1ZEEA

X-ray crystal structure of protein so4414 from shewanella oneidensis. northeast structural genomics consortium target sor52.
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
sequence length
387
structure length
363
Chain Sequence
YNTEAFDEWIRSRFVELNSQLEQLYYQQTDRANVQEVGTELKHTLESEGRELVKALLDEGNTDEGFDSAFDLLGNVGLYMAACRRHEITEPTRETTSPLLEASALAMHIGASIGVTPRFATAHLTTHNRAHNGIYKRFTDLPDEKLFVDYNTKGILAYKRASDALLKIQPLGISHPISHDLLRVTKQALQDVIESNQQLFNRLDTDRFFYCVRPYYKPYRVGSVVYRGANAGDFAGINVIDLTLGLCFANEASYSQMLVDKFLYMMPEDQQILRECMRRPNLMDDFLQAKGCIHQDWYQENLKLFIEVCELHGQTAIQHHNELVTKYVLLASLERLRDRRAAVLRDDIRTRYYDLKKLKDSLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein SO4414
publication title Crystal Structure of the Hypothetical Protein SO4414 from Shewanella oneidensis, NESG Target SoR52
rcsb
source organism Shewanella oneidensis
molecule tags Unknown function
total genus 129
structure length 363
sequence length 387
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08933 DUF1864 Domain of unknown function (DUF1864)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.480 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 1zeeA02
1.20.58.600 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 1zeeA01
2V7LA 1YW0A 2NW8A 4PW8A 2D0UA 2X67A 4PK5A 4HKAA 4U72A 5EK4A 2NOXA 2X68A 2X66A 2V7MA 2V7JA 2V7IA 2NW7A 2D0TA 5ETWA 4PK6A 5EK2A 2NW9A 2NWBA 2V7KA 1ZEEA 4U74A 3BK9A 5EK3A 3E08A
chains in the Genus database with same CATH superfamily
4IL9A 5KX5E 3UULA 2QGSA 3SRZA 3P4PA 5JRCA 2DLRA 2H7OA 2WWUA 3EDUA 5LBMA 3TLSA 4JEHB 2WCAA 3RC3A 5L4EA 2EHOC 2QRXA 1W09A 2IAKA 2V8SV 2X0YA 5DJQC 1FEWA 4LMKA 4YHJA 3BQKA 1QLBA 3CX6B 2W63A 3JAFA 4ZI7E 4DR2T 1S94A 1XNQT 5HWYA 4FJOA 4QH1A 3U78A 2QYWA 3UUBA 3NZQA 3PUGA 1OEDE 4DV1T 3LK42 2CRBA 1MNDA 2H89A 4QX8B 2LOSA 3ANWA 2V6YA 2RA1A 2LSKA 2XM2A 2VK9A 3ZMSB 2UUAT 3RIUA 4AKLA 5C8YE 3FZLB 5JR9A 1HNZT 3EUHA 3SWHA 4YSXA 3N2KE 3AEAA 1BR4A 2CHOA 3QUJA 4GK0E 2UXNB 4HN9A 2E9XA 4IGUA 4C91A 1HR0T 3RX6A 3LK3B 1LKXA 2A3DA 2CCQA 3KV6A 1MMAA 2VVSA 5AQMB 4HWDA 2Q9QB 3GN5B 4IE5A 1V9DA 3RYFE 4HWFA 3LBXB 4BAYB 1U4QA 2IUBA 4ZZCA 2JMKA 2XASB 4ILCA 2BKOA 4ILBA 4OYKA 4V1Av 4COFA 2C5JA 2LOPA 1G73A 2BDEA 4TV8E 5HEJA 4IDPA 3RYHE 1IBLT 1KK7A 4L5GA 4HE8A 5AQOB 2XQ9A 2VL8A 3ZSSA 5AFUL 4WZXA 2ZM8A 2V5CA 1HG2A 5FXZA 5JQGE 2NWBA 1MNEA 5LJMA 3NVOA 3PJAJ 3K8PC 5JRCB 5TAOA 3ZJ2A 4LFBT 5F5WA 2E9XC 1KFYA 2DL1A 2Q9QD 3TLVA 2XAJB 2YU1A 4DUYT 2VWAA 4JLEA 3HL6A 1M62A 1W0AA 4AQGA 4KMCA 4O4IE 1NAFA 3VHLA 3HKEE 1YKEB 3OYXA 2BG9C 3Q5DA 5JDHA 1D1AA 3DJBA 4J2CA 5L3GB 4DBQA 2UXXB 5HCJA 4KX6A 4A56A 2FJEA 3V5SA 3QK6A 2BVMA 4H9NC 4LMLA 2KMFA 3RYCE 3ZT5A 1Z8UA 3ANWB 2V6YB 2XJ7A 1T7SA 4X1KE 3G06A 5EZYE 4WBOA 5FY1A 4DR7T 5LGNB 2KZ7B 2OLTA 1VCTA 5JR9B 1YD8G 3AE7A 2E5VA 3PU3A 4AQFC 4WW0A 4CXWA 4BA9A 2DCFA 2X9WA 2XQYA 2PFVA 5HEHA 4KHZF 2IDOB 4DR5T 4TUYE 1UURA 2XUEA 4TX5A 3EHZA 3O1HA 3N9PA 3MZKB 2NW8A 4GKJT 1XMOT 5HYAA 2FJAA 5AQJB 4KP3C 2CWYA 4YSYA 2YINA 2LHRA 4ZI2C 4U2ZA 3TKLB 3AA0B 4DV3T 5LXTE 3UT5E 2CXFA 2CM0A 2X9HA 4PK4A 2D5UA 4JI5T 3AE1A 3VR9A 3FZHB 5DABA 2ACXA 2DNXA 3PUQA 2BKPA 1OXZA 2LSYA 2XY8B 4YLHA 1HX8A 2X0HA 3CQXC 5DQWA 1HF8A 2BG9E 3FZKB 1XWMA 1W9RA 1HX1B 3N5LA 3V5UA 4PK5A 3DTOA 2E9XD 1E2AA 3N2GE 2MOZA 3GA8A 3C4ZA 3LDQB 3RC8A 3KINB 3PUXF 3E08A 5M4YA 4PW8A 3CX8B 5FL0A 3CPZA 3ABVA 4EAHA 4CI3B 3PUSA 1VRBA 3L09A 2WWVA 2SPCA 4ZZBA 2XTLA 4ADZA 3KFWX 5CB4E 3M3ZB 4DMWA 4JI0T 3FBLA 5EK3A 5AQUB 5JDMA 2WP9A 2W2UA 1I6ZA 4OX9T 2LEHA 5FKYA 2DI4A 4GK5E 5LYJE 2WMOA 1X79A 4ANJA 5FXWA 3A8YC 4TNVA 4UVCB 4L0RA 1KNPA 3JAEA 2A72A 2VKHA 2B76A 3BQIA 4Q25A 4O2BE 3EI0A 3KVBA 1IJ5A 5HAXA 2M6IA 5HEOA 3CX7B 2K48A 2E2AA 3O9XA 3QB5K 4C90A 5CA1E 2UUCT 2QA7A 5ABFA 3JC6C 4KBMB 2L8KA 3UUMA 4P0AA 3E0ZA 3OYZA 5JDGA 4WBNE 3GMIA 2YEVC 3KV9A 4X1YE 4ZI2D 2JMHA 3UU5A 1YW0A 1L0VA 4CN4A 4LFAT 4F8HA 4PFOA 1ZP0A 3PUZF 2KWIB 5LHGB 4CXXA 5FNVE 4UF0A 2CBJA 2J47A 1OWAA 3JADA 4EEDA 5LBQB 1KF6A 5DQVA 5F3JA 4E7ZA 3ZPOA 1JNRA 4H9QC 3P8CD 5LG4A 2L9QA 3BQLA 5L3CB 4HFHA 2MPKA 3RI5A 1MIVA 4DR1T 1N36T 4IE4A 2VQFT 3I0OA 1XNRT 3QC9A 4IE7A 2UXCT 4P09A 2G0UA 1AJ3A 2JQQA 2X0LB 5JTGA 2V7IA 4CZZB 1XZYA 3F31A 5ETWA 3RLFF 2LRKA 3SS1A 4UEMA 2PG8A 3ETUA 4QXHB 5HXHA 3CIRA 4U33A 2CMRA 4U31A 2A2FX 2D9DA 2LKHA 1WR0A 2JQHA 5FVLA 5LJNA 1VCSA 4GYRA 3R84B 3FHNA 3OTOT 3AE4A 2XZEA 2Q9QC 3RKOA 3ZYKA 3I0QA 4B3ST 2W00A 3MK7C 3C98B 3RQWA 4DV7T 1IZNB 1WLXA 2XM1A 1FMWA 1IAPA 3OJAA 2XAHB 3F57A 1J5ET 4IE6A 3UU4A 1QUUA 5HEGA 1FIOA 3ZMUB 5CJ5A 4DV0T 3JC6D 2K9AA 4IDZA 4U7IA 1MMNA 1MMGA 1D0ZA 4AKIA 3CQCB 4GOUA 3W15B 3MKDA 4NIQA 3TLWA 2IC9A 5ABFB 1CUNA 4OYJA 4X64T 2M6BA 5J2TE 5FVKA 4JI3T 2UXDT 4U72A 2JQKA 4ZXLA 4EZ4A 2IMLA 4I0UA 2W66A 4NXMT 4LF5T 3U3IA 1Y01A 3UU6A 5J1GA 3AE5A 1FJGT 3NKZA 3VKHA 1LVKA 4P0BA 2XQ3A 4DIDB 4CN6A 4YSZA 4UF0B 4O4LE 2ODVA 5KDMC 2XSBA 4EZHA 5L3FB 4ISTA 3O1IA 2LSIA 5HCMA 3ONJA 1HS7A 4PNIA 4H9RC 4BJNA 4LF7T 2KLQA 2R6GF 4YTNA 4X65T 2ZM0A 4ZI3C 3AEGA 2P9BA 5AQQB 4KI0F 3T1YT 3VRBA 1HNXT 2UU9T 2WZHA 5AQTB 1D0YA 3FZFB 4H63V 4MHCA 4OK0A 3ZT6A 1S35A 3RIUC 2ZM2A 3KV5A 4P1NA 2NW9A 5JR9C 1SUMB 2V7KA 4DVDA 4AKRB 4CXYA 3C4XA 5FXXA 3D0TA 4A98A 5FP3A 3ZC1A 4UELA 2HPJA 1T72A 1UX5A 4H63H 1N32T 4O4HE 3C51A 5LGTB 3AEFA 3OKQA 4AQYT 3AA7B 4H9OC 3IA3A 5FYMA 3SFEA 4HWIB 2J62A 1O3XA 2CLYB 3A7MA 1XDOA 5L2LA 4LFCT 4JUYA 2IW5B 4AKGA 4HFCA 2WBLA 3EVYA 3UQ7A 3RIFA 3FXDB 4CI1B 2YDRA 3VKGA 4WYVA 1WFDA 3ZN0B 4DR6T 2VURA 4IDOA 2FUPA 1HFAA 4EIWA 3RIAA 1WR6A 4YY3T 3IEEA 3K3OA 4UVBB 3QB5A 4UV9B 2VL0A 4NPPA 2WY2A 4XZCA 5FL1A 3OBVE 2A9UA 5H6QB 2YKSA 2W4XA 2I6HA 2I0MA 2WB5A 3ZYLA 2NR4A 3ESLA 5CA0E 2RP4A 5FY7A 3P4SA 2BBJA 4LF8T 4EV6A 4ASKA 3B13A 3RRCA 4DV2T 3AA6B 5JVDE 2VKDA 3N9MA 4IL4A 4QHOA 2GK9A 3EAMA 4TN7B 4ZI3D 2ZM6T 1I94T 5AQSB 1UGOA 4NUUA 2LM2A 1YXRA 3NZPA 2WDQA 4IREA 3HKDE 2Z6EA 3ZN1B 4QKNA 3ZMTB 4YXDA 2X9YA 2KT9A 3PDYA 4YJ3E 2DHRA 1LVFA 3HA4A 1NWMX 3ZC0A 2K3WA 2HN1A 1N33T 3HI2A 4K0UA 5GONE 1FMVA 1M7KA 1Z0PA 3AB3B 1HTJF 2IHR1 4L9IA 2JJ9A 3TLTA 4DNDA 3LFMA 4BJMA 1CHUA 5LGUB 5ADXL 3PURA 5AQHB 2CE7A 4GIWA 2MTQA 4E7SA 2ACZA 4ZS2A 3MXZA 2Y6XA 2H7VC 3ZSTA 4AI6A 5AQGB 1WYBA 5CGMA 1R8IA 1J1JA 3CQGB 4OFZA 2JQ9A 4HFVA 2ES0A 3AEEA 3P50A 2LSJA 4XAXB 5HXSA 4EB6E 4QH4A 2ZMAA 2PJQA 3AVRA 2FJDA 1OEDA 4DV6T 2WAUA 3LG7A 4I50E 4TWHA 4I55E 4JI1T 4G2AA 2XQAA 2LRLA 3Q5EA 2D2SA 5L3BB 4XBFB 4FI5A 4B3MT 2V7JA 2LKGA 3UQ4A 3ZMVB 1MIWA 2BS2A 3N2OA 1US7B 1BR2A 3AVSA 2N1GA 3ZT7A 3Q2MA 2B1EA 3ETVA 4CQIA 5FY0A 4QWNB 3FXEB 3I9WA 3X1DA 3DP7A 3T1HT 3B5MA 2CXDA 1ZV4X 2NTXA 4LMJA 4DBRA 4YTMA 2LLYA 3P4RA 1IJ6A 4ZS3A 2QVAA 1YQ4A 3RQUA 2V7LA 3AAAB 2W61A 4O2AE 4IT4A 4CN1A 2WZIA 3L8RA 4X5TA 2WMNA 3O4XE 2XQ7A 4QH5A 2C0SA 2VKOA 1VOMA 4PJLA 1BR0A 2PTFA 4TWDA 1NEKA 3J7Yq 4JI8T 5JDFA 2K24A 4Z91A 2WU5A 2EHOA 4KHPT 2D0TA 3FB2A 4A5XA 2UXBT 2Y8DA 1BR1A 3KVAA 4EGWA 4M1PA 4GKKT 2KXPB 4ILUA 5JDQA 2CXLA 4G63A 4QX7B 2C5IT 5AQVB 4X20E 4KUMB 3WAJA 3ONLC 3I9YA 4IIJE 2ODUA 1ZKEA 2VKJA 3NRYA 2K5BB 2FBWA 1NENA 5IYZE 2YN6A 4U2YA 4IHJE 1HCIA 2J4GA 4JBWF 3N9OA 2BZBA 4HKAA 2VQET 4UV8B 3P4WA 2LE8A 3OVUA 2W67A 1OEDB 3KBUA 2XQ4A 3H3AA 3CVRA 5HWXA 1KNRA 4JEUB 2VB6A 3C64A 3WAKA 5BR8T 2BKNA 3PUYF 5IUXA 3UFGA 4AIUA 3FZMB 1XMQT 3ZEFB 2YK0A 4NXNT 2VASA 1KEYA 4ZOLE 5FXVA 1UX4A 4EYYR 2X67A 4PJNA 3TLUA 4NUVA 4I4TE 2BS3A 3SOLA 4QXCB 4LF4T 3RYIE 2XQ8A 2MAWA 5LNKA 3M65A 4PFPA 4H9PC 3P7IA 1X9BA 1G8XA 4MALA 2PBIA 4Z90A 4QXBB 1UCUA 3KBTA 5LA6E 3UUXB 5LMNT 3PUAA 2AE9A 5AQNB 3PTRB 4MBQA 5LMUT 5LOVE 5LHIB 5L47A 2HHHT 2WS3A 1T98A 5EK4A 5L3EB 5LP6E 3MJXA 4TV9E 2H3RA 2WM9A 2EHOB 1N34T 2CLYC 4B6XA 3RRWA 5ABGA 2BS4A 4HGAA 3H3MA 3NBXX 2BG9A 3N9NA 2XQ5A 4X66T 1U5PA 3ZJ1A 2ZLYA 4DV4T 2DWKA 3FBZA 5AQFB 1MIYA 1QSDA 3UU8A 4ILAA 2KNDA 3ZKRA 2XSAA 4HFBA 5AQPB 4YFSA 1D1CA 2W0GA 3B57A 4AQFA 4DUZT 4CI2B 3Q5WA 1WCRA 3PE0A 4UVAB 2HPLA 4U74A 5JH7E 3PUWF 2YDSA 4IDQA 2XAFB 3N9LA 2LSGA 2LHNA 1XDPA 2EHOD 2X68A 3AEDA 4A97A 3CK6A 2X9XA 1MMDA 4GYSA 3LJCA 3AXJA 2KSRA 3MA9A 2C5KT 2WQYA 1LRZA 3I1AA 4YHHT 4JYAT 4EYUA 2NOXA 3E22E 3ZYMA 3MACA 3IF8B 4HEAA 2I59A 3ZCJA 2AXDS 2KINB 3AAIA 2HH7A 4PJMA 4N78D 1HNWT 1E1HB 4I43B 2V5DA 3RPUA 5C2TA 3QOFA 3AE6A 1E7PA 1WRDA 5AQLB 5LHHB 3T8OA 2DWGA 4UIGA 5AQRB 3S4UA 2E9XB 2JRKA 3H37A 3PU8A 2FJBA 4DR4T 3HKBE 4X62T 5HXEA 4UR9A 4OHFA 3LK2B 4ZEYA 3K1SA 4B3RT 5EK2A 2WDRA 2JIWA 5ABHA 4X1IE 3HR0A 5LCYA 5JREA 2N2NA 3CMLA 2D0UA 2LM9A 4HWCA 3AE2A 3L39A 2WDVA 2JPFA 1SE7A 2BG9B 2NW7A 1HG5A 3K3QC 3EDVA 2CWOA 2MBGA 1UUSA 1YQ3A 5ABEA 5FMNA 4B3TT 2OV9A 5E0OA 3GWHA 2E5LT 5L3DB 3UFEA 2WSSV 5LG3A 1YKHB 3O1JA 4PAGA 2CA5A 3R6NA 5LB7B 2J1DG 4PK6A 3NWIA 5IWAT 3ZMZB 2VVNA 4H9SE 2XAGB 5BMVE 3PV0F 4LF9T 3C50A 3RGLA 2CPTA 3JCFA 4YJ2E 4JI4T 3A5XA 5AQKB 5J0ZA 3J9X1 3RHWA 3PUVF 3RH3A 3C4WA 3P4QA 4U7YA 3AAEB 5J2UE 1Y64B 4IE0A 2H88A 2V6XA 3EABA 1W0BA 4EEBA 2YU2A 3UU3A 1D1BA 2Y48B 4TWFA 2W62A 2CHNA 1IBMT 3AXJB 5KXJA 1T8BA 4O8SA 4Z8XA 3AE9A 2UUBT 4AXPA 2LT3A 3WI3A 1B7TA 1D0XA 1SA0E 5IHYA 4AISA 4HTEA 4WNKA 5KMGP 5HXRA 2X66A 2V7MA 2F4VT 4PJJA 4JV5T 3RKGA 5C3JA 1ZEEA 3AEBA 2NTYA 3ONXA 1GQEA 2RPAA 5JDNA 1IBKT 4K0KT 4JI2T 3UUNA 2KWHA 4HFEA 2NP9A 5HXCA 1EZ3A 2MYSA 4JI7T 2CBIA 4ZHQE 4TZ4C 4F6RC 3IBPA 3AECA 1UK5A 2XHEB 3AE8A 3QNUA 1DU2A 5H6RB 4HFDA 2HN2A 2YOEA 2YDQA 3N9QA 3VR8A 4ERRA 4EXTA 4HWHA 4YT0A 2XPKA 2XAQB 2X51A 3CWZB 4TNWA 4YTPA 3Q9DA 1SHZC 3VU7H 1H7CA 3ZCIA 4LF6T 4EOZB 1WYCA 4MFRA 3Q5XA 3SFDA 3IHRA 4DO0A 5JDLA 4O4JE 3NRXA 2LJLA 1OEDC 2Q9QA 4IDNA 4DMVA 3KV4A 3HKCE 3VRAA 3BK9A 3GN5A 3KDSE 5HEUA 3PJAA 2N9DA 5CFBA 2V1DB 3LBXA 3F2EA 4U3CA 5AQIB 1ZHCA 2CEAA 3LSVA 3CKDA 3RF1A 2E8IA 2BVLA 3K3NA 5A1LA 2L3LA 4ISSA 2IC6A 1KNZA 5L4HA 4MLKA 1J5WA 4UXNB 3ZLIA 3AE3A 1ZOYA 1JNZA 4HFIA 5F8PA 2BBHA 2V26A 3UTKA 4JI6T 3L3PA 2XQ6A 3OPCA 4AKHA 2OA5A 4DV5T 2WU2A 3AA1B 2IIUA 4DR3T 2M67A
chains in the Genus database with same CATH topology
2A72A 3N9NA 5FY7A 5KX5E 3UULA 2QGSA 2VKHA 1U5PA 3BQIA 4ASKA 3ZJ1A 3B13A 3SRZA 3RRCA 2ZLYA 4O2BE 3AA6B 2DWKA 3FBZA 5JVDE 5JRCA 2VKDA 2DLRA 3N9MA 3KVBA 4QHOA 1IJ5A 2H7OA 5HAXA 2WWUA 1MIYA 2GK9A 3EDUA 1QSDA 4TN7B 5CA0E 5LBMA 3CX7B 2K48A 4ZI3D 3O9XA 4C90A 4JEHB 5CA1E 3RC3A 2QA7A 2KNDA 4NUUA 3JC6C 2EHOC 4KBMB 4YFSA 1D1CA 3NZPA 2IAKA 2W0GA 3B57A 2L8KA 3UUMA 3HKDE 2Z6EA 5DJQC 3E0ZA 3ZN1B 4AQFA 4P0AA 1FEWA 4CI2B 4QKNA 3OYZA 4YHJA 3Q5WA 5JDGA 3ZMTB 4WBNE 3BQKA 3CX6B 3GMIA 2W63A 2YEVC 2X9YA 3PE0A 2KT9A 3PDYA 4UVAB 2HPLA 2DHRA 3KV9A 4X1YE 4YJ3E 4ZI7E 1LVFA 3HA4A 4U74A 4ZI2D 2JMHA 5JH7E 1S94A 1NWMX 3ZC0A 2XAFB 3N9LA 5HWYA 1YW0A 2LSGA 4FJOA 2LHNA 3U78A 3HI2A 3NZQA 4K0UA 5GONE 3PUGA 1FMVA 1Z0PA 3AB3B 3LK42 2EHOD 4PFOA 1HTJF 1MNDA 4QX8B 2X68A 2LOSA 4L9IA 2KWIB 5LHGB 3ANWA 2X9XA 2JJ9A 1MMDA 4CXXA 2RA1A 4DNDA 2LSKA 3LFMA 4UF0A 5FNVE 2VK9A 4BJMA 5LGUB 5ADXL 4GYSA 3LJCA 3ZMSB 1OWAA 3MA9A 4AKLA 2C5KT 5C8YE 3PURA 5LBQB 1LRZA 5DQVA 5F3JA 3I1AA 4E7ZA 5JR9A 2CE7A 3ZPOA 4GIWA 2MTQA 3EUHA 4H9QC 3SWHA 3P8CD 4E7SA 5LG4A 2L9QA 3BQLA 4EYUA 2NOXA 3N2KE 1BR4A 3QUJA 3E22E 3ZYMA 5L3CB 3MACA 3IF8B 4ZS2A 4GK0E 4HEAA 1MIVA 3MXZA 2UXNB 4HN9A 2E9XA 2Y6XA 2I59A 4IGUA 2H7VC 4AI6A 4C91A 4IE4A 3RX6A 1WYBA 3ZCJA 2KINB 3LK3B 3CQGB 3AAIA 3I0OA 1LKXA 2A3DA 2CCQA 4OFZA 2HH7A 3KV6A 1MMAA 3QC9A 4PJMA 4IE7A 4N78D 4HFVA 2ES0A 4P09A 2G0UA 1AJ3A 2JQQA 2X0LB 2Q9QB 1E1HB 4I43B 2LSJA 2V7IA 3GN5B 4IE5A 4XAXB 4CZZB 5HXSA 3F31A 5ETWA 3RPUA 4EB6E 1V9DA 3RYFE 3SS1A 4UEMA 2ZMAA 3LBXB 2PJQA 4BAYB 1U4QA 1WRDA 2JMKA 2PG8A 3AVRA 3ETUA 2WAUA 2XASB 3LG7A 3T8OA 5LHHB 4I50E 4I55E 4QXHB 5HXHA 4G2AA 2DWGA 4UIGA 4AKIA 4OYKA 4V1Av 3S4UA 2E9XB 2C5JA 2JRKA 3H37A 3PU8A 2LOPA 2CMRA 2A2FX 2D2SA 1G73A 3HKBE 4FI5A 5L3BB 4XBFB 5HXEA 2V7JA 2BDEA 4TV8E 4OHFA 3LK2B 5LJNA 3ZMVB 1MIWA 5EK2A 3N2OA 1US7B 1BR2A 4X1IE 3AVSA 3HR0A 2N1GA 3Q2MA 2B1EA 3RYHE 5LCYA 5JREA 1KK7A 2N2NA 3CMLA 4GYRA 2D0UA 2LM9A 3ETVA 4HE8A 4L5GA 3R84B 4CQIA 2VL8A 3FHNA 5FY0A 4QWNB 5AFUL 3FXEB 3I9WA 2ZM8A 2Q9QC 2JPFA 3RKOA 3ZYKA 3DP7A 3I0QA 2W00A 2CXDA 1HG2A 1HG5A 1ZV4X 2NTXA 2NW7A 3C98B 3K3QC 3MK7C 1IZNB 1WLXA 4DBRA 1FMWA 1IJ6A 5FXZA 1IAPA 4ZS3A 3OJAA 3EDVA 5JQGE 2CWOA 2NWBA 1MNEA 2XAHB 2MBGA 5LJMA 3F57A 3K8PC 2V7LA 3AAAB 4IE6A 1QUUA 5JRCB 2W61A 1FIOA 5FMNA 5TAOA 4O2AE 3ZJ2A 3ZMUB 5E0OA 3GWHA 2E9XC 5L3DB 3JC6D 3UFEA 2WSSV 2WMNA 2Q9QD 2K9AA 1YKHB 2XAJB 3O1JA 2YU1A 3O4XE 4IDZA 4PAGA 2CA5A 3R6NA 1MMNA 1MMGA 2C0SA 1D0ZA 2VKOA 1VOMA 3CQCB 2J1DG 2VWAA 4GOUA 3MKDA 4JLEA 4PJLA 3HL6A 3W15B 1BR0A 4PK6A 2IC9A 3ZMZB 1CUNA 4OYJA 4AQGA 4KMCA 4O4IE 5J2TE 3J7Yq 1NAFA 4H9SE 2XAGB 5BMVE 3VHLA 3HKEE 3C50A 1YKEB 3OYXA 4U72A 5JDFA 2K24A 4YJ2E 5JDHA 3A5XA 1D1AA 4EZ4A 3DJBA 2EHOA 2D0TA 3J9X1 4J2CA 5L3GB 3RH3A 4DBQA 3C4WA 2UXXB 3FB2A 3AAEB 5J2UE 1Y64B 4A56A 4IE0A 3U3IA 3V5SA 3QK6A 2BVMA 5J1GA 2Y8DA 4H9NC 1BR1A 2KMFA 3KVAA 4M1PA 3RYCE 2YU2A 2KXPB 3VKHA 3ANWB 1D1BA 1LVKA 2Y48B 4P0BA 4X1KE 4ILUA 5EZYE 2W62A 5JDQA 4UF0B 4O4LE 2ODVA 4WBOA 2CXLA 5FY1A 5KDMC 4G63A 4QX7B 4O8SA 2C5IT 4Z8XA 4EZHA 5LGNB 2KZ7B 5L3FB 4ISTA 3O1IA 2LSIA 4X20E 4KUMB 1YD8G 5JR9B 1HS7A 4AXPA 2LT3A 4PNIA 3WI3A 1B7TA 3WAJA 1D0XA 3PU3A 4H9RC 3I9YA 4AQFC 4BJNA 4WW0A 4IIJE 4CXWA 2ODUA 1ZKEA 2DCFA 4BA9A 2X9WA 1SA0E 2VKJA 5IHYA 3NRYA 2K5BB 2XQYA 2KLQA 2PFVA 4HTEA 4WNKA 5KMGP 5IYZE 5HXRA 2X66A 2V7MA 4TUYE 2XUEA 2ZM0A 4TX5A 4ZI3C 4PJJA 3O1HA 2P9BA 4IHJE 1ZEEA 3N9PA 1HCIA 2NTYA 3MZKB 3ONXA 2NW8A 1D0YA 4H63V 3N9OA 5JDNA 4MHCA 5HYAA 2BZBA 4OK0A 4HKAA 3UUNA 2KWHA 1S35A 2NP9A 4UV8B 5HXCA 1EZ3A 4KP3C 2CWYA 2MYSA 2YINA 4ZHQE 2LE8A 2ZM2A 4TZ4C 3KV5A 2LHRA 4F6RC 3IBPA 2NW9A 3KBUA 4ZI2C 5JR9C 2V7KA 4DVDA 3H3AA 3CVRA 3TKLB 3AA0B 5HWXA 2XHEB 4AKRB 3C4XA 4CXYA 5LXTE 3UT5E 2CXFA 2CM0A 2X9HA 4PK4A 4JEUB 2D5UA 2VB6A 5FXXA 3C64A 5DABA 3WAKA 3D0TA 5H6RB 2ACXA 5FP3A 3ZC1A 2DNXA 3PUQA 4UELA 1OXZA 2LSYA 3N9QA 2HPJA 4ERRA 4EXTA 1UX5A 3ZEFB 2YK0A 4YLHA 1HX8A 2XAQB 4H63H 2VASA 4O4HE 3C51A 3CQXC 5DQWA 5LGTB 2X51A 1HF8A 3CWZB 3OKQA 3Q9DA 4ZOLE 1SHZC 3AA7B 5FXVA 3VU7H 1UX4A 3N5LA 3V5UA 4H9OC 4EYYR 1H7CA 2X67A 5FYMA 4PJNA 3ZCIA 4PK5A 4EOZB 1WYCA 4MFRA 4NUVA 3Q5XA 3DTOA 2E9XD 4I4TE 1O3XA 2CLYB 3N2GE 3IHRA 3SOLA 4DO0A 2MOZA 5JDLA 5L2LA 3GA8A 4O4JE 3NRXA 3C4ZA 4QXCB 3RC8A 2LJLA 3KINB 2Q9QA 4DMVA 3KV4A 3RYIE 4JUYA 2IW5B 4AKGA 3HKCE 5LNKA 3BK9A 3M65A 2WBLA 3EVYA 4PFPA 3E08A 3GN5A 3KDSE 4H9PC 3P7IA 5M4YA 2N9DA 4PW8A 1G8XA 3FXDB 3CX8B 4MALA 2PBIA 4CI1B 4QXBB 2V1DB 3VKGA 3CPZA 1UCUA 3KBTA 3LBXA 3F2EA 4EAHA 5LA6E 3ZN0B 3UUXB 4CI3B 1ZHCA 2CEAA 3PUSA 3CKDA 3PUAA 1VRBA 2E8IA 2BVLA 3PTRB 3L09A 4MBQA 2SPCA 1HFAA 4EIWA 2XTLA 5LOVE 3KFWX 4ADZA 1WR6A 3K3NA 5A1LA 5LHIB 3IEEA 2L3LA 3K3OA 5CB4E 4ISSA 4UVBB 2IC6A 4UV9B 4DMWA 1KNZA 3FBLA 5EK3A 5JDMA 1T98A 5EK4A 5L3EB 4XZCA 4MLKA 3OBVE 5LP6E 3MJXA 4UXNB 5H6QB 4TV9E 3ZLIA 2H3RA 2WM9A 2EHOB 5F8PA 2CLYC 4B6XA 2V26A 3RRWA 2LEHA 3UTKA 3L3PA 2DI4A 4GK5E 5LYJE 2WMOA 4AKHA 1X79A 2OA5A 4HGAA 4ANJA 3AA1B 5FXWA 3ZYLA 2M67A 3ESLA 3NBXX 4UVCB 4L0RA 2RP4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2V7L A;  1YW0 A;  2NW8 A;  4PW8 A;  2D0U A;  2X67 A;  4PK5 A;  4HKA A;  4U72 A;  5EK4 A;  2NOX A;  2X68 A;  2X66 A;  2V7M A;  2V7J A;  2V7I A;  2NW7 A;  2D0T A;  5ETW A;  4PK6 A;  5EK2 A;  2NW9 A;  2NWB A;  2V7K A;  1ZEE A;  4U74 A;  3BK9 A;  5EK3 A;  3E08 A; 
#chains in the Genus database with same CATH topology
 4IL9 A;  5KX5 E;  3UUL A;  2QGS A;  3SRZ A;  3P4P A;  5JRC A;  2DLR A;  2H7O A;  2WWU A;  3EDU A;  5LBM A;  3TLS A;  4JEH B;  2WCA A;  3RC3 A;  5L4E A;  2EHO C;  2QRX A;  1W09 A;  2IAK A;  2V8S V;  2X0Y A;  5DJQ C;  1FEW A;  4LMK A;  4YHJ A;  3BQK A;  1QLB A;  3CX6 B;  2W63 A;  3JAF A;  4ZI7 E;  4DR2 T;  1S94 A;  1XNQ T;  5HWY A;  4FJO A;  4QH1 A;  3U78 A;  2QYW A;  3UUB A;  3NZQ A;  3PUG A;  1OED E;  4DV1 T;  3LK4 2;  2CRB A;  1MND A;  2H89 A;  4QX8 B;  2LOS A;  3ANW A;  2V6Y A;  2RA1 A;  2LSK A;  2XM2 A;  2VK9 A;  3ZMS B;  2UUA T;  3RIU A;  4AKL A;  5C8Y E;  3FZL B;  5JR9 A;  1HNZ T;  3EUH A;  3SWH A;  4YSX A;  3N2K E;  3AEA A;  1BR4 A;  2CHO A;  3QUJ A;  4GK0 E;  2UXN B;  4HN9 A;  2E9X A;  4IGU A;  4C91 A;  1HR0 T;  3RX6 A;  3LK3 B;  1LKX A;  2A3D A;  2CCQ A;  3KV6 A;  1MMA A;  2VVS A;  5AQM B;  4HWD A;  2Q9Q B;  3GN5 B;  4IE5 A;  1V9D A;  3RYF E;  4HWF A;  3LBX B;  4BAY B;  1U4Q A;  2IUB A;  4ZZC A;  2JMK A;  2XAS B;  4ILC A;  2BKO A;  4ILB A;  4OYK A;  4V1A v;  4COF A;  2C5J A;  2LOP A;  1G73 A;  2BDE A;  4TV8 E;  5HEJ A;  4IDP A;  3RYH E;  1IBL T;  1KK7 A;  4L5G A;  4HE8 A;  5AQO B;  2XQ9 A;  2VL8 A;  3ZSS A;  5AFU L;  4WZX A;  2ZM8 A;  2V5C A;  1HG2 A;  5FXZ A;  5JQG E;  2NWB A;  1MNE A;  5LJM A;  3NVO A;  3PJA J;  3K8P C;  5JRC B;  5TAO A;  3ZJ2 A;  4LFB T;  5F5W A;  2E9X C;  1KFY A;  2DL1 A;  2Q9Q D;  3TLV A;  2XAJ B;  2YU1 A;  4DUY T;  2VWA A;  4JLE A;  3HL6 A;  1M62 A;  1W0A A;  4AQG A;  4KMC A;  4O4I E;  1NAF A;  3VHL A;  3HKE E;  1YKE B;  3OYX A;  2BG9 C;  3Q5D A;  5JDH A;  1D1A A;  3DJB A;  4J2C A;  5L3G B;  4DBQ A;  2UXX B;  5HCJ A;  4KX6 A;  4A56 A;  2FJE A;  3V5S A;  3QK6 A;  2BVM A;  4H9N C;  4LML A;  2KMF A;  3RYC E;  3ZT5 A;  1Z8U A;  3ANW B;  2V6Y B;  2XJ7 A;  1T7S A;  4X1K E;  3G06 A;  5EZY E;  4WBO A;  5FY1 A;  4DR7 T;  5LGN B;  2KZ7 B;  2OLT A;  1VCT A;  5JR9 B;  1YD8 G;  3AE7 A;  2E5V A;  3PU3 A;  4AQF C;  4WW0 A;  4CXW A;  4BA9 A;  2DCF A;  2X9W A;  2XQY A;  2PFV A;  5HEH A;  4KHZ F;  2IDO B;  4DR5 T;  4TUY E;  1UUR A;  2XUE A;  4TX5 A;  3EHZ A;  3O1H A;  3N9P A;  3MZK B;  2NW8 A;  4GKJ T;  1XMO T;  5HYA A;  2FJA A;  5AQJ B;  4KP3 C;  2CWY A;  4YSY A;  2YIN A;  2LHR A;  4ZI2 C;  4U2Z A;  3TKL B;  3AA0 B;  4DV3 T;  5LXT E;  3UT5 E;  2CXF A;  2CM0 A;  2X9H A;  4PK4 A;  2D5U A;  4JI5 T;  3AE1 A;  3VR9 A;  3FZH B;  5DAB A;  2ACX A;  2DNX A;  3PUQ A;  2BKP A;  1OXZ A;  2LSY A;  2XY8 B;  4YLH A;  1HX8 A;  2X0H A;  3CQX C;  5DQW A;  1HF8 A;  2BG9 E;  3FZK B;  1XWM A;  1W9R A;  1HX1 B;  3N5L A;  3V5U A;  4PK5 A;  3DTO A;  2E9X D;  1E2A A;  3N2G E;  2MOZ A;  3GA8 A;  3C4Z A;  3LDQ B;  3RC8 A;  3KIN B;  3PUX F;  3E08 A;  5M4Y A;  4PW8 A;  3CX8 B;  5FL0 A;  3CPZ A;  3ABV A;  4EAH A;  4CI3 B;  3PUS A;  1VRB A;  3L09 A;  2WWV A;  2SPC A;  4ZZB A;  2XTL A;  4ADZ A;  3KFW X;  5CB4 E;  3M3Z B;  4DMW A;  4JI0 T;  3FBL A;  5EK3 A;  5AQU B;  5JDM A;  2WP9 A;  2W2U A;  1I6Z A;  4OX9 T;  2LEH A;  5FKY A;  2DI4 A;  4GK5 E;  5LYJ E;  2WMO A;  1X79 A;  4ANJ A;  5FXW A;  3A8Y C;  4TNV A;  4UVC B;  4L0R A;  1KNP A;  3JAE A;  2A72 A;  2VKH A;  2B76 A;  3BQI A;  4Q25 A;  4O2B E;  3EI0 A;  3KVB A;  1IJ5 A;  5HAX A;  2M6I A;  5HEO A;  3CX7 B;  2K48 A;  2E2A A;  3O9X A;  3QB5 K;  4C90 A;  5CA1 E;  2UUC T;  2QA7 A;  5ABF A;  3JC6 C;  4KBM B;  2L8K A;  3UUM A;  4P0A A;  3E0Z A;  3OYZ A;  5JDG A;  4WBN E;  3GMI A;  2YEV C;  3KV9 A;  4X1Y E;  4ZI2 D;  2JMH A;  3UU5 A;  1YW0 A;  1L0V A;  4CN4 A;  4LFA T;  4F8H A;  4PFO A;  1ZP0 A;  3PUZ F;  2KWI B;  5LHG B;  4CXX A;  5FNV E;  4UF0 A;  2CBJ A;  2J47 A;  1OWA A;  3JAD A;  4EED A;  5LBQ B;  1KF6 A;  5DQV A;  5F3J A;  4E7Z A;  3ZPO A;  1JNR A;  4H9Q C;  3P8C D;  5LG4 A;  2L9Q A;  3BQL A;  5L3C B;  4HFH A;  2MPK A;  3RI5 A;  1MIV A;  4DR1 T;  1N36 T;  4IE4 A;  2VQF T;  3I0O A;  1XNR T;  3QC9 A;  4IE7 A;  2UXC T;  4P09 A;  2G0U A;  1AJ3 A;  2JQQ A;  2X0L B;  5JTG A;  2V7I A;  4CZZ B;  1XZY A;  3F31 A;  5ETW A;  3RLF F;  2LRK A;  3SS1 A;  4UEM A;  2PG8 A;  3ETU A;  4QXH B;  5HXH A;  3CIR A;  4U33 A;  2CMR A;  4U31 A;  2A2F X;  2D9D A;  2LKH A;  1WR0 A;  2JQH A;  5FVL A;  5LJN A;  1VCS A;  4GYR A;  3R84 B;  3FHN A;  3OTO T;  3AE4 A;  2XZE A;  2Q9Q C;  3RKO A;  3ZYK A;  3I0Q A;  4B3S T;  2W00 A;  3MK7 C;  3C98 B;  3RQW A;  4DV7 T;  1IZN B;  1WLX A;  2XM1 A;  1FMW A;  1IAP A;  3OJA A;  2XAH B;  3F57 A;  1J5E T;  4IE6 A;  3UU4 A;  1QUU A;  5HEG A;  1FIO A;  3ZMU B;  5CJ5 A;  4DV0 T;  3JC6 D;  2K9A A;  4IDZ A;  4U7I A;  1MMN A;  1MMG A;  1D0Z A;  4AKI A;  3CQC B;  4GOU A;  3W15 B;  3MKD A;  4NIQ A;  3TLW A;  2IC9 A;  5ABF B;  1CUN A;  4OYJ A;  4X64 T;  2M6B A;  5J2T E;  5FVK A;  4JI3 T;  2UXD T;  4U72 A;  2JQK A;  4ZXL A;  4EZ4 A;  2IML A;  4I0U A;  2W66 A;  4NXM T;  4LF5 T;  3U3I A;  1Y01 A;  3UU6 A;  5J1G A;  3AE5 A;  1FJG T;  3NKZ A;  3VKH A;  1LVK A;  4P0B A;  2XQ3 A;  4DID B;  4CN6 A;  4YSZ A;  4UF0 B;  4O4L E;  2ODV A;  5KDM C;  2XSB A;  4EZH A;  5L3F B;  4IST A;  3O1I A;  2LSI A;  5HCM A;  3ONJ A;  1HS7 A;  4PNI A;  4H9R C;  4BJN A;  4LF7 T;  2KLQ A;  2R6G F;  4YTN A;  4X65 T;  2ZM0 A;  4ZI3 C;  3AEG A;  2P9B A;  5AQQ B;  4KI0 F;  3T1Y T;  3VRB A;  1HNX T;  2UU9 T;  2WZH A;  5AQT B;  1D0Y A;  3FZF B;  4H63 V;  4MHC A;  4OK0 A;  3ZT6 A;  1S35 A;  3RIU C;  2ZM2 A;  3KV5 A;  4P1N A;  2NW9 A;  5JR9 C;  1SUM B;  2V7K A;  4DVD A;  4AKR B;  4CXY A;  3C4X A;  5FXX A;  3D0T A;  4A98 A;  5FP3 A;  3ZC1 A;  4UEL A;  2HPJ A;  1T72 A;  1UX5 A;  4H63 H;  1N32 T;  4O4H E;  3C51 A;  5LGT B;  3AEF A;  3OKQ A;  4AQY T;  3AA7 B;  4H9O C;  3IA3 A;  5FYM A;  3SFE A;  4HWI B;  2J62 A;  1O3X A;  2CLY B;  3A7M A;  1XDO A;  5L2L A;  4LFC T;  4JUY A;  2IW5 B;  4AKG A;  4HFC A;  2WBL A;  3EVY A;  3UQ7 A;  3RIF A;  3FXD B;  4CI1 B;  2YDR A;  3VKG A;  4WYV A;  1WFD A;  3ZN0 B;  4DR6 T;  2VUR A;  4IDO A;  2FUP A;  1HFA A;  4EIW A;  3RIA A;  1WR6 A;  4YY3 T;  3IEE A;  3K3O A;  4UVB B;  3QB5 A;  4UV9 B;  2VL0 A;  4NPP A;  2WY2 A;  4XZC A;  5FL1 A;  3OBV E;  2A9U A;  5H6Q B;  2YKS A;  2W4X A;  2I6H A;  2I0M A;  2WB5 A;  3ZYL A;  2NR4 A;  3ESL A;  5CA0 E;  2RP4 A;  5FY7 A;  3P4S A;  2BBJ A;  4LF8 T;  4EV6 A;  4ASK A;  3B13 A;  3RRC A;  4DV2 T;  3AA6 B;  5JVD E;  2VKD A;  3N9M A;  4IL4 A;  4QHO A;  2GK9 A;  3EAM A;  4TN7 B;  4ZI3 D;  2ZM6 T;  1I94 T;  5AQS B;  1UGO A;  4NUU A;  2LM2 A;  1YXR A;  3NZP A;  2WDQ A;  4IRE A;  3HKD E;  2Z6E A;  3ZN1 B;  4QKN A;  3ZMT B;  4YXD A;  2X9Y A;  2KT9 A;  3PDY A;  4YJ3 E;  2DHR A;  1LVF A;  3HA4 A;  1NWM X;  3ZC0 A;  2K3W A;  2HN1 A;  1N33 T;  3HI2 A;  4K0U A;  5GON E;  1FMV A;  1M7K A;  1Z0P A;  3AB3 B;  1HTJ F;  2IHR 1;  4L9I A;  2JJ9 A;  3TLT A;  4DND A;  3LFM A;  4BJM A;  1CHU A;  5LGU B;  5ADX L;  3PUR A;  5AQH B;  2CE7 A;  4GIW A;  2MTQ A;  4E7S A;  2ACZ A;  4ZS2 A;  3MXZ A;  2Y6X A;  2H7V C;  3ZST A;  4AI6 A;  5AQG B;  1WYB A;  5CGM A;  1R8I A;  1J1J A;  3CQG B;  4OFZ A;  2JQ9 A;  4HFV A;  2ES0 A;  3AEE A;  3P50 A;  2LSJ A;  4XAX B;  5HXS A;  4EB6 E;  4QH4 A;  2ZMA A;  2PJQ A;  3AVR A;  2FJD A;  1OED A;  4DV6 T;  2WAU A;  3LG7 A;  4I50 E;  4TWH A;  4I55 E;  4JI1 T;  4G2A A;  2XQA A;  2LRL A;  3Q5E A;  2D2S A;  5L3B B;  4XBF B;  4FI5 A;  4B3M T;  2V7J A;  2LKG A;  3UQ4 A;  3ZMV B;  1MIW A;  2BS2 A;  3N2O A;  1US7 B;  1BR2 A;  3AVS A;  2N1G A;  3ZT7 A;  3Q2M A;  2B1E A;  3ETV A;  4CQI A;  5FY0 A;  4QWN B;  3FXE B;  3I9W A;  3X1D A;  3DP7 A;  3T1H T;  3B5M A;  2CXD A;  1ZV4 X;  2NTX A;  4LMJ A;  4DBR A;  4YTM A;  2LLY A;  3P4R A;  1IJ6 A;  4ZS3 A;  2QVA A;  1YQ4 A;  3RQU A;  2V7L A;  3AAA B;  2W61 A;  4O2A E;  4IT4 A;  4CN1 A;  2WZI A;  3L8R A;  4X5T A;  2WMN A;  3O4X E;  2XQ7 A;  4QH5 A;  2C0S A;  2VKO A;  1VOM A;  4PJL A;  1BR0 A;  2PTF A;  4TWD A;  1NEK A;  3J7Y q;  4JI8 T;  5JDF A;  2K24 A;  4Z91 A;  2WU5 A;  2EHO A;  4KHP T;  2D0T A;  3FB2 A;  4A5X A;  2UXB T;  2Y8D A;  1BR1 A;  3KVA A;  4EGW A;  4M1P A;  4GKK T;  2KXP B;  4ILU A;  5JDQ A;  2CXL A;  4G63 A;  4QX7 B;  2C5I T;  5AQV B;  4X20 E;  4KUM B;  3WAJ A;  3ONL C;  3I9Y A;  4IIJ E;  2ODU A;  1ZKE A;  2VKJ A;  3NRY A;  2K5B B;  2FBW A;  1NEN A;  5IYZ E;  2YN6 A;  4U2Y A;  4IHJ E;  1HCI A;  2J4G A;  4JBW F;  3N9O A;  2BZB A;  4HKA A;  2VQE T;  4UV8 B;  3P4W A;  2LE8 A;  3OVU A;  2W67 A;  1OED B;  3KBU A;  2XQ4 A;  3H3A A;  3CVR A;  5HWX A;  1KNR A;  4JEU B;  2VB6 A;  3C64 A;  3WAK A;  5BR8 T;  2BKN A;  3PUY F;  5IUX A;  3UFG A;  4AIU A;  3FZM B;  1XMQ T;  3ZEF B;  2YK0 A;  4NXN T;  2VAS A;  1KEY A;  4ZOL E;  5FXV A;  1UX4 A;  4EYY R;  2X67 A;  4PJN A;  3TLU A;  4NUV A;  4I4T E;  2BS3 A;  3SOL A;  4QXC B;  4LF4 T;  3RYI E;  2XQ8 A;  2MAW A;  5LNK A;  3M65 A;  4PFP A;  4H9P C;  3P7I A;  1X9B A;  1G8X A;  4MAL A;  2PBI A;  4Z90 A;  4QXB B;  1UCU A;  3KBT A;  5LA6 E;  3UUX B;  5LMN T;  3PUA A;  2AE9 A;  5AQN B;  3PTR B;  4MBQ A;  5LMU T;  5LOV E;  5LHI B;  5L47 A;  2HHH T;  2WS3 A;  1T98 A;  5EK4 A;  5L3E B;  5LP6 E;  3MJX A;  4TV9 E;  2H3R A;  2WM9 A;  2EHO B;  1N34 T;  2CLY C;  4B6X A;  3RRW A;  5ABG A;  2BS4 A;  4HGA A;  3H3M A;  3NBX X;  2BG9 A;  3N9N A;  2XQ5 A;  4X66 T;  1U5P A;  3ZJ1 A;  2ZLY A;  4DV4 T;  2DWK A;  3FBZ A;  5AQF B;  1MIY A;  1QSD A;  3UU8 A;  4ILA A;  2KND A;  3ZKR A;  2XSA A;  4HFB A;  5AQP B;  4YFS A;  1D1C A;  2W0G A;  3B57 A;  4AQF A;  4DUZ T;  4CI2 B;  3Q5W A;  1WCR A;  3PE0 A;  4UVA B;  2HPL A;  4U74 A;  5JH7 E;  3PUW F;  2YDS A;  4IDQ A;  2XAF B;  3N9L A;  2LSG A;  2LHN A;  1XDP A;  2EHO D;  2X68 A;  3AED A;  4A97 A;  3CK6 A;  2X9X A;  1MMD A;  4GYS A;  3LJC A;  3AXJ A;  2KSR A;  3MA9 A;  2C5K T;  2WQY A;  1LRZ A;  3I1A A;  4YHH T;  4JYA T;  4EYU A;  2NOX A;  3E22 E;  3ZYM A;  3MAC A;  3IF8 B;  4HEA A;  2I59 A;  3ZCJ A;  2AXD S;  2KIN B;  3AAI A;  2HH7 A;  4PJM A;  4N78 D;  1HNW T;  1E1H B;  4I43 B;  2V5D A;  3RPU A;  5C2T A;  3QOF A;  3AE6 A;  1E7P A;  1WRD A;  5AQL B;  5LHH B;  3T8O A;  2DWG A;  4UIG A;  5AQR B;  3S4U A;  2E9X B;  2JRK A;  3H37 A;  3PU8 A;  2FJB A;  4DR4 T;  3HKB E;  4X62 T;  5HXE A;  4UR9 A;  4OHF A;  3LK2 B;  4ZEY A;  3K1S A;  4B3R T;  5EK2 A;  2WDR A;  2JIW A;  5ABH A;  4X1I E;  3HR0 A;  5LCY A;  5JRE A;  2N2N A;  3CML A;  2D0U A;  2LM9 A;  4HWC A;  3AE2 A;  3L39 A;  2WDV A;  2JPF A;  1SE7 A;  2BG9 B;  2NW7 A;  1HG5 A;  3K3Q C;  3EDV A;  2CWO A;  2MBG A;  1UUS A;  1YQ3 A;  5ABE A;  5FMN A;  4B3T T;  2OV9 A;  5E0O A;  3GWH A;  2E5L T;  5L3D B;  3UFE A;  2WSS V;  5LG3 A;  1YKH B;  3O1J A;  4PAG A;  2CA5 A;  3R6N A;  5LB7 B;  2J1D G;  4PK6 A;  3NWI A;  5IWA T;  3ZMZ B;  2VVN A;  4H9S E;  2XAG B;  5BMV E;  3PV0 F;  4LF9 T;  3C50 A;  3RGL A;  2CPT A;  3JCF A;  4YJ2 E;  4JI4 T;  3A5X A;  5AQK B;  5J0Z A;  3J9X 1;  3RHW A;  3PUV F;  3RH3 A;  3C4W A;  3P4Q A;  4U7Y A;  3AAE B;  5J2U E;  1Y64 B;  4IE0 A;  2H88 A;  2V6X A;  3EAB A;  1W0B A;  4EEB A;  2YU2 A;  3UU3 A;  1D1B A;  2Y48 B;  4TWF A;  2W62 A;  2CHN A;  1IBM T;  3AXJ B;  5KXJ A;  1T8B A;  4O8S A;  4Z8X A;  3AE9 A;  2UUB T;  4AXP A;  2LT3 A;  3WI3 A;  1B7T A;  1D0X A;  1SA0 E;  5IHY A;  4AIS A;  4HTE A;  4WNK A;  5KMG P;  5HXR A;  2X66 A;  2V7M A;  2F4V T;  4PJJ A;  4JV5 T;  3RKG A;  5C3J A;  1ZEE A;  3AEB A;  2NTY A;  3ONX A;  1GQE A;  2RPA A;  5JDN A;  1IBK T;  4K0K T;  4JI2 T;  3UUN A;  2KWH A;  4HFE A;  2NP9 A;  5HXC A;  1EZ3 A;  2MYS A;  4JI7 T;  2CBI A;  4ZHQ E;  4TZ4 C;  4F6R C;  3IBP A;  3AEC A;  1UK5 A;  2XHE B;  3AE8 A;  3QNU A;  1DU2 A;  5H6R B;  4HFD A;  2HN2 A;  2YOE A;  2YDQ A;  3N9Q A;  3VR8 A;  4ERR A;  4EXT A;  4HWH A;  4YT0 A;  2XPK A;  2XAQ B;  2X51 A;  3CWZ B;  4TNW A;  4YTP A;  3Q9D A;  1SHZ C;  3VU7 H;  1H7C A;  3ZCI A;  4LF6 T;  4EOZ B;  1WYC A;  4MFR A;  3Q5X A;  3SFD A;  3IHR A;  4DO0 A;  5JDL A;  4O4J E;  3NRX A;  2LJL A;  1OED C;  2Q9Q A;  4IDN A;  4DMV A;  3KV4 A;  3HKC E;  3VRA A;  3BK9 A;  3GN5 A;  3KDS E;  5HEU A;  3PJA A;  2N9D A;  5CFB A;  2V1D B;  3LBX A;  3F2E A;  4U3C A;  5AQI B;  1ZHC A;  2CEA A;  3LSV A;  3CKD A;  3RF1 A;  2E8I A;  2BVL A;  3K3N A;  5A1L A;  2L3L A;  4ISS A;  2IC6 A;  1KNZ A;  5L4H A;  4MLK A;  1J5W A;  4UXN B;  3ZLI A;  3AE3 A;  1ZOY A;  1JNZ A;  4HFI A;  5F8P A;  2BBH A;  2V26 A;  3UTK A;  4JI6 T;  3L3P A;  2XQ6 A;  3OPC A;  4AKH A;  2OA5 A;  4DV5 T;  2WU2 A;  3AA1 B;  2IIU A;  4DR3 T;  2M67 A; 
#chains in the Genus database with same CATH homology
 2A72 A;  3N9N A;  5FY7 A;  5KX5 E;  3UUL A;  2QGS A;  2VKH A;  1U5P A;  3BQI A;  4ASK A;  3ZJ1 A;  3B13 A;  3SRZ A;  3RRC A;  2ZLY A;  4O2B E;  3AA6 B;  2DWK A;  3FBZ A;  5JVD E;  5JRC A;  2VKD A;  2DLR A;  3N9M A;  3KVB A;  4QHO A;  1IJ5 A;  2H7O A;  5HAX A;  2WWU A;  1MIY A;  2GK9 A;  3EDU A;  1QSD A;  4TN7 B;  5CA0 E;  5LBM A;  3CX7 B;  2K48 A;  4ZI3 D;  3O9X A;  4C90 A;  4JEH B;  5CA1 E;  3RC3 A;  2QA7 A;  2KND A;  4NUU A;  3JC6 C;  2EHO C;  4KBM B;  4YFS A;  1D1C A;  3NZP A;  2IAK A;  2W0G A;  3B57 A;  2L8K A;  3UUM A;  3HKD E;  2Z6E A;  5DJQ C;  3E0Z A;  3ZN1 B;  4AQF A;  4P0A A;  1FEW A;  4CI2 B;  4QKN A;  3OYZ A;  4YHJ A;  3Q5W A;  5JDG A;  3ZMT B;  4WBN E;  3BQK A;  3CX6 B;  3GMI A;  2W63 A;  2YEV C;  2X9Y A;  3PE0 A;  2KT9 A;  3PDY A;  4UVA B;  2HPL A;  2DHR A;  3KV9 A;  4X1Y E;  4YJ3 E;  4ZI7 E;  1LVF A;  3HA4 A;  4U74 A;  4ZI2 D;  2JMH A;  5JH7 E;  1S94 A;  1NWM X;  3ZC0 A;  2XAF B;  3N9L A;  5HWY A;  1YW0 A;  2LSG A;  4FJO A;  2LHN A;  3U78 A;  3HI2 A;  3NZQ A;  4K0U A;  5GON E;  3PUG A;  1FMV A;  1Z0P A;  3AB3 B;  3LK4 2;  2EHO D;  4PFO A;  1HTJ F;  1MND A;  4QX8 B;  2X68 A;  2LOS A;  4L9I A;  2KWI B;  5LHG B;  3ANW A;  2X9X A;  2JJ9 A;  1MMD A;  4CXX A;  2RA1 A;  4DND A;  2LSK A;  3LFM A;  4UF0 A;  5FNV E;  2VK9 A;  4BJM A;  5LGU B;  5ADX L;  4GYS A;  3LJC A;  3ZMS B;  1OWA A;  3MA9 A;  4AKL A;  2C5K T;  5C8Y E;  3PUR A;  5LBQ B;  1LRZ A;  5DQV A;  5F3J A;  3I1A A;  4E7Z A;  5JR9 A;  2CE7 A;  3ZPO A;  4GIW A;  2MTQ A;  3EUH A;  4H9Q C;  3SWH A;  3P8C D;  4E7S A;  5LG4 A;  2L9Q A;  3BQL A;  4EYU A;  2NOX A;  3N2K E;  1BR4 A;  3QUJ A;  3E22 E;  3ZYM A;  5L3C B;  3MAC A;  3IF8 B;  4ZS2 A;  4GK0 E;  4HEA A;  1MIV A;  3MXZ A;  2UXN B;  4HN9 A;  2E9X A;  2Y6X A;  2I59 A;  4IGU A;  2H7V C;  4AI6 A;  4C91 A;  4IE4 A;  3RX6 A;  1WYB A;  3ZCJ A;  2KIN B;  3LK3 B;  3CQG B;  3AAI A;  3I0O A;  1LKX A;  2A3D A;  2CCQ A;  4OFZ A;  2HH7 A;  3KV6 A;  1MMA A;  3QC9 A;  4PJM A;  4IE7 A;  4N78 D;  4HFV A;  2ES0 A;  4P09 A;  2G0U A;  1AJ3 A;  2JQQ A;  2X0L B;  2Q9Q B;  1E1H B;  4I43 B;  2LSJ A;  2V7I A;  3GN5 B;  4IE5 A;  4XAX B;  4CZZ B;  5HXS A;  3F31 A;  5ETW A;  3RPU A;  4EB6 E;  1V9D A;  3RYF E;  3SS1 A;  4UEM A;  2ZMA A;  3LBX B;  2PJQ A;  4BAY B;  1U4Q A;  1WRD A;  2JMK A;  2PG8 A;  3AVR A;  3ETU A;  2WAU A;  2XAS B;  3LG7 A;  3T8O A;  5LHH B;  4I50 E;  4I55 E;  4QXH B;  5HXH A;  4G2A A;  2DWG A;  4UIG A;  4AKI A;  4OYK A;  4V1A v;  3S4U A;  2E9X B;  2C5J A;  2JRK A;  3H37 A;  3PU8 A;  2LOP A;  2CMR A;  2A2F X;  2D2S A;  1G73 A;  3HKB E;  4FI5 A;  5L3B B;  4XBF B;  5HXE A;  2V7J A;  2BDE A;  4TV8 E;  4OHF A;  3LK2 B;  5LJN A;  3ZMV B;  1MIW A;  5EK2 A;  3N2O A;  1US7 B;  1BR2 A;  4X1I E;  3AVS A;  3HR0 A;  2N1G A;  3Q2M A;  2B1E A;  3RYH E;  5LCY A;  5JRE A;  1KK7 A;  2N2N A;  3CML A;  4GYR A;  2D0U A;  2LM9 A;  3ETV A;  4HE8 A;  4L5G A;  3R84 B;  4CQI A;  2VL8 A;  3FHN A;  5FY0 A;  4QWN B;  5AFU L;  3FXE B;  3I9W A;  2ZM8 A;  2Q9Q C;  2JPF A;  3RKO A;  3ZYK A;  3DP7 A;  3I0Q A;  2W00 A;  2CXD A;  1HG2 A;  1HG5 A;  1ZV4 X;  2NTX A;  2NW7 A;  3C98 B;  3K3Q C;  3MK7 C;  1IZN B;  1WLX A;  4DBR A;  1FMW A;  1IJ6 A;  5FXZ A;  1IAP A;  4ZS3 A;  3OJA A;  3EDV A;  5JQG E;  2CWO A;  2NWB A;  1MNE A;  2XAH B;  2MBG A;  5LJM A;  3F57 A;  3K8P C;  2V7L A;  3AAA B;  4IE6 A;  1QUU A;  5JRC B;  2W61 A;  1FIO A;  5FMN A;  5TAO A;  4O2A E;  3ZJ2 A;  3ZMU B;  5E0O A;  3GWH A;  2E9X C;  5L3D B;  3JC6 D;  3UFE A;  2WSS V;  2WMN A;  2Q9Q D;  2K9A A;  1YKH B;  2XAJ B;  3O1J A;  2YU1 A;  3O4X E;  4IDZ A;  4PAG A;  2CA5 A;  3R6N A;  1MMN A;  1MMG A;  2C0S A;  1D0Z A;  2VKO A;  1VOM A;  3CQC B;  2J1D G;  2VWA A;  4GOU A;  3MKD A;  4JLE A;  4PJL A;  3HL6 A;  3W15 B;  1BR0 A;  4PK6 A;  2IC9 A;  3ZMZ B;  1CUN A;  4OYJ A;  4AQG A;  4KMC A;  4O4I E;  5J2T E;  3J7Y q;  1NAF A;  4H9S E;  2XAG B;  5BMV E;  3VHL A;  3HKE E;  3C50 A;  1YKE B;  3OYX A;  4U72 A;  5JDF A;  2K24 A;  4YJ2 E;  5JDH A;  3A5X A;  1D1A A;  4EZ4 A;  3DJB A;  2EHO A;  2D0T A;  3J9X 1;  4J2C A;  5L3G B;  3RH3 A;  4DBQ A;  3C4W A;  2UXX B;  3FB2 A;  3AAE B;  5J2U E;  1Y64 B;  4A56 A;  4IE0 A;  3U3I A;  3V5S A;  3QK6 A;  2BVM A;  5J1G A;  2Y8D A;  4H9N C;  1BR1 A;  2KMF A;  3KVA A;  4M1P A;  3RYC E;  2YU2 A;  2KXP B;  3VKH A;  3ANW B;  1D1B A;  1LVK A;  2Y48 B;  4P0B A;  4X1K E;  4ILU A;  5EZY E;  2W62 A;  5JDQ A;  4UF0 B;  4O4L E;  2ODV A;  4WBO A;  2CXL A;  5FY1 A;  5KDM C;  4G63 A;  4QX7 B;  4O8S A;  2C5I T;  4Z8X A;  4EZH A;  5LGN B;  2KZ7 B;  5L3F B;  4IST A;  3O1I A;  2LSI A;  4X20 E;  4KUM B;  1YD8 G;  5JR9 B;  1HS7 A;  4AXP A;  2LT3 A;  4PNI A;  3WI3 A;  1B7T A;  3WAJ A;  1D0X A;  3PU3 A;  4H9R C;  3I9Y A;  4AQF C;  4BJN A;  4WW0 A;  4IIJ E;  4CXW A;  2ODU A;  1ZKE A;  2DCF A;  4BA9 A;  2X9W A;  1SA0 E;  2VKJ A;  5IHY A;  3NRY A;  2K5B B;  2XQY A;  2KLQ A;  2PFV A;  4HTE A;  4WNK A;  5KMG P;  5IYZ E;  5HXR A;  2X66 A;  2V7M A;  4TUY E;  2XUE A;  2ZM0 A;  4TX5 A;  4ZI3 C;  4PJJ A;  3O1H A;  2P9B A;  4IHJ E;  1ZEE A;  3N9P A;  1HCI A;  2NTY A;  3MZK B;  3ONX A;  2NW8 A;  1D0Y A;  4H63 V;  3N9O A;  5JDN A;  4MHC A;  5HYA A;  2BZB A;  4OK0 A;  4HKA A;  3UUN A;  2KWH A;  1S35 A;  2NP9 A;  4UV8 B;  5HXC A;  1EZ3 A;  4KP3 C;  2CWY A;  2MYS A;  2YIN A;  4ZHQ E;  2LE8 A;  2ZM2 A;  4TZ4 C;  3KV5 A;  2LHR A;  4F6R C;  3IBP A;  2NW9 A;  3KBU A;  4ZI2 C;  5JR9 C;  2V7K A;  4DVD A;  3H3A A;  3CVR A;  3TKL B;  3AA0 B;  5HWX A;  2XHE B;  4AKR B;  3C4X A;  4CXY A;  5LXT E;  3UT5 E;  2CXF A;  2CM0 A;  2X9H A;  4PK4 A;  4JEU B;  2D5U A;  2VB6 A;  5FXX A;  3C64 A;  5DAB A;  3WAK A;  3D0T A;  5H6R B;  2ACX A;  5FP3 A;  3ZC1 A;  2DNX A;  3PUQ A;  4UEL A;  1OXZ A;  2LSY A;  3N9Q A;  2HPJ A;  4ERR A;  4EXT A;  1UX5 A;  3ZEF B;  2YK0 A;  4YLH A;  1HX8 A;  2XAQ B;  4H63 H;  2VAS A;  4O4H E;  3C51 A;  3CQX C;  5DQW A;  5LGT B;  2X51 A;  1HF8 A;  3CWZ B;  3OKQ A;  3Q9D A;  4ZOL E;  1SHZ C;  3AA7 B;  5FXV A;  3VU7 H;  1UX4 A;  3N5L A;  3V5U A;  4H9O C;  4EYY R;  1H7C A;  2X67 A;  5FYM A;  4PJN A;  3ZCI A;  4PK5 A;  4EOZ B;  1WYC A;  4MFR A;  4NUV A;  3Q5X A;  3DTO A;  2E9X D;  4I4T E;  1O3X A;  2CLY B;  3N2G E;  3IHR A;  3SOL A;  4DO0 A;  2MOZ A;  5JDL A;  5L2L A;  3GA8 A;  4O4J E;  3NRX A;  3C4Z A;  4QXC B;  3RC8 A;  2LJL A;  3KIN B;  2Q9Q A;  4DMV A;  3KV4 A;  3RYI E;  4JUY A;  2IW5 B;  4AKG A;  3HKC E;  5LNK A;  3BK9 A;  3M65 A;  2WBL A;  3EVY A;  4PFP A;  3E08 A;  3GN5 A;  3KDS E;  4H9P C;  3P7I A;  5M4Y A;  2N9D A;  4PW8 A;  1G8X A;  3FXD B;  3CX8 B;  4MAL A;  2PBI A;  4CI1 B;  4QXB B;  2V1D B;  3VKG A;  3CPZ A;  1UCU A;  3KBT A;  3LBX A;  3F2E A;  4EAH A;  5LA6 E;  3ZN0 B;  3UUX B;  4CI3 B;  1ZHC A;  2CEA A;  3PUS A;  3CKD A;  3PUA A;  1VRB A;  2E8I A;  2BVL A;  3PTR B;  3L09 A;  4MBQ A;  2SPC A;  1HFA A;  4EIW A;  2XTL A;  5LOV E;  3KFW X;  4ADZ A;  1WR6 A;  3K3N A;  5A1L A;  5LHI B;  3IEE A;  2L3L A;  3K3O A;  5CB4 E;  4ISS A;  4UVB B;  2IC6 A;  4UV9 B;  4DMW A;  1KNZ A;  3FBL A;  5EK3 A;  5JDM A;  1T98 A;  5EK4 A;  5L3E B;  4XZC A;  4MLK A;  3OBV E;  5LP6 E;  3MJX A;  4UXN B;  5H6Q B;  4TV9 E;  3ZLI A;  2H3R A;  2WM9 A;  2EHO B;  5F8P A;  2CLY C;  4B6X A;  2V26 A;  3RRW A;  2LEH A;  3UTK A;  3L3P A;  2DI4 A;  4GK5 E;  5LYJ E;  2WMO A;  4AKH A;  1X79 A;  2OA5 A;  4HGA A;  4ANJ A;  3AA1 B;  5FXW A;  3ZYL A;  2M67 A;  3ESL A;  3NBX X;  4UVC B;  4L0R A;  2RP4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...