1R8IA

Crystal structure of trac
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
187
structure length
187
Chain Sequence
TELIKQGEQLEQMAQQLEQLKSQLETQKNMYESMAKTTNLGDLLGTSTNTLANNLPDNWKEVYSDAMNSSSSVTPSVNSMMGQFNAEVDDMTPSEAIAYMNKKLAEKGAYDRVMAEKAYNNQMQELSDMQALTEQIKSTPDLKSIADLQARIQTSQGAIQGEQAKLNLMNMLQQSQDKLLRAQKDRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords TraC
publication title Structural and functional characterization of the VirB5 protein from the type IV secretion system encoded by the conjugative plasmid pKM101
pubmed doi rcsb
source organism Escherichia coli
total genus 70
structure length 187
sequence length 187
ec nomenclature
pdb deposition date 2003-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07996 T4SS Type IV secretion system proteins
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.430 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Type IV secretion system, VirB5-domain 1r8iA00
1R8IA
chains in the Genus database with same CATH superfamily
4EOZB 3OJAA 3FBLA 1IBMT 2X0LB 3EDVA 3AAEB 2MAWA 2I59A 5HEJA 4O2AE 4P09A 1OWAA 4BA9A 2YDRA 5FNVE 4I55E 3H3AA 4KUMB 5LBQB 5J0ZA 3IA3A 4ZI3D 2IC9A 3JC6D 3RIUC 3KBUA 3J9X1 4HFVA 3F2EA 5FKYA 3PURA 3EVYA 4EZ4A 1MMAA 2PJQA 4DUYT 5JR9B 2LSJA 3CMLA 5E0OA 2KNDA 1NWMX 3B57A 2D9DA 4MLKA 1SHZC 4NXNT 2PBIA 2VURA 4E7SA 1O3XA 3ZSTA 2VL0A 3F57A 2XSAA 3LK2B 4LFAT 2JPFA 2WP9A 1I6ZA 2CWOA 5LJNA 4IL9A 2KWHA 1IZNB 2CBJA 2RPAA 3FB2A 4WYVA 4Q25A 5LNKA 3I0QA 5H6QB 4CN4A 4IE4A 3EHZA 2MYSA 3SFEA 4DV3T 3TLUA 3EI0A 4GIWA 3JAFA 5FXWA 4EIWA 1IJ6A 4BJMA 4NIQA 3PUVF 1UX5A 3CX6B 4IT4A 4JI1T 4JI3T 2VQET 5ABHA 4OHFA 4HWCA 1S94A 2Q9QC 2Y6XA 3ZCIA 5L3CB 4ERRA 3AA1B 4TV8E 2CXDA 2WZIA 3ZKRA 4JBWF 5LOVE 2H88A 4ILAA 1UUSA 2BG9B 2IW5B 2V7MA 4ZEYA 4AIUA 1D1CA 3T1YT 2N2NA 3KV9A 4L9IA 5DQVA 3RYFE 4DMVA 4TX5A 4G2AA 3ONXA 3K8PC 1N34T 1FEWA 3AA7B 4AXPA 1KNPA 4PK4A 2X67A 4HFEA 1QLBA 4UELA 2UXNB 4OFZA 4DIDB 2YU2A 3HKCE 2EHOA 3VR9A 2V7KA 3AE7A 5AQGB 4EB6E 2QA7A 4IL4A 4U3CA 3RX6A 4X64T 4B3TT 3ZMTB 4X20E 5H6RB 4IE5A 4NXMT 2VWAA 2VVNA 5AQTB 4MFRA 4UVCB 2ZM0A 3C98B 2R6GF 2IMLA 2L9QA 2CXFA 4QKNA 4DVDA 5EK2A 3R84B 5JDNA 5FXVA 3RPUA 2LSGA 1HS7A 3ZMUB 4HFCA 4TNVA 1US7B 2NOXA 4PK6A 3N9MA 4O4JE 4IREA 1MMDA 2E9XB 4ILBA 3NZPA 3ZYLA 3V5UA 2W00A 3ZN1B 2KT9A 2V5CA 3ZLIA 3KDSE 2BZBA 2DWKA 4H9OC 4PAGA 4QX8B 4A98A 2XUEA 2XTLA 2VKHA 3WAKA 3S4UA 4LF6T 2YOEA 1S35A 2N9DA 1WR6A 4ZI3C 2V6YB 4X62T 3CWZB 3J7Yq 2XQYA 3JCFA 2ZLYA 4UF0A 4ILUA 3N9LA 4QXCB 4OX9T 1Z0PA 1HR0T 4H9RC 5DABA 3GWHA 3PUYF 3V5SA 1Z8UA 1OEDC 4B3MT 2LHRA 2H89A 1SA0E 2XQ5A 3PUQA 5LB7B 5LGUB 3NWIA 5ABFB 3AEGA 3CPZA 4HEAA 3NRXA 4IGUA 4AISA 4HGAA 4HFDA 2X0HA 3P4PA 3F31A 1V9DA 1IBLT 3PUXF 2YKSA 3TLWA 3I9WA 1KFYA 1OXZA 4LFCT 4I50E 2WWVA 4IDZA 4BJNA 2X9YA 3NBXX 2CPTA 2CMRA 2BVMA 3CQGB 5FVLA 5LGNB 2A3DA 2IIUA 3M3ZB 4OK0A 3BQIA 3RH3A 3L8RA 3HKDE 2KINB 4CXXA 2W66A 4A97A 1I94T 5EZYE 2XASB 2HPLA 3GA8A 1L0VA 4Z8XA 2IUBA 1IJ5A 2BKOA 2KZ7B 3KBTA 3ZN0B 5LXTE 5FY1A 3VHLA 3UUBA 4QH4A 4O8SA 4X65T 3G06A 3FZMB 4Z91A 3EABA 3MXZA 2DNXA 3ANWB 3D0TA 4X1IE 4X5TA 2NW8A 1KNRA 1D1BA 2BKPA 4DV7T 2YDSA 4IHJE 3UFGA 5AFUL 2K5BB 4DMWA 2DWGA 2PG8A 2CEAA 1T72A 1J5ET 4JI8T 3E08A 2K9AA 5HCMA 3LBXB 3P4WA 3ZEFB 4ASKA 2HH7A 3ONLC 4PNIA 4LMJA 4DR6T 2ES0A 3PTRB 4DR3T 2X9XA 5IYZE 4YSZA 4KP3C 1HNWT 1OEDB 3IBPA 4PJJA 4UXNB 4EAHA 1MIYA 4ZS3A 2VQFT 5FP3A 4UV8B 2V7LA 3GMIA 4UVAB 5AQVB 2UXCT 2XAQB 5M4YA 1W09A 5AQKB 4B3ST 3ZCJA 1KF6A 3BK9A 5LCYA 3RYIE 3AEFA 4CN6A 4NPPA 1YW0A 3ZT6A 5IWAT 5J2TE 2YN6A 1CHUA 2WDVA 5J2UE 2XQ9A 4MBQA 4JV5T 1WCRA 2WU5A 4ISSA 2BBHA 3HR0A 2XAJB 1EZ3A 2LM2A 2N1GA 2X68A 3N2KE 5LP6E 5EK4A 2VASA 4J2CA 2NP9A 2OA5A 3NZQA 3N5LA 2EHOD 4YJ3E 4L5GA 3MJXA 3EUHA 5L4HA 3A7MA 4V1Av 3QK6A 2LKGA 2DI4A 5HYAA 2LSIA 2D0TA 4AI6A 3PU3A 4H9PC 1X9BA 3AXJB 2XJ7A 5EK3A 4AQGA 3FZKB 5AQIB 5FY0A 5FXXA 5HCJA 5JRCA 1CUNA 4GK5E 3ZSSA 3KVAA 2V6XA 1KNZA 4B3RT 3K3QC 3DP7A 4HE8A 4U33A 5IHYA 5FY7A 4MHCA 5JDFA 3IEEA 4AQFC 5BR8T 2VKDA 3AEAA 4ZI2D 2XPKA 4LF9T 3H37A 2WWUA 3N9QA 3HL6A 5JDGA 2WMOA 2IDOB 2XM2A 3LK42 4LF8T 2K24A 3NKZA 4COFA 4JI4T 1VRBA 2Y48B 4AKLA 2V5DA 3P50A 2LRLA 3ZT5A 2BDEA 2A72A 4YY3T 2CHOA 1W0BA 2Q9QA 3TLSA 4ZS2A 4N78D 1BR0A 2CM0A 2NTYA 2BS4A 4UIGA 2E9XC 4CXYA 4TUYE 3K1SA 1WLXA 1FIOA 1D0YA 4H63H 2Z6EA 4YT0A 3FZLB 4KX6A 4H63V 2RA1A 5AQUB 2BS3A 5CA1E 1SE7A 1HCIA 1WFDA 2E2AA 3B13A 3K3OA 4NUVA 5C2TA 4JI2T 1WYBA 3OYXA 2WZHA 5AQNB 4DO0A 1BR1A 4CI3B 5JDQA 2IHR1 1UK5A 1HF8A 3RRCA 4HWIB 4KBMB 4PFPA 2JQ9A 4ZZCA 2LT3A 3RRWA 5C3JA 3MZKB 3TKLB 5L3GB 1UGOA 2V26A 5HEGA 2E5LT 4GK0E 4U2YA 2DHRA 3TLTA 1YQ4A 1MIWA 4PFOA 1LRZA 3AE1A 4KHPT 2OLTA 2W63A 4CZZB 1YKHB 2DL1A 2XQAA 2JQHA 3OYZA 4JLEA 3Q5DA 2BKNA 3UTKA 2LEHA 4QHOA 2CXLA 1W9RA 5ABEA 1YKEB 2WSSV 4GKKT 2VL8A 1XMOT 2WDRA 4EEDA 5AQOB 2CLYB 2ACZA 1E2AA 3QC9A 2HN1A 3CVRA 4DV1T 4U2ZA 2WCAA 2LHNA 5AQFB 5IUXA 5KXJA 2H7OA 3MK7C 1LVKA 4AKGA 5HXCA 3ZT7A 5HAXA 3C4XA 2YU1A 1SUMB 5LGTB 2B1EA 4PJNA 4QX7B 2LLYA 3RC3A 2JQKA 3ETVA 4WNKA 1KEYA 2KLQA 4A5XA 3QUJA 5TAOA 4QXBB 5ADXL 1NENA 3RQWA 5AQJB 4NUUA 1HNXT 4O4IE 4GYSA 4KHZF 5GONE 3L39A 4EYYR 3FZHB 4HFIA 5AQSB 4DV2T 4YJ2E 4HN9A 2WAUA 3VU7H 3GN5A 2W62A 3VR8A 2XAFB 3ONJA 1MNEA 5FL0A 4JUYA 1AJ3A 4EGWA 2H3RA 3UU6A 3AB3B 3CIRA 4PJLA 2PTFA 3JC6C 5HXEA 3OKQA 5L3FB 4IE6A 3ZYMA 1Y01A 1T8BA 2CRBA 1VCTA 4XAXB 4B6XA 3KFWX 4AKRB 4ZI2C 2YINA 3N9NA 2HPJA 4AKHA 2MTQA 3U3IA 4H9NC 2LM9A 2WU2A 3I0OA 3AA6B 3FXEB 5LA6E 1ZOYA 2WY2A 2M6IA 1G8XA 2LSYA 2ACXA 2FJAA 3E0ZA 1VOMA 2CWYA 4GOUA 2JRKA 3RIAA 4DBQA 3N2GE 3QB5K 4IDOA 4FI5A 2WB5A 3PUZF 4LF5T 2BVLA 3P8CD 1N36T 1HTJF 3ZMVB 2QGSA 3KV5A 4TV9E 2UXXB 2UUAT 4HWHA 4P0AA 2D2SA 2MOZA 4O4LE 4DUZT 1X79A 2ZM6T 3HKEE 2LOPA 4UEMA 3AEBA 3O1IA 2CBIA 2FJDA 2A9UA 3KV6A 3AE4A 2W61A 5JREA 5L47A 2JMKA 2WS3A 2XZEA 4PK5A 3C4WA 2EHOB 1QUUA 3HA4A 4DBRA 3FXDB 2I6HA 3T8OA 3FHNA 3ETUA 3PU8A 1WYCA 2DCFA 5JR9A 4TNWA 2L8KA 3AE8A 3ZC0A 3FBZA 3C4ZA 4F6RC 5AQPB 3ZJ1A 3AE6A 3M65A 5ABGA 4X1KE 5LHGB 1IBKT 3UULA 4KMCA 4TWDA 4HKAA 3LK3B 2K48A 1XZYA 1YXRA 5CA0E 3AVSA 3RYHE 4HTEA 1ZP0A 5HXHA 2A2FX 2KSRA 2Q9QD 2J4GA 3PV0F 3QNUA 3VKGA 4ZI7E 3UU3A 5LG3A 2I0MA 4C91A 4WZXA 1D1AA 5FYMA 3DJBA 3RF1A 2XQ7A 3Q5XA 2X51A 4JEUB 2UUCT 3CK6A 4DR4T 5F5WA 2V7JA 2C5KT 3UFEA 4CQIA 2BG9A 3VKHA 3ZJ2A 1UCUA 4UF0B 4WBOA 3AE9A 5CFBA 3P7IA 3R6NA 2NTXA 3KINB 2X9WA 1R8IA 3PUSA 4HWFA 5L3DB 4YHJA 3WI3A 2NR4A 3OBVE 4ZXLA 2LOSA 4M1PA 1UURA 4PW8A 1M62A 2H7VC 1DU2A 1W0AA 3C64A 2P9BA 5JTGA 5L3EB 2L3LA 4JI0T 4P1NA 3O9XA 3RIUA 2J47A 5L4EA 4EYUA 3CX8B 3I9YA 4DV6T 3UQ7A 2C0SA 3PUGA 3MACA 4AQFA 3VRAA 3AE2A 4JYAT 1H7CA 3A5XA 3ZMZB 3KVBA 2BG9E 3QB5A 2XY8B 1WRDA 1BR2A 2XAHB 4I0UA 2NW9A 2D5UA 2CLYC 3RKGA 2Y8DA 2VKJA 2K3WA 4YXDA 3MA9A 5AQQB 1WR0A 1HG5A 2LRKA 2E9XA 5HXSA 3E22E 2MPKA 4K0KT 5AQRB 5AQLB 5HWYA 5AQMB 3OTOT 4BAYB 4WBNE 1IAPA 2F4VT 4YHHT 1MNDA 2LJLA 5HEOA 2FBWA 3AEEA 2VVSA 2XM1A 4U31A 5A1LA 2YEVC 3JAEA 1ZKEA 1UX4A 4YTPA 2NWBA 2V6YA 2VK9A 3IF8B 5LYJE 2LKHA 1YQ3A 4YTMA 3AAAB 5BMVE 1NEKA 2V8SV 2XHEB 3VRBA 2HN2A 3PJAA 3PUAA 4C90A 3AA0B 4DV5T 2QRXA 2HHHT 1U5PA 2FUPA 4I4TE 2IAKA 5J1GA 2QVAA 2XQ6A 2M6BA 3CQXC 4CI1B 4YFSA 5ABFA 2UUBT 3B5MA 3L09A 1JNRA 4YSXA 3TLVA 1XNRT 5C8YE 3RKOA 3QOFA 3BQLA 5HXRA 3Q5EA 2WBLA 3UU8A 3P4QA 2KWIB 3IHRA 3UQ4A 1M7KA 3O1JA 3DTOA 2W67A 1N32T 3BQKA 3SS1A 3P4RA 4YLHA 3RQUA 3ESLA 4HWDA 4QH1A 4H9SE 3SOLA 3HKBE 3ZYKA 3HI2A 4P0BA 2CA5A 4YSYA 4ZOLE 5LG4A 2GK9A 3PUWF 3RIFA 1B7TA 5DJQC 4ANJA 4IE7A 3RLFF 3N9OA 4TZ4C 4PJMA 2MBGA 4QH5A 3JADA 4O4HE 3CKDA 2OV9A 2JMHA 2KMFA 1BR4A 3Q9DA 3SRZA 5CGMA 1HX8A 3U78A 2VKOA 3ANWA 3N9PA 4IE0A 5LMNT 1D0ZA 2UU9T 2ZMAA 2LE8A 4QXHB 2WDQA 4A56A 3LSVA 4X66T 4TWFA 2FJBA 3RGLA 4DR7T 5JRCB 4O2BE 3RYCE 2EHOC 3AAIA 5F8PA 2X66A 4ZZBA 3UT5E 2V7IA 1D0XA 3OPCA 3LBXA 5F3JA 2W4XA 1Y64B 4JI6T 3C51A 5FMNA 3K3NA 3UU4A 4DV4T 1XDPA 4IDNA 2JQQA 3NRYA 2C5JA 4GYRA 1OEDA 4QWNB 5CB4E 3Q5WA 4WW0A 2JIWA 2WMNA 4UR9A 3T1HT 4AKIA 2WM9A 1J5WA 4L0RA 4TN7B 2UXBT 2Q9QB 2ODVA 1FMVA 1KK7A 2BBJA 4IDPA 4JEHB 4ISTA 4ADZA 2E8IA 4HFHA 1GQEA 3EDUA 1J1JA 2UXDT 3NVOA 4F8HA 3LG7A 4DNDA 4U7YA 4LMLA 3RI5A 3CX7B 1E1HB 5KMGP 4DR5T 2CE7A 1LVFA 4K0UA 2KXPB 4UV9B 5LHIB 2CHNA 2JJ9A 2J62A 3ZMSB 3PJAJ 5KX5E 2X0YA 5JVDE 5ETWA 4UVBB 1OEDE 2XSBA 4YTNA 3AE5A 5LMUT 2W0GA 2XAGB 2YDQA 3AEDA 4LF7T 1MMGA 1T98A 4JI5T 3AXJA 2B76A 4IIJE 1ZEEA 3C50A 5FXZA 4XZCA 4DR1T 1MIVA 1QSDA 3LFMA 3P4SA 4GKJT 1N33T 4DV0T 1XWMA 4EEBA 2XQ4A 5JH7E 1FJGT 5CJ5A 3A8YC 2YK0A 3PE0A 4KI0F 3FZFB 3W15B 2BS2A 3UU5A 2DLRA 2QYWA 4TWHA 5LJMA 2PFVA 2W2UA 3AECA 3OVUA 4EXTA 4AQYT 3I1AA 2M67A 3ZC1A 1HNZT 4OYKA 4ZHQE 4OYJA 1XMQT 5AQHB 2XQ8A 2E9XD 4LMKA 3N2OA 2SPCA 1XDOA 4G63A 2XQ3A 2VB6A 2CCQA 4Z90A 4IDQA 1HG2A 4H9QC 4LFBT 2WQYA 2V1DB 3O4XE 3AVRA 1HFAA 1HX1B 2G0UA 3MKDA 5JDLA 4HFBA 3SFDA 3WAJA 3L3PA 5JQGE 1JNZA 3EAMA 1FMWA 5JR9C 2E5VA 2ZM8A 5FL1A 5LBMA 3GN5B 2ZM2A 5HWXA 4JI7T 3LDQB 3KV4A 4U7IA 1E7PA 4FJOA 4EZHA 2C5IT 3PDYA 5JDHA 1XNQT 1MMNA 4EV6A 3RC8A 5L2LA 4DR2T 3CQCB 3LJCA 1ZHCA 2ODUA 4XBFB 2RP4A 2AXDS 3H3MA 1YD8G 1T7SA 2NW7A 4CN1A 5L3BB 3X1DA 5KDMC 4MALA 5FVKA 4CXWA 4X1YE 4E7ZA 3ABVA 2LSKA 3AE3A 2AE9A 2FJEA 4ILCA 4U74A 1U4QA 1G73A 1VCSA 1ZV4X 4U72A 2X9HA 4LF4T 2J1DG 5LHHB 3O1HA 3ZPOA 3RHWA 3Q2MA 3UUMA 5DQWA 4I43B 1LKXA 2BG9C 2IC6A 5HEUA 5HEHA 4CI2B 3UUNA 3UUXB 2D0UA 3SWHA 1NAFA 5JDMA
chains in the Genus database with same CATH topology
1R8IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1R8I A; 
#chains in the Genus database with same CATH topology
 4EOZ B;  3OJA A;  3FBL A;  1IBM T;  2X0L B;  3EDV A;  3AAE B;  2MAW A;  2I59 A;  5HEJ A;  4O2A E;  4P09 A;  1OWA A;  4BA9 A;  2YDR A;  5FNV E;  4I55 E;  3H3A A;  4KUM B;  5LBQ B;  5J0Z A;  3IA3 A;  4ZI3 D;  2IC9 A;  3JC6 D;  3RIU C;  3KBU A;  3J9X 1;  4HFV A;  3F2E A;  5FKY A;  3PUR A;  3EVY A;  4EZ4 A;  1MMA A;  2PJQ A;  4DUY T;  5JR9 B;  2LSJ A;  3CML A;  5E0O A;  2KND A;  1NWM X;  3B57 A;  2D9D A;  4MLK A;  1SHZ C;  4NXN T;  2PBI A;  2VUR A;  4E7S A;  1O3X A;  3ZST A;  2VL0 A;  3F57 A;  2XSA A;  3LK2 B;  4LFA T;  2JPF A;  2WP9 A;  1I6Z A;  2CWO A;  5LJN A;  4IL9 A;  2KWH A;  1IZN B;  2CBJ A;  2RPA A;  3FB2 A;  4WYV A;  4Q25 A;  5LNK A;  3I0Q A;  5H6Q B;  4CN4 A;  4IE4 A;  3EHZ A;  2MYS A;  3SFE A;  4DV3 T;  3TLU A;  3EI0 A;  4GIW A;  3JAF A;  5FXW A;  4EIW A;  1IJ6 A;  4BJM A;  4NIQ A;  3PUV F;  1UX5 A;  3CX6 B;  4IT4 A;  4JI1 T;  4JI3 T;  2VQE T;  5ABH A;  4OHF A;  4HWC A;  1S94 A;  2Q9Q C;  2Y6X A;  3ZCI A;  5L3C B;  4ERR A;  3AA1 B;  4TV8 E;  2CXD A;  2WZI A;  3ZKR A;  4JBW F;  5LOV E;  2H88 A;  4ILA A;  1UUS A;  2BG9 B;  2IW5 B;  2V7M A;  4ZEY A;  4AIU A;  1D1C A;  3T1Y T;  2N2N A;  3KV9 A;  4L9I A;  5DQV A;  3RYF E;  4DMV A;  4TX5 A;  4G2A A;  3ONX A;  3K8P C;  1N34 T;  1FEW A;  3AA7 B;  4AXP A;  1KNP A;  4PK4 A;  2X67 A;  4HFE A;  1QLB A;  4UEL A;  2UXN B;  4OFZ A;  4DID B;  2YU2 A;  3HKC E;  2EHO A;  3VR9 A;  2V7K A;  3AE7 A;  5AQG B;  4EB6 E;  2QA7 A;  4IL4 A;  4U3C A;  3RX6 A;  4X64 T;  4B3T T;  3ZMT B;  4X20 E;  5H6R B;  4IE5 A;  4NXM T;  2VWA A;  2VVN A;  5AQT B;  4MFR A;  4UVC B;  2ZM0 A;  3C98 B;  2R6G F;  2IML A;  2L9Q A;  2CXF A;  4QKN A;  4DVD A;  5EK2 A;  3R84 B;  5JDN A;  5FXV A;  3RPU A;  2LSG A;  1HS7 A;  3ZMU B;  4HFC A;  4TNV A;  1US7 B;  2NOX A;  4PK6 A;  3N9M A;  4O4J E;  4IRE A;  1MMD A;  2E9X B;  4ILB A;  3NZP A;  3ZYL A;  3V5U A;  2W00 A;  3ZN1 B;  2KT9 A;  2V5C A;  3ZLI A;  3KDS E;  2BZB A;  2DWK A;  4H9O C;  4PAG A;  4QX8 B;  4A98 A;  2XUE A;  2XTL A;  2VKH A;  3WAK A;  3S4U A;  4LF6 T;  2YOE A;  1S35 A;  2N9D A;  1WR6 A;  4ZI3 C;  2V6Y B;  4X62 T;  3CWZ B;  3J7Y q;  2XQY A;  3JCF A;  2ZLY A;  4UF0 A;  4ILU A;  3N9L A;  4QXC B;  4OX9 T;  1Z0P A;  1HR0 T;  4H9R C;  5DAB A;  3GWH A;  3PUY F;  3V5S A;  1Z8U A;  1OED C;  4B3M T;  2LHR A;  2H89 A;  1SA0 E;  2XQ5 A;  3PUQ A;  5LB7 B;  5LGU B;  3NWI A;  5ABF B;  3AEG A;  3CPZ A;  4HEA A;  3NRX A;  4IGU A;  4AIS A;  4HGA A;  4HFD A;  2X0H A;  3P4P A;  3F31 A;  1V9D A;  1IBL T;  3PUX F;  2YKS A;  3TLW A;  3I9W A;  1KFY A;  1OXZ A;  4LFC T;  4I50 E;  2WWV A;  4IDZ A;  4BJN A;  2X9Y A;  3NBX X;  2CPT A;  2CMR A;  2BVM A;  3CQG B;  5FVL A;  5LGN B;  2A3D A;  2IIU A;  3M3Z B;  4OK0 A;  3BQI A;  3RH3 A;  3L8R A;  3HKD E;  2KIN B;  4CXX A;  2W66 A;  4A97 A;  1I94 T;  5EZY E;  2XAS B;  2HPL A;  3GA8 A;  1L0V A;  4Z8X A;  2IUB A;  1IJ5 A;  2BKO A;  2KZ7 B;  3KBT A;  3ZN0 B;  5LXT E;  5FY1 A;  3VHL A;  3UUB A;  4QH4 A;  4O8S A;  4X65 T;  3G06 A;  3FZM B;  4Z91 A;  3EAB A;  3MXZ A;  2DNX A;  3ANW B;  3D0T A;  4X1I E;  4X5T A;  2NW8 A;  1KNR A;  1D1B A;  2BKP A;  4DV7 T;  2YDS A;  4IHJ E;  3UFG A;  5AFU L;  2K5B B;  4DMW A;  2DWG A;  2PG8 A;  2CEA A;  1T72 A;  1J5E T;  4JI8 T;  3E08 A;  2K9A A;  5HCM A;  3LBX B;  3P4W A;  3ZEF B;  4ASK A;  2HH7 A;  3ONL C;  4PNI A;  4LMJ A;  4DR6 T;  2ES0 A;  3PTR B;  4DR3 T;  2X9X A;  5IYZ E;  4YSZ A;  4KP3 C;  1HNW T;  1OED B;  3IBP A;  4PJJ A;  4UXN B;  4EAH A;  1MIY A;  4ZS3 A;  2VQF T;  5FP3 A;  4UV8 B;  2V7L A;  3GMI A;  4UVA B;  5AQV B;  2UXC T;  2XAQ B;  5M4Y A;  1W09 A;  5AQK B;  4B3S T;  3ZCJ A;  1KF6 A;  3BK9 A;  5LCY A;  3RYI E;  3AEF A;  4CN6 A;  4NPP A;  1YW0 A;  3ZT6 A;  5IWA T;  5J2T E;  2YN6 A;  1CHU A;  2WDV A;  5J2U E;  2XQ9 A;  4MBQ A;  4JV5 T;  1WCR A;  2WU5 A;  4ISS A;  2BBH A;  3HR0 A;  2XAJ B;  1EZ3 A;  2LM2 A;  2N1G A;  2X68 A;  3N2K E;  5LP6 E;  5EK4 A;  2VAS A;  4J2C A;  2NP9 A;  2OA5 A;  3NZQ A;  3N5L A;  2EHO D;  4YJ3 E;  4L5G A;  3MJX A;  3EUH A;  5L4H A;  3A7M A;  4V1A v;  3QK6 A;  2LKG A;  2DI4 A;  5HYA A;  2LSI A;  2D0T A;  4AI6 A;  3PU3 A;  4H9P C;  1X9B A;  3AXJ B;  2XJ7 A;  5EK3 A;  4AQG A;  3FZK B;  5AQI B;  5FY0 A;  5FXX A;  5HCJ A;  5JRC A;  1CUN A;  4GK5 E;  3ZSS A;  3KVA A;  2V6X A;  1KNZ A;  4B3R T;  3K3Q C;  3DP7 A;  4HE8 A;  4U33 A;  5IHY A;  5FY7 A;  4MHC A;  5JDF A;  3IEE A;  4AQF C;  5BR8 T;  2VKD A;  3AEA A;  4ZI2 D;  2XPK A;  4LF9 T;  3H37 A;  2WWU A;  3N9Q A;  3HL6 A;  5JDG A;  2WMO A;  2IDO B;  2XM2 A;  3LK4 2;  4LF8 T;  2K24 A;  3NKZ A;  4COF A;  4JI4 T;  1VRB A;  2Y48 B;  4AKL A;  2V5D A;  3P50 A;  2LRL A;  3ZT5 A;  2BDE A;  2A72 A;  4YY3 T;  2CHO A;  1W0B A;  2Q9Q A;  3TLS A;  4ZS2 A;  4N78 D;  1BR0 A;  2CM0 A;  2NTY A;  2BS4 A;  4UIG A;  2E9X C;  4CXY A;  4TUY E;  3K1S A;  1WLX A;  1FIO A;  1D0Y A;  4H63 H;  2Z6E A;  4YT0 A;  3FZL B;  4KX6 A;  4H63 V;  2RA1 A;  5AQU B;  2BS3 A;  5CA1 E;  1SE7 A;  1HCI A;  1WFD A;  2E2A A;  3B13 A;  3K3O A;  4NUV A;  5C2T A;  4JI2 T;  1WYB A;  3OYX A;  2WZH A;  5AQN B;  4DO0 A;  1BR1 A;  4CI3 B;  5JDQ A;  2IHR 1;  1UK5 A;  1HF8 A;  3RRC A;  4HWI B;  4KBM B;  4PFP A;  2JQ9 A;  4ZZC A;  2LT3 A;  3RRW A;  5C3J A;  3MZK B;  3TKL B;  5L3G B;  1UGO A;  2V26 A;  5HEG A;  2E5L T;  4GK0 E;  4U2Y A;  2DHR A;  3TLT A;  1YQ4 A;  1MIW A;  4PFO A;  1LRZ A;  3AE1 A;  4KHP T;  2OLT A;  2W63 A;  4CZZ B;  1YKH B;  2DL1 A;  2XQA A;  2JQH A;  3OYZ A;  4JLE A;  3Q5D A;  2BKN A;  3UTK A;  2LEH A;  4QHO A;  2CXL A;  1W9R A;  5ABE A;  1YKE B;  2WSS V;  4GKK T;  2VL8 A;  1XMO T;  2WDR A;  4EED A;  5AQO B;  2CLY B;  2ACZ A;  1E2A A;  3QC9 A;  2HN1 A;  3CVR A;  4DV1 T;  4U2Z A;  2WCA A;  2LHN A;  5AQF B;  5IUX A;  5KXJ A;  2H7O A;  3MK7 C;  1LVK A;  4AKG A;  5HXC A;  3ZT7 A;  5HAX A;  3C4X A;  2YU1 A;  1SUM B;  5LGT B;  2B1E A;  4PJN A;  4QX7 B;  2LLY A;  3RC3 A;  2JQK A;  3ETV A;  4WNK A;  1KEY A;  2KLQ A;  4A5X A;  3QUJ A;  5TAO A;  4QXB B;  5ADX L;  1NEN A;  3RQW A;  5AQJ B;  4NUU A;  1HNX T;  4O4I E;  4GYS A;  4KHZ F;  5GON E;  3L39 A;  4EYY R;  3FZH B;  4HFI A;  5AQS B;  4DV2 T;  4YJ2 E;  4HN9 A;  2WAU A;  3VU7 H;  3GN5 A;  2W62 A;  3VR8 A;  2XAF B;  3ONJ A;  1MNE A;  5FL0 A;  4JUY A;  1AJ3 A;  4EGW A;  2H3R A;  3UU6 A;  3AB3 B;  3CIR A;  4PJL A;  2PTF A;  3JC6 C;  5HXE A;  3OKQ A;  5L3F B;  4IE6 A;  3ZYM A;  1Y01 A;  1T8B A;  2CRB A;  1VCT A;  4XAX B;  4B6X A;  3KFW X;  4AKR B;  4ZI2 C;  2YIN A;  3N9N A;  2HPJ A;  4AKH A;  2MTQ A;  3U3I A;  4H9N C;  2LM9 A;  2WU2 A;  3I0O A;  3AA6 B;  3FXE B;  5LA6 E;  1ZOY A;  2WY2 A;  2M6I A;  1G8X A;  2LSY A;  2ACX A;  2FJA A;  3E0Z A;  1VOM A;  2CWY A;  4GOU A;  2JRK A;  3RIA A;  4DBQ A;  3N2G E;  3QB5 K;  4IDO A;  4FI5 A;  2WB5 A;  3PUZ F;  4LF5 T;  2BVL A;  3P8C D;  1N36 T;  1HTJ F;  3ZMV B;  2QGS A;  3KV5 A;  4TV9 E;  2UXX B;  2UUA T;  4HWH A;  4P0A A;  2D2S A;  2MOZ A;  4O4L E;  4DUZ T;  1X79 A;  2ZM6 T;  3HKE E;  2LOP A;  4UEM A;  3AEB A;  3O1I A;  2CBI A;  2FJD A;  2A9U A;  3KV6 A;  3AE4 A;  2W61 A;  5JRE A;  5L47 A;  2JMK A;  2WS3 A;  2XZE A;  4PK5 A;  3C4W A;  2EHO B;  1QUU A;  3HA4 A;  4DBR A;  3FXD B;  2I6H A;  3T8O A;  3FHN A;  3ETU A;  3PU8 A;  1WYC A;  2DCF A;  5JR9 A;  4TNW A;  2L8K A;  3AE8 A;  3ZC0 A;  3FBZ A;  3C4Z A;  4F6R C;  5AQP B;  3ZJ1 A;  3AE6 A;  3M65 A;  5ABG A;  4X1K E;  5LHG B;  1IBK T;  3UUL A;  4KMC A;  4TWD A;  4HKA A;  3LK3 B;  2K48 A;  1XZY A;  1YXR A;  5CA0 E;  3AVS A;  3RYH E;  4HTE A;  1ZP0 A;  5HXH A;  2A2F X;  2KSR A;  2Q9Q D;  2J4G A;  3PV0 F;  3QNU A;  3VKG A;  4ZI7 E;  3UU3 A;  5LG3 A;  2I0M A;  4C91 A;  4WZX A;  1D1A A;  5FYM A;  3DJB A;  3RF1 A;  2XQ7 A;  3Q5X A;  2X51 A;  4JEU B;  2UUC T;  3CK6 A;  4DR4 T;  5F5W A;  2V7J A;  2C5K T;  3UFE A;  4CQI A;  2BG9 A;  3VKH A;  3ZJ2 A;  1UCU A;  4UF0 B;  4WBO A;  3AE9 A;  5CFB A;  3P7I A;  3R6N A;  2NTX A;  3KIN B;  2X9W A;  1R8I A;  3PUS A;  4HWF A;  5L3D B;  4YHJ A;  3WI3 A;  2NR4 A;  3OBV E;  4ZXL A;  2LOS A;  4M1P A;  1UUR A;  4PW8 A;  1M62 A;  2H7V C;  1DU2 A;  1W0A A;  3C64 A;  2P9B A;  5JTG A;  5L3E B;  2L3L A;  4JI0 T;  4P1N A;  3O9X A;  3RIU A;  2J47 A;  5L4E A;  4EYU A;  3CX8 B;  3I9Y A;  4DV6 T;  3UQ7 A;  2C0S A;  3PUG A;  3MAC A;  4AQF A;  3VRA A;  3AE2 A;  4JYA T;  1H7C A;  3A5X A;  3ZMZ B;  3KVB A;  2BG9 E;  3QB5 A;  2XY8 B;  1WRD A;  1BR2 A;  2XAH B;  4I0U A;  2NW9 A;  2D5U A;  2CLY C;  3RKG A;  2Y8D A;  2VKJ A;  2K3W A;  4YXD A;  3MA9 A;  5AQQ B;  1WR0 A;  1HG5 A;  2LRK A;  2E9X A;  5HXS A;  3E22 E;  2MPK A;  4K0K T;  5AQR B;  5AQL B;  5HWY A;  5AQM B;  3OTO T;  4BAY B;  4WBN E;  1IAP A;  2F4V T;  4YHH T;  1MND A;  2LJL A;  5HEO A;  2FBW A;  3AEE A;  2VVS A;  2XM1 A;  4U31 A;  5A1L A;  2YEV C;  3JAE A;  1ZKE A;  1UX4 A;  4YTP A;  2NWB A;  2V6Y A;  2VK9 A;  3IF8 B;  5LYJ E;  2LKH A;  1YQ3 A;  4YTM A;  3AAA B;  5BMV E;  1NEK A;  2V8S V;  2XHE B;  3VRB A;  2HN2 A;  3PJA A;  3PUA A;  4C90 A;  3AA0 B;  4DV5 T;  2QRX A;  2HHH T;  1U5P A;  2FUP A;  4I4T E;  2IAK A;  5J1G A;  2QVA A;  2XQ6 A;  2M6B A;  3CQX C;  4CI1 B;  4YFS A;  5ABF A;  2UUB T;  3B5M A;  3L09 A;  1JNR A;  4YSX A;  3TLV A;  1XNR T;  5C8Y E;  3RKO A;  3QOF A;  3BQL A;  5HXR A;  3Q5E A;  2WBL A;  3UU8 A;  3P4Q A;  2KWI B;  3IHR A;  3UQ4 A;  1M7K A;  3O1J A;  3DTO A;  2W67 A;  1N32 T;  3BQK A;  3SS1 A;  3P4R A;  4YLH A;  3RQU A;  3ESL A;  4HWD A;  4QH1 A;  4H9S E;  3SOL A;  3HKB E;  3ZYK A;  3HI2 A;  4P0B A;  2CA5 A;  4YSY A;  4ZOL E;  5LG4 A;  2GK9 A;  3PUW F;  3RIF A;  1B7T A;  5DJQ C;  4ANJ A;  4IE7 A;  3RLF F;  3N9O A;  4TZ4 C;  4PJM A;  2MBG A;  4QH5 A;  3JAD A;  4O4H E;  3CKD A;  2OV9 A;  2JMH A;  2KMF A;  1BR4 A;  3Q9D A;  3SRZ A;  5CGM A;  1HX8 A;  3U78 A;  2VKO A;  3ANW A;  3N9P A;  4IE0 A;  5LMN T;  1D0Z A;  2UU9 T;  2ZMA A;  2LE8 A;  4QXH B;  2WDQ A;  4A56 A;  3LSV A;  4X66 T;  4TWF A;  2FJB A;  3RGL A;  4DR7 T;  5JRC B;  4O2B E;  3RYC E;  2EHO C;  3AAI A;  5F8P A;  2X66 A;  4ZZB A;  3UT5 E;  2V7I A;  1D0X A;  3OPC A;  3LBX A;  5F3J A;  2W4X A;  1Y64 B;  4JI6 T;  3C51 A;  5FMN A;  3K3N A;  3UU4 A;  4DV4 T;  1XDP A;  4IDN A;  2JQQ A;  3NRY A;  2C5J A;  4GYR A;  1OED A;  4QWN B;  5CB4 E;  3Q5W A;  4WW0 A;  2JIW A;  2WMN A;  4UR9 A;  3T1H T;  4AKI A;  2WM9 A;  1J5W A;  4L0R A;  4TN7 B;  2UXB T;  2Q9Q B;  2ODV A;  1FMV A;  1KK7 A;  2BBJ A;  4IDP A;  4JEH B;  4IST A;  4ADZ A;  2E8I A;  4HFH A;  1GQE A;  3EDU A;  1J1J A;  2UXD T;  3NVO A;  4F8H A;  3LG7 A;  4DND A;  4U7Y A;  4LML A;  3RI5 A;  3CX7 B;  1E1H B;  5KMG P;  4DR5 T;  2CE7 A;  1LVF A;  4K0U A;  2KXP B;  4UV9 B;  5LHI B;  2CHN A;  2JJ9 A;  2J62 A;  3ZMS B;  3PJA J;  5KX5 E;  2X0Y A;  5JVD E;  5ETW A;  4UVB B;  1OED E;  2XSB A;  4YTN A;  3AE5 A;  5LMU T;  2W0G A;  2XAG B;  2YDQ A;  3AED A;  4LF7 T;  1MMG A;  1T98 A;  4JI5 T;  3AXJ A;  2B76 A;  4IIJ E;  1ZEE A;  3C50 A;  5FXZ A;  4XZC A;  4DR1 T;  1MIV A;  1QSD A;  3LFM A;  3P4S A;  4GKJ T;  1N33 T;  4DV0 T;  1XWM A;  4EEB A;  2XQ4 A;  5JH7 E;  1FJG T;  5CJ5 A;  3A8Y C;  2YK0 A;  3PE0 A;  4KI0 F;  3FZF B;  3W15 B;  2BS2 A;  3UU5 A;  2DLR A;  2QYW A;  4TWH A;  5LJM A;  2PFV A;  2W2U A;  3AEC A;  3OVU A;  4EXT A;  4AQY T;  3I1A A;  2M67 A;  3ZC1 A;  1HNZ T;  4OYK A;  4ZHQ E;  4OYJ A;  1XMQ T;  5AQH B;  2XQ8 A;  2E9X D;  4LMK A;  3N2O A;  2SPC A;  1XDO A;  4G63 A;  2XQ3 A;  2VB6 A;  2CCQ A;  4Z90 A;  4IDQ A;  1HG2 A;  4H9Q C;  4LFB T;  2WQY A;  2V1D B;  3O4X E;  3AVR A;  1HFA A;  1HX1 B;  2G0U A;  3MKD A;  5JDL A;  4HFB A;  3SFD A;  3WAJ A;  3L3P A;  5JQG E;  1JNZ A;  3EAM A;  1FMW A;  5JR9 C;  2E5V A;  2ZM8 A;  5FL1 A;  5LBM A;  3GN5 B;  2ZM2 A;  5HWX A;  4JI7 T;  3LDQ B;  3KV4 A;  4U7I A;  1E7P A;  4FJO A;  4EZH A;  2C5I T;  3PDY A;  5JDH A;  1XNQ T;  1MMN A;  4EV6 A;  3RC8 A;  5L2L A;  4DR2 T;  3CQC B;  3LJC A;  1ZHC A;  2ODU A;  4XBF B;  2RP4 A;  2AXD S;  3H3M A;  1YD8 G;  1T7S A;  2NW7 A;  4CN1 A;  5L3B B;  3X1D A;  5KDM C;  4MAL A;  5FVK A;  4CXW A;  4X1Y E;  4E7Z A;  3ABV A;  2LSK A;  3AE3 A;  2AE9 A;  2FJE A;  4ILC A;  4U74 A;  1U4Q A;  1G73 A;  1VCS A;  1ZV4 X;  4U72 A;  2X9H A;  4LF4 T;  2J1D G;  5LHH B;  3O1H A;  3ZPO A;  3RHW A;  3Q2M A;  3UUM A;  5DQW A;  4I43 B;  1LKX A;  2BG9 C;  2IC6 A;  5HEU A;  5HEH A;  4CI2 B;  3UUN A;  3UUX B;  2D0U A;  3SWH A;  1NAF A;  5JDM A; 
#chains in the Genus database with same CATH homology
 1R8I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...