1ZEEA

X-ray crystal structure of protein so4414 from shewanella oneidensis. northeast structural genomics consortium target sor52.
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
sequence length
387
structure length
363
Chain Sequence
YNTEAFDEWIRSRFVELNSQLEQLYYQQTDRANVQEVGTELKHTLESEGRELVKALLDEGNTDEGFDSAFDLLGNVGLYMAACRRHEITEPTRETTSPLLEASALAMHIGASIGVTPRFATAHLTTHNRAHNGIYKRFTDLPDEKLFVDYNTKGILAYKRASDALLKIQPLGISHPISHDLLRVTKQALQDVIESNQQLFNRLDTDRFFYCVRPYYKPYRVGSVVYRGANAGDFAGINVIDLTLGLCFANEASYSQMLVDKFLYMMPEDQQILRECMRRPNLMDDFLQAKGCIHQDWYQENLKLFIEVCELHGQTAIQHHNELVTKYVLLASLERLRDRRAAVLRDDIRTRYYDLKKLKDSLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords hypothetical protein SO4414
publication title Crystal Structure of the Hypothetical Protein SO4414 from Shewanella oneidensis, NESG Target SoR52
rcsb
source organism Shewanella oneidensis
total genus 129
structure length 363
sequence length 387
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08933 DUF1864 Domain of unknown function (DUF1864)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.480 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 1zeeA02
1.20.58.600 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 1zeeA01
2D0TA 2X66A 4HKAA 4PW8A 4U74A 5ETWA 1YW0A 5EK2A 4PK5A 2NOXA 5EK4A 2V7LA 5EK3A 2X68A 4PK6A 2V7IA 1ZEEA 2X67A 2NW7A 3BK9A 2D0UA 2NWBA 4U72A 2NW8A 2V7JA 2V7KA 2NW9A 2V7MA 3E08A
chains in the Genus database with same CATH superfamily
3ETVA 3ZT6A 4H9QC 2OV9A 4KHPT 2N1GA 2WB5A 5LGNB 4F6RC 5J2TE 2MPKA 5JR9B 2B1EA 1JNZA 4AIUA 4IL4A 4HGAA 5HXEA 3CQCB 2QGSA 4H9NC 4HWCA 4AISA 4HE8A 4KHZF 5JR9C 4OK0A 2LOPA 4HEAA 2YDQA 3GA8A 3PUXF 3Q5DA 4I50E 2NWBA 3BK9A 2CWOA 4DV7T 4DR5T 2JIWA 2GK9A 5HEHA 4BJNA 4JI1T 3H37A 3N9QA 4OFZA 3UUMA 3AEAA 2W61A 3LK3B 5ABFB 2LHRA 4U72A 3IA3A 3ZSTA 3ZC0A 3L3PA 3ONXA 5HWXA 1B7TA 1YW0A 2BS4A 4UVAB 3NBXX 4QHOA 3AEFA 4YFSA 2KXPB 3K8PC 3EAMA 3AE2A 4TWHA 2ACZA 2VL0A 3RKGA 2FJBA 4XZCA 3RIUC 4P1NA 1XDOA 2J1DG 4EXTA 3UUBA 5HCJA 2UXBT 3GMIA 4YT0A 4B3RT 3LK42 3HKEE 4ZOLE 5IHYA 2WCAA 3M3ZB 4CI2B 4AQGA 2J4GA 3JAFA 2VKDA 4ZI3C 3HKDE 3L39A 3EI0A 3N9OA 1BR0A 1T8BA 1NWMX 2BKNA 1ZEEA 2JJ9A 1VCSA 5J1GA 2KINB 1E1HB 3P8CD 4OYJA 2LHNA 3P4QA 3HKCE 4IREA 4PJMA 2FUPA 3K3OA 2YKSA 5E0OA 2VWAA 2WS3A 4X65T 4ZEYA 3RPUA 2Y48B 2LKHA 5H6RB 3EABA 3RYCE 4ILAA 5L3CB 2X66A 4ILUA 4U3CA 2IMLA 1MMNA 1HF8A 2XHEB 5FXVA 5C3JA 2SPCA 3ZMUB 2VURA 3T1YT 2OA5A 4ISSA 2VKJA 4TX5A 5JRCB 2QVAA 4QH5A 3EUHA 4MBQA 3ZMSB 1JNRA 4U33A 1G8XA 4GK5E 2RA1A 5IUXA 3J9X1 3AVSA 5HWYA 2WAUA 3ZYLA 3O4XE 3UQ4A 2KNDA 5F3JA 3WI3A 4PAGA 3ZJ2A 3PUQA 2X9HA 4E7SA 4DR4T 2NW9A 3FZHB 3E08A 1J1JA 2VB6A 4G63A 3UULA 3NKZA 1EZ3A 5EK2A 3K3QC 4CXXA 4NPPA 2XAHB 5HAXA 4OYKA 1Y64B 4LFCT 4TWDA 3CKDA 4LF8T 3PE0A 2M67A 4YHHT 5A1LA 1GQEA 3EDUA 4GK0E 1UX5A 2CM0A 3NZPA 4L5GA 2NOXA 5DABA 1G73A 4GYRA 4N78D 4X1KE 4UVCB 5LGUB 3L8RA 1QUUA 4YJ3E 3I9WA 4B3ST 4HWIB 5DJQC 2ZM2A 1OEDC 4CN6A 1S35A 4IE6A 4CZZB 4DR2T 3TLVA 5ABFA 5LXTE 3VHLA 4P0BA 5J0ZA 5LP6E 3N2GE 1YKEB 3UFGA 3ZPOA 5HXHA 1NENA 3OTOT 5LB7B 4HN9A 5CGMA 4G2AA 2FBWA 2XQ9A 2MTQA 4KUMB 2XJ7A 4HKAA 1IJ6A 2C5JA 2V5CA 4PFPA 4IE7A 3LDQB 3ZCJA 3DP7A 2VQET 5AQHB 2F4VT 2V7IA 4B3TT 3C50A 2DCFA 3HKBE 4YTPA 2DLRA 4JEHB 2BS2A 2J47A 2G0UA 3KBTA 2UXCT 4YJ2E 2V6YB 2L8KA 4AKHA 2JMKA 1XMOT 2EHOB 2E5VA 1MMGA 4QH4A 2ODVA 4MHCA 3UU6A 3ZYMA 4IE0A 2XQ5A 2PFVA 4PK4A 4DV6T 5FY1A 2YU1A 1YQ4A 2W2UA 5LGTB 3P4SA 2LRKA 5AQRB 2E9XC 3AE6A 1OWAA 2UXDT 2LLYA 1W09A 3FB2A 3ZCIA 5CA1E 5EZYE 2NW7A 3LK2B 3AAAB 3B5MA 4O4HE 4ZI2C 4IDZA 3QK6A 2FJDA 4CI3B 3C98B 4K0KT 4A97A 4KBMB 4PJLA 5CB4E 2XQ6A 3CVRA 3N5LA 3AXJB 4AI6A 2L3LA 3FZFB 4XBFB 4FI5A 4CN4A 5JDQA 3DJBA 4DUYT 1BR4A 5KMGP 1T72A 4XAXB 1J5WA 3PV0F 5JH7E 2ZM8A 2K9AA 2OLTA 4Q25A 3GN5B 1WYCA 2X0LB 3ONJA 1WYBA 2K24A 3N2OA 3PJAJ 3HR0A 4ZXLA 4ILBA 4PK5A 3Q5WA 5L2LA 4U2ZA 4UF0A 5LJMA 3ZKRA 4ZI7E 1ZOYA 2BZBA 2JMHA 3LJCA 4HTEA 2UXNB 3OPCA 1X79A 1R8IA 3CMLA 3T8OA 2IC9A 5ADXL 1OXZA 4IT4A 3RH3A 4EB6E 1US7B 4C90A 2L9QA 4UELA 2RPAA 3LG7A 5LBMA 1NEKA 5AQUB 3CPZA 3ABVA 2UXXB 4GOUA 1KF6A 3AAIA 4WW0A 2D0UA 3CX8B 2XASB 4EAHA 2WY2A 2CLYB 3QB5K 2LRLA 5CA0E 2Y8DA 1J5ET 1HX8A 3H3MA 4JI6T 2WMOA 5AQFB 3PUYF 2Y6XA 2Q9QB 2W66A 2FJAA 2XAFB 4U7IA 2CBJA 1CHUA 3AA6B 2QRXA 5C2TA 5AQTB 1MMDA 1WFDA 3FBZA 2BKPA 4UVBB 5AQGB 2W00A 1IAPA 4DNDA 1UUSA 5JVDE 5AQLB 4HFCA 5L3GB 4WNKA 1LVFA 1QSDA 4YTMA 5DQVA 2LSJA 3UU5A 2VL8A 4DV4T 2I0MA 3AEBA 4UV9B 2C5KT 2WZIA 4QXBB 2V6YA 1UCUA 2LOSA 5FY7A 2V26A 2EHOD 3QOFA 4ADZA 2EHOA 3LBXB 2YEVC 2LM9A 4I4TE 2VKHA 5FXXA 4V1Av 2BKOA 3AE1A 2LSGA 5LHIB 5LBQB 1U5PA 2BG9A 1D0XA 3JC6D 2WDQA 5KX5E 2YDSA 3KVBA 2UUCT 1IBMT 3O1HA 2WP9A 3BQIA 4IE4A 1W0AA 5F8PA 3RI5A 1LRZA 3A8YC 3AXJA 2LM2A 3UT5E 5JDHA 4EYYR 1FIOA 5JDNA 3ZT5A 4JLEA 1NAFA 4IGUA 4U31A 3FZLB 1MIWA 3GN5A 3KBUA 4IL9A 2KWIB 3A5XA 5LCYA 4PNIA 3L09A 3AEDA 3HA4A 2CCQA 4AQYT 2BVMA 3ZN0B 2WM9A 4ZS3A 1ZHCA 3I9YA 4H63H 3F31A 3MACA 5AQMB 5LA6E 4JUYA 1HTJF 1IBKT 4HFEA 3WAKA 3MZKB 3VKHA 3PUVF 2DHRA 5LJNA 1Y01A 5HXRA 4BA9A 2WWUA 4TV9E 4QXCB 3A7MA 4DV2T 2K3WA 4X64T 5LMUT 1LVKA 2R6GF 4DR7T 4COFA 4YSXA 3P4WA 2WBLA 5BR8T 1BR1A 5IWAT 2CXDA 1HS7A 1E7PA 1MNEA 3AE7A 3P50A 5H6QB 3CK6A 3KV6A 4PW8A 2HPJA 2ACXA 2JRKA 5FY0A 3KDSE 1KNPA 3RYIE 4JV5T 4HFDA 4LF7T 4J2CA 3O9XA 1XNRT 2YK0A 5AQIB 4EIWA 4UEMA 4YLHA 3KV4A 3S4UA 2W67A 3AE3A 4O8SA 3PU8A 4ZHQE 4X5TA 4CXYA 3UQ7A 4WBNE 2IDOB 1YXRA 4AQFC 1MIYA 1ZV4X 2H88A 2LKGA 5AFUL 2KWHA 1WR0A 2V7JA 4TZ4C 5M4YA 4GKKT 3R6NA 5JR9A 2IW5B 4JI5T 1FJGT 2CA5A 3H3AA 3HI2A 1N36T 2FJEA 4KI0F 3LBXA 1XNQT 2X9YA 3P7IA 5ABHA 4NUVA 1LKXA 1HNZT 4Z91A 5FL1A 2LSYA 2D5UA 5JDFA 2DWGA 3AECA 5L47A 1OEDB 3EVYA 5FVKA 2VASA 2ZM6T 4CXWA 2QYWA 2XM2A 2WU2A 3PUSA 3FZMB 1Z8UA 3UUNA 4IHJE 4HWHA 3E0ZA 3UFEA 4K0UA 2C0SA 1MMAA 4L0RA 3C51A 1D0ZA 2V7KA 3KINB 3RIUA 4ZS2A 4X20E 2W62A 5FP3A 2W4XA 3ETUA 3AE8A 3RC8A 4H9SE 4DMWA 5HXSA 4LF5T 4EOZB 3OKQA 3DTOA 3AE5A 2D2SA 2HPLA 5J2UE 4M1PA 5EK3A 3Q5EA 4ERRA 5AQVB 2XUEA 2UUAT 4TNVA 2X0YA 2MYSA 4HFHA 3RLFF 4U2YA 5LHGB 2YINA 2VVSA 4KP3C 2E9XB 2JQKA 2XAGB 3MK7C 1IBLT 4IDPA 1BR2A 5HXCA 3ZSSA 3N9PA 4P0AA 4DMVA 5LYJE 4DO0A 4BJMA 4Z8XA 2BVLA 2DNXA 2NW8A 5FNVE 3BQKA 4EYUA 3NWIA 3PDYA 2XM1A 1I94T 3AB3B 3TLUA 3N2KE 4UIGA 2WDRA 3KV5A 2PJQA 5LG3A 3ZMTB 1DU2A 1ZP0A 2XSAA 3FXEB 3P4PA 4A98A 3OYXA 3FBLA 1O3XA 2XY8B 1N32T 4JI8T 5AQPB 2VKOA 5JRCA 1OEDE 2BG9C 2Z6EA 1KK7A 2KSRA 4PK6A 3K3NA 2KT9A 3Q5XA 5LOVE 5AQOB 2P9BA 3OVUA 3RYFE 3T1HT 2IHR1 4LMJA 3OBVE 2M6BA 4DV3T 2LT3A 4O2AE 2BDEA 2DL1A 4Z90A 1KFYA 2NR4A 4X62T 1SA0E 4YTNA 1IZNB 3W15B 4DBRA 4ANJA 1N33T 4JEUB 5JDGA 2ES0A 3RHWA 1HX1B 4HFBA 4AXPA 1W9RA 3NRXA 4ILCA 4L9IA 4EEDA 2XQAA 4QX7B 1WCRA 1UGOA 3RF1A 2LE8A 2LJLA 4NXNT 5CJ5A 4UXNB 4X66T 5ABGA 1D1AA 3RIAA 3UU8A 5AQKB 2V8SV 2WU5A 2PTFA 5LNKA 2WMNA 4WBOA 1S94A 3P4RA 3QNUA 2C5IT 5JDMA 3AEEA 2H3RA 4O4LE 2DWKA 2I6HA 1FEWA 1W0BA 2WWVA 4DUZT 4NXMT 2CMRA 1SUMB 1X9BA 4QWNB 3QB5A 4X1YE 2XQ4A 3LSVA 4A56A 1KNRA 5IYZE 2UU9T 5FVLA 1XZYA 3BQLA 4PFOA 3F57A 3RQWA 3RIFA 2H89A 1XDPA 3B13A 5BMVE 3CQGB 1CUNA 3AVRA 1T7SA 3IEEA 5L3FB 2V6XA 1MIVA 1VOMA 3KVAA 2E9XD 3N9MA 2E9XA 1YD8G 4NIQA 1SHZC 2XSBA 4I43B 4A5XA 1D1CA 2MAWA 2IC6A 4ZI2D 4DV0T 3LFMA 5HCMA 2YN6A 4QKNA 2V7LA 1QLBA 3ZN1B 5FMNA 4ISTA 3ZMZB 2XPKA 4YHJA 4DV1T 4JI0T 2E8IA 2HN1A 2IAKA 2BS3A 3IF8B 3QC9A 1YKHB 3GWHA 1U4QA 2X51A 2H7VC 4LMLA 4PJJA 2XQ3A 2VVNA 3FZKB 2LSIA 5JREA 2N2NA 2XTLA 3TKLB 5F5WA 1I6ZA 3B57A 3ONLC 1UURA 2A72A 2K48A 3O1IA 4LF6T 4TUYE 5FYMA 1WRDA 5HEOA 2ZLYA 2KZ7B 2RP4A 2LSKA 4EV6A 4C91A 4EZ4A 3AA1B 3OJAA 1UK5A 2JQQA 3VKGA 3ZMVB 4B3MT 3AEGA 1XMQT 2E5LT 2HH7A 3JCFA 2AE9A 2CXLA 3KFWX 4I0UA 4CI1B 2CEAA 2M6IA 1FMWA 2XQ8A 1HNWT 3AA0B 4UR9A 3SRZA 3N9NA 3NRYA 4AKGA 5CFBA 3MXZA 3V5SA 3CX7B 4HFIA 2YOEA 2I59A 2NTYA 5AQQB 5DQWA 4EGWA 4HWFA 2X9XA 3I0OA 4IDNA 1HCIA 2Q9QD 1AJ3A 2Q9QA 2JQ9A 3I1AA 3JADA 4LMKA 5L3DB 4YY3T 5TAOA 1YQ3A 1VCTA 2XAJB 2LEHA 2XQ7A 1HFAA 4FJOA 4CN1A 1ZKEA 3ZEFB 3MKDA 2X68A 5FKYA 3F2EA 1WR6A 3NVOA 3AA7B 4ZZCA 3G06A 2W0GA 4EEBA 4DVDA 4P09A 3E22E 2V7MA 4JI4T 2NTXA 4WYVA 2ZMAA 3R84B 3ANWB 3WAJA 4JI7T 3U3IA 3ZLIA 3CX6B 4F8HA 2A2FX 2CHNA 3EHZA 3UTKA 2N9DA 3N9LA 4UF0B 4LF9T 4ASKA 1D1BA 1WLXA 3RGLA 1MNDA 4X1IE 5C8YE 2PBIA 3NZQA 2CXFA 3RQUA 5LMNT 4OHFA 3U78A 4H9OC 5HEGA 4IIJE 5FXWA 2X67A 2XZEA 3X1DA 5FL0A 5JDLA 3UUXB 4DV5T 3V5UA 3AE9A 5HEJA 3PURA 4U74A 5LHHB 5JTGA 2CWYA 4YSZA 3VR9A 3ZJ1A 4KMCA 4MALA 3SWHA 4JBWF 3PUGA 4B6XA 3J7Yq 3SFEA 2ZM0A 1KEYA 4TWFA 4WZXA 3MJXA 2V1DB 2KLQA 4U7YA 5L3BB 3RYHE 3RC3A 3PTRB 4UV8B 3C4ZA 4TNWA 3EDVA 4H63V 4ZI3D 2AXDS 2MBGA 4QH1A 3UU3A 4IE5A 3QUJA 3IHRA 3C64A 2CPTA 2HHHT 4DBQA 3PU3A 4DR3T 4QX8B 2XAQB 4KX6A 4JI3T 2K5BB 4LFAT 5L3EB 3RRWA 1IJ5A 4ZZBA 2PG8A 3ZC1A 2J62A 1D0YA 2A3DA 3TLTA 3Q9DA 2V5DA 4BAYB 3RX6A 5AQSB 2CHOA 2WDVA 2KMFA 4DR6T 2X9WA 1V9DA 5HEUA 4QXHB 4NUUA 2ODUA 3KV9A 4MFRA 2EHOC 2CBIA 2H7OA 4JI2T 4O4IE 4GYSA 4DIDB 3UU4A 5HYAA 2BG9B 2WSSV 5AQNB 2UUBT 2CRBA 4TN7B 2X0HA 3VU7H 3RRCA 4GIWA 4AKRB 2D0TA 5KXJA 5ETWA 1HG2A 3ESLA 4YXDA 1L0VA 3TLSA 4AQFA 3ZT7A 2VQFT 3JC6C 2B76A 3IBPA 2W63A 1HG5A 1H7CA 4HFVA 4AKIA 1XWMA 2MOZA 3AE4A 3VRAA 2E2AA 5L4EA 1N34T 3VR8A 4DR1T 4I55E 3SS1A 2VK9A 3TLWA 4IDQA 3JAEA 4TV8E 3ANWA 3CQXC 3PUWF 4H9RC 2XQYA 3OYZA 5JQGE 4O2BE 3I0QA 4GKJT 1FMVA 3C4WA 3PJAA 3SFDA 3FXDB 2HN2A 2BBJA 2CE7A 1OEDA 2DI4A 4PJNA 1KNZA 3FHNA 3Q2MA 2JPFA 2YDRA 2NP9A 2IUBA 4CQIA 4E7ZA 5ABEA 4IDOA 3MA9A 3VRBA 1M62A 2WQYA 4MLKA 4HWDA 3AAEB 5L4HA 3CIRA 1T98A 1E2AA 3O1JA 5KDMC 2YU2A 1Z0PA 5AQJB 2QA7A 3D0TA 5EK4A 1SE7A 4O4JE 2A9UA 2BBHA 2D9DA 3SOLA 1HR0T 4LFBT 2CLYC 3HL6A 3K1SA 1UX4A 3CWZB 3M65A 4OX9T 1VRBA 3RKOA 3PUAA 4AKLA 2WZHA 3C4XA 5LG4A 3PUZF 4LF4T 1M7KA 2BG9E 4YSYA 2Q9QC 4H9PC 5GONE 2JQHA 1HNXT 3ZYKA 2IIUA 4EZHA 4JYAT 5FXZA
chains in the Genus database with same CATH topology
3ETVA 3AA0B 4XAXB 3UUNA 4H9QC 3SRZA 3N9NA 3NRYA 2N1GA 5JH7E 5LGNB 4IHJE 3E0ZA 3UFEA 4K0UA 2ZM8A 2K9AA 2C0SA 1MMAA 3GN5B 4F6RC 5J2TE 4AKGA 1WYCA 5JR9B 2X0LB 4L0RA 2B1EA 3MXZA 3C51A 3V5SA 1D0ZA 1WYBA 2V7KA 3CX7B 2K24A 3N2OA 3KINB 4HGAA 5HXEA 3CQCB 4ZS2A 2QGSA 3HR0A 4X20E 4H9NC 2I59A 2W62A 2NTYA 5FP3A 3ETUA 4HE8A 4PK5A 3Q5WA 3RC8A 4H9SE 4DMWA 5DQWA 5L2LA 5JR9C 2X9XA 3I0OA 4OK0A 1HCIA 2Q9QD 4UF0A 1AJ3A 5LJMA 2Q9QA 2LOPA 4HEAA 5HXSA 4ZI7E 4EOZB 3GA8A 3OKQA 2BZBA 3DTOA 3I1AA 2JMHA 3LJCA 4HTEA 2UXNB 5L3DB 1X79A 4I50E 3CMLA 5TAOA 2IC9A 2NWBA 3BK9A 3T8OA 5ADXL 2D2SA 1OXZA 2XAJB 2CWOA 2LEHA 2HPLA 3RH3A 1HFAA 2GK9A 5J2UE 4EB6E 1US7B 4FJOA 4C90A 2L9QA 4BJNA 1ZKEA 4UELA 3ZEFB 3LG7A 4M1PA 3MKDA 2X68A 5EK3A 3F2EA 3H37A 5LBMA 3N9QA 1WR6A 4ERRA 4OFZA 2XUEA 3UUMA 3CPZA 2UXXB 3AA7B 4GOUA 2W61A 3AAIA 3LK3B 2LHRA 2MYSA 2W0GA 4WW0A 4DVDA 2D0UA 3CX8B 4P09A 3E22E 2XASB 4U72A 2V7MA 4EAHA 5LHGB 3ZC0A 3L3PA 2YINA 4KP3C 2E9XB 3ONXA 2CLYB 2NTXA 2XAGB 3MK7C 5HWXA 1B7TA 1YW0A 5CA0E 4UVAB 2Y8DA 1BR2A 2ZMAA 3NBXX 1HX8A 4QHOA 5HXCA 3R84B 3ANWB 3WAJA 3U3IA 3ZLIA 3CX6B 4YFSA 3N9PA 2KXPB 3K8PC 4P0AA 2A2FX 4DMVA 2WMOA 5LYJE 4DO0A 3UTKA 4BJMA 4Z8XA 2N9DA 2BVLA 2DNXA 2NW8A 2Y6XA 3N9LA 4UF0B 5FNVE 2Q9QB 3BQKA 4XZCA 4ASKA 4EYUA 2XAFB 3PDYA 1D1BA 1WLXA 3AA6B 1MNDA 4X1IE 2J1DG 3AB3B 5C8YE 2PBIA 1MMDA 3NZQA 3FBZA 4EXTA 3N2KE 4UIGA 2CXFA 4UVBB 2W00A 4OHFA 3U78A 3KV5A 1IAPA 2PJQA 4DNDA 4H9OC 3ZMTB 5JVDE 3GMIA 4IIJE 5FXWA 2X67A 5L3GB 3LK42 4WNKA 3FXEB 3HKEE 1LVFA 3OYXA 3FBLA 4ZOLE 5IHYA 1QSDA 5JDLA 3UUXB 3V5UA 1O3XA 4CI2B 3PURA 4U74A 5LHHB 4AQGA 2VKDA 2VKOA 5JRCA 2CWYA 5DQVA 2LSJA 4ZI3C 2Z6EA 2VL8A 1KK7A 3HKDE 4PK6A 3ZJ1A 3N9OA 4KMCA 4MALA 2C5KT 3K3NA 2KT9A 4UV9B 1BR0A 3Q5XA 5LOVE 4QXBB 3SWHA 1NWMX 1ZEEA 2P9BA 2JJ9A 5J1GA 3PUGA 1UCUA 2LOSA 3RYFE 4B6XA 3J7Yq 5FY7A 2KINB 1E1HB 2V26A 3P8CD 2EHOD 4OYJA 2LHNA 2ZM0A 4ADZA 2EHOA 3OBVE 3HKCE 2LT3A 4PJMA 3LBXB 2YEVC 3K3OA 4O2AE 2LM9A 3MJXA 4I4TE 2BDEA 2VKHA 5FXXA 5E0OA 2V1DB 2KLQA 2VWAA 4V1Av 5L3BB 1SA0E 3RYHE 3RPUA 2Y48B 3RC3A 5H6RB 3PTRB 1IZNB 2LSGA 3W15B 4DBRA 4UV8B 3RYCE 5LHIB 4ANJA 5LBQB 3C4ZA 5L3CB 4JEUB 1U5PA 2ES0A 5JDGA 3EDVA 2X66A 4ILUA 4H63V 4ZI3D 2MBGA 1MMNA 4AXPA 1D0XA 4IE5A 3JC6D 1HF8A 2XHEB 3QUJA 5FXVA 3IHRA 2SPCA 3NRXA 3ZMUB 5KX5E 3C64A 4L9IA 3KVBA 4DBQA 3PU3A 4QX7B 2OA5A 4ISSA 4QX8B 2XAQB 2VKJA 4TX5A 3O1HA 3BQIA 4IE4A 5JRCB 3EUHA 5F8PA 2LE8A 2LJLA 4MBQA 3ZMSB 1G8XA 1LRZA 2K5BB 5L3EB 3RRWA 1IJ5A 4GK5E 2RA1A 4UXNB 3J9X1 3AVSA 3UT5E 5HWYA 2PG8A 2WAUA 3ZC1A 3ZYLA 5JDHA 4EYYR 3O4XE 1FIOA 2KNDA 5F3JA 5JDNA 3WI3A 1D1AA 4PAGA 1D0YA 2A3DA 3ZJ2A 3PUQA 4JLEA 2X9HA 3Q9DA 4BAYB 3RX6A 5LNKA 4E7SA 2WMNA 2NW9A 1NAFA 4IGUA 4WBOA 2KMFA 1MIWA 2X9WA 1S94A 3GN5A 3E08A 1V9DA 2C5IT 4G63A 2VB6A 4QXHB 3KBUA 5JDMA 4NUUA 2ODUA 2H3RA 3UULA 4O4LE 1EZ3A 2DWKA 5EK2A 3KV9A 4MFRA 2EHOC 3K3QC 4CXXA 2H7OA 1FEWA 2KWIB 3A5XA 4O4IE 2XAHB 5HAXA 4GYSA 5LCYA 5HYAA 4OYKA 4PNIA 3L09A 3HA4A 1Y64B 2CCQA 2WSSV 2BVMA 3ZN0B 2WM9A 4TN7B 3CKDA 3PE0A 2CMRA 2M67A 4ZS3A 3VU7H 3RRCA 1ZHCA 4GIWA 3I9YA 4QWNB 5A1LA 4X1YE 4AKRB 4H63H 2D0TA 3F31A 3EDUA 3MACA 4GK0E 5ETWA 1UX5A 2CM0A 5LA6E 4JUYA 1HTJF 1HG2A 3NZPA 4A56A 3ESLA 4L5GA 5IYZE 2NOXA 3WAKA 3MZKB 3VKHA 5DABA 1G73A 4GYRA 4N78D 4X1KE 4UVCB 2DHRA 4AQFA 3BQLA 5LJNA 5LGUB 4PFOA 3JC6C 1QUUA 3F57A 4YJ3E 5HXRA 3I9WA 4BA9A 3IBPA 2WWUA 5DJQC 2W63A 1HG5A 1H7CA 4HFVA 4AKIA 2ZM2A 3B13A 5BMVE 3CQGB 2MOZA 4QXCB 4TV9E 1CUNA 1S35A 3AVRA 3IEEA 4IE6A 4CZZB 5L3FB 5LXTE 1LVKA 3VHLA 1MIVA 1VOMA 3KVAA 4P0BA 2E9XD 5LP6E 3N9MA 2E9XA 1YD8G 3N2GE 1YKEB 4I55E 2WBLA 1SHZC 3ZPOA 4I43B 5HXHA 3SS1A 1BR1A 2VK9A 1D1CA 4TV8E 2IC6A 4HN9A 4G2AA 3ANWA 2CXDA 4ZI2D 3LFMA 1HS7A 3CQXC 2MTQA 4H9RC 1MNEA 5H6QB 4KUMB 2XQYA 3OYZA 5JQGE 4HKAA 3KV6A 4PW8A 2HPJA 4O2BE 2ACXA 3I0QA 1IJ6A 1FMVA 2C5JA 2JRKA 3C4WA 4QKNA 4IE7A 4PFPA 2V7LA 5FY0A 3ZCJA 3DP7A 3KDSE 3ZN1B 3RYIE 5FMNA 2V7IA 4ISTA 3FXDB 3ZMZB 4J2CA 3O9XA 2YK0A 3C50A 4YHJA 4EIWA 2CE7A 2DCFA 3HKBE 4UEMA 4YLHA 2DI4A 3KV4A 4PJNA 3S4UA 1KNZA 2E8IA 3FHNA 3Q2MA 4O8SA 2IAKA 2DLRA 2JPFA 4JEHB 3IF8B 3PU8A 4ZHQE 2NP9A 2G0UA 3KBTA 3QC9A 1YKHB 3GWHA 4YJ2E 1U4QA 4CXYA 4WBNE 2X51A 4CQIA 4E7ZA 2H7VC 2L8KA 3MA9A 4AKHA 4PJJA 2JMKA 4MLKA 1ZV4X 1MIYA 2EHOB 1MMGA 4AQFC 2ODVA 4MHCA 2LSIA 3AAEB 5JREA 2N2NA 5AFUL 2KWHA 1T98A 3ZYMA 2V7JA 2XTLA 3O1JA 4IE0A 4TZ4C 3TKLB 5M4YA 5KDMC 2PFVA 4PK4A 2YU2A 3B57A 3R6NA 5FY1A 1Z0PA 5JR9A 2QA7A 3D0TA 2IW5B 2A72A 2CA5A 2K48A 2YU1A 3H3AA 3O1IA 4O4JE 5EK4A 5LGTB 3HI2A 3SOLA 4TUYE 3LBXA 5FYMA 1WRDA 2E9XC 2CLYC 2ZLYA 2KZ7B 2RP4A 2X9YA 1OWAA 2LSKA 3HL6A 3FB2A 3ZCIA 5CA1E 5EZYE 4C91A 2NW7A 1UX4A 3AA1B 3LK2B 3P7IA 3CWZB 3M65A 4EZ4A 4NUVA 3AAAB 3OJAA 1LKXA 1VRBA 2JQQA 3RKOA 3VKGA 2LSYA 4O4HE 3ZMVB 4ZI2C 2D5UA 5JDFA 2DWGA 4IDZA 3PUAA 3QK6A 4CI3B 3C98B 4AKLA 4KBMB 3C4XA 5LG4A 2HH7A 3EVYA 2CXLA 2VASA 4PJLA 5CB4E 3CVRA 4CXWA 3N5LA 2Q9QC 4H9PC 4AI6A 3KFWX 2L3LA 5GONE 4XBFB 4FI5A 3PUSA 5JDQA 3DJBA 1BR4A 3ZYKA 4CI1B 4EZHA 2CEAA 5FXZA 5KMGP 1FMWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2D0T A;  2X66 A;  4HKA A;  4PW8 A;  4U74 A;  5ETW A;  1YW0 A;  5EK2 A;  4PK5 A;  2NOX A;  5EK4 A;  2V7L A;  5EK3 A;  2X68 A;  4PK6 A;  2V7I A;  1ZEE A;  2X67 A;  2NW7 A;  3BK9 A;  2D0U A;  2NWB A;  4U72 A;  2NW8 A;  2V7J A;  2V7K A;  2NW9 A;  2V7M A;  3E08 A; 
#chains in the Genus database with same CATH topology
 3ETV A;  3ZT6 A;  4H9Q C;  2OV9 A;  4KHP T;  2N1G A;  2WB5 A;  5LGN B;  4F6R C;  5J2T E;  2MPK A;  5JR9 B;  2B1E A;  1JNZ A;  4AIU A;  4IL4 A;  4HGA A;  5HXE A;  3CQC B;  2QGS A;  4H9N C;  4HWC A;  4AIS A;  4HE8 A;  4KHZ F;  5JR9 C;  4OK0 A;  2LOP A;  4HEA A;  2YDQ A;  3GA8 A;  3PUX F;  3Q5D A;  4I50 E;  2NWB A;  3BK9 A;  2CWO A;  4DV7 T;  4DR5 T;  2JIW A;  2GK9 A;  5HEH A;  4BJN A;  4JI1 T;  3H37 A;  3N9Q A;  4OFZ A;  3UUM A;  3AEA A;  2W61 A;  3LK3 B;  5ABF B;  2LHR A;  4U72 A;  3IA3 A;  3ZST A;  3ZC0 A;  3L3P A;  3ONX A;  5HWX A;  1B7T A;  1YW0 A;  2BS4 A;  4UVA B;  3NBX X;  4QHO A;  3AEF A;  4YFS A;  2KXP B;  3K8P C;  3EAM A;  3AE2 A;  4TWH A;  2ACZ A;  2VL0 A;  3RKG A;  2FJB A;  4XZC A;  3RIU C;  4P1N A;  1XDO A;  2J1D G;  4EXT A;  3UUB A;  5HCJ A;  2UXB T;  3GMI A;  4YT0 A;  4B3R T;  3LK4 2;  3HKE E;  4ZOL E;  5IHY A;  2WCA A;  3M3Z B;  4CI2 B;  4AQG A;  2J4G A;  3JAF A;  2VKD A;  4ZI3 C;  3HKD E;  3L39 A;  3EI0 A;  3N9O A;  1BR0 A;  1T8B A;  1NWM X;  2BKN A;  1ZEE A;  2JJ9 A;  1VCS A;  5J1G A;  2KIN B;  1E1H B;  3P8C D;  4OYJ A;  2LHN A;  3P4Q A;  3HKC E;  4IRE A;  4PJM A;  2FUP A;  3K3O A;  2YKS A;  5E0O A;  2VWA A;  2WS3 A;  4X65 T;  4ZEY A;  3RPU A;  2Y48 B;  2LKH A;  5H6R B;  3EAB A;  3RYC E;  4ILA A;  5L3C B;  2X66 A;  4ILU A;  4U3C A;  2IML A;  1MMN A;  1HF8 A;  2XHE B;  5FXV A;  5C3J A;  2SPC A;  3ZMU B;  2VUR A;  3T1Y T;  2OA5 A;  4ISS A;  2VKJ A;  4TX5 A;  5JRC B;  2QVA A;  4QH5 A;  3EUH A;  4MBQ A;  3ZMS B;  1JNR A;  4U33 A;  1G8X A;  4GK5 E;  2RA1 A;  5IUX A;  3J9X 1;  3AVS A;  5HWY A;  2WAU A;  3ZYL A;  3O4X E;  3UQ4 A;  2KND A;  5F3J A;  3WI3 A;  4PAG A;  3ZJ2 A;  3PUQ A;  2X9H A;  4E7S A;  4DR4 T;  2NW9 A;  3FZH B;  3E08 A;  1J1J A;  2VB6 A;  4G63 A;  3UUL A;  3NKZ A;  1EZ3 A;  5EK2 A;  3K3Q C;  4CXX A;  4NPP A;  2XAH B;  5HAX A;  4OYK A;  1Y64 B;  4LFC T;  4TWD A;  3CKD A;  4LF8 T;  3PE0 A;  2M67 A;  4YHH T;  5A1L A;  1GQE A;  3EDU A;  4GK0 E;  1UX5 A;  2CM0 A;  3NZP A;  4L5G A;  2NOX A;  5DAB A;  1G73 A;  4GYR A;  4N78 D;  4X1K E;  4UVC B;  5LGU B;  3L8R A;  1QUU A;  4YJ3 E;  3I9W A;  4B3S T;  4HWI B;  5DJQ C;  2ZM2 A;  1OED C;  4CN6 A;  1S35 A;  4IE6 A;  4CZZ B;  4DR2 T;  3TLV A;  5ABF A;  5LXT E;  3VHL A;  4P0B A;  5J0Z A;  5LP6 E;  3N2G E;  1YKE B;  3UFG A;  3ZPO A;  5HXH A;  1NEN A;  3OTO T;  5LB7 B;  4HN9 A;  5CGM A;  4G2A A;  2FBW A;  2XQ9 A;  2MTQ A;  4KUM B;  2XJ7 A;  4HKA A;  1IJ6 A;  2C5J A;  2V5C A;  4PFP A;  4IE7 A;  3LDQ B;  3ZCJ A;  3DP7 A;  2VQE T;  5AQH B;  2F4V T;  2V7I A;  4B3T T;  3C50 A;  2DCF A;  3HKB E;  4YTP A;  2DLR A;  4JEH B;  2BS2 A;  2J47 A;  2G0U A;  3KBT A;  2UXC T;  4YJ2 E;  2V6Y B;  2L8K A;  4AKH A;  2JMK A;  1XMO T;  2EHO B;  2E5V A;  1MMG A;  4QH4 A;  2ODV A;  4MHC A;  3UU6 A;  3ZYM A;  4IE0 A;  2XQ5 A;  2PFV A;  4PK4 A;  4DV6 T;  5FY1 A;  2YU1 A;  1YQ4 A;  2W2U A;  5LGT B;  3P4S A;  2LRK A;  5AQR B;  2E9X C;  3AE6 A;  1OWA A;  2UXD T;  2LLY A;  1W09 A;  3FB2 A;  3ZCI A;  5CA1 E;  5EZY E;  2NW7 A;  3LK2 B;  3AAA B;  3B5M A;  4O4H E;  4ZI2 C;  4IDZ A;  3QK6 A;  2FJD A;  4CI3 B;  3C98 B;  4K0K T;  4A97 A;  4KBM B;  4PJL A;  5CB4 E;  2XQ6 A;  3CVR A;  3N5L A;  3AXJ B;  4AI6 A;  2L3L A;  3FZF B;  4XBF B;  4FI5 A;  4CN4 A;  5JDQ A;  3DJB A;  4DUY T;  1BR4 A;  5KMG P;  1T72 A;  4XAX B;  1J5W A;  3PV0 F;  5JH7 E;  2ZM8 A;  2K9A A;  2OLT A;  4Q25 A;  3GN5 B;  1WYC A;  2X0L B;  3ONJ A;  1WYB A;  2K24 A;  3N2O A;  3PJA J;  3HR0 A;  4ZXL A;  4ILB A;  4PK5 A;  3Q5W A;  5L2L A;  4U2Z A;  4UF0 A;  5LJM A;  3ZKR A;  4ZI7 E;  1ZOY A;  2BZB A;  2JMH A;  3LJC A;  4HTE A;  2UXN B;  3OPC A;  1X79 A;  1R8I A;  3CML A;  3T8O A;  2IC9 A;  5ADX L;  1OXZ A;  4IT4 A;  3RH3 A;  4EB6 E;  1US7 B;  4C90 A;  2L9Q A;  4UEL A;  2RPA A;  3LG7 A;  5LBM A;  1NEK A;  5AQU B;  3CPZ A;  3ABV A;  2UXX B;  4GOU A;  1KF6 A;  3AAI A;  4WW0 A;  2D0U A;  3CX8 B;  2XAS B;  4EAH A;  2WY2 A;  2CLY B;  3QB5 K;  2LRL A;  5CA0 E;  2Y8D A;  1J5E T;  1HX8 A;  3H3M A;  4JI6 T;  2WMO A;  5AQF B;  3PUY F;  2Y6X A;  2Q9Q B;  2W66 A;  2FJA A;  2XAF B;  4U7I A;  2CBJ A;  1CHU A;  3AA6 B;  2QRX A;  5C2T A;  5AQT B;  1MMD A;  1WFD A;  3FBZ A;  2BKP A;  4UVB B;  5AQG B;  2W00 A;  1IAP A;  4DND A;  1UUS A;  5JVD E;  5AQL B;  4HFC A;  5L3G B;  4WNK A;  1LVF A;  1QSD A;  4YTM A;  5DQV A;  2LSJ A;  3UU5 A;  2VL8 A;  4DV4 T;  2I0M A;  3AEB A;  4UV9 B;  2C5K T;  2WZI A;  4QXB B;  2V6Y A;  1UCU A;  2LOS A;  5FY7 A;  2V26 A;  2EHO D;  3QOF A;  4ADZ A;  2EHO A;  3LBX B;  2YEV C;  2LM9 A;  4I4T E;  2VKH A;  5FXX A;  4V1A v;  2BKO A;  3AE1 A;  2LSG A;  5LHI B;  5LBQ B;  1U5P A;  2BG9 A;  1D0X A;  3JC6 D;  2WDQ A;  5KX5 E;  2YDS A;  3KVB A;  2UUC T;  1IBM T;  3O1H A;  2WP9 A;  3BQI A;  4IE4 A;  1W0A A;  5F8P A;  3RI5 A;  1LRZ A;  3A8Y C;  3AXJ A;  2LM2 A;  3UT5 E;  5JDH A;  4EYY R;  1FIO A;  5JDN A;  3ZT5 A;  4JLE A;  1NAF A;  4IGU A;  4U31 A;  3FZL B;  1MIW A;  3GN5 A;  3KBU A;  4IL9 A;  2KWI B;  3A5X A;  5LCY A;  4PNI A;  3L09 A;  3AED A;  3HA4 A;  2CCQ A;  4AQY T;  2BVM A;  3ZN0 B;  2WM9 A;  4ZS3 A;  1ZHC A;  3I9Y A;  4H63 H;  3F31 A;  3MAC A;  5AQM B;  5LA6 E;  4JUY A;  1HTJ F;  1IBK T;  4HFE A;  3WAK A;  3MZK B;  3VKH A;  3PUV F;  2DHR A;  5LJN A;  1Y01 A;  5HXR A;  4BA9 A;  2WWU A;  4TV9 E;  4QXC B;  3A7M A;  4DV2 T;  2K3W A;  4X64 T;  5LMU T;  1LVK A;  2R6G F;  4DR7 T;  4COF A;  4YSX A;  3P4W A;  2WBL A;  5BR8 T;  1BR1 A;  5IWA T;  2CXD A;  1HS7 A;  1E7P A;  1MNE A;  3AE7 A;  3P50 A;  5H6Q B;  3CK6 A;  3KV6 A;  4PW8 A;  2HPJ A;  2ACX A;  2JRK A;  5FY0 A;  3KDS E;  1KNP A;  3RYI E;  4JV5 T;  4HFD A;  4LF7 T;  4J2C A;  3O9X A;  1XNR T;  2YK0 A;  5AQI B;  4EIW A;  4UEM A;  4YLH A;  3KV4 A;  3S4U A;  2W67 A;  3AE3 A;  4O8S A;  3PU8 A;  4ZHQ E;  4X5T A;  4CXY A;  3UQ7 A;  4WBN E;  2IDO B;  1YXR A;  4AQF C;  1MIY A;  1ZV4 X;  2H88 A;  2LKG A;  5AFU L;  2KWH A;  1WR0 A;  2V7J A;  4TZ4 C;  5M4Y A;  4GKK T;  3R6N A;  5JR9 A;  2IW5 B;  4JI5 T;  1FJG T;  2CA5 A;  3H3A A;  3HI2 A;  1N36 T;  2FJE A;  4KI0 F;  3LBX A;  1XNQ T;  2X9Y A;  3P7I A;  5ABH A;  4NUV A;  1LKX A;  1HNZ T;  4Z91 A;  5FL1 A;  2LSY A;  2D5U A;  5JDF A;  2DWG A;  3AEC A;  5L47 A;  1OED B;  3EVY A;  5FVK A;  2VAS A;  2ZM6 T;  4CXW A;  2QYW A;  2XM2 A;  2WU2 A;  3PUS A;  3FZM B;  1Z8U A;  3UUN A;  4IHJ E;  4HWH A;  3E0Z A;  3UFE A;  4K0U A;  2C0S A;  1MMA A;  4L0R A;  3C51 A;  1D0Z A;  2V7K A;  3KIN B;  3RIU A;  4ZS2 A;  4X20 E;  2W62 A;  5FP3 A;  2W4X A;  3ETU A;  3AE8 A;  3RC8 A;  4H9S E;  4DMW A;  5HXS A;  4LF5 T;  4EOZ B;  3OKQ A;  3DTO A;  3AE5 A;  2D2S A;  2HPL A;  5J2U E;  4M1P A;  5EK3 A;  3Q5E A;  4ERR A;  5AQV B;  2XUE A;  2UUA T;  4TNV A;  2X0Y A;  2MYS A;  4HFH A;  3RLF F;  4U2Y A;  5LHG B;  2YIN A;  2VVS A;  4KP3 C;  2E9X B;  2JQK A;  2XAG B;  3MK7 C;  1IBL T;  4IDP A;  1BR2 A;  5HXC A;  3ZSS A;  3N9P A;  4P0A A;  4DMV A;  5LYJ E;  4DO0 A;  4BJM A;  4Z8X A;  2BVL A;  2DNX A;  2NW8 A;  5FNV E;  3BQK A;  4EYU A;  3NWI A;  3PDY A;  2XM1 A;  1I94 T;  3AB3 B;  3TLU A;  3N2K E;  4UIG A;  2WDR A;  3KV5 A;  2PJQ A;  5LG3 A;  3ZMT B;  1DU2 A;  1ZP0 A;  2XSA A;  3FXE B;  3P4P A;  4A98 A;  3OYX A;  3FBL A;  1O3X A;  2XY8 B;  1N32 T;  4JI8 T;  5AQP B;  2VKO A;  5JRC A;  1OED E;  2BG9 C;  2Z6E A;  1KK7 A;  2KSR A;  4PK6 A;  3K3N A;  2KT9 A;  3Q5X A;  5LOV E;  5AQO B;  2P9B A;  3OVU A;  3RYF E;  3T1H T;  2IHR 1;  4LMJ A;  3OBV E;  2M6B A;  4DV3 T;  2LT3 A;  4O2A E;  2BDE A;  2DL1 A;  4Z90 A;  1KFY A;  2NR4 A;  4X62 T;  1SA0 E;  4YTN A;  1IZN B;  3W15 B;  4DBR A;  4ANJ A;  1N33 T;  4JEU B;  5JDG A;  2ES0 A;  3RHW A;  1HX1 B;  4HFB A;  4AXP A;  1W9R A;  3NRX A;  4ILC A;  4L9I A;  4EED A;  2XQA A;  4QX7 B;  1WCR A;  1UGO A;  3RF1 A;  2LE8 A;  2LJL A;  4NXN T;  5CJ5 A;  4UXN B;  4X66 T;  5ABG A;  1D1A A;  3RIA A;  3UU8 A;  5AQK B;  2V8S V;  2WU5 A;  2PTF A;  5LNK A;  2WMN A;  4WBO A;  1S94 A;  3P4R A;  3QNU A;  2C5I T;  5JDM A;  3AEE A;  2H3R A;  4O4L E;  2DWK A;  2I6H A;  1FEW A;  1W0B A;  2WWV A;  4DUZ T;  4NXM T;  2CMR A;  1SUM B;  1X9B A;  4QWN B;  3QB5 A;  4X1Y E;  2XQ4 A;  3LSV A;  4A56 A;  1KNR A;  5IYZ E;  2UU9 T;  5FVL A;  1XZY A;  3BQL A;  4PFO A;  3F57 A;  3RQW A;  3RIF A;  2H89 A;  1XDP A;  3B13 A;  5BMV E;  3CQG B;  1CUN A;  3AVR A;  1T7S A;  3IEE A;  5L3F B;  2V6X A;  1MIV A;  1VOM A;  3KVA A;  2E9X D;  3N9M A;  2E9X A;  1YD8 G;  4NIQ A;  1SHZ C;  2XSB A;  4I43 B;  4A5X A;  1D1C A;  2MAW A;  2IC6 A;  4ZI2 D;  4DV0 T;  3LFM A;  5HCM A;  2YN6 A;  4QKN A;  2V7L A;  1QLB A;  3ZN1 B;  5FMN A;  4IST A;  3ZMZ B;  2XPK A;  4YHJ A;  4DV1 T;  4JI0 T;  2E8I A;  2HN1 A;  2IAK A;  2BS3 A;  3IF8 B;  3QC9 A;  1YKH B;  3GWH A;  1U4Q A;  2X51 A;  2H7V C;  4LML A;  4PJJ A;  2XQ3 A;  2VVN A;  3FZK B;  2LSI A;  5JRE A;  2N2N A;  2XTL A;  3TKL B;  5F5W A;  1I6Z A;  3B57 A;  3ONL C;  1UUR A;  2A72 A;  2K48 A;  3O1I A;  4LF6 T;  4TUY E;  5FYM A;  1WRD A;  5HEO A;  2ZLY A;  2KZ7 B;  2RP4 A;  2LSK A;  4EV6 A;  4C91 A;  4EZ4 A;  3AA1 B;  3OJA A;  1UK5 A;  2JQQ A;  3VKG A;  3ZMV B;  4B3M T;  3AEG A;  1XMQ T;  2E5L T;  2HH7 A;  3JCF A;  2AE9 A;  2CXL A;  3KFW X;  4I0U A;  4CI1 B;  2CEA A;  2M6I A;  1FMW A;  2XQ8 A;  1HNW T;  3AA0 B;  4UR9 A;  3SRZ A;  3N9N A;  3NRY A;  4AKG A;  5CFB A;  3MXZ A;  3V5S A;  3CX7 B;  4HFI A;  2YOE A;  2I59 A;  2NTY A;  5AQQ B;  5DQW A;  4EGW A;  4HWF A;  2X9X A;  3I0O A;  4IDN A;  1HCI A;  2Q9Q D;  1AJ3 A;  2Q9Q A;  2JQ9 A;  3I1A A;  3JAD A;  4LMK A;  5L3D B;  4YY3 T;  5TAO A;  1YQ3 A;  1VCT A;  2XAJ B;  2LEH A;  2XQ7 A;  1HFA A;  4FJO A;  4CN1 A;  1ZKE A;  3ZEF B;  3MKD A;  2X68 A;  5FKY A;  3F2E A;  1WR6 A;  3NVO A;  3AA7 B;  4ZZC A;  3G06 A;  2W0G A;  4EEB A;  4DVD A;  4P09 A;  3E22 E;  2V7M A;  4JI4 T;  2NTX A;  4WYV A;  2ZMA A;  3R84 B;  3ANW B;  3WAJ A;  4JI7 T;  3U3I A;  3ZLI A;  3CX6 B;  4F8H A;  2A2F X;  2CHN A;  3EHZ A;  3UTK A;  2N9D A;  3N9L A;  4UF0 B;  4LF9 T;  4ASK A;  1D1B A;  1WLX A;  3RGL A;  1MND A;  4X1I E;  5C8Y E;  2PBI A;  3NZQ A;  2CXF A;  3RQU A;  5LMN T;  4OHF A;  3U78 A;  4H9O C;  5HEG A;  4IIJ E;  5FXW A;  2X67 A;  2XZE A;  3X1D A;  5FL0 A;  5JDL A;  3UUX B;  4DV5 T;  3V5U A;  3AE9 A;  5HEJ A;  3PUR A;  4U74 A;  5LHH B;  5JTG A;  2CWY A;  4YSZ A;  3VR9 A;  3ZJ1 A;  4KMC A;  4MAL A;  3SWH A;  4JBW F;  3PUG A;  4B6X A;  3J7Y q;  3SFE A;  2ZM0 A;  1KEY A;  4TWF A;  4WZX A;  3MJX A;  2V1D B;  2KLQ A;  4U7Y A;  5L3B B;  3RYH E;  3RC3 A;  3PTR B;  4UV8 B;  3C4Z A;  4TNW A;  3EDV A;  4H63 V;  4ZI3 D;  2AXD S;  2MBG A;  4QH1 A;  3UU3 A;  4IE5 A;  3QUJ A;  3IHR A;  3C64 A;  2CPT A;  2HHH T;  4DBQ A;  3PU3 A;  4DR3 T;  4QX8 B;  2XAQ B;  4KX6 A;  4JI3 T;  2K5B B;  4LFA T;  5L3E B;  3RRW A;  1IJ5 A;  4ZZB A;  2PG8 A;  3ZC1 A;  2J62 A;  1D0Y A;  2A3D A;  3TLT A;  3Q9D A;  2V5D A;  4BAY B;  3RX6 A;  5AQS B;  2CHO A;  2WDV A;  2KMF A;  4DR6 T;  2X9W A;  1V9D A;  5HEU A;  4QXH B;  4NUU A;  2ODU A;  3KV9 A;  4MFR A;  2EHO C;  2CBI A;  2H7O A;  4JI2 T;  4O4I E;  4GYS A;  4DID B;  3UU4 A;  5HYA A;  2BG9 B;  2WSS V;  5AQN B;  2UUB T;  2CRB A;  4TN7 B;  2X0H A;  3VU7 H;  3RRC A;  4GIW A;  4AKR B;  2D0T A;  5KXJ A;  5ETW A;  1HG2 A;  3ESL A;  4YXD A;  1L0V A;  3TLS A;  4AQF A;  3ZT7 A;  2VQF T;  3JC6 C;  2B76 A;  3IBP A;  2W63 A;  1HG5 A;  1H7C A;  4HFV A;  4AKI A;  1XWM A;  2MOZ A;  3AE4 A;  3VRA A;  2E2A A;  5L4E A;  1N34 T;  3VR8 A;  4DR1 T;  4I55 E;  3SS1 A;  2VK9 A;  3TLW A;  4IDQ A;  3JAE A;  4TV8 E;  3ANW A;  3CQX C;  3PUW F;  4H9R C;  2XQY A;  3OYZ A;  5JQG E;  4O2B E;  3I0Q A;  4GKJ T;  1FMV A;  3C4W A;  3PJA A;  3SFD A;  3FXD B;  2HN2 A;  2BBJ A;  2CE7 A;  1OED A;  2DI4 A;  4PJN A;  1KNZ A;  3FHN A;  3Q2M A;  2JPF A;  2YDR A;  2NP9 A;  2IUB A;  4CQI A;  4E7Z A;  5ABE A;  4IDO A;  3MA9 A;  3VRB A;  1M62 A;  2WQY A;  4MLK A;  4HWD A;  3AAE B;  5L4H A;  3CIR A;  1T98 A;  1E2A A;  3O1J A;  5KDM C;  2YU2 A;  1Z0P A;  5AQJ B;  2QA7 A;  3D0T A;  5EK4 A;  1SE7 A;  4O4J E;  2A9U A;  2BBH A;  2D9D A;  3SOL A;  1HR0 T;  4LFB T;  2CLY C;  3HL6 A;  3K1S A;  1UX4 A;  3CWZ B;  3M65 A;  4OX9 T;  1VRB A;  3RKO A;  3PUA A;  4AKL A;  2WZH A;  3C4X A;  5LG4 A;  3PUZ F;  4LF4 T;  1M7K A;  2BG9 E;  4YSY A;  2Q9Q C;  4H9P C;  5GON E;  2JQH A;  1HNX T;  3ZYK A;  2IIU A;  4EZH A;  4JYA T;  5FXZ A; 
#chains in the Genus database with same CATH homology
 3ETV A;  3AA0 B;  4XAX B;  3UUN A;  4H9Q C;  3SRZ A;  3N9N A;  3NRY A;  2N1G A;  5JH7 E;  5LGN B;  4IHJ E;  3E0Z A;  3UFE A;  4K0U A;  2ZM8 A;  2K9A A;  2C0S A;  1MMA A;  3GN5 B;  4F6R C;  5J2T E;  4AKG A;  1WYC A;  5JR9 B;  2X0L B;  4L0R A;  2B1E A;  3MXZ A;  3C51 A;  3V5S A;  1D0Z A;  1WYB A;  2V7K A;  3CX7 B;  2K24 A;  3N2O A;  3KIN B;  4HGA A;  5HXE A;  3CQC B;  4ZS2 A;  2QGS A;  3HR0 A;  4X20 E;  4H9N C;  2I59 A;  2W62 A;  2NTY A;  5FP3 A;  3ETU A;  4HE8 A;  4PK5 A;  3Q5W A;  3RC8 A;  4H9S E;  4DMW A;  5DQW A;  5L2L A;  5JR9 C;  2X9X A;  3I0O A;  4OK0 A;  1HCI A;  2Q9Q D;  4UF0 A;  1AJ3 A;  5LJM A;  2Q9Q A;  2LOP A;  4HEA A;  5HXS A;  4ZI7 E;  4EOZ B;  3GA8 A;  3OKQ A;  2BZB A;  3DTO A;  3I1A A;  2JMH A;  3LJC A;  4HTE A;  2UXN B;  5L3D B;  1X79 A;  4I50 E;  3CML A;  5TAO A;  2IC9 A;  2NWB A;  3BK9 A;  3T8O A;  5ADX L;  2D2S A;  1OXZ A;  2XAJ B;  2CWO A;  2LEH A;  2HPL A;  3RH3 A;  1HFA A;  2GK9 A;  5J2U E;  4EB6 E;  1US7 B;  4FJO A;  4C90 A;  2L9Q A;  4BJN A;  1ZKE A;  4UEL A;  3ZEF B;  3LG7 A;  4M1P A;  3MKD A;  2X68 A;  5EK3 A;  3F2E A;  3H37 A;  5LBM A;  3N9Q A;  1WR6 A;  4ERR A;  4OFZ A;  2XUE A;  3UUM A;  3CPZ A;  2UXX B;  3AA7 B;  4GOU A;  2W61 A;  3AAI A;  3LK3 B;  2LHR A;  2MYS A;  2W0G A;  4WW0 A;  4DVD A;  2D0U A;  3CX8 B;  4P09 A;  3E22 E;  2XAS B;  4U72 A;  2V7M A;  4EAH A;  5LHG B;  3ZC0 A;  3L3P A;  2YIN A;  4KP3 C;  2E9X B;  3ONX A;  2CLY B;  2NTX A;  2XAG B;  3MK7 C;  5HWX A;  1B7T A;  1YW0 A;  5CA0 E;  4UVA B;  2Y8D A;  1BR2 A;  2ZMA A;  3NBX X;  1HX8 A;  4QHO A;  5HXC A;  3R84 B;  3ANW B;  3WAJ A;  3U3I A;  3ZLI A;  3CX6 B;  4YFS A;  3N9P A;  2KXP B;  3K8P C;  4P0A A;  2A2F X;  4DMV A;  2WMO A;  5LYJ E;  4DO0 A;  3UTK A;  4BJM A;  4Z8X A;  2N9D A;  2BVL A;  2DNX A;  2NW8 A;  2Y6X A;  3N9L A;  4UF0 B;  5FNV E;  2Q9Q B;  3BQK A;  4XZC A;  4ASK A;  4EYU A;  2XAF B;  3PDY A;  1D1B A;  1WLX A;  3AA6 B;  1MND A;  4X1I E;  2J1D G;  3AB3 B;  5C8Y E;  2PBI A;  1MMD A;  3NZQ A;  3FBZ A;  4EXT A;  3N2K E;  4UIG A;  2CXF A;  4UVB B;  2W00 A;  4OHF A;  3U78 A;  3KV5 A;  1IAP A;  2PJQ A;  4DND A;  4H9O C;  3ZMT B;  5JVD E;  3GMI A;  4IIJ E;  5FXW A;  2X67 A;  5L3G B;  3LK4 2;  4WNK A;  3FXE B;  3HKE E;  1LVF A;  3OYX A;  3FBL A;  4ZOL E;  5IHY A;  1QSD A;  5JDL A;  3UUX B;  3V5U A;  1O3X A;  4CI2 B;  3PUR A;  4U74 A;  5LHH B;  4AQG A;  2VKD A;  2VKO A;  5JRC A;  2CWY A;  5DQV A;  2LSJ A;  4ZI3 C;  2Z6E A;  2VL8 A;  1KK7 A;  3HKD E;  4PK6 A;  3ZJ1 A;  3N9O A;  4KMC A;  4MAL A;  2C5K T;  3K3N A;  2KT9 A;  4UV9 B;  1BR0 A;  3Q5X A;  5LOV E;  4QXB B;  3SWH A;  1NWM X;  1ZEE A;  2P9B A;  2JJ9 A;  5J1G A;  3PUG A;  1UCU A;  2LOS A;  3RYF E;  4B6X A;  3J7Y q;  5FY7 A;  2KIN B;  1E1H B;  2V26 A;  3P8C D;  2EHO D;  4OYJ A;  2LHN A;  2ZM0 A;  4ADZ A;  2EHO A;  3OBV E;  3HKC E;  2LT3 A;  4PJM A;  3LBX B;  2YEV C;  3K3O A;  4O2A E;  2LM9 A;  3MJX A;  4I4T E;  2BDE A;  2VKH A;  5FXX A;  5E0O A;  2V1D B;  2KLQ A;  2VWA A;  4V1A v;  5L3B B;  1SA0 E;  3RYH E;  3RPU A;  2Y48 B;  3RC3 A;  5H6R B;  3PTR B;  1IZN B;  2LSG A;  3W15 B;  4DBR A;  4UV8 B;  3RYC E;  5LHI B;  4ANJ A;  5LBQ B;  3C4Z A;  5L3C B;  4JEU B;  1U5P A;  2ES0 A;  5JDG A;  3EDV A;  2X66 A;  4ILU A;  4H63 V;  4ZI3 D;  2MBG A;  1MMN A;  4AXP A;  1D0X A;  4IE5 A;  3JC6 D;  1HF8 A;  2XHE B;  3QUJ A;  5FXV A;  3IHR A;  2SPC A;  3NRX A;  3ZMU B;  5KX5 E;  3C64 A;  4L9I A;  3KVB A;  4DBQ A;  3PU3 A;  4QX7 B;  2OA5 A;  4ISS A;  4QX8 B;  2XAQ B;  2VKJ A;  4TX5 A;  3O1H A;  3BQI A;  4IE4 A;  5JRC B;  3EUH A;  5F8P A;  2LE8 A;  2LJL A;  4MBQ A;  3ZMS B;  1G8X A;  1LRZ A;  2K5B B;  5L3E B;  3RRW A;  1IJ5 A;  4GK5 E;  2RA1 A;  4UXN B;  3J9X 1;  3AVS A;  3UT5 E;  5HWY A;  2PG8 A;  2WAU A;  3ZC1 A;  3ZYL A;  5JDH A;  4EYY R;  3O4X E;  1FIO A;  2KND A;  5F3J A;  5JDN A;  3WI3 A;  1D1A A;  4PAG A;  1D0Y A;  2A3D A;  3ZJ2 A;  3PUQ A;  4JLE A;  2X9H A;  3Q9D A;  4BAY B;  3RX6 A;  5LNK A;  4E7S A;  2WMN A;  2NW9 A;  1NAF A;  4IGU A;  4WBO A;  2KMF A;  1MIW A;  2X9W A;  1S94 A;  3GN5 A;  3E08 A;  1V9D A;  2C5I T;  4G63 A;  2VB6 A;  4QXH B;  3KBU A;  5JDM A;  4NUU A;  2ODU A;  2H3R A;  3UUL A;  4O4L E;  1EZ3 A;  2DWK A;  5EK2 A;  3KV9 A;  4MFR A;  2EHO C;  3K3Q C;  4CXX A;  2H7O A;  1FEW A;  2KWI B;  3A5X A;  4O4I E;  2XAH B;  5HAX A;  4GYS A;  5LCY A;  5HYA A;  4OYK A;  4PNI A;  3L09 A;  3HA4 A;  1Y64 B;  2CCQ A;  2WSS V;  2BVM A;  3ZN0 B;  2WM9 A;  4TN7 B;  3CKD A;  3PE0 A;  2CMR A;  2M67 A;  4ZS3 A;  3VU7 H;  3RRC A;  1ZHC A;  4GIW A;  3I9Y A;  4QWN B;  5A1L A;  4X1Y E;  4AKR B;  4H63 H;  2D0T A;  3F31 A;  3EDU A;  3MAC A;  4GK0 E;  5ETW A;  1UX5 A;  2CM0 A;  5LA6 E;  4JUY A;  1HTJ F;  1HG2 A;  3NZP A;  4A56 A;  3ESL A;  4L5G A;  5IYZ E;  2NOX A;  3WAK A;  3MZK B;  3VKH A;  5DAB A;  1G73 A;  4GYR A;  4N78 D;  4X1K E;  4UVC B;  2DHR A;  4AQF A;  3BQL A;  5LJN A;  5LGU B;  4PFO A;  3JC6 C;  1QUU A;  3F57 A;  4YJ3 E;  5HXR A;  3I9W A;  4BA9 A;  3IBP A;  2WWU A;  5DJQ C;  2W63 A;  1HG5 A;  1H7C A;  4HFV A;  4AKI A;  2ZM2 A;  3B13 A;  5BMV E;  3CQG B;  2MOZ A;  4QXC B;  4TV9 E;  1CUN A;  1S35 A;  3AVR A;  3IEE A;  4IE6 A;  4CZZ B;  5L3F B;  5LXT E;  1LVK A;  3VHL A;  1MIV A;  1VOM A;  3KVA A;  4P0B A;  2E9X D;  5LP6 E;  3N9M A;  2E9X A;  1YD8 G;  3N2G E;  1YKE B;  4I55 E;  2WBL A;  1SHZ C;  3ZPO A;  4I43 B;  5HXH A;  3SS1 A;  1BR1 A;  2VK9 A;  1D1C A;  4TV8 E;  2IC6 A;  4HN9 A;  4G2A A;  3ANW A;  2CXD A;  4ZI2 D;  3LFM A;  1HS7 A;  3CQX C;  2MTQ A;  4H9R C;  1MNE A;  5H6Q B;  4KUM B;  2XQY A;  3OYZ A;  5JQG E;  4HKA A;  3KV6 A;  4PW8 A;  2HPJ A;  4O2B E;  2ACX A;  3I0Q A;  1IJ6 A;  1FMV A;  2C5J A;  2JRK A;  3C4W A;  4QKN A;  4IE7 A;  4PFP A;  2V7L A;  5FY0 A;  3ZCJ A;  3DP7 A;  3KDS E;  3ZN1 B;  3RYI E;  5FMN A;  2V7I A;  4IST A;  3FXD B;  3ZMZ B;  4J2C A;  3O9X A;  2YK0 A;  3C50 A;  4YHJ A;  4EIW A;  2CE7 A;  2DCF A;  3HKB E;  4UEM A;  4YLH A;  2DI4 A;  3KV4 A;  4PJN A;  3S4U A;  1KNZ A;  2E8I A;  3FHN A;  3Q2M A;  4O8S A;  2IAK A;  2DLR A;  2JPF A;  4JEH B;  3IF8 B;  3PU8 A;  4ZHQ E;  2NP9 A;  2G0U A;  3KBT A;  3QC9 A;  1YKH B;  3GWH A;  4YJ2 E;  1U4Q A;  4CXY A;  4WBN E;  2X51 A;  4CQI A;  4E7Z A;  2H7V C;  2L8K A;  3MA9 A;  4AKH A;  4PJJ A;  2JMK A;  4MLK A;  1ZV4 X;  1MIY A;  2EHO B;  1MMG A;  4AQF C;  2ODV A;  4MHC A;  2LSI A;  3AAE B;  5JRE A;  2N2N A;  5AFU L;  2KWH A;  1T98 A;  3ZYM A;  2V7J A;  2XTL A;  3O1J A;  4IE0 A;  4TZ4 C;  3TKL B;  5M4Y A;  5KDM C;  2PFV A;  4PK4 A;  2YU2 A;  3B57 A;  3R6N A;  5FY1 A;  1Z0P A;  5JR9 A;  2QA7 A;  3D0T A;  2IW5 B;  2A72 A;  2CA5 A;  2K48 A;  2YU1 A;  3H3A A;  3O1I A;  4O4J E;  5EK4 A;  5LGT B;  3HI2 A;  3SOL A;  4TUY E;  3LBX A;  5FYM A;  1WRD A;  2E9X C;  2CLY C;  2ZLY A;  2KZ7 B;  2RP4 A;  2X9Y A;  1OWA A;  2LSK A;  3HL6 A;  3FB2 A;  3ZCI A;  5CA1 E;  5EZY E;  4C91 A;  2NW7 A;  1UX4 A;  3AA1 B;  3LK2 B;  3P7I A;  3CWZ B;  3M65 A;  4EZ4 A;  4NUV A;  3AAA B;  3OJA A;  1LKX A;  1VRB A;  2JQQ A;  3RKO A;  3VKG A;  2LSY A;  4O4H E;  3ZMV B;  4ZI2 C;  2D5U A;  5JDF A;  2DWG A;  4IDZ A;  3PUA A;  3QK6 A;  4CI3 B;  3C98 B;  4AKL A;  4KBM B;  3C4X A;  5LG4 A;  2HH7 A;  3EVY A;  2CXL A;  2VAS A;  4PJL A;  5CB4 E;  3CVR A;  4CXW A;  3N5L A;  2Q9Q C;  4H9P C;  4AI6 A;  3KFW X;  2L3L A;  5GON E;  4XBF B;  4FI5 A;  3PUS A;  5JDQ A;  3DJB A;  1BR4 A;  3ZYK A;  4CI1 B;  4EZH A;  2CEA A;  5FXZ A;  5KMG P;  1FMW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...