUL A;  2KIN B;  2A2F X;  4KBM B;  2V5C A;  2VWA A;  4JI8 T;  4JEU B;  2UXD T;  2X67 A;  1HX8 A;  2IDO B;  4OX9 T;  1HS7 A;  4G63 A;  2BKO A;  2XTL A;  5KX5 E;  4OFZ A;  4UIG A;  3RC3 A;  2V7I A;  1WYB A;  4IHJ E;  2X9Y A;  1XMO T;  4DBR A;  5C3J A;  4LFA T;  5A1L A;  4QH1 A;  4ZI2 D;  4AKG A;  3TLS A;  2P9B A;  4U31 A;  3AEA A;  4UF0 B;  3PU3 A;  3CVR A;  2L9Q A;  2XQ5 A;  2VKH A;  5AQH B;  1X9B A;  4ZI7 E;  3QUJ A;  1OED A;  1G73 A;  3MXZ A;  3GWH A;  4EYY R;  3VRB A;  3TLV A;  2V7L A;  4DV1 T;  1FMV A;  2LEH A;  1KFY A;  1WRD A;  4Q25 A;  3P4Q A;  1N32 T;  2EHO B;  3HR0 A;  5AQU B;  1UX4 A;  2QGS A;  4AI6 A;  4MAL A;  3VU7 H;  3UQ7 A;  3RIU C;  3AAI A;  1J5E T;  2YN6 A;  1O3X A;  2ACX A;  4YXD A;  3JAD A;  2C5K T;  3MA9 A;  4LF8 T;  4KX6 A;  2E5V A;  4ZI2 C;  3ZT7 A;  2UXC T;  3AEG A;  3N9M A;  2BS2 A;  4MBQ A;  1S94 A;  4YLH A;  2V6Y B;  3RRW A;  2ZLY A;  1UX5 A;  1SE7 A;  3LK3 B;  4ADZ A;  4MLK A;  2Y8D A;  1IBK T;  1D0Z A;  4UV8 B;  1GQE A;  1MNE A;  3AAE B;  2JQQ A;  3ETU A;  3LK4 2;  5L3F B;  3RYH E;  1XDP A;  4QH4 A;  3IHR A;  2X51 A;  1W0B A;  1EZ3 A;  3KV5 A;  2LOP A;  3FXD B;  2WY2 A;  2CMR A;  1N34 T;  2FBW A;  3LSV A;  1NEN A;  5HEU A;  2YKS A;  1KK7 A;  1Z0P A;  5HCJ A;  4B3R T;  5ABF A;  3AEC A;  1MMD A;  4A56 A;  5AQT B;  2IAK A;  4JUY A;  4H9S E;  4CN6 A;  3Q5E A;  1IJ5 A;  3AA6 B;  5LJN A;  2CEA A;  2DNX A;  3PUW F;  2N9D A;  4LML A;  2M6I A;  3KBU A;  5BR8 T;  3KFW X;  3UT5 E;  1IJ6 A;  5FL1 A;  2BS4 A;  2IUB A;  1D1A A;  1N36 T;  3N9O A;  1Y64 B;  4P1N A;  1FIO A;  2LT3 A;  4LF6 T;  4PJJ A;  3CQG B;  4GOU A;  2WQY A;  5FL0 A;  4CZZ B;  4YJ3 E;  2V7K A;  4ERR A;  2CPT A;  5LHI B;  5EZY E;  2UU9 T;  3UU5 A;  4I4T E;  4E7S A;  3C50 A;  3HKD E;  5AQP B;  4DV4 T;  3ZJ2 A;  3NKZ A;  4L5G A;  4QH5 A;  4X1K E;  2LRK A;  2V8S V;  5L4E A;  1OXZ A;  1XNQ T;  2I6H A;  3EUH A;  1ZEE A;  4TV9 E;  3K3N A;  2DWG A;  2H7V C;  1BR4 A;  2L8K A;  2FJD A;  3NRY A;  3I9Y A;  3PUZ F;  4XAX B;  4GYR A;  3RC8 A;  4NIQ A;  3RGL A;  3EAB A;  5F8P A;  4IL4 A;  3ZMS B;  2WMN A;  3MZK B;  3T1H T;  4ZS3 A;  4DR6 T;  1MIY A;  2LSG A;  5FY1 A;  2VL0 A;  2A72 A;  2Q9Q D;  3ZSS A;  3OPC A;  4OYJ A;  2A3D A;  2WBL A;  3HKE E;  2HPL A;  1X79 A;  3PUX F;  4YTP A;  5JDM A;  4X66 T;  4C91 A;  5CJ5 A;  2D0U A;  2LKH A;  4JI7 T;  3CK6 A;  2D0T A;  3ZJ1 A;  4YHJ A;  3FZM B;  2N2N A;  5KDM C;  2VKD A;  2X9H A;  4CXY A;  1UUR A;  2DLR A;  5HAX A;  5FXZ A;  3JAF A;  5KMG P;  4Z8X A;  2V6Y A;  2ES0 A;  2UUA T;  3X1D A;  2QA7 A;  1JNZ A;  4IDQ A;  4UEM A;  2VQF T;  3FZF B;  1YW0 A;  2NTX A;  4QXC B;  2XZE A;  3ZCI A;  1FMW A;  4CN4 A;  2V5D A;  3R84 B;  5F3J A;  2LSK A;  4DMW A;  1NEK A;  4H9Q C;  2Q9Q C;  4ZS2 A;  4JI5 T;  4PK6 A;  3ESL A;  4KHZ F;  5E0O A;  4B3S T;  3O4X E;  2J1D G;  5HXH A;  3LJC A;  2XPK A;  1LRZ A;  2Y6X A;  3KVA A;  1T98 A;  5LCY A;  2XUE A;  1OWA A;  4YSX A;  4P0B A;  2X0L B;  3I9W A;  1WR6 A;  2Z6E A;  1JNR A;  1IAP A;  2CXD A;  3L8R A;  2KLQ A;  3NZP A;  2ZM2 A;  4TV8 E;  1MND A;  5FXW A;  5LBQ B;  5AQR B;  5HXC A;  2I59 A;  3RIF A;  3P4P A;  3QB5 A;  4GK0 E;  3DJB A;  3KV4 A;  3IF8 B;  2UUC T;  3PTR B;  3P4W A;  2UXN B;  3SWH A;  4BJN A;  1D1B A;  3QK6 A;  4CN1 A;  5JDH A;  3CX6 B;  4XBF B;  2JIW A;  2WU5 A;  1WLX A;  3VKG A;  4IE0 A;  2AXD S;  3WAK A;  5J2U E;  2KND A;  3ONL C;  5GON E;  2CLY C;  4ISS A;  4JI6 T;  2JPF A;  3AE2 A;  4DV6 T;  2YDR A;  4YTN A;  5CA1 E;  2WP9 A;  2DCF A;  4LFC T;  2RPA A;  3SRZ A;  5LGT B;  3E0Z A;  4YTM A;  3ONJ A;  4ASK A;  1I94 T;  2XAJ B;  4HKA A;  5LGN B;  2WZI A;  3AB3 B;  5LG4 A;  2YIN A;  3RH3 A;  2CRB A;  2W62 A;  4GK5 E;  4AQG A;  4LMJ A;  1MMA A;  4QHO A;  2XAH B;  1MMG A;  3LK2 B;  2XQA A;  4HEA A;  1T7S A;  3BQI A;  1WYC A;  4U74 A;  4YSZ A;  4HFD A;  4KI0 F;  2CXL A;  4KUM B;  1KEY A;  4WZX A;  3FHN A;  3AA1 B;  4KP3 C;  3C4Z A;  2KMF A;  1XMQ T;  5FY7 A;  3FXE B;  4JYA T;  3EI0 A;  2VAS A;  1ZKE A;  5LMU T;  3PJA A;  3R6N A;  3AE5 A;  2H7O A;  3K8P C;  5JR9 B;  4TNW A;  1BR2 A;  4X20 E;  1HR0 T;  3L39 A;  5CFB A;  3BQL A;  2ZM8 A;  1OED C;  4YHH T;  4QX8 B;  2DI4 A;  3AE3 A;  5LHG B;  2B1E A;  3ZYM A;  3AVR A;  2BG9 B;  3N9Q A;  3PE0 A;  3ZST A;  4X1Y E;  3P4S A;  1HX1 B;  3AE4 A;  2RP4 A;  2JQ9 A;  3UU6 A;  2CHN A;  4ILC A;  3EHZ A;  4ZHQ E;  4AKR B;  4ZZC A;  4YJ2 E;  3D0T A;  4HWC A;  4UV9 B;  2JQK A;  2QYW A;  4AQF C;  4BJM A;  3FZH B;  4FI5 A;  2W61 A;  4TWF A;  2JJ9 A;  4OHF A;  2WZH A;  4OK0 A;  1W09 A;  4O2A E;  3W15 B;  2IHR 1;  3WI3 A;  2RA1 A;  4I50 E;  3N2G E;  2XAF B;  4PK5 A;  5LGU B;  3MK7 C;  5CGM A;  4AQY T;  4LF5 T;  4PJM A;  3Q5W A;  1HF8 A;  5TAO A;  3RYC E;  3H3M A;  3A8Y C;  2LJL A;  4H9R C;  2PTF A;  4DR5 T;  2NWB A;  1SA0 E;  5JDN A;  2NP9 A;  2V26 A;  2ZM6 T;  2BVM A;  2W66 A;  4CI1 B;  4IE7 A;  4EGW A;  4ZOL E;  1I6Z A;  4EZH A;  1LVK A;  4UVA B;  3K3O A;  3GN5 B;  3E08 A;  3N9L A;  4AQF A;  2BKP A;  3LBX A;  2UXB T;  3OBV E;  5ABH A;  3A5X A;  4B6X A;  4MFR A;  4U7I A;  2FJA A;  2YEV C;  2XAG B;  4PW8 A;  2XY8 B;  3NRX A;  4LF7 T;  2J4G A;  2H88 A;  2MOZ A;  3DTO A;  1IBL T;  4N78 D;  3ZMT B;  1N33 T;  3EAM A;  3ZMZ B;  4HFC A;  2HH7 A;  4PAG A;  3EDU A;  2E9X B;  4KMC A;  5EK2 A;  2BG9 E;  2VUR A;  3I0O A;  5JDQ A;  3AE6 A;  3B13 A;  5AQG B;  3ZMV B;  5JRE A;  4MHC A;  4CXW A;  3T8O A;  4P09 A;  1M62 A;  3IBP A;  2MBG A;  1YQ3 A;  4XZC A;  4DMV A;  3SFE A;  3RKG A;  3DP7 A;  2QVA A;  2X9X A;  4IST A;  1J1J A;  3RKO A;  5HEG A;  5L4H A;  3TLW A;  3N2K E;  3CX8 B;  2F4V T;  3PUG A;  4JBW F;  3KIN B;  5FP3 A;  4HE8 A;  4WNK A;  4HFI A;  3ZLI A;  5L47 A;  4F6R C;  3V5S A;  1L0V A;  4E7Z A;  3F57 A;  5AQI B;  5AQQ B;  1E7P A;  5LA6 E;  2XAQ B;  3C98 B;  5JRC B;  5IUX A;  1YKE B;  3AA7 B;  2QRX A;  4ILA A;  3RQU A;  3FZL B;  1Z8U A;  4Z91 A;  1IZN B;  2W67 A;  2WCA A;  4PJN A;  1SHZ C;  1US7 B;  1BR0 A;  2YDS A;  4WBO A;  3KV6 A;  4TUY E;  1XZY A;  4L0R A;  1SUM B;  4UXN B;  4I43 B;  2LOS A;  4GKJ T;  1UCU A;  2NR4 A;  3HA4 A;  2Q9Q B;  5AQV B;  3JC6 D;  5L3B B;  4UF0 A;  2LSY A;  1ZHC A;  4IDN A;  5HXS A;  2VVS A;  1WR0 A;  1HG5 A;  2VKJ A;  2VQE T;  4LF4 T;  4QWN B;  2R6G F;  2EHO A;  3L3P A;  3V5U A;  4WBN E;  3KVB A;  5AQJ B;  2C5J A;  4PFP A;  3QOF A;  4HGA A;  5JDF A;  1W0A A;  3GN5 A;  2M67 A;  2W00 A;  4WW0 A;  2CE7 A;  3M65 A;  2C5I T;  4NUU A;  1BR1 A;  3B5M A;  2CBJ A;  3RF1 A;  2UUB T;  3AED A;  2XJ7 A;  3FZK B;  4DV5 T;  5JDG A;  3RPU A;  1MIV A;  2BBH A;  4QX7 B;  3JC6 C;  4IDO A;  4DUY T;  4HWF A;  2IC9 A;  3I1A A;  3O1H A;  4F8H A;  4IDP A;  4Z90 A;  3CML A;  4YSY A;  5J0Z A;  4X64 T;  4B3M T;  2X0H A;  2H3R A;  4NUV A;  4C90 A;  3CWZ B;  3LDQ B;  2JMH A;  2CLY B;  5FY0 A;  3PUY F;  1UK5 A;  1D1C A;  4AIS A;  1UUS A;  4JI2 T;  4ANJ A;  2CM0 A;  5HWY A;  3AXJ B;  1HNX T;  3G06 A;  3H37 A;  4DR3 T;  1D0X A;  4L9I A;  3TLT A;  5FVL A;  4IE6 A;  2KWH A;  2E2A A;  4U33 A;  3ZN0 B;  3LG7 A;  5LYJ E;  3N9P A;  4O2B E;  4IRE A;  5FNV E;  3RYF E;  2WB5 A;  2LHN A;  2VL8 A;  1HCI A;  5LP6 E;  3F2E A;  3UUM A;  1B7T A;  2B76 A;  2W2U A;  4BAY B;  2IW5 B;  2K24 A;  2UXX B;  5L3C B;  3SS1 A;  2V1D B;  3E22 E;  4GKK T;  3Q5X A;  2K9A A;  1LKX A;  4TX5 A;  4O4H E;  1HTJ F;  2VKO A;  3CIR A;  4UEL A;  4DO0 A;  5ABE A;  3NBX X;  3GA8 A;  2NW7 A;  4AKI A;  2XAS B;  4HWH A;  4O8S A;  3U78 A;  2XQ7 A;  3Q9D A;  3QNU A;  5EK3 A;  3KBT A;  2IC6 A;  4LMK A;  2OLT A;  2D5U A;  1UGO A;  5IYZ E;  1E2A A;  5ADX L;  3RRC A;  2V6X A;  2WDQ A;  3H3A A;  3UQ4 A;  3IEE A;  1HFA A;  1KNP A;  1OED B;  5JQG E;  5LXT E;  2C0S A;  3ZT5 A;  4KHP T;  4BA9 A;  1XDO A;  5L2L A;  4IIJ E;  1XNR T;  3PUQ A;  3P50 A;  3AEB A;  5AQO B;  4JEH B;  1ZOY A;  5HEO A;  2ODV A;  2JQH A;  2OA5 A;  3VHL A;  1KF6 A;  3P4R A;  3PJA J;  5AQL B;  5LG3 A;  4HFB A;  2J47 A;  2XQ8 A;  5HEJ A;  5FYM A;  1MMN A;  3M3Z B;  3UUN A;  5H6Q B;  2BKN A;  3O1J A;  3S4U A;  3UFG A;  5JDL A;  3OYZ A;  3AE1 A;  4QXB B;  3UUB A;  2KZ7 B;  3FBL A;  4U2Z A;  1H7C A;  2I0M A;  3ZT6 A;  3IA3 A;  2XQ6 A;  3ZPO A;  3J7Y q;  3PDY A;  5AQS B;  3Q2M A;  2FJB A;  3F31 A;  4ZZB A;  4DUZ T;  3ZMU B;  5ABF B;  1XWM A;  4TZ4 C;  4V1A v;  3AE7 A;  3RHW A;  4X5T A;  2CA5 A;  3I0Q A;  4IT4 A;  1D0Y A;  2WAU A;  3AXJ A;  4EEB A;  4DBQ A;  1NWM X;  2CCQ A;  2LRL A;  2LSI A;  5LHH B;  2X9W A;  5LJM A;  2WWU A;  2BVL A;  5L3D B;  2X66 A;  1VRB A;  4O4I E;  5H6R B;  2IIU A;  2LM2 A;  2LLY A;  1T72 A;  2PJQ A;  1U4Q A;  2CBI A;  3TKL B;  2J62 A;  3A7M A;  3FB2 A;  4EV6 A;  1OED E;  3OYX A;  4YFS A;  5DQV A;  4ZI3 C;  2WU2 A;  4DV0 T;  2PFV A;  4EZ4 A;  2KWI B;  3AE9 A;  2XHE B;  2XQ4 A;  5M4Y A;  1QSD A;  3C64 A;  5BMV E;  1CHU A;  3AVS A;  3AEF A;  2YDQ A;  2G0U A;  3AE8 A;  1J5W A;  3TLU A;  4NXM T;  4HFV A;  3RI5 A;  4AKL A;  4CQI A;  3EVY A;  1VOM A;  5CB4 E;  4EYU A;  5IWA T;  4LF9 T;  4TNV A;  5FKY A;  1HNW T;  5HYA A;  2PBI A;  4X65 T;  5JR9 C;  4DVD A;  2KT9 A;  5HEH A;  5FXX A;  4DR1 T;  3RIA A;  2BDE A;  1HNZ T;  2XM1 A;  4NXN T;  3ZYK A;  3B57 A;  1QLB A;  4G2A A;  2BG9 C;  3PV0 F;  2CWY A;  2XQ9 A;  4DR7 T;  3PUR A;  1Y01 A;  2NW8 A;  4P0A A;  2EHO D;  3KV9 A;  5L3E B;  3VR9 A;  2JRK A;  4U2Y A;  2DL1 A;  5HXR A;  2L3L A;  2ACZ A;  1IBM T;  3C4W A;  3O1I A;  2XQY A;  2WSS V;  4U72 A;  2AE9 A;  2CWO A;  3ZKR A;  4TWD A;  3HI2 A;  4QKN A;  2LE8 A;  2IML A;  3SFD A;  2N1G A;  2ZMA A;  4DV3 T;  4ILB A;  5F5W A;  3MAC A;  3N9N A;  5JR9 A;  3OKQ A;  2K48 A;  4JV5 T;  2W0G A;  3NZQ A;  2LKG A;  3RIU A;  2Y48 B;  4HFE A;  4AXP A;  5J2T E;  3VR8 A;  2CXF A;  3ABV A;  4A5X A;  3T1Y T;  1E1H B;  2PG8 A;  2BG9 A;  2KSR A;  5JVD E;  4M1P A;  2E9X D;  4GIW A;  3N2O A;  2K5B B;  4H63 V;  2YK0 A;  2EHO C;  3HKC E;  5AQM B;  5AFU L;  2XM2 A;  2E5L T;  5HCM A;  2WWV A;  5JTG A;  2LSJ A;  1V9D A; 
#chains in the Genus database with same CATH homology
 3QUJ A;  2BZB A;  3AB3 B;  5LG4 A;  2ODU A;  2YIN A;  3RH3 A;  1G73 A;  4ANJ A;  2CM0 A;  3MXZ A;  4QXH B;  3GWH A;  4EYY R;  2W62 A;  4GK5 E;  5HWY A;  2V7L A;  4AQG A;  1FMV A;  1MMA A;  4QHO A;  1G8X A;  2XAH B;  1MMG A;  3LK2 B;  2LEH A;  3FBZ A;  4HEA A;  3H37 A;  1WRD A;  3BQI A;  1WYC A;  1D0X A;  4L9I A;  4TN7 B;  4U74 A;  2EHO B;  5FXV A;  4IE6 A;  2KWH A;  4K0U A;  4KUM B;  2CXL A;  3HR0 A;  3ZN0 B;  4EIW A;  4HN9 A;  3LG7 A;  5LYJ E;  1UX4 A;  2QGS A;  3N9P A;  4O2B E;  5IHY A;  1KNZ A;  4AI6 A;  2MYS A;  4MAL A;  3CPZ A;  3VU7 H;  2ZM0 A;  3FHN A;  3AA1 B;  4KP3 C;  5FNV E;  3C4Z A;  3RYF E;  2KMF A;  3HKB E;  3AAI A;  4PK4 A;  2LHN A;  2VL8 A;  5FY7 A;  1HCI A;  3FXE B;  5ETW A;  3SOL A;  1O3X A;  5LP6 E;  2ACX A;  2VAS A;  3AAA B;  3F2E A;  3ZC0 A;  3UUM A;  1B7T A;  4BAY B;  2IW5 B;  2K24 A;  3ZC1 A;  2UXX B;  2C5K T;  3MA9 A;  1ZKE A;  5LOV E;  5L3C B;  4H9N C;  3O9X A;  3SS1 A;  3C4X A;  2V1D B;  3E22 E;  4ZI2 C;  3R6N A;  3K8P C;  2H7O A;  5JR9 B;  3Q5X A;  2WM9 A;  2K9A A;  3N9M A;  2E9X C;  1BR2 A;  4X20 E;  4MBQ A;  1S94 A;  2DHR A;  4YLH A;  3RRW A;  1LKX A;  3BQL A;  4TX5 A;  4O4H E;  1HTJ F;  2VKO A;  1UX5 A;  2ZLY A;  2ZM8 A;  4DO0 A;  4UEL A;  4I55 E;  3LK3 B;  4QX8 B;  3NBX X;  4ADZ A;  4MLK A;  2DI4 A;  2Y8D A;  3GA8 A;  1D0Z A;  2NW7 A;  4O4L E;  4UV8 B;  5LBM A;  2B1E A;  2NOX A;  2XAS B;  3AVR A;  3RX6 A;  4PNI A;  3ZYM A;  5LHG B;  5HWX A;  4O8S A;  3ANW B;  1MNE A;  2V7M A;  2YU1 A;  2JQQ A;  3AAE B;  3ETU A;  3KDS E;  3LK4 2;  3N9Q A;  3PE0 A;  3RYH E;  5L3F B;  2LM9 A;  4X1Y E;  5EK3 A;  3IHR A;  3ZN1 B;  3KBT A;  2IC6 A;  2W63 A;  2X51 A;  2RP4 A;  2D5U A;  4EXT A;  1EZ3 A;  3KV5 A;  2LOP A;  3FXD B;  5IYZ E;  4H63 H;  5ADX L;  3RRC A;  2CMR A;  4ZHQ E;  4AKR B;  3WAJ A;  4YJ2 E;  3ZEF B;  3H3A A;  2NTY A;  3IEE A;  2VK9 A;  3P8C D;  1HFA A;  2DWK A;  4H9P C;  3D0T A;  5JQG E;  5LXT E;  4UV9 B;  1KK7 A;  1Z0P A;  2C0S A;  4AQF C;  4BA9 A;  4BJM A;  4FI5 A;  2W61 A;  2NW9 A;  2JJ9 A;  4OHF A;  4EB6 E;  5C8Y E;  4OK0 A;  5L2L A;  4IIJ E;  4O2A E;  3W15 B;  1MMD A;  4A56 A;  2IAK A;  3PUQ A;  4CI2 B;  4JUY A;  1U5P A;  3PU8 A;  4H9S E;  2RA1 A;  3WI3 A;  3PUS A;  4I50 E;  2SPC A;  2XAF B;  3N2G E;  4PK5 A;  5LGU B;  1IJ5 A;  3AA6 B;  5LJN A;  3MK7 C;  4JEH B;  2CEA A;  4AKI A;  4UVC B;  2DNX A;  2ODV A;  2N9D A;  4PJM A;  4HTE A;  3OJA A;  2OA5 A;  1HF8 A;  2KXP B;  3Q5W A;  3VHL A;  4CXX A;  4J2C A;  5TAO A;  3RYC E;  2E9X A;  3KBU A;  3KFW X;  4DND A;  3L09 A;  3UT5 E;  1IJ6 A;  2LJL A;  1D1A A;  4H9R C;  5FYM A;  1MMN A;  2VB6 A;  3N9O A;  1Y64 B;  3UUN A;  5H6Q B;  1FIO A;  2LT3 A;  2NWB A;  3O1J A;  3S4U A;  1SA0 E;  2MTQ A;  4UVB B;  4PJJ A;  5JDN A;  2NP9 A;  2V26 A;  3CQG B;  4GOU A;  5JDL A;  3OYZ A;  2LHR A;  5DQW A;  2BVM A;  4QXB B;  3CX7 B;  2V7J A;  4YJ3 E;  4CZZ B;  2V7K A;  2KZ7 B;  4ERR A;  3C51 A;  5LHI B;  3J9X 1;  3FBL A;  4CI1 B;  4IE7 A;  5EZY E;  4ZOL E;  4PFO A;  4EZH A;  3MKD A;  1LVK A;  1H7C A;  4UVA B;  4I4T E;  5EK4 A;  4E7S A;  3PUA A;  3K3O A;  3C50 A;  1LVF A;  3HKD E;  3BQK A;  3GN5 B;  3E08 A;  5LNK A;  3EDV A;  3N9L A;  4AQF A;  3ZJ2 A;  3ZPO A;  4FJO A;  3J7Y q;  3LBX A;  3OBV E;  4L5G A;  5CA0 E;  3A5X A;  1S35 A;  4B6X A;  4X1K E;  3PDY A;  4MFR A;  1OXZ A;  3MJX A;  4EAH A;  2GK9 A;  3CQX C;  3Q2M A;  4PJL A;  3EUH A;  5JRC A;  1ZEE A;  2YEV C;  4TV9 E;  3F31 A;  2DWG A;  3K3N A;  1AJ3 A;  2XAG B;  4PW8 A;  2H7V C;  3NRX A;  1BR4 A;  2L8K A;  3ZMU B;  4TZ4 C;  4V1A v;  3NRY A;  3I9Y A;  4X1I E;  2MOZ A;  2CA5 A;  3DTO A;  4O4J E;  2X68 A;  3I0Q A;  4XAX B;  1D0Y A;  2WAU A;  4GYR A;  3RC8 A;  5F8P A;  4N78 D;  3UTK A;  3ZMT B;  3ZMS B;  4AKH A;  4H9O C;  2WMN A;  1NWM X;  4DBQ A;  3ZMZ B;  2CCQ A;  3MZK B;  2HH7 A;  2LSI A;  5LHH B;  2X9W A;  4IDZ A;  4PAG A;  5DAB A;  4ZS3 A;  3EDU A;  2E9X B;  4KMC A;  5EK2 A;  5LJM A;  3GMI A;  1MIY A;  2LSG A;  5FY1 A;  3I0O A;  5JDQ A;  2WWU A;  2BVL A;  3B13 A;  2A72 A;  5L3D B;  2Q9Q D;  4OYJ A;  2X66 A;  2A3D A;  3ZMV B;  5JRE A;  2WBL A;  1VRB A;  3HKE E;  2HPL A;  4MHC A;  4CXW A;  1X79 A;  3T8O A;  1ZV4 X;  5JDM A;  2Q9Q A;  4O4I E;  5H6R B;  4P09 A;  3IBP A;  4C91 A;  2MBG A;  2D2S A;  2D0U A;  2D0T A;  2PJQ A;  3UUX B;  1U4Q A;  4XZC A;  4YHJ A;  3ZJ1 A;  4DMV A;  3TKL B;  3U78 A;  3FB2 A;  2N2N A;  3DP7 A;  3Q9D A;  5KDM C;  4OYK A;  2X9X A;  5L3G B;  2VKD A;  3OYX A;  4YFS A;  4IST A;  5DQV A;  2X9H A;  2E8I A;  3RKO A;  4ZI3 C;  3HL6 A;  4IE4 A;  4CXY A;  3BK9 A;  2DLR A;  1FEW A;  5HAX A;  3N2K E;  3CX8 B;  3PUG A;  5FXZ A;  3ONX A;  5KMG P;  1YD8 G;  3KIN B;  5FP3 A;  4HE8 A;  4WNK A;  3ZLI A;  4Z8X A;  2PFV A;  2ES0 A;  4EZ4 A;  3U3I A;  4F6R C;  2KWI B;  3V5S A;  2QA7 A;  3CQC B;  4ILU A;  2XHE B;  4E7Z A;  3F57 A;  5M4Y A;  1QSD A;  3C64 A;  3LBX B;  1QUU A;  4UEM A;  5BMV E;  3AVS A;  2G0U A;  3ANW A;  3ETV A;  1YKH B;  1NAF A;  5LA6 E;  2XAQ B;  3C98 B;  3QC9 A;  4HFV A;  2WMO A;  5JRC B;  1YW0 A;  2NTX A;  4QXC B;  1YKE B;  3AA7 B;  4AKL A;  4CQI A;  3ZCI A;  1FMW A;  3EVY A;  1VOM A;  5CB4 E;  4EYU A;  3R84 B;  5F3J A;  2LSK A;  4DMW A;  3ZYL A;  4H9Q C;  2Q9Q C;  4ZS2 A;  1IZN B;  2JMK A;  4PK6 A;  3ESL A;  4CI3 B;  4PJN A;  5E0O A;  1SHZ C;  1US7 B;  3O4X E;  3P7I A;  1BR0 A;  1CUN A;  2J1D G;  5HXH A;  3LJC A;  4WBO A;  5HYA A;  3KV6 A;  3LFM A;  1LRZ A;  2YU2 A;  4TUY E;  2PBI A;  2Y6X A;  3KVA A;  4IGU A;  1T98 A;  5LCY A;  2XUE A;  4L0R A;  5JR9 C;  4UXN B;  1OWA A;  4I43 B;  2KT9 A;  4DVD A;  2LOS A;  4ZI3 D;  4EOZ B;  4P0B A;  5FXX A;  1UCU A;  2BDE A;  2X0L B;  3HA4 A;  3I9W A;  1WR6 A;  2Q9Q B;  3JC6 D;  5L3B B;  4UF0 A;  3AA0 B;  2Z6E A;  3N5L A;  2LSY A;  3ZCJ A;  3ZYK A;  1ZHC A;  3B57 A;  1IAP A;  5J1G A;  2CXD A;  4G2A A;  2CWY A;  5HXS A;  2KLQ A;  1HG5 A;  2VKJ A;  3NZP A;  3PUR A;  2HPJ A;  3CKD A;  2ZM2 A;  4TV8 E;  2NW8 A;  1MND A;  3RYI E;  5FXW A;  5LBQ B;  5HXC A;  4P0A A;  2EHO D;  2I59 A;  4QWN B;  3KV9 A;  5L3E B;  2JRK A;  3K3Q C;  5DJQ C;  5HXE A;  4GK0 E;  3VKH A;  3DJB A;  2EHO A;  3IF8 B;  3KV4 A;  4JLE A;  4GYS A;  3L3P A;  3V5U A;  4WBN E;  3PTR B;  5JH7 E;  5FMN A;  5HXR A;  3KVB A;  1MIW A;  4IE5 A;  3UFE A;  1HG2 A;  2UXN B;  2C5J A;  2L3L A;  4PFP A;  3C4W A;  3O1I A;  3UUL A;  2KIN B;  3SWH A;  2A2F X;  4HGA A;  5JDF A;  2XQY A;  4KBM B;  2WSS V;  4U72 A;  4BJN A;  1D1B A;  3GN5 A;  2VWA A;  2CWO A;  3QK6 A;  2M67 A;  2W00 A;  4JEU B;  4WW0 A;  2X67 A;  2CE7 A;  1HX8 A;  5JDH A;  3M65 A;  2C5I T;  3HI2 A;  4QKN A;  2LE8 A;  4NUU A;  1BR1 A;  3CX6 B;  4XBF B;  2N1G A;  2ZMA A;  1HS7 A;  1WLX A;  3VKG A;  4G63 A;  4IE0 A;  3MAC A;  3N9N A;  5JR9 A;  3WAK A;  5J2U E;  3OKQ A;  2K48 A;  2KND A;  2XTL A;  5KX5 E;  5JDG A;  2W0G A;  3RPU A;  5GON E;  1MIV A;  4OFZ A;  3NZQ A;  4QX7 B;  2CLY C;  3JC6 C;  4ISS A;  2Y48 B;  4UIG A;  4AXP A;  3RC3 A;  5J2T E;  2JPF A;  2V7I A;  2IC9 A;  1WYB A;  2CXF A;  3I1A A;  4IHJ E;  3O1H A;  2X9Y A;  5CA1 E;  4DBR A;  1E1H B;  2PG8 A;  3CML A;  2DCF A;  5A1L A;  4ZI2 D;  5JVD E;  3SRZ A;  5LGT B;  4M1P A;  4AKG A;  2E9X D;  3E0Z A;  4GIW A;  3N2O A;  2K5B B;  4H63 V;  2YK0 A;  2P9B A;  2EHO C;  3HKC E;  5AFU L;  4ASK A;  4UF0 B;  3PU3 A;  2H3R A;  4NUV A;  4C90 A;  3CWZ B;  3CVR A;  2L9Q A;  2JMH A;  2CLY B;  2LSJ A;  2XAJ B;  4HKA A;  5FY0 A;  2VKH A;  1V9D A;  5LGN B;  1D1C A;  4ZI7 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...