1ZEEA

X-ray crystal structure of protein so4414 from shewanella oneidensis. northeast structural genomics consortium target sor52.
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
sequence length
387
structure length
363
Chain Sequence
YNTEAFDEWIRSRFVELNSQLEQLYYQQTDRANVQEVGTELKHTLESEGRELVKALLDEGNTDEGFDSAFDLLGNVGLYMAACRRHEITEPTRETTSPLLEASALAMHIGASIGVTPRFATAHLTTHNRAHNGIYKRFTDLPDEKLFVDYNTKGILAYKRASDALLKIQPLGISHPISHDLLRVTKQALQDVIESNQQLFNRLDTDRFFYCVRPYYKPYRVGSVVYRGANAGDFAGINVIDLTLGLCFANEASYSQMLVDKFLYMMPEDQQILRECMRRPNLMDDFLQAKGCIHQDWYQENLKLFIEVCELHGQTAIQHHNELVTKYVLLASLERLRDRRAAVLRDDIRTRYYDLKKLKDSLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein SO4414
publication title Crystal Structure of the Hypothetical Protein SO4414 from Shewanella oneidensis, NESG Target SoR52
rcsb
source organism Shewanella oneidensis
molecule tags Unknown function
total genus 129
structure length 363
sequence length 387
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08933 DUF1864 Domain of unknown function (DUF1864)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.480 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 1zeeA02
1.20.58.600 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 1zeeA01
4U74A 1ZEEA 2D0TA 1YW0A 2NW7A 4HKAA 2V7IA 5EK2A 3E08A 5EK4A 2V7LA 5EK3A 2NW8A 2X67A 2NW9A 2V7MA 5ETWA 2V7KA 2X68A 2NOXA 2X66A 2NWBA 2D0UA 4PW8A 4PK6A 2V7JA 4PK5A 4U72A 3BK9A
chains in the Genus database with same CATH superfamily
2K48A 2E8IA 5FY7A 4QH5A 2EHOC 3S4UA 4TWFA 2JPFA 3R6NA 3FXEB 4MBQA 3ZMVB 1D1BA 2DI4A 2BBHA 4LF7T 4YTMA 2XAFB 3LBXB 2A72A 2D9DA 2V5DA 3T1HT 2HHHT 2DNXA 3FZFB 1XDPA 4X62T 4X1YE 3HL6A 1ZHCA 3JADA 1LRZA 4TX5A 3I9WA 1EZ3A 3P4PA 3OVUA 3ONXA 3ZPOA 3X1DA 1SHZC 4QX7B 4B3ST 5FXWA 3UU4A 3JC6C 3QC9A 4ZXLA 4KI0F 2YDRA 3Q5DA 3MJXA 4LFAT 2C5KT 5J2UE 4YXDA 2WCAA 3QK6A 3ZYKA 2R6GF 5J0ZA 4B3TT 3IEEA 2WU2A 2V5CA 1HS7A 2QA7A 1N33T 5C8YE 4C90A 3VR9A 1BR0A 4ILAA 3HKCE 4DBQA 5CA1E 2XQ9A 2QRXA 3CPZA 1ZP0A 4N78D 2V7LA 4WYVA 3C64A 5L3DB 5AQFB 4L5GA 4UVAB 2JJ9A 3RF1A 2WDVA 2JQKA 3ONJA 3J9X1 3L3PA 3GN5A 2CCQA 3N9PA 4GIWA 5LG3A 4CXYA 4G2AA 1KFYA 4X65T 4B6XA 2L3LA 3FXDB 3AVSA 5J2TE 4X5TA 4DNDA 2NP9A 2YU2A 2D0UA 4IE0A 4U2YA 2LT3A 1IJ6A 2WMOA 3AA1B 2Z6EA 2JIWA 4F8HA 2XQ5A 3ZJ2A 4DV0T 3RI5A 2VASA 4JBWF 4I4TE 3UUNA 3ZEFB 3KVAA 4HWHA 2IMLA 3KINB 4JI4T 4U33A 3PTRB 4ZI2D 2X0HA 3C4WA 5CGMA 3K8PC 4HFVA 4L9IA 2NR4A 4GOUA 4EZ4A 3UQ4A 2Q9QA 5FYMA 2YN6A 1D0YA 5L4HA 1WFDA 2XSBA 5L3FB 2WM9A 2PFVA 4UV8B 1V9DA 4EAHA 4DUZT 1UCUA 4DR2T 3CIRA 3E22E 3ETUA 4CXWA 4HWFA 3AXJB 2XQ3A 3M3ZB 1MMAA 1YKEB 3PE0A 2XUEA 4DIDB 1XNRT 2XAQB 4UEMA 2WB5A 4CQIA 4O4IE 4I43B 3J7Yq 2FJAA 4DR7T 5JDLA 2X67A 2BS3A 2OLTA 1IJ5A 1QUUA 2VKHA 4IL9A 2IW5B 5FXXA 1BR4A 2WAUA 1MNEA 4YTNA 3QUJA 1J5ET 3ZMSB 2J1DG 2EHOD 3A7MA 5IYZE 3BQKA 3FZLB 1XWMA 1BR1A 3N9QA 3GA8A 4PK5A 5L2LA 2WDRA 5AQIB 4H63V 4JEHB 4L0RA 2KXPB 5KXJA 3VRAA 5CB4E 3RPUA 5EK3A 3QB5K 3PV0F 3RRWA 3N2GE 5LYJE 3Q5XA 4HGAA 5CJ5A 3AE4A 4G63A 3MZKB 3JC6D 3SRZA 3E08A 3LK3B 3SFDA 2NW8A 3FB2A 4P09A 3RKGA 2X51A 3HI2A 4JI1T 4EEDA 2CLYB 5HXRA 4AISA 4ISTA 3AE6A 2WY2A 4ASKA 1OXZA 4IIJE 3UU6A 4CI3B 3PUAA 5BMVE 2A3DA 1KNZA 5LGUB 3E0ZA 2IUBA 2W0GA 4KX6A 2W62A 2N1GA 1T72A 4QWNB 2LOSA 3RH3A 2GK9A 1YQ4A 3UTKA 1N36T 3LSVA 5FVLA 5LP6E 2XY8B 4HFDA 3P4SA 2CHNA 4B3MT 2SPCA 4PJJA 3A5XA 1KEYA 1HNWT 4TV8E 2HPLA 2UUAT 4JI3T 4NXMT 5JDFA 2ACXA 1WLXA 3RIUA 3KV5A 3JAFA 4X66T 1HFAA 2NW9A 3RC8A 2WBLA 3RC3A 3CKDA 3LDQB 3RRCA 1MMGA 3CMLA 3RIUC 1XMQT 3ZMUB 2E9XA 3P4RA 5M4YA 5FMNA 3P4WA 2X9WA 3HKDE 2PBIA 3OJAA 3ZCJA 5LCYA 1XNQT 2ODVA 2X0LB 3N2OA 5HEHA 5HXHA 2YOEA 5LXTE 4EEBA 2B76A 2E9XC 5HEJA 3C4XA 3NRXA 3ANWA 3AEEA 3IA3A 4Q25A 5LGTB 2CBJA 4HFEA 2KINB 3V5SA 3V5UA 4TWDA 3NZPA 2HN2A 5KX5E 3RQWA 1T8BA 5L47A 2V7MA 5AQHB 4HFIA 1OEDA 2DWGA 3UUXB 5HAXA 5LBQB 2M6BA 2KSRA 2NW7A 5ABFB 1W9RA 2XM2A 3PJAA 2F4VT 3CX7B 3AE8A 2JMKA 2K9AA 3PDYA 3EUHA 3BQIA 3RYHE 3ONLC 5AQLB 4KBMB 2CBIA 5BR8T 3H37A 3O1IA 2X68A 4EGWA 4YSZA 5CA0E 4C91A 3KBTA 3KV6A 4DV2T 1JNZA 4DV5T 2LSIA 3AAEB 3HKBE 2H7OA 2BG9A 5H6RB 3Q5EA 3TLUA 2EHOA 3PJAJ 4IGUA 4YSYA 4P0AA 4UELA 2UU9T 4MHCA 2BKOA 2H89A 4I50E 4UVBB 3OYXA 2X9XA 2BG9C 3KV4A 3L09A 3CWZB 3FBLA 3KFWX 5EZYE 5IUXA 2RPAA 2CRBA 2XAJB 5LOVE 2LKHA 2IIUA 4LFCT 1G8XA 4COFA 2V7IA 1WR6A 4X1KE 5E0OA 2W61A 5AQTB 2JQQA 3ZT5A 4JI5T 2KMFA 2VQET 3AE9A 3PUXF 2LSYA 4KUMB 3GMIA 2UXXB 5H6QB 1YQ3A 4MLKA 2H7VC 2FJDA 3AECA 3ZN0B 3EDUA 4CI2B 1WCRA 1W09A 3NZQA 4LF8T 4OFZA 5HWXA 3VRBA 4IE7A 3AEGA 2XASB 3LJCA 2MBGA 4PFOA 4AI6A 2LLYA 5JH7E 3RYFE 3ZKRA 1IBKT 4GKJT 3C50A 5ADXL 5FP3A 4AIUA 4ZS3A 5LG4A 1X79A 3O1HA 2PG8A 1WYBA 5JDHA 4HFCA 2MTQA 2E5LT 5HEOA 5JQGE 2Y6XA 3PUGA 2BVLA 5ABGA 2YDQA 2V26A 5TAOA 2LM9A 3AA0B 2BZBA 4HWDA 3ETVA 4IL4A 3ESLA 5JRCA 5FVKA 3C98B 2WP9A 4X64T 4HE8A 2E9XD 3F2EA 4KHZF 2HH7A 4CXXA 5L4EA 4O8SA 4ADZA 4O4JE 5L3EB 3BK9A 1MIWA 2P9BA 2PJQA 1US7B 4ZHQE 3M65A 3LK42 2VK9A 1GQEA 2CWYA 5IHYA 5FL0A 1UUSA 5EK4A 1HNXT 3CQGB 3IF8B 5C2TA 2W00A 3AE5A 2OV9A 4HTEA 4JI2T 3WI3A 2CPTA 4UV9B 1Y64B 2Y48B 2H88A 2I0MA 2CM0A 5LJMA 4QXHB 2CA5A 1HG2A 3UFGA 3L8RA 2LEHA 1IAPA 3LG7A 4XAXB 4YT0A 2V7JA 1ZOYA 2L8KA 4YHJA 5C3JA 5L3BB 5FL1A 3HA4A 4TNWA 3UFEA 3OBVE 4X1IE 2UXCT 3WAKA 3I9YA 3EI0A 3ANWB 4QH4A 4WZXA 3ZYMA 5GONE 1LVFA 2ZM6T 4DV6T 3AEAA 1WR0A 4M1PA 3FZMB 4EV6A 4KP3C 5LNKA 2QGSA 1HG5A 4AKHA 3LFMA 3RYIE 2YEVC 1NWMX 4BA9A 3KV9A 4JI0T 2C5IT 2WZIA 4YJ3E 2QVAA 2LM2A 2AXDS 3AAAB 1WYCA 4U74A 4HKAA 1D1AA 4LFBT 4CN4A 3LBXA 4AQGA 4BJNA 3BQLA 4JYAT 2B1EA 4H9PC 5HXCA 3PUYF 5AQKB 4WBOA 2X9HA 4CN6A 1OWAA 3PUVF 3VR8A 4EB6E 2N2NA 4WBNE 2IC9A 2KZ7B 3TLTA 1SE7A 4UIGA 2NTXA 3CX6B 2ZM0A 3W15B 4TUYE 1S35A 3FZHB 3RX6A 4AQFC 4QH1A 3F57A 4YY3T 4E7SA 1LVKA 1IZNB 3AB3B 5JR9B 1HCIA 2ES0A 5AQUB 4EYYR 2D0TA 2Y8DA 2XQ8A 2EHOB 2CXLA 2WSSV 4A98A 2C0SA 2X9YA 2HPJA 4HN9A 4DR5T 4QXBB 4OX9T 2ZM8A 3FBZA 4AKLA 1HX1B 3DTOA 4JV5T 4EYUA 4AXPA 3N9OA 3EABA 3MKDA 3ZT7A 3AA6B 2WS3A 2CXFA 1KK7A 2PTFA 4JI8T 2K24A 1ZEEA 2KT9A 4ZS2A 4KHPT 1KF6A 3VKHA 5AFUL 1FEWA 2I6HA 2W4XA 2MOZA 2LSJA 4H9QC 2X0YA 1U4QA 4O2AE 2LE8A 5LHHB 1R8IA 4ZI3C 3ZYLA 3CX8B 2XQ6A 3EAMA 3AE3A 3NBXX 2YU1A 4UVCB 3MXZA 4LF6T 2J47A 2E5VA 4ILBA 2J4GA 5LMNT 4CZZB 3N2KE 3FHNA 4IDPA 1J1JA 1B7TA 2WDQA 1D0ZA 2ZLYA 4DV7T 4DBRA 2CEAA 2UXNB 3T1YT 3B57A 3CQXC 5LBMA 2X66A 3N9NA 2A9UA 4DMWA 4AKGA 4PK6A 4JUYA 5LB7B 3U78A 4H63H 1Y01A 4GYSA 3I1AA 4UF0A 1N32T 3UU8A 1Z0PA 3ZN1B 3AAIA 1HR0T 2WWVA 3UU5A 3GN5B 5L3CB 2A2FX 3NRYA 4LF4T 4IDQA 4WW0A 1QLBA 4TN7B 4DV4T 3CQCB 4HFHA 3RHWA 1HF8A 5AQMB 5JDQA 3P50A 2JQHA 3B13A 3F31A 1D0XA 3AEDA 5FY0A 2UUBT 2V6XA 3EDVA 2LSGA 4K0UA 1IBLT 2XQAA 1W0BA 2DLRA 5ABEA 1UK5A 3U3IA 2UXBT 4YSXA 3RIFA 1O3XA 2ZM2A 1I6ZA 2VL0A 1MMNA 2Q9QB 4U2ZA 2XZEA 1KNPA 2BBJA 2WU5A 4IDOA 2LSKA 1VCTA 4H9NC 2DHRA 5HCJA 2JQ9A 4YTPA 3Q9DA 4P1NA 3ZSSA 1M7KA 5FXZA 3T8OA 4PW8A 5AQRB 2LHRA 4JEUB 2JRKA 5AQVB 3OKQA 1CUNA 4DR6T 4HFBA 1M62A 4IHJE 1FIOA 5ABHA 5JDGA 5AQSB 2ODUA 3TLWA 4U72A 5LGNB 3R84B 5JR9C 3H3MA 4U31A 4LF5T 3KBUA 3DP7A 5JDNA 4PFPA 1VOMA 3ZJ1A 2V8SV 3I0QA 3PURA 5LMUT 3PU8A 4IE5A 4QHOA 3RIAA 4UXNB 2XPKA 5KMGP 2G0UA 2D2SA 1SA0E 2CLYC 4H9RC 4DV1T 5HXSA 3AVRA 2IAKA 2WZHA 3PUSA 2FUPA 3ABVA 2LJLA 4DMVA 3RYCE 4Z91A 4BAYB 3GWHA 4IDZA 2NWBA 1YXRA 1OEDE 2N9DA 1MIVA 4QKNA 4EIWA 1MNDA 3NWIA 3OTOT 4NXNT 3LK2B 4Z8XA 5FY1A 3EVYA 2VURA 3IHRA 4GYRA 2LHNA 3HKEE 5AQNB 4HEAA 4YHHT 1WRDA 2NOXA 5F8PA 1D1CA 3N9MA 5CFBA 2FJBA 5HYAA 2K5BB 1FJGT 4PJNA 5JREA 3PU3A 5AQQB 3KDSE 4ZI3D 2CMRA 3MACA 4P0BA 2C5JA 2MAWA 1XMOT 4I55E 2YK0A 4LMKA 2BKNA 3ZMTB 4OYJA 1E7PA 4GKKT 5HWYA 4OK0A 3RKOA 2BG9E 4U7IA 3EHZA 4ZI7E 5HEGA 5AQJB 3B5MA 4CN1A 3AE2A 2VB6A 2YDSA 3FZKB 5DJQC 1E1HB 4A5XA 4O4LE 1FMWA 2M67A 2V6YA 2VL8A 5ABFA 1W0AA 4I0UA 2OA5A 2BKPA 4IREA 2M6IA 4XBFB 1ZV4X 3O9XA 3NVOA 3WAJA 2E9XB 1CHUA 2W63A 2WWUA 1UGOA 2K3WA 4YFSA 3SOLA 2DWKA 4TWHA 5IWAT 1S94A 3L39A 3OYZA 2HN1A 1L0VA 1MMDA 2IHR1 3JCFA 4DV3T 4ANJA 4UF0B 3OPCA 4DVDA 4NPPA 4YLHA 1H7CA 2Q9QC 4O4HE 3SFEA 1YD8G 4QXCB 1NENA 4U3CA 3K3NA 2VVNA 1OEDB 2BVMA 5ETWA 5LHGB 1VRBA 1JNRA 4NUUA 4O2BE 2IC6A 3Q2MA 4LF9T 2QYWA 4IE4A 4JI6T 2DCFA 5HEUA 5J1GA 4KMCA 4A97A 3AEFA 3ZLIA 1DU2A 2FBWA 4MALA 4OYKA 2CE7A 2V1DB 4NUVA 4UR9A 2KNDA 4TZ4C 3N5LA 5JVDE 1E2AA 2IDOB 3UUMA 3QB5A 2W67A 2VVSA 2LKGA 4AQFA 4JI7T 3D0TA 2XHEB 4GK0E 3TLSA 1HNZT 4PJLA 3CK6A 3ZSTA 4DR1T 1ZKEA 3AE1A 2CXDA 3AEBA 3G06A 2H3RA 4DR3T 4EZHA 2BG9B 2FJEA 5AQPB 1J5WA 1NAFA 4ZOLE 1FMVA 4AKRB 4DUYT 3RLFF 1NEKA 1YKHB 3HR0A 3DJBA 2VWAA 1SUMB 2CWOA 3O1JA 2XQ4A 2BS4A 1QSDA 4H9SE 2WQYA 2WMNA 2RP4A 2DL1A 3RQUA 3VU7H 4AKIA 4ERRA 5LHIB 1VCSA 3QNUA 4IDNA 3VHLA 3K3OA 2VKJA 1T98A 2KLQA 4Z90A 1HX8A 2NTYA 2CHOA 3N9LA 5FKYA 4HWIB 5F3JA 2AE9A 3UT5E 2XAGB 1U5PA 3ZT6A 2XM1A 4EXTA 1IBMT 2BDEA 3C4ZA 2UUCT 5AQGB 2W66A 2ZMAA 4EOZB 2YKSA 2KWIB 4B3RT 1KNRA 3UUBA 5FNVE 4ISSA 4X20E 4HWCA 3UU3A 4IE6A 5L3GB 4IT4A 1Z8UA 4ZZCA 4F6RC 2I59A 4PNIA 3NKZA 4PAGA 3TLVA 3ZCIA 4YJ2E 3IBPA 5AQOB 5DABA 2XQ7A 5A1LA 2ACZA 4E7ZA 3H3AA 3PUZF 3VKGA 2E2AA 3P7IA 2YINA 3ZC1A 4V1Av 3UQ7A 4LMLA 2XQYA 4TNVA 3ZMZB 3QOFA 4J2CA 2L9QA 3MK7C 1XDOA 4FI5A 2LRKA 4ILUA 3AA7B 4NIQA 4JLEA 2VQFT 1MIYA 2XAHB 3C51A 3K3QC 1G73A 3A8YC 1LKXA 3AXJA 5JRCB 3MA9A 3AE7A 1AJ3A 3JAEA 1UX4A 4TV9E 3P8CD 4GK5E 3SWHA 4DO0A 3CVRA 4ZI2C 2MYSA 5DQVA 3RGLA 3K1SA 2UXDT 2V6YB 1UX5A 4XZCA 2Q9QD 4PK4A 5JDMA 5F5WA 3PUWF 4AQYT 5LJNA 1I94T 5HCMA 3UULA 4ZZBA 4LMJA 3O4XE 1OEDC 2XTLA 4MFRA 2VKOA 2LRLA 4K0KT 4FJOA 1N34T 3I0OA 3ZC0A 2KWHA 3KVBA 4A56A 4DR4T 5EK2A 2XJ7A 1BR2A 2LOPA 1T7SA 4ZEYA 3SS1A 2V7KA 5HXEA 3Q5WA 4H9OC 1XZYA 1UURA 2D5UA 4PJMA 4BJMA 2XSAA 2J62A 3PUQA 1YW0A 2JMHA 2MPKA 4QX8B 4WNKA 5LA6E 5DQWA 2VKDA 3P4QA 2RA1A 5JR9A 4U7YA 2BS2A 5FXVA 5KDMC 1HTJF 2W2UA 5JTGA 3TKLB 4ILCA 4OHFA 4CI1B 1X9BA
chains in the Genus database with same CATH topology
2KZ7B 5FMNA 2X9WA 3HKDE 2NTXA 4UIGA 2VB6A 2PBIA 3CX6B 2ZM0A 3W15B 3OJAA 3ZCJA 2K48A 4TUYE 5DJQC 5LCYA 1E1HB 2E8IA 2ODVA 5FY7A 4O4LE 2EHOC 3S4UA 1FMWA 1S35A 2M67A 3RX6A 2X0LB 3N2OA 4AQFC 2JPFA 5HXHA 3R6NA 2VL8A 3FXEB 3F57A 4MBQA 5LXTE 3ZMVB 2E9XC 1D1BA 2OA5A 2DI4A 3C4XA 3NRXA 4E7SA 2XAFB 3ANWA 1LVKA 2A72A 3LBXB 1IZNB 3AB3B 5LGTB 5JR9B 1HCIA 2KINB 3V5SA 3V5UA 2ES0A 4EYYR 2D0TA 2DNXA 2Y8DA 3NZPA 4X1YE 3HL6A 2EHOB 1ZHCA 4XBFB 2CXLA 1ZV4X 3O9XA 1LRZA 5KX5E 3WAJA 4TX5A 2V7MA 2E9XB 2WSSV 3I9WA 1EZ3A 2W63A 2WWUA 2C0SA 2X9YA 4YFSA 3ONXA 3ZPOA 2HPJA 1SHZC 3SOLA 2DWGA 3UUXB 4QX7B 4HN9A 4QXBB 5FXWA 5HAXA 2DWKA 5LBQB 3JC6C 3QC9A 2NW7A 1S94A 2ZM8A 3OYZA 3FBZA 4AKLA 3MJXA 3DTOA 3CX7B 1MMDA 2JMKA 4EYUA 4AXPA 2K9AA 3N9OA 3PDYA 2C5KT 3EUHA 3MKDA 5J2UE 3QK6A 3ZYKA 4ANJA 3AA6B 2CXFA 4UF0B 4DVDA 1KK7A 3BQIA 4YLHA 3RYHE 1H7CA 2Q9QC 2K24A 1ZEEA 3IEEA 2KT9A 4O4HE 1YD8G 4QXCB 4ZS2A 1HS7A 2QA7A 3K3NA 4KBMB 3VKHA 3H37A 5AFUL 2BVMA 5ETWA 3O1IA 5C8YE 5LHGB 1FEWA 1VRBA 2X68A 4C90A 4NUUA 4O2BE 1BR0A 2IC6A 3Q2MA 3HKCE 2MOZA 4IE4A 4DBQA 5CA1E 2DCFA 2LSJA 5CA0E 4H9QC 5J1GA 4KMCA 1U4QA 4C91A 3CPZA 3KBTA 3KV6A 4O2AE 2LE8A 3ZLIA 5LHHB 4N78D 4MALA 4OYKA 2CE7A 2LSIA 4ZI3C 3ZYLA 2V1DB 3CX8B 4NUVA 2V7LA 3NBXX 2YU1A 2KNDA 4TZ4C 4UVCB 3N5LA 3MXZA 3AAEB 5JVDE 3HKBE 3C64A 3UUMA 5L3DB 2H7OA 5H6RB 2EHOA 4IGUA 4L5GA 4AQFA 4P0AA 4UVAB 4UELA 2JJ9A 4MHCA 4CZZB 3N2KE 3FHNA 3J9X1 3L3PA 3GN5A 2CCQA 3D0TA 3N9PA 4GIWA 2XHEB 4I50E 4CXYA 4GK0E 4UVBB 4G2AA 1B7TA 3OYXA 1D0ZA 2X9XA 2ZLYA 4PJLA 3KV4A 3L09A 4B6XA 4DBRA 3CWZB 2CEAA 2L3LA 3FBLA 2UXNB 3FXDB 3AVSA 5J2TE 3B57A 3CQXC 3KFWX 4DNDA 5LBMA 5EZYE 2NP9A 2X66A 1ZKEA 2D0UA 2YU2A 3N9NA 4IE0A 2CXDA 4DMWA 2XAJB 4AKGA 4PK6A 5LOVE 4JUYA 2LT3A 1IJ6A 2WMOA 2H3RA 4EZHA 3AA1B 3U78A 4H63H 1G8XA 2Z6EA 2V7IA 4GYSA 3I1AA 4UF0A 3ZJ2A 1WR6A 1NAFA 2VASA 1Z0PA 4X1KE 5E0OA 3ZN1B 3AAIA 4ZOLE 4I4TE 3UUNA 3ZEFB 2W61A 3KVAA 1FMVA 4AKRB 2JQQA 3KINB 3GN5B 5L3CB 1YKHB 2KMFA 2A2FX 3DJBA 3HR0A 3NRYA 3PTRB 4ZI2D 2VWAA 3C4WA 2CWOA 2LSYA 3O1JA 4KUMB 4WW0A 3K8PC 3GMIA 4HFVA 1QSDA 4L9IA 4H9SE 4GOUA 2UXXB 4TN7B 5H6QB 4EZ4A 2WMNA 2Q9QA 5FYMA 4MLKA 2H7VC 3CQCB 2RP4A 1D0YA 3ZN0B 3EDUA 4CI2B 1HF8A 5JDQA 5L3FB 2WM9A 3B13A 3VU7H 2PFVA 3NZQA 4UV8B 3F31A 4AKIA 1V9DA 1D0XA 4EAHA 4OFZA 5FY0A 4ERRA 5LHIB 3EDVA 3VHLA 2LSGA 1UCUA 4K0UA 5HWXA 3K3OA 2VKJA 4IE7A 1T98A 3E22E 2KLQA 3ETUA 4CXWA 2XASB 2DLRA 3LJCA 2MBGA 3U3IA 4PFOA 4AI6A 1MMAA 1HX8A 1YKEB 2NTYA 4WBNE 5JH7E 3PE0A 2XUEA 3RYFE 1O3XA 3N9LA 2ZM2A 5F3JA 3UT5E 2XAQB 1MMNA 2Q9QB 2XAGB 1U5PA 4UEMA 4EXTA 3C50A 2BDEA 4CQIA 2LSKA 5ADXL 5FP3A 4H9NC 4ZS3A 4O4IE 4I43B 3C4ZA 3J7Yq 2DHRA 5LG4A 5JDLA 1X79A 2X67A 3O1HA 3Q9DA 2PG8A 1WYBA 2ZMAA 4EOZB 5JDHA 2KWIB 2MTQA 5FXZA 5FNVE 4ISSA 4X20E 5JQGE 1IJ5A 2Y6XA 3PUGA 1QUUA 4PW8A 2VKHA 3T8OA 2IW5B 4IE6A 5FXXA 2BVLA 5L3GB 2V26A 2LHRA 4JEUB 2JRKA 2LM9A 5TAOA 3OKQA 3AA0B 4F6RC 1BR4A 2WAUA 1MNEA 1CUNA 3QUJA 2I59A 4PNIA 2BZBA 4PAGA 3ZCIA 4YJ2E 3IBPA 3ZMSB 2J1DG 4IHJE 3ETVA 2EHOD 3ESLA 1FIOA 5DABA 5A1LA 4E7ZA 5JRCA 5IYZE 3BQKA 3C98B 4HE8A 2E9XD 3F2EA 3H3AA 5JDGA 3VKGA 3P7IA 1BR1A 3N9QA 2YINA 3GA8A 2HH7A 4CXXA 4O8SA 3ZC1A 4PK5A 4ADZA 5L2LA 4O4JE 2ODUA 5L3EB 4U72A 3BK9A 4V1Av 1MIWA 2P9BA 2PJQA 4H63V 5LGNB 4JEHB 3R84B 4L0RA 5JR9C 1US7B 4ZHQE 2KXPB 5CB4E 3M65A 3KBUA 3DP7A 2VK9A 2XQYA 3LK42 2CWYA 5IHYA 5JDNA 3RPUA 4PFPA 5EK4A 3CQGB 3IF8B 1VOMA 3ZMZB 4J2CA 2L9QA 3MK7C 5EK3A 4FI5A 3ZJ1A 3I0QA 4ILUA 3AA7B 4JLEA 3RRWA 3N2GE 3PURA 1MIYA 2W00A 2XAHB 3PU8A 3C51A 4HTEA 3K3QC 4IE5A 4QHOA 4UXNB 1G73A 5LYJE 3Q5XA 5KMGP 4HGAA 1LKXA 4G63A 2G0UA 3MZKB 3WI3A 2D2SA 1SA0E 2CLYC 4UV9B 5JRCB 3JC6D 3MA9A 4H9RC 1Y64B 2Y48B 5HXSA 3AVRA 1AJ3A 3SRZA 2IAKA 3E08A 3LK3B 1UX4A 2CM0A 5LJMA 2NW8A 3PUSA 4TV9E 3FB2A 3P8CD 2CA5A 4P09A 2X51A 3HI2A 4QXHB 4GK5E 3SWHA 1HG2A 2LJLA 4DO0A 4DMVA 3RYCE 4BAYB 3GWHA 3CVRA 2LEHA 2NWBA 4IDZA 1IAPA 3LG7A 4XAXB 4ZI2C 2N9DA 1MIVA 4QKNA 4EIWA 2CLYB 2MYSA 2V7JA 5DQVA 5HXRA 2L8KA 1MNDA 4YHJA 5L3BB 1UX5A 3LK2B 4ISTA 3HA4A 4XZCA 3UFEA 2Q9QD 4Z8XA 4PK4A 5JDMA 3OBVE 5FY1A 3EVYA 4X1IE 4ASKA 1OXZA 3WAKA 3I9YA 4IIJE 3IHRA 4CI3B 5LJNA 3PUAA 3ANWB 4GYRA 5BMVE 3UULA 2LHNA 3HKEE 2A3DA 3ZYMA 4HEAA 3O4XE 5GONE 1LVFA 1WRDA 2NOXA 5LGUB 1KNZA 5F8PA 1D1CA 3E0ZA 2W0GA 2XTLA 4MFRA 2VKOA 2W62A 4FJOA 4M1PA 2N1GA 3N9MA 5LNKA 4KP3C 4QWNB 2LOSA 2QGSA 3I0OA 1HG5A 3RH3A 3ZC0A 2GK9A 4AKHA 2KWHA 3LFMA 3RYIE 5HYAA 2K5BB 2YEVC 4PJNA 1NWMX 3KVBA 4BA9A 3PU3A 4A56A 3UTKA 5JREA 3KV9A 5LP6E 3KDSE 4ZI3D 5EK2A 1BR2A 2LOPA 2CMRA 2SPCA 3MACA 4PJJA 3A5XA 3SS1A 4P0BA 2C5JA 2V7KA 5HXEA 3Q5WA 2C5IT 4TV8E 2HPLA 4H9OC 4I55E 2YK0A 4YJ3E 3ZMTB 4OYJA 2D5UA 4PJMA 5JDFA 2ACXA 3AAAB 1WYCA 4BJMA 4U74A 3PUQA 1WLXA 1YW0A 2JMHA 5HWYA 4HKAA 4OK0A 3KV5A 1D1AA 4QX8B 4WNKA 3RKOA 5LA6E 5DQWA 3LBXA 2VKDA 1HFAA 4AQGA 4BJNA 2RA1A 5JR9A 3BQLA 2NW9A 3RC8A 2WBLA 3RC3A 5FXVA 3CKDA 5KDMC 2B1EA 1HTJF 4H9PC 5HXCA 4WBOA 2X9HA 3RRCA 3TKLB 4ZI7E 1MMGA 1OWAA 3CMLA 4OHFA 4CI1B 3ZMUB 2N2NA 4EB6E 2E9XA 2IC9A 5M4YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4U74 A;  1ZEE A;  2D0T A;  1YW0 A;  2NW7 A;  4HKA A;  2V7I A;  5EK2 A;  3E08 A;  5EK4 A;  2V7L A;  5EK3 A;  2NW8 A;  2X67 A;  2NW9 A;  2V7M A;  5ETW A;  2V7K A;  2X68 A;  2NOX A;  2X66 A;  2NWB A;  2D0U A;  4PW8 A;  4PK6 A;  2V7J A;  4PK5 A;  4U72 A;  3BK9 A; 
#chains in the Genus database with same CATH topology
 2K48 A;  2E8I A;  5FY7 A;  4QH5 A;  2EHO C;  3S4U A;  4TWF A;  2JPF A;  3R6N A;  3FXE B;  4MBQ A;  3ZMV B;  1D1B A;  2DI4 A;  2BBH A;  4LF7 T;  4YTM A;  2XAF B;  3LBX B;  2A72 A;  2D9D A;  2V5D A;  3T1H T;  2HHH T;  2DNX A;  3FZF B;  1XDP A;  4X62 T;  4X1Y E;  3HL6 A;  1ZHC A;  3JAD A;  1LRZ A;  4TX5 A;  3I9W A;  1EZ3 A;  3P4P A;  3OVU A;  3ONX A;  3ZPO A;  3X1D A;  1SHZ C;  4QX7 B;  4B3S T;  5FXW A;  3UU4 A;  3JC6 C;  3QC9 A;  4ZXL A;  4KI0 F;  2YDR A;  3Q5D A;  3MJX A;  4LFA T;  2C5K T;  5J2U E;  4YXD A;  2WCA A;  3QK6 A;  3ZYK A;  2R6G F;  5J0Z A;  4B3T T;  3IEE A;  2WU2 A;  2V5C A;  1HS7 A;  2QA7 A;  1N33 T;  5C8Y E;  4C90 A;  3VR9 A;  1BR0 A;  4ILA A;  3HKC E;  4DBQ A;  5CA1 E;  2XQ9 A;  2QRX A;  3CPZ A;  1ZP0 A;  4N78 D;  2V7L A;  4WYV A;  3C64 A;  5L3D B;  5AQF B;  4L5G A;  4UVA B;  2JJ9 A;  3RF1 A;  2WDV A;  2JQK A;  3ONJ A;  3J9X 1;  3L3P A;  3GN5 A;  2CCQ A;  3N9P A;  4GIW A;  5LG3 A;  4CXY A;  4G2A A;  1KFY A;  4X65 T;  4B6X A;  2L3L A;  3FXD B;  3AVS A;  5J2T E;  4X5T A;  4DND A;  2NP9 A;  2YU2 A;  2D0U A;  4IE0 A;  4U2Y A;  2LT3 A;  1IJ6 A;  2WMO A;  3AA1 B;  2Z6E A;  2JIW A;  4F8H A;  2XQ5 A;  3ZJ2 A;  4DV0 T;  3RI5 A;  2VAS A;  4JBW F;  4I4T E;  3UUN A;  3ZEF B;  3KVA A;  4HWH A;  2IML A;  3KIN B;  4JI4 T;  4U33 A;  3PTR B;  4ZI2 D;  2X0H A;  3C4W A;  5CGM A;  3K8P C;  4HFV A;  4L9I A;  2NR4 A;  4GOU A;  4EZ4 A;  3UQ4 A;  2Q9Q A;  5FYM A;  2YN6 A;  1D0Y A;  5L4H A;  1WFD A;  2XSB A;  5L3F B;  2WM9 A;  2PFV A;  4UV8 B;  1V9D A;  4EAH A;  4DUZ T;  1UCU A;  4DR2 T;  3CIR A;  3E22 E;  3ETU A;  4CXW A;  4HWF A;  3AXJ B;  2XQ3 A;  3M3Z B;  1MMA A;  1YKE B;  3PE0 A;  2XUE A;  4DID B;  1XNR T;  2XAQ B;  4UEM A;  2WB5 A;  4CQI A;  4O4I E;  4I43 B;  3J7Y q;  2FJA A;  4DR7 T;  5JDL A;  2X67 A;  2BS3 A;  2OLT A;  1IJ5 A;  1QUU A;  2VKH A;  4IL9 A;  2IW5 B;  5FXX A;  1BR4 A;  2WAU A;  1MNE A;  4YTN A;  3QUJ A;  1J5E T;  3ZMS B;  2J1D G;  2EHO D;  3A7M A;  5IYZ E;  3BQK A;  3FZL B;  1XWM A;  1BR1 A;  3N9Q A;  3GA8 A;  4PK5 A;  5L2L A;  2WDR A;  5AQI B;  4H63 V;  4JEH B;  4L0R A;  2KXP B;  5KXJ A;  3VRA A;  5CB4 E;  3RPU A;  5EK3 A;  3QB5 K;  3PV0 F;  3RRW A;  3N2G E;  5LYJ E;  3Q5X A;  4HGA A;  5CJ5 A;  3AE4 A;  4G63 A;  3MZK B;  3JC6 D;  3SRZ A;  3E08 A;  3LK3 B;  3SFD A;  2NW8 A;  3FB2 A;  4P09 A;  3RKG A;  2X51 A;  3HI2 A;  4JI1 T;  4EED A;  2CLY B;  5HXR A;  4AIS A;  4IST A;  3AE6 A;  2WY2 A;  4ASK A;  1OXZ A;  4IIJ E;  3UU6 A;  4CI3 B;  3PUA A;  5BMV E;  2A3D A;  1KNZ A;  5LGU B;  3E0Z A;  2IUB A;  2W0G A;  4KX6 A;  2W62 A;  2N1G A;  1T72 A;  4QWN B;  2LOS A;  3RH3 A;  2GK9 A;  1YQ4 A;  3UTK A;  1N36 T;  3LSV A;  5FVL A;  5LP6 E;  2XY8 B;  4HFD A;  3P4S A;  2CHN A;  4B3M T;  2SPC A;  4PJJ A;  3A5X A;  1KEY A;  1HNW T;  4TV8 E;  2HPL A;  2UUA T;  4JI3 T;  4NXM T;  5JDF A;  2ACX A;  1WLX A;  3RIU A;  3KV5 A;  3JAF A;  4X66 T;  1HFA A;  2NW9 A;  3RC8 A;  2WBL A;  3RC3 A;  3CKD A;  3LDQ B;  3RRC A;  1MMG A;  3CML A;  3RIU C;  1XMQ T;  3ZMU B;  2E9X A;  3P4R A;  5M4Y A;  5FMN A;  3P4W A;  2X9W A;  3HKD E;  2PBI A;  3OJA A;  3ZCJ A;  5LCY A;  1XNQ T;  2ODV A;  2X0L B;  3N2O A;  5HEH A;  5HXH A;  2YOE A;  5LXT E;  4EEB A;  2B76 A;  2E9X C;  5HEJ A;  3C4X A;  3NRX A;  3ANW A;  3AEE A;  3IA3 A;  4Q25 A;  5LGT B;  2CBJ A;  4HFE A;  2KIN B;  3V5S A;  3V5U A;  4TWD A;  3NZP A;  2HN2 A;  5KX5 E;  3RQW A;  1T8B A;  5L47 A;  2V7M A;  5AQH B;  4HFI A;  1OED A;  2DWG A;  3UUX B;  5HAX A;  5LBQ B;  2M6B A;  2KSR A;  2NW7 A;  5ABF B;  1W9R A;  2XM2 A;  3PJA A;  2F4V T;  3CX7 B;  3AE8 A;  2JMK A;  2K9A A;  3PDY A;  3EUH A;  3BQI A;  3RYH E;  3ONL C;  5AQL B;  4KBM B;  2CBI A;  5BR8 T;  3H37 A;  3O1I A;  2X68 A;  4EGW A;  4YSZ A;  5CA0 E;  4C91 A;  3KBT A;  3KV6 A;  4DV2 T;  1JNZ A;  4DV5 T;  2LSI A;  3AAE B;  3HKB E;  2H7O A;  2BG9 A;  5H6R B;  3Q5E A;  3TLU A;  2EHO A;  3PJA J;  4IGU A;  4YSY A;  4P0A A;  4UEL A;  2UU9 T;  4MHC A;  2BKO A;  2H89 A;  4I50 E;  4UVB B;  3OYX A;  2X9X A;  2BG9 C;  3KV4 A;  3L09 A;  3CWZ B;  3FBL A;  3KFW X;  5EZY E;  5IUX A;  2RPA A;  2CRB A;  2XAJ B;  5LOV E;  2LKH A;  2IIU A;  4LFC T;  1G8X A;  4COF A;  2V7I A;  1WR6 A;  4X1K E;  5E0O A;  2W61 A;  5AQT B;  2JQQ A;  3ZT5 A;  4JI5 T;  2KMF A;  2VQE T;  3AE9 A;  3PUX F;  2LSY A;  4KUM B;  3GMI A;  2UXX B;  5H6Q B;  1YQ3 A;  4MLK A;  2H7V C;  2FJD A;  3AEC A;  3ZN0 B;  3EDU A;  4CI2 B;  1WCR A;  1W09 A;  3NZQ A;  4LF8 T;  4OFZ A;  5HWX A;  3VRB A;  4IE7 A;  3AEG A;  2XAS B;  3LJC A;  2MBG A;  4PFO A;  4AI6 A;  2LLY A;  5JH7 E;  3RYF E;  3ZKR A;  1IBK T;  4GKJ T;  3C50 A;  5ADX L;  5FP3 A;  4AIU A;  4ZS3 A;  5LG4 A;  1X79 A;  3O1H A;  2PG8 A;  1WYB A;  5JDH A;  4HFC A;  2MTQ A;  2E5L T;  5HEO A;  5JQG E;  2Y6X A;  3PUG A;  2BVL A;  5ABG A;  2YDQ A;  2V26 A;  5TAO A;  2LM9 A;  3AA0 B;  2BZB A;  4HWD A;  3ETV A;  4IL4 A;  3ESL A;  5JRC A;  5FVK A;  3C98 B;  2WP9 A;  4X64 T;  4HE8 A;  2E9X D;  3F2E A;  4KHZ F;  2HH7 A;  4CXX A;  5L4E A;  4O8S A;  4ADZ A;  4O4J E;  5L3E B;  3BK9 A;  1MIW A;  2P9B A;  2PJQ A;  1US7 B;  4ZHQ E;  3M65 A;  3LK4 2;  2VK9 A;  1GQE A;  2CWY A;  5IHY A;  5FL0 A;  1UUS A;  5EK4 A;  1HNX T;  3CQG B;  3IF8 B;  5C2T A;  2W00 A;  3AE5 A;  2OV9 A;  4HTE A;  4JI2 T;  3WI3 A;  2CPT A;  4UV9 B;  1Y64 B;  2Y48 B;  2H88 A;  2I0M A;  2CM0 A;  5LJM A;  4QXH B;  2CA5 A;  1HG2 A;  3UFG A;  3L8R A;  2LEH A;  1IAP A;  3LG7 A;  4XAX B;  4YT0 A;  2V7J A;  1ZOY A;  2L8K A;  4YHJ A;  5C3J A;  5L3B B;  5FL1 A;  3HA4 A;  4TNW A;  3UFE A;  3OBV E;  4X1I E;  2UXC T;  3WAK A;  3I9Y A;  3EI0 A;  3ANW B;  4QH4 A;  4WZX A;  3ZYM A;  5GON E;  1LVF A;  2ZM6 T;  4DV6 T;  3AEA A;  1WR0 A;  4M1P A;  3FZM B;  4EV6 A;  4KP3 C;  5LNK A;  2QGS A;  1HG5 A;  4AKH A;  3LFM A;  3RYI E;  2YEV C;  1NWM X;  4BA9 A;  3KV9 A;  4JI0 T;  2C5I T;  2WZI A;  4YJ3 E;  2QVA A;  2LM2 A;  2AXD S;  3AAA B;  1WYC A;  4U74 A;  4HKA A;  1D1A A;  4LFB T;  4CN4 A;  3LBX A;  4AQG A;  4BJN A;  3BQL A;  4JYA T;  2B1E A;  4H9P C;  5HXC A;  3PUY F;  5AQK B;  4WBO A;  2X9H A;  4CN6 A;  1OWA A;  3PUV F;  3VR8 A;  4EB6 E;  2N2N A;  4WBN E;  2IC9 A;  2KZ7 B;  3TLT A;  1SE7 A;  4UIG A;  2NTX A;  3CX6 B;  2ZM0 A;  3W15 B;  4TUY E;  1S35 A;  3FZH B;  3RX6 A;  4AQF C;  4QH1 A;  3F57 A;  4YY3 T;  4E7S A;  1LVK A;  1IZN B;  3AB3 B;  5JR9 B;  1HCI A;  2ES0 A;  5AQU B;  4EYY R;  2D0T A;  2Y8D A;  2XQ8 A;  2EHO B;  2CXL A;  2WSS V;  4A98 A;  2C0S A;  2X9Y A;  2HPJ A;  4HN9 A;  4DR5 T;  4QXB B;  4OX9 T;  2ZM8 A;  3FBZ A;  4AKL A;  1HX1 B;  3DTO A;  4JV5 T;  4EYU A;  4AXP A;  3N9O A;  3EAB A;  3MKD A;  3ZT7 A;  3AA6 B;  2WS3 A;  2CXF A;  1KK7 A;  2PTF A;  4JI8 T;  2K24 A;  1ZEE A;  2KT9 A;  4ZS2 A;  4KHP T;  1KF6 A;  3VKH A;  5AFU L;  1FEW A;  2I6H A;  2W4X A;  2MOZ A;  2LSJ A;  4H9Q C;  2X0Y A;  1U4Q A;  4O2A E;  2LE8 A;  5LHH B;  1R8I A;  4ZI3 C;  3ZYL A;  3CX8 B;  2XQ6 A;  3EAM A;  3AE3 A;  3NBX X;  2YU1 A;  4UVC B;  3MXZ A;  4LF6 T;  2J47 A;  2E5V A;  4ILB A;  2J4G A;  5LMN T;  4CZZ B;  3N2K E;  3FHN A;  4IDP A;  1J1J A;  1B7T A;  2WDQ A;  1D0Z A;  2ZLY A;  4DV7 T;  4DBR A;  2CEA A;  2UXN B;  3T1Y T;  3B57 A;  3CQX C;  5LBM A;  2X66 A;  3N9N A;  2A9U A;  4DMW A;  4AKG A;  4PK6 A;  4JUY A;  5LB7 B;  3U78 A;  4H63 H;  1Y01 A;  4GYS A;  3I1A A;  4UF0 A;  1N32 T;  3UU8 A;  1Z0P A;  3ZN1 B;  3AAI A;  1HR0 T;  2WWV A;  3UU5 A;  3GN5 B;  5L3C B;  2A2F X;  3NRY A;  4LF4 T;  4IDQ A;  4WW0 A;  1QLB A;  4TN7 B;  4DV4 T;  3CQC B;  4HFH A;  3RHW A;  1HF8 A;  5AQM B;  5JDQ A;  3P50 A;  2JQH A;  3B13 A;  3F31 A;  1D0X A;  3AED A;  5FY0 A;  2UUB T;  2V6X A;  3EDV A;  2LSG A;  4K0U A;  1IBL T;  2XQA A;  1W0B A;  2DLR A;  5ABE A;  1UK5 A;  3U3I A;  2UXB T;  4YSX A;  3RIF A;  1O3X A;  2ZM2 A;  1I6Z A;  2VL0 A;  1MMN A;  2Q9Q B;  4U2Z A;  2XZE A;  1KNP A;  2BBJ A;  2WU5 A;  4IDO A;  2LSK A;  1VCT A;  4H9N C;  2DHR A;  5HCJ A;  2JQ9 A;  4YTP A;  3Q9D A;  4P1N A;  3ZSS A;  1M7K A;  5FXZ A;  3T8O A;  4PW8 A;  5AQR B;  2LHR A;  4JEU B;  2JRK A;  5AQV B;  3OKQ A;  1CUN A;  4DR6 T;  4HFB A;  1M62 A;  4IHJ E;  1FIO A;  5ABH A;  5JDG A;  5AQS B;  2ODU A;  3TLW A;  4U72 A;  5LGN B;  3R84 B;  5JR9 C;  3H3M A;  4U31 A;  4LF5 T;  3KBU A;  3DP7 A;  5JDN A;  4PFP A;  1VOM A;  3ZJ1 A;  2V8S V;  3I0Q A;  3PUR A;  5LMU T;  3PU8 A;  4IE5 A;  4QHO A;  3RIA A;  4UXN B;  2XPK A;  5KMG P;  2G0U A;  2D2S A;  1SA0 E;  2CLY C;  4H9R C;  4DV1 T;  5HXS A;  3AVR A;  2IAK A;  2WZH A;  3PUS A;  2FUP A;  3ABV A;  2LJL A;  4DMV A;  3RYC E;  4Z91 A;  4BAY B;  3GWH A;  4IDZ A;  2NWB A;  1YXR A;  1OED E;  2N9D A;  1MIV A;  4QKN A;  4EIW A;  1MND A;  3NWI A;  3OTO T;  4NXN T;  3LK2 B;  4Z8X A;  5FY1 A;  3EVY A;  2VUR A;  3IHR A;  4GYR A;  2LHN A;  3HKE E;  5AQN B;  4HEA A;  4YHH T;  1WRD A;  2NOX A;  5F8P A;  1D1C A;  3N9M A;  5CFB A;  2FJB A;  5HYA A;  2K5B B;  1FJG T;  4PJN A;  5JRE A;  3PU3 A;  5AQQ B;  3KDS E;  4ZI3 D;  2CMR A;  3MAC A;  4P0B A;  2C5J A;  2MAW A;  1XMO T;  4I55 E;  2YK0 A;  4LMK A;  2BKN A;  3ZMT B;  4OYJ A;  1E7P A;  4GKK T;  5HWY A;  4OK0 A;  3RKO A;  2BG9 E;  4U7I A;  3EHZ A;  4ZI7 E;  5HEG A;  5AQJ B;  3B5M A;  4CN1 A;  3AE2 A;  2VB6 A;  2YDS A;  3FZK B;  5DJQ C;  1E1H B;  4A5X A;  4O4L E;  1FMW A;  2M67 A;  2V6Y A;  2VL8 A;  5ABF A;  1W0A A;  4I0U A;  2OA5 A;  2BKP A;  4IRE A;  2M6I A;  4XBF B;  1ZV4 X;  3O9X A;  3NVO A;  3WAJ A;  2E9X B;  1CHU A;  2W63 A;  2WWU A;  1UGO A;  2K3W A;  4YFS A;  3SOL A;  2DWK A;  4TWH A;  5IWA T;  1S94 A;  3L39 A;  3OYZ A;  2HN1 A;  1L0V A;  1MMD A;  2IHR 1;  3JCF A;  4DV3 T;  4ANJ A;  4UF0 B;  3OPC A;  4DVD A;  4NPP A;  4YLH A;  1H7C A;  2Q9Q C;  4O4H E;  3SFE A;  1YD8 G;  4QXC B;  1NEN A;  4U3C A;  3K3N A;  2VVN A;  1OED B;  2BVM A;  5ETW A;  5LHG B;  1VRB A;  1JNR A;  4NUU A;  4O2B E;  2IC6 A;  3Q2M A;  4LF9 T;  2QYW A;  4IE4 A;  4JI6 T;  2DCF A;  5HEU A;  5J1G A;  4KMC A;  4A97 A;  3AEF A;  3ZLI A;  1DU2 A;  2FBW A;  4MAL A;  4OYK A;  2CE7 A;  2V1D B;  4NUV A;  4UR9 A;  2KND A;  4TZ4 C;  3N5L A;  5JVD E;  1E2A A;  2IDO B;  3UUM A;  3QB5 A;  2W67 A;  2VVS A;  2LKG A;  4AQF A;  4JI7 T;  3D0T A;  2XHE B;  4GK0 E;  3TLS A;  1HNZ T;  4PJL A;  3CK6 A;  3ZST A;  4DR1 T;  1ZKE A;  3AE1 A;  2CXD A;  3AEB A;  3G06 A;  2H3R A;  4DR3 T;  4EZH A;  2BG9 B;  2FJE A;  5AQP B;  1J5W A;  1NAF A;  4ZOL E;  1FMV A;  4AKR B;  4DUY T;  3RLF F;  1NEK A;  1YKH B;  3HR0 A;  3DJB A;  2VWA A;  1SUM B;  2CWO A;  3O1J A;  2XQ4 A;  2BS4 A;  1QSD A;  4H9S E;  2WQY A;  2WMN A;  2RP4 A;  2DL1 A;  3RQU A;  3VU7 H;  4AKI A;  4ERR A;  5LHI B;  1VCS A;  3QNU A;  4IDN A;  3VHL A;  3K3O A;  2VKJ A;  1T98 A;  2KLQ A;  4Z90 A;  1HX8 A;  2NTY A;  2CHO A;  3N9L A;  5FKY A;  4HWI B;  5F3J A;  2AE9 A;  3UT5 E;  2XAG B;  1U5P A;  3ZT6 A;  2XM1 A;  4EXT A;  1IBM T;  2BDE A;  3C4Z A;  2UUC T;  5AQG B;  2W66 A;  2ZMA A;  4EOZ B;  2YKS A;  2KWI B;  4B3R T;  1KNR A;  3UUB A;  5FNV E;  4ISS A;  4X20 E;  4HWC A;  3UU3 A;  4IE6 A;  5L3G B;  4IT4 A;  1Z8U A;  4ZZC A;  4F6R C;  2I59 A;  4PNI A;  3NKZ A;  4PAG A;  3TLV A;  3ZCI A;  4YJ2 E;  3IBP A;  5AQO B;  5DAB A;  2XQ7 A;  5A1L A;  2ACZ A;  4E7Z A;  3H3A A;  3PUZ F;  3VKG A;  2E2A A;  3P7I A;  2YIN A;  3ZC1 A;  4V1A v;  3UQ7 A;  4LML A;  2XQY A;  4TNV A;  3ZMZ B;  3QOF A;  4J2C A;  2L9Q A;  3MK7 C;  1XDO A;  4FI5 A;  2LRK A;  4ILU A;  3AA7 B;  4NIQ A;  4JLE A;  2VQF T;  1MIY A;  2XAH B;  3C51 A;  3K3Q C;  1G73 A;  3A8Y C;  1LKX A;  3AXJ A;  5JRC B;  3MA9 A;  3AE7 A;  1AJ3 A;  3JAE A;  1UX4 A;  4TV9 E;  3P8C D;  4GK5 E;  3SWH A;  4DO0 A;  3CVR A;  4ZI2 C;  2MYS A;  5DQV A;  3RGL A;  3K1S A;  2UXD T;  2V6Y B;  1UX5 A;  4XZC A;  2Q9Q D;  4PK4 A;  5JDM A;  5F5W A;  3PUW F;  4AQY T;  5LJN A;  1I94 T;  5HCM A;  3UUL A;  4ZZB A;  4LMJ A;  3O4X E;  1OED C;  2XTL A;  4MFR A;  2VKO A;  2LRL A;  4K0K T;  4FJO A;  1N34 T;  3I0O A;  3ZC0 A;  2KWH A;  3KVB A;  4A56 A;  4DR4 T;  5EK2 A;  2XJ7 A;  1BR2 A;  2LOP A;  1T7S A;  4ZEY A;  3SS1 A;  2V7K A;  5HXE A;  3Q5W A;  4H9O C;  1XZY A;  1UUR A;  2D5U A;  4PJM A;  4BJM A;  2XSA A;  2J62 A;  3PUQ A;  1YW0 A;  2JMH A;  2MPK A;  4QX8 B;  4WNK A;  5LA6 E;  5DQW A;  2VKD A;  3P4Q A;  2RA1 A;  5JR9 A;  4U7Y A;  2BS2 A;  5FXV A;  5KDM C;  1HTJ F;  2W2U A;  5JTG A;  3TKL B;  4ILC A;  4OHF A;  4CI1 B;  1X9B A; 
#chains in the Genus database with same CATH homology
 2KZ7 B;  5FMN A;  2X9W A;  3HKD E;  2NTX A;  4UIG A;  2VB6 A;  2PBI A;  3CX6 B;  2ZM0 A;  3W15 B;  3OJA A;  3ZCJ A;  2K48 A;  4TUY E;  5DJQ C;  5LCY A;  1E1H B;  2E8I A;  2ODV A;  5FY7 A;  4O4L E;  2EHO C;  3S4U A;  1FMW A;  1S35 A;  2M67 A;  3RX6 A;  2X0L B;  3N2O A;  4AQF C;  2JPF A;  5HXH A;  3R6N A;  2VL8 A;  3FXE B;  3F57 A;  4MBQ A;  5LXT E;  3ZMV B;  2E9X C;  1D1B A;  2OA5 A;  2DI4 A;  3C4X A;  3NRX A;  4E7S A;  2XAF B;  3ANW A;  1LVK A;  2A72 A;  3LBX B;  1IZN B;  3AB3 B;  5LGT B;  5JR9 B;  1HCI A;  2KIN B;  3V5S A;  3V5U A;  2ES0 A;  4EYY R;  2D0T A;  2DNX A;  2Y8D A;  3NZP A;  4X1Y E;  3HL6 A;  2EHO B;  1ZHC A;  4XBF B;  2CXL A;  1ZV4 X;  3O9X A;  1LRZ A;  5KX5 E;  3WAJ A;  4TX5 A;  2V7M A;  2E9X B;  2WSS V;  3I9W A;  1EZ3 A;  2W63 A;  2WWU A;  2C0S A;  2X9Y A;  4YFS A;  3ONX A;  3ZPO A;  2HPJ A;  1SHZ C;  3SOL A;  2DWG A;  3UUX B;  4QX7 B;  4HN9 A;  4QXB B;  5FXW A;  5HAX A;  2DWK A;  5LBQ B;  3JC6 C;  3QC9 A;  2NW7 A;  1S94 A;  2ZM8 A;  3OYZ A;  3FBZ A;  4AKL A;  3MJX A;  3DTO A;  3CX7 B;  1MMD A;  2JMK A;  4EYU A;  4AXP A;  2K9A A;  3N9O A;  3PDY A;  2C5K T;  3EUH A;  3MKD A;  5J2U E;  3QK6 A;  3ZYK A;  4ANJ A;  3AA6 B;  2CXF A;  4UF0 B;  4DVD A;  1KK7 A;  3BQI A;  4YLH A;  3RYH E;  1H7C A;  2Q9Q C;  2K24 A;  1ZEE A;  3IEE A;  2KT9 A;  4O4H E;  1YD8 G;  4QXC B;  4ZS2 A;  1HS7 A;  2QA7 A;  3K3N A;  4KBM B;  3VKH A;  3H37 A;  5AFU L;  2BVM A;  5ETW A;  3O1I A;  5C8Y E;  5LHG B;  1FEW A;  1VRB A;  2X68 A;  4C90 A;  4NUU A;  4O2B E;  1BR0 A;  2IC6 A;  3Q2M A;  3HKC E;  2MOZ A;  4IE4 A;  4DBQ A;  5CA1 E;  2DCF A;  2LSJ A;  5CA0 E;  4H9Q C;  5J1G A;  4KMC A;  1U4Q A;  4C91 A;  3CPZ A;  3KBT A;  3KV6 A;  4O2A E;  2LE8 A;  3ZLI A;  5LHH B;  4N78 D;  4MAL A;  4OYK A;  2CE7 A;  2LSI A;  4ZI3 C;  3ZYL A;  2V1D B;  3CX8 B;  4NUV A;  2V7L A;  3NBX X;  2YU1 A;  2KND A;  4TZ4 C;  4UVC B;  3N5L A;  3MXZ A;  3AAE B;  5JVD E;  3HKB E;  3C64 A;  3UUM A;  5L3D B;  2H7O A;  5H6R B;  2EHO A;  4IGU A;  4L5G A;  4AQF A;  4P0A A;  4UVA B;  4UEL A;  2JJ9 A;  4MHC A;  4CZZ B;  3N2K E;  3FHN A;  3J9X 1;  3L3P A;  3GN5 A;  2CCQ A;  3D0T A;  3N9P A;  4GIW A;  2XHE B;  4I50 E;  4CXY A;  4GK0 E;  4UVB B;  4G2A A;  1B7T A;  3OYX A;  1D0Z A;  2X9X A;  2ZLY A;  4PJL A;  3KV4 A;  3L09 A;  4B6X A;  4DBR A;  3CWZ B;  2CEA A;  2L3L A;  3FBL A;  2UXN B;  3FXD B;  3AVS A;  5J2T E;  3B57 A;  3CQX C;  3KFW X;  4DND A;  5LBM A;  5EZY E;  2NP9 A;  2X66 A;  1ZKE A;  2D0U A;  2YU2 A;  3N9N A;  4IE0 A;  2CXD A;  4DMW A;  2XAJ B;  4AKG A;  4PK6 A;  5LOV E;  4JUY A;  2LT3 A;  1IJ6 A;  2WMO A;  2H3R A;  4EZH A;  3AA1 B;  3U78 A;  4H63 H;  1G8X A;  2Z6E A;  2V7I A;  4GYS A;  3I1A A;  4UF0 A;  3ZJ2 A;  1WR6 A;  1NAF A;  2VAS A;  1Z0P A;  4X1K E;  5E0O A;  3ZN1 B;  3AAI A;  4ZOL E;  4I4T E;  3UUN A;  3ZEF B;  2W61 A;  3KVA A;  1FMV A;  4AKR B;  2JQQ A;  3KIN B;  3GN5 B;  5L3C B;  1YKH B;  2KMF A;  2A2F X;  3DJB A;  3HR0 A;  3NRY A;  3PTR B;  4ZI2 D;  2VWA A;  3C4W A;  2CWO A;  2LSY A;  3O1J A;  4KUM B;  4WW0 A;  3K8P C;  3GMI A;  4HFV A;  1QSD A;  4L9I A;  4H9S E;  4GOU A;  2UXX B;  4TN7 B;  5H6Q B;  4EZ4 A;  2WMN A;  2Q9Q A;  5FYM A;  4MLK A;  2H7V C;  3CQC B;  2RP4 A;  1D0Y A;  3ZN0 B;  3EDU A;  4CI2 B;  1HF8 A;  5JDQ A;  5L3F B;  2WM9 A;  3B13 A;  3VU7 H;  2PFV A;  3NZQ A;  4UV8 B;  3F31 A;  4AKI A;  1V9D A;  1D0X A;  4EAH A;  4OFZ A;  5FY0 A;  4ERR A;  5LHI B;  3EDV A;  3VHL A;  2LSG A;  1UCU A;  4K0U A;  5HWX A;  3K3O A;  2VKJ A;  4IE7 A;  1T98 A;  3E22 E;  2KLQ A;  3ETU A;  4CXW A;  2XAS B;  2DLR A;  3LJC A;  2MBG A;  3U3I A;  4PFO A;  4AI6 A;  1MMA A;  1HX8 A;  1YKE B;  2NTY A;  4WBN E;  5JH7 E;  3PE0 A;  2XUE A;  3RYF E;  1O3X A;  3N9L A;  2ZM2 A;  5F3J A;  3UT5 E;  2XAQ B;  1MMN A;  2Q9Q B;  2XAG B;  1U5P A;  4UEM A;  4EXT A;  3C50 A;  2BDE A;  4CQI A;  2LSK A;  5ADX L;  5FP3 A;  4H9N C;  4ZS3 A;  4O4I E;  4I43 B;  3C4Z A;  3J7Y q;  2DHR A;  5LG4 A;  5JDL A;  1X79 A;  2X67 A;  3O1H A;  3Q9D A;  2PG8 A;  1WYB A;  2ZMA A;  4EOZ B;  5JDH A;  2KWI B;  2MTQ A;  5FXZ A;  5FNV E;  4ISS A;  4X20 E;  5JQG E;  1IJ5 A;  2Y6X A;  3PUG A;  1QUU A;  4PW8 A;  2VKH A;  3T8O A;  2IW5 B;  4IE6 A;  5FXX A;  2BVL A;  5L3G B;  2V26 A;  2LHR A;  4JEU B;  2JRK A;  2LM9 A;  5TAO A;  3OKQ A;  3AA0 B;  4F6R C;  1BR4 A;  2WAU A;  1MNE A;  1CUN A;  3QUJ A;  2I59 A;  4PNI A;  2BZB A;  4PAG A;  3ZCI A;  4YJ2 E;  3IBP A;  3ZMS B;  2J1D G;  4IHJ E;  3ETV A;  2EHO D;  3ESL A;  1FIO A;  5DAB A;  5A1L A;  4E7Z A;  5JRC A;  5IYZ E;  3BQK A;  3C98 B;  4HE8 A;  2E9X D;  3F2E A;  3H3A A;  5JDG A;  3VKG A;  3P7I A;  1BR1 A;  3N9Q A;  2YIN A;  3GA8 A;  2HH7 A;  4CXX A;  4O8S A;  3ZC1 A;  4PK5 A;  4ADZ A;  5L2L A;  4O4J E;  2ODU A;  5L3E B;  4U72 A;  3BK9 A;  4V1A v;  1MIW A;  2P9B A;  2PJQ A;  4H63 V;  5LGN B;  4JEH B;  3R84 B;  4L0R A;  5JR9 C;  1US7 B;  4ZHQ E;  2KXP B;  5CB4 E;  3M65 A;  3KBU A;  3DP7 A;  2VK9 A;  2XQY A;  3LK4 2;  2CWY A;  5IHY A;  5JDN A;  3RPU A;  4PFP A;  5EK4 A;  3CQG B;  3IF8 B;  1VOM A;  3ZMZ B;  4J2C A;  2L9Q A;  3MK7 C;  5EK3 A;  4FI5 A;  3ZJ1 A;  3I0Q A;  4ILU A;  3AA7 B;  4JLE A;  3RRW A;  3N2G E;  3PUR A;  1MIY A;  2W00 A;  2XAH B;  3PU8 A;  3C51 A;  4HTE A;  3K3Q C;  4IE5 A;  4QHO A;  4UXN B;  1G73 A;  5LYJ E;  3Q5X A;  5KMG P;  4HGA A;  1LKX A;  4G63 A;  2G0U A;  3MZK B;  3WI3 A;  2D2S A;  1SA0 E;  2CLY C;  4UV9 B;  5JRC B;  3JC6 D;  3MA9 A;  4H9R C;  1Y64 B;  2Y48 B;  5HXS A;  3AVR A;  1AJ3 A;  3SRZ A;  2IAK A;  3E08 A;  3LK3 B;  1UX4 A;  2CM0 A;  5LJM A;  2NW8 A;  3PUS A;  4TV9 E;  3FB2 A;  3P8C D;  2CA5 A;  4P09 A;  2X51 A;  3HI2 A;  4QXH B;  4GK5 E;  3SWH A;  1HG2 A;  2LJL A;  4DO0 A;  4DMV A;  3RYC E;  4BAY B;  3GWH A;  3CVR A;  2LEH A;  2NWB A;  4IDZ A;  1IAP A;  3LG7 A;  4XAX B;  4ZI2 C;  2N9D A;  1MIV A;  4QKN A;  4EIW A;  2CLY B;  2MYS A;  2V7J A;  5DQV A;  5HXR A;  2L8K A;  1MND A;  4YHJ A;  5L3B B;  1UX5 A;  3LK2 B;  4IST A;  3HA4 A;  4XZC A;  3UFE A;  2Q9Q D;  4Z8X A;  4PK4 A;  5JDM A;  3OBV E;  5FY1 A;  3EVY A;  4X1I E;  4ASK A;  1OXZ A;  3WAK A;  3I9Y A;  4IIJ E;  3IHR A;  4CI3 B;  5LJN A;  3PUA A;  3ANW B;  4GYR A;  5BMV E;  3UUL A;  2LHN A;  3HKE E;  2A3D A;  3ZYM A;  4HEA A;  3O4X E;  5GON E;  1LVF A;  1WRD A;  2NOX A;  5LGU B;  1KNZ A;  5F8P A;  1D1C A;  3E0Z A;  2W0G A;  2XTL A;  4MFR A;  2VKO A;  2W62 A;  4FJO A;  4M1P A;  2N1G A;  3N9M A;  5LNK A;  4KP3 C;  4QWN B;  2LOS A;  2QGS A;  3I0O A;  1HG5 A;  3RH3 A;  3ZC0 A;  2GK9 A;  4AKH A;  2KWH A;  3LFM A;  3RYI E;  5HYA A;  2K5B B;  2YEV C;  4PJN A;  1NWM X;  3KVB A;  4BA9 A;  3PU3 A;  4A56 A;  3UTK A;  5JRE A;  3KV9 A;  5LP6 E;  3KDS E;  4ZI3 D;  5EK2 A;  1BR2 A;  2LOP A;  2CMR A;  2SPC A;  3MAC A;  4PJJ A;  3A5X A;  3SS1 A;  4P0B A;  2C5J A;  2V7K A;  5HXE A;  3Q5W A;  2C5I T;  4TV8 E;  2HPL A;  4H9O C;  4I55 E;  2YK0 A;  4YJ3 E;  3ZMT B;  4OYJ A;  2D5U A;  4PJM A;  5JDF A;  2ACX A;  3AAA B;  1WYC A;  4BJM A;  4U74 A;  3PUQ A;  1WLX A;  1YW0 A;  2JMH A;  5HWY A;  4HKA A;  4OK0 A;  3KV5 A;  1D1A A;  4QX8 B;  4WNK A;  3RKO A;  5LA6 E;  5DQW A;  3LBX A;  2VKD A;  1HFA A;  4AQG A;  4BJN A;  2RA1 A;  5JR9 A;  3BQL A;  2NW9 A;  3RC8 A;  2WBL A;  3RC3 A;  5FXV A;  3CKD A;  5KDM C;  2B1E A;  1HTJ F;  4H9P C;  5HXC A;  4WBO A;  2X9H A;  3RRC A;  3TKL B;  4ZI7 E;  1MMG A;  1OWA A;  3CML A;  4OHF A;  4CI1 B;  3ZMU B;  2N2N A;  4EB6 E;  2E9X A;  2IC9 A;  5M4Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...