1R8IA

Crystal structure of trac
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
187
structure length
187
Chain Sequence
TELIKQGEQLEQMAQQLEQLKSQLETQKNMYESMAKTTNLGDLLGTSTNTLANNLPDNWKEVYSDAMNSSSSVTPSVNSMMGQFNAEVDDMTPSEAIAYMNKKLAEKGAYDRVMAEKAYNNQMQELSDMQALTEQIKSTPDLKSIADLQARIQTSQGAIQGEQAKLNLMNMLQQSQDKLLRAQKDRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and functional characterization of the VirB5 protein from the type IV secretion system encoded by the conjugative plasmid pKM101
pubmed doi rcsb
source organism Escherichia coli
molecule tags Structural protein
molecule keywords TraC
total genus 70
structure length 187
sequence length 187
ec nomenclature
pdb deposition date 2003-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07996 T4SS Type IV secretion system proteins
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.430 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Type IV secretion system, VirB5-domain 1r8iA00
1R8IA
chains in the Genus database with same CATH superfamily
5L3CB 2XQ8A 5F3JA 2JMHA 1YKEB 3UUNA 4C91A 4LF7T 1DU2A 3JAEA 2W61A 4ISSA 1HCIA 2W66A 3GMIA 4TZ4C 4UVBB 3TLVA 3SRZA 4U72A 3TLWA 2QVAA 3ZJ2A 1T98A 2CE7A 2W4XA 3DP7A 3W15B 3ETVA 4DR7T 1GQEA 1LRZA 2V7MA 2X0HA 2R6GF 3P7IA 4O4HE 2LHNA 5LBQB 4ASKA 4CI2B 3O1HA 5HYAA 5LGUB 5J2TE 4DV5T 4IL4A 2C5IT 2EHOC 3B13A 3HKEE 2A9UA 2ES0A 2YEVC 1W0AA 1ZP0A 2ZMAA 4JYAT 3AE4A 4CZZB 4AKGA 2XQ6A 4DV3T 4H63V 4O2BE 5LYJE 4XBFB 4MLKA 2A72A 5FYMA 3Q9DA 4ZZCA 2QGSA 1XZYA 2M6IA 3FXEB 2VQET 5LNKA 1IBKT 3SOLA 2JJ9A 1HX1B 2V26A 2UXBT 1D1AA 2LLYA 4I55E 1SUMB 4U3CA 2BG9C 4X1IE 2PBIA 4LF8T 5ABEA 4JI3T 3B57A 4Q25A 5AQPB 5L2LA 2K48A 2DLRA 5JDFA 3TLUA 3CKDA 4UIGA 2X0YA 2X66A 4E7SA 2MAWA 1CUNA 2LSGA 2V7KA 2LM2A 3BQIA 4HWCA 4JLEA 2BS2A 2VL8A 4U7IA 2EHOD 2LE8A 2PG8A 4HKAA 3FBLA 3ZMSB 4HEAA 3SFDA 4DR6T 4HFHA 1UCUA 2DHRA 3PTRB 3N2KE 1KF6A 4QXCB 2WAUA 5E0OA 5CA0E 2DCFA 3CWZB 3IHRA 3F57A 2D2SA 2E5LT 4JEUB 4UF0A 4AQFC 4NXMT 2RPAA 5FL0A 4HFEA 5DQVA 4DR5T 3ZEFB 4LF5T 3ETUA 3ZMTB 2XM2A 2YDSA 2DNXA 2ZM0A 3O1IA 4LMJA 2I6HA 5L4HA 3UT5E 5EZYE 3PU8A 5C2TA 2CWOA 2NR4A 2W0GA 3AAAB 5AQVB 5A1LA 1HS7A 4EXTA 4GYRA 2XQYA 2KWIB 3CX6B 3I9WA 4G63A 5CB4E 4I0UA 2FBWA 3MA9A 1WLXA 1Y01A 3I0QA 3UFGA 2JMKA 4YFSA 5HEOA 5H6RB 2WDRA 5JR9A 4QXBB 1N33T 5EK4A 4JUYA 5AQQB 2DWGA 3FZHB 3MXZA 3QC9A 3J9X1 3RYHE 2RA1A 3LBXA 1BR4A 2CLYC 3NZQA 4K0KT 3KVBA 4QH1A 2JQKA 3ANWA 5J1GA 1G73A 2P9BA 3PJAJ 2N1GA 2VL0A 3C98B 3C50A 2YINA 1FMVA 1H7CA 4C90A 1WR0A 4YLHA 3UFEA 2NTXA 1J5ET 2X9HA 1OEDE 2V1DB 2VKHA 4A97A 5LHHB 4EIWA 4TWFA 3CMLA 5LMNT 1U5PA 2E2AA 2W67A 4PNIA 2JQQA 3IA3A 1MNDA 5L3FB 3T1HT 1KNZA 3ZMVB 2WBLA 4H9SE 1UX4A 2LKHA 5CJ5A 5ABFA 4JI6T 3ZSTA 2YU1A 4QHOA 4LF9T 2PJQA 4YT0A 1D0ZA 2N9DA 3A8YC 4ZEYA 3KV9A 4TNWA 2X68A 2CA5A 1LVKA 2V6YA 4UV8B 3N9MA 4ADZA 2WU5A 3PU3A 2V6XA 4YJ2E 5H6QB 1D0YA 1SE7A 3UU5A 1VRBA 5CFBA 4H9QC 4KP3C 2XQ4A 3L39A 2Y48B 4UELA 4A5XA 3R84B 3AECA 3FB2A 3OYZA 3QOFA 3B5MA 4H9NC 3K8PC 3PUZF 2UXNB 3Q5DA 1EZ3A 3NKZA 4IDZA 4ILBA 4KUMB 3ZCIA 5HXEA 4AQGA 5KDMC 5F8PA 2UUBT 3EHZA 4JI4T 2LKGA 2ZM8A 5FL1A 1E7PA 2C5JA 3VR9A 2XY8B 2WY2A 4ZI3C 3RKOA 1ZKEA 4ZS2A 1XMOT 4AISA 2WSSV 2MOZA 2CEAA 2LJLA 1US7B 4L9IA 2NW7A 4UV9B 5FY1A 3LK2B 2KT9A 3NZPA 4ILCA 2X9WA 3C4WA 4KI0F 3ZT5A 3E08A 1X9BA 2VKOA 1SA0E 3C64A 3A7MA 2X67A 2VB6A 2VK9A 3GA8A 3KDSE 5J2UE 5L3DB 2UXCT 4EYYR 2XPKA 5AQFB 2JIWA 3MKDA 4PFPA 3U78A 4HWHA 1FIOA 5IUXA 3OJAA 5FXZA 5JRCB 3RX6A 1B7TA 1LVFA 3AB3B 3O9XA 2V5DA 3RYCE 2NTYA 4GYSA 5CA1E 4AXPA 4BAYB 3ZLIA 2NW8A 3AA1B 3DJBA 2CMRA 3NVOA 3RYIE 2G0UA 5LB7B 4PJJA 1N36T 1W0BA 4OX9T 3AA6B 2DI4A 3GN5A 4HWDA 4HFDA 5ABGA 1KEYA 3ZYMA 1OEDB 5LP6E 3ZMZB 2JQ9A 1D0XA 4TN7B 2WU2A 4HFBA 4UF0B 5JR9C 4NUVA 2X9XA 2E9XB 1L0VA 2NOXA 3HI2A 2ZM6T 2N2NA 3P4QA 2CBJA 4WBOA 4CXWA 4H9RC 5FY0A 3PUQA 2X9YA 2WM9A 4JI7T 2EHOA 3I9YA 3EUHA 1NWMX 3JCFA 4XAXB 2FUPA 4X1KE 3TLSA 4B3TT 3OVUA 2KZ7B 2BG9B 2LSYA 4TV9E 3SWHA 5ABHA 3AE5A 4B6XA 4K0UA 1ZEEA 1WCRA 3AAEB 1HG5A 4X65T 2L9QA 3FZMB 3UUMA 3VKHA 1XWMA 4KX6A 2KINB 1HNXT 4P1NA 3MK7C 3CK6A 5HCJA 2VVNA 3LSVA 2H7VC 3AE1A 4LMKA 5L3GB 2ZLYA 1V9DA 2L3LA 3HKDE 3K1SA 3BQLA 4AQYT 3P4SA 3EAMA 3KVAA 4O2AE 1KNPA 3N9PA 2BVLA 3TLTA 2Q9QD 2V7JA 5JRCA 3FHNA 2CHNA 1AJ3A 3ZN0B 4AIUA 4AKHA 4NPPA 2W62A 2XM1A 3CX7B 4E7ZA 1Y64B 4YTPA 2ACXA 3AE8A 2PTFA 1KNRA 2CXFA 2XQ5A 3H3AA 4TV8E 5CGMA 1G8XA 3AEBA 2M6BA 4HFIA 3OPCA 2EHOB 4L0RA 1XDOA 1MMGA 4ZI7E 4HFVA 2V7LA 3ABVA 1UURA 4G2AA 3C4ZA 1YW0A 2WWVA 3CX8B 5AQLB 5AQGB 5ADXL 1LKXA 2LSJA 3UQ4A 2V5CA 2WB5A 3LJCA 4COFA 2UU9T 2YU2A 5AQJB 5FVKA 4LFBT 2BKPA 2XQ7A 3LG7A 3P8CD 4O8SA 5FP3A 2XUEA 5HWYA 5LBMA 4EAHA 2C0SA 4X62T 3FZFB 5AQUB 4IDPA 2Y8DA 2HPJA 1VOMA 2VVSA 1ZHCA 2JQHA 2BS3A 4M1PA 3Q5WA 2LEHA 4GKJT 3VU7H 2A2FX 2QRXA 3G06A 5DJQC 1MIVA 2LOPA 4QXHB 4TWDA 3VHLA 4CI1B 1XNRT 2E9XA 4DR1T 3M3ZB 4TUYE 5FNVE 1HR0T 3HR0A 4CN4A 3K3QC 2ODUA 3KV4A 2AE9A 4OK0A 5HAXA 4X66T 3R6NA 4CXXA 1ZOYA 3P4RA 2YK0A 3L09A 3P50A 3RH3A 5JDMA 1IJ5A 4PK4A 1FMWA 4HE8A 3MACA 3UU8A 3PUSA 3RRCA 5JDNA 4DV2T 3MZKB 5J0ZA 5HXSA 1WYCA 1WRDA 5ABFB 3EDUA 4CXYA 2BVMA 2XAGB 2MYSA 3RQUA 3P4WA 4HTEA 3H37A 4U74A 4ZXLA 4EGWA 2YDQA 2YN6A 3I0OA 3OKQA 4N78D 3PV0F 5F5WA 3AEAA 4AKLA 2K3WA 2FJBA 2KXPB 1XNQT 2I59A 2WZIA 3LDQB 3PUGA 4QWNB 3ZSSA 1U4QA 2VKDA 5JDHA 3WAJA 4KBMB 5JREA 3SFEA 4ZZBA 1T8BA 2XAHB 3K3OA 1T7SA 3KV5A 4OYKA 3DTOA 4BJMA 3EI0A 4IE0A 5IYZE 2LSKA 5AQTB 2IC6A 3FBZA 4A98A 4AQFA 2HN1A 1IAPA 4LF4T 2BDEA 2LT3A 2VURA 2X0LB 4HFCA 5C3JA 4B3MT 4ANJA 4F8HA 3N9NA 3QK6A 4KMCA 5L47A 2HH7A 4NIQA 4P09A 4ZHQE 2BZBA 1T72A 4LMLA 5AQIB 5IWAT 2WMNA 3RIUC 4V1Av 4ZI2D 4UXNB 4ZS3A 4ZI3D 2W2UA 2MTQA 1MMDA 1UK5A 5LGTB 1KK7A 3ZT7A 2XHEB 4HWFA 2B1EA 5BR8T 2K24A 3PUWF 5LHIB 2D0TA 2Q9QC 5L3EB 3UU6A 2ZM2A 5LA6E 1YQ3A 4DR3T 3RPUA 2AXDS 2WWUA 3FZKB 3N9QA 5GONE 4PAGA 4CI3B 3J7Yq 3AXJA 3LK3B 3N5LA 4EV6A 4U2ZA 3HKCE 4QH5A 4AKRB 4U31A 4JI2T 4ZOLE 2UXXB 2K5BB 4UVAB 1MIWA 2H89A 2OA5A 1NENA 2BKOA 4X5TA 3KBUA 1O3XA 5HXCA 2J47A 5IHYA 4QX7B 5HCMA 2BS4A 4JBWF 1S94A 4WNKA 5JQGE 3N9LA 4X20E 2XAJB 2QYWA 1YXRA 2XZEA 3RIAA 4XZCA 4DV7T 1I6ZA 1HFAA 1Z8UA 4EZHA 2D9DA 3N2GE 4IIJE 4Z91A 5ETWA 2IMLA 4WBNE 1HTJF 1W09A 2CLYB 3U3IA 5LMUT 3IBPA 4TNVA 5AQOB 4EYUA 4EZ4A 4IREA 4EEBA 4H63H 3ZKRA 1JNRA 2LOSA 4WZXA 3PUYF 2VQFT 3RYFE 3FZLB 5LXTE 2E9XC 3RRWA 3EABA 2CM0A 2HPLA 4YJ3E 5FXVA 2M67A 5HEGA 5TAOA 4F6RC 2IHR1 4GIWA 4O4JE 5FY7A 3PJAA 2LRKA 3QB5K 1N32T 3RIFA 5HEJA 3ZCJA 2H3RA 5KXJA 2KMFA 4IE7A 1ZV4X 2Z6EA 2YOEA 2E9XD 3LBXB 4Z8XA 3QNUA 1D1CA 2BBJA 2SPCA 1CHUA 3AE6A 5JDLA 4PK6A 1BR2A 4DVDA 4KHPT 3BK9A 1S35A 4PJNA 4U2YA 3UTKA 4L5GA 2FJDA 3JADA 3ZJ1A 4IT4A 2XTLA 4CN1A 2WMOA 3JAFA 4DMWA 3BQKA 2YDRA 2LSIA 1I94T 1NAFA 2DL1A 2GK9A 3FXDB 3AA7B 3GWHA 4LFAT 5JDGA 3MJXA 4DV1T 2IUBA 3CQXC 3C4XA 3K3NA 1OEDC 4DV4T 2F4VT 2WDQA 4MHCA 4U33A 2CRBA 2I0MA 3S4UA 3VRBA 5BMVE 1M62A 4X1YE 4FI5A 5LG3A 4DV0T 1Z0PA 1XMQT 5HWXA 5AQSB 1X79A 4AI6A 4HGAA 4LF6T 2WP9A 2XASB 1HNZT 3LK42 5LHGB 2J4GA 2H88A 3WI3A 2Q9QA 1XDPA 1UGOA 2B76A 3AE3A 5JDQA 1OWAA 2H7OA 4GK0E 5JH7E 2J62A 2NW9A 3H3MA 1FEWA 3ANWB 5HEHA 4MALA 4PFOA 2BKNA 3KV6A 2Q9QB 4YTMA 5FVLA 3RF1A 2XQAA 4FJOA 3RGLA 4DIDB 4YHHT 4GK5E 1OXZA 2LM9A 4YTNA 5LCYA 1VCSA 2XAQB 2PFVA 3OYXA 4LFCT 5FMNA 4A56A 4CN6A 4ZI2C 4ILUA 4JV5T 2JPFA 2VASA 4JEHB 1M7KA 3X1DA 4WYVA 3HL6A 2KSRA 5LGNB 4P0AA 4GKKT 4YY3T 1IJ6A 1HX8A 1BR0A 1NEKA 2IAKA 3AVSA 5LG4A 4DO0A 4QH4A 3WAKA 4QX8B 1W9RA 3AEFA 5DQWA 3D0TA 2CHOA 2K9AA 3LFMA 5FXWA 2MBGA 3UU4A 4DBQA 3JC6D 3RI5A 2MPKA 3I1AA 3AVRA 3V5SA 5LJNA 1D1BA 1OEDA 3NBXX 4TX5A 3SS1A 1N34T 1HF8A 3CIRA 3RQWA 3NWIA 2CWYA 1JNZA 3C51A 3GN5B 4PJLA 1R8IA 3UU3A 3VRAA 2HHHT 5FXXA 3RIUA 4NXNT 4JI1T 2QA7A 2W63A 3VKGA 2CCQA 4P0BA 5JVDE 2BG9E 3JC6C 2HN2A 3PUXF 2BBHA 5HXRA 4JI5T 4B3RT 3KBTA 4DNDA 5L4EA 3AE2A 4UR9A 4OYJA 4MFRA 3F2EA 4DR4T 3AE9A 1MMAA 1E2AA 2W00A 4HWIB 4WW0A 3UUXB 4DV6T 1QUUA 1VCTA 1MNEA 2NWBA 5EK2A 4PK5A 4PW8A 3NRYA 4EEDA 2A3DA 4IHJE 3ZYLA 3PUAA 4ILAA 3ZC0A 5FKYA 5HXHA 3RKGA 4EOZB 1HNWT 3CVRA 2C5KT 2J1DG 2YKSA 3PUVF 1WYBA 2WCAA 5AQKB 3UUBA 4JI0T 4IGUA 2L8KA 1BR1A 4OFZA 1QLBA 3HKBE 3E0ZA 4I4TE 4IDQA 4O4LE 2RP4A 3ZPOA 2OV9A 3RHWA 4H9OC 2Y6XA 4J2CA 1IBMT 4AKIA 2ODVA 1MMNA 2UUCT 3AEGA 4Z90A 1SHZC 5LOVE 5AQRB 3ZMUB 5LJMA 4TWHA 2CXLA 3EVYA 1UX5A 3A5XA 4QKNA 5C8YE 4YXDA 2VKJA 3L8RA 3PDYA 1YQ4A 3QUJA 2WQYA 2ACZA 3UQ7A 4UVCB 2KNDA 4OHFA 3HA4A 4U7YA 2UXDT 3ONJA 3V5UA 2LRLA 3P4PA 2IIUA 2XQ3A 5AFUL 3ESLA 4I50E 3CPZA 4H9PC 2E8IA 2IW5B 2CBIA 2JRKA 2D5UA 2V8SV 3ZN1B 3O1JA 3AE7A 1HG2A 4BJNA 3PE0A 2E5VA 2KWHA 2VWAA 2IC9A 4BA9A 1IZNB 5JR9B 4IDNA 5L3BB 1FJGT 2D0UA 4I43B 5KX5E 3RC8A 3ZYKA 3T1YT 2CPTA 2XQ9A 1KFYA 3AEDA 4KHZF 3VR8A 2WS3A 4ERRA 2OLTA 1YKHB 2V7IA 2LHRA 4IL9A 3RC3A 5JTGA 4YSZA 3ZT6A 5AQMB 3T8OA 3TKLB 3RLFF 2FJAA 3AEEA 4MBQA 1YD8G 4NUUA 4HN9A 5EK3A 4DMVA 4DR2T 2NP9A 3E22E 2DWKA 4UEMA 5DABA 5HEUA 3N2OA 3N9OA 4IE4A 3AA0B 4EB6E 4YSXA 1IBLT 3EDVA 3L3PA 2XSBA 2BG9A 1QSDA 2X51A 4DUZT 2FJEA 3ONXA 4ISTA 3OTOT 3F31A 2KLQA 4CQIA 4DUYT 4YSYA 4B3ST 2XJ7A 3Q2MA 5AQNB 1UUSA 3ZC1A 4JI8T 1WFDA 3CQGB 2UUAT 2XAFB 1J5WA 1WR6A 3OBVE 4IE5A 3ONLC 4O4IE 4DBRA 2WZHA 3M65A 4GOUA 3IF8B 4IDOA 4YHJA 3KINB 3UULA 3PURA 5M4YA 4PJMA 2CXDA 3KFWX 3Q5EA 2V6YB 3NRXA 3AXJB 3AAIA 3CQCB 3O4XE 4IE6A 1E1HB 1MIYA 5AQHB 1J1JA 2IDOB 5KMGP 4X64T 3QB5A 3Q5XA 2WDVA 2XSAA 3IEEA
chains in the Genus database with same CATH topology
1R8IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1R8I A; 
#chains in the Genus database with same CATH topology
 5L3C B;  2XQ8 A;  5F3J A;  2JMH A;  1YKE B;  3UUN A;  4C91 A;  4LF7 T;  1DU2 A;  3JAE A;  2W61 A;  4ISS A;  1HCI A;  2W66 A;  3GMI A;  4TZ4 C;  4UVB B;  3TLV A;  3SRZ A;  4U72 A;  3TLW A;  2QVA A;  3ZJ2 A;  1T98 A;  2CE7 A;  2W4X A;  3DP7 A;  3W15 B;  3ETV A;  4DR7 T;  1GQE A;  1LRZ A;  2V7M A;  2X0H A;  2R6G F;  3P7I A;  4O4H E;  2LHN A;  5LBQ B;  4ASK A;  4CI2 B;  3O1H A;  5HYA A;  5LGU B;  5J2T E;  4DV5 T;  4IL4 A;  2C5I T;  2EHO C;  3B13 A;  3HKE E;  2A9U A;  2ES0 A;  2YEV C;  1W0A A;  1ZP0 A;  2ZMA A;  4JYA T;  3AE4 A;  4CZZ B;  4AKG A;  2XQ6 A;  4DV3 T;  4H63 V;  4O2B E;  5LYJ E;  4XBF B;  4MLK A;  2A72 A;  5FYM A;  3Q9D A;  4ZZC A;  2QGS A;  1XZY A;  2M6I A;  3FXE B;  2VQE T;  5LNK A;  1IBK T;  3SOL A;  2JJ9 A;  1HX1 B;  2V26 A;  2UXB T;  1D1A A;  2LLY A;  4I55 E;  1SUM B;  4U3C A;  2BG9 C;  4X1I E;  2PBI A;  4LF8 T;  5ABE A;  4JI3 T;  3B57 A;  4Q25 A;  5AQP B;  5L2L A;  2K48 A;  2DLR A;  5JDF A;  3TLU A;  3CKD A;  4UIG A;  2X0Y A;  2X66 A;  4E7S A;  2MAW A;  1CUN A;  2LSG A;  2V7K A;  2LM2 A;  3BQI A;  4HWC A;  4JLE A;  2BS2 A;  2VL8 A;  4U7I A;  2EHO D;  2LE8 A;  2PG8 A;  4HKA A;  3FBL A;  3ZMS B;  4HEA A;  3SFD A;  4DR6 T;  4HFH A;  1UCU A;  2DHR A;  3PTR B;  3N2K E;  1KF6 A;  4QXC B;  2WAU A;  5E0O A;  5CA0 E;  2DCF A;  3CWZ B;  3IHR A;  3F57 A;  2D2S A;  2E5L T;  4JEU B;  4UF0 A;  4AQF C;  4NXM T;  2RPA A;  5FL0 A;  4HFE A;  5DQV A;  4DR5 T;  3ZEF B;  4LF5 T;  3ETU A;  3ZMT B;  2XM2 A;  2YDS A;  2DNX A;  2ZM0 A;  3O1I A;  4LMJ A;  2I6H A;  5L4H A;  3UT5 E;  5EZY E;  3PU8 A;  5C2T A;  2CWO A;  2NR4 A;  2W0G A;  3AAA B;  5AQV B;  5A1L A;  1HS7 A;  4EXT A;  4GYR A;  2XQY A;  2KWI B;  3CX6 B;  3I9W A;  4G63 A;  5CB4 E;  4I0U A;  2FBW A;  3MA9 A;  1WLX A;  1Y01 A;  3I0Q A;  3UFG A;  2JMK A;  4YFS A;  5HEO A;  5H6R B;  2WDR A;  5JR9 A;  4QXB B;  1N33 T;  5EK4 A;  4JUY A;  5AQQ B;  2DWG A;  3FZH B;  3MXZ A;  3QC9 A;  3J9X 1;  3RYH E;  2RA1 A;  3LBX A;  1BR4 A;  2CLY C;  3NZQ A;  4K0K T;  3KVB A;  4QH1 A;  2JQK A;  3ANW A;  5J1G A;  1G73 A;  2P9B A;  3PJA J;  2N1G A;  2VL0 A;  3C98 B;  3C50 A;  2YIN A;  1FMV A;  1H7C A;  4C90 A;  1WR0 A;  4YLH A;  3UFE A;  2NTX A;  1J5E T;  2X9H A;  1OED E;  2V1D B;  2VKH A;  4A97 A;  5LHH B;  4EIW A;  4TWF A;  3CML A;  5LMN T;  1U5P A;  2E2A A;  2W67 A;  4PNI A;  2JQQ A;  3IA3 A;  1MND A;  5L3F B;  3T1H T;  1KNZ A;  3ZMV B;  2WBL A;  4H9S E;  1UX4 A;  2LKH A;  5CJ5 A;  5ABF A;  4JI6 T;  3ZST A;  2YU1 A;  4QHO A;  4LF9 T;  2PJQ A;  4YT0 A;  1D0Z A;  2N9D A;  3A8Y C;  4ZEY A;  3KV9 A;  4TNW A;  2X68 A;  2CA5 A;  1LVK A;  2V6Y A;  4UV8 B;  3N9M A;  4ADZ A;  2WU5 A;  3PU3 A;  2V6X A;  4YJ2 E;  5H6Q B;  1D0Y A;  1SE7 A;  3UU5 A;  1VRB A;  5CFB A;  4H9Q C;  4KP3 C;  2XQ4 A;  3L39 A;  2Y48 B;  4UEL A;  4A5X A;  3R84 B;  3AEC A;  3FB2 A;  3OYZ A;  3QOF A;  3B5M A;  4H9N C;  3K8P C;  3PUZ F;  2UXN B;  3Q5D A;  1EZ3 A;  3NKZ A;  4IDZ A;  4ILB A;  4KUM B;  3ZCI A;  5HXE A;  4AQG A;  5KDM C;  5F8P A;  2UUB T;  3EHZ A;  4JI4 T;  2LKG A;  2ZM8 A;  5FL1 A;  1E7P A;  2C5J A;  3VR9 A;  2XY8 B;  2WY2 A;  4ZI3 C;  3RKO A;  1ZKE A;  4ZS2 A;  1XMO T;  4AIS A;  2WSS V;  2MOZ A;  2CEA A;  2LJL A;  1US7 B;  4L9I A;  2NW7 A;  4UV9 B;  5FY1 A;  3LK2 B;  2KT9 A;  3NZP A;  4ILC A;  2X9W A;  3C4W A;  4KI0 F;  3ZT5 A;  3E08 A;  1X9B A;  2VKO A;  1SA0 E;  3C64 A;  3A7M A;  2X67 A;  2VB6 A;  2VK9 A;  3GA8 A;  3KDS E;  5J2U E;  5L3D B;  2UXC T;  4EYY R;  2XPK A;  5AQF B;  2JIW A;  3MKD A;  4PFP A;  3U78 A;  4HWH A;  1FIO A;  5IUX A;  3OJA A;  5FXZ A;  5JRC B;  3RX6 A;  1B7T A;  1LVF A;  3AB3 B;  3O9X A;  2V5D A;  3RYC E;  2NTY A;  4GYS A;  5CA1 E;  4AXP A;  4BAY B;  3ZLI A;  2NW8 A;  3AA1 B;  3DJB A;  2CMR A;  3NVO A;  3RYI E;  2G0U A;  5LB7 B;  4PJJ A;  1N36 T;  1W0B A;  4OX9 T;  3AA6 B;  2DI4 A;  3GN5 A;  4HWD A;  4HFD A;  5ABG A;  1KEY A;  3ZYM A;  1OED B;  5LP6 E;  3ZMZ B;  2JQ9 A;  1D0X A;  4TN7 B;  2WU2 A;  4HFB A;  4UF0 B;  5JR9 C;  4NUV A;  2X9X A;  2E9X B;  1L0V A;  2NOX A;  3HI2 A;  2ZM6 T;  2N2N A;  3P4Q A;  2CBJ A;  4WBO A;  4CXW A;  4H9R C;  5FY0 A;  3PUQ A;  2X9Y A;  2WM9 A;  4JI7 T;  2EHO A;  3I9Y A;  3EUH A;  1NWM X;  3JCF A;  4XAX B;  2FUP A;  4X1K E;  3TLS A;  4B3T T;  3OVU A;  2KZ7 B;  2BG9 B;  2LSY A;  4TV9 E;  3SWH A;  5ABH A;  3AE5 A;  4B6X A;  4K0U A;  1ZEE A;  1WCR A;  3AAE B;  1HG5 A;  4X65 T;  2L9Q A;  3FZM B;  3UUM A;  3VKH A;  1XWM A;  4KX6 A;  2KIN B;  1HNX T;  4P1N A;  3MK7 C;  3CK6 A;  5HCJ A;  2VVN A;  3LSV A;  2H7V C;  3AE1 A;  4LMK A;  5L3G B;  2ZLY A;  1V9D A;  2L3L A;  3HKD E;  3K1S A;  3BQL A;  4AQY T;  3P4S A;  3EAM A;  3KVA A;  4O2A E;  1KNP A;  3N9P A;  2BVL A;  3TLT A;  2Q9Q D;  2V7J A;  5JRC A;  3FHN A;  2CHN A;  1AJ3 A;  3ZN0 B;  4AIU A;  4AKH A;  4NPP A;  2W62 A;  2XM1 A;  3CX7 B;  4E7Z A;  1Y64 B;  4YTP A;  2ACX A;  3AE8 A;  2PTF A;  1KNR A;  2CXF A;  2XQ5 A;  3H3A A;  4TV8 E;  5CGM A;  1G8X A;  3AEB A;  2M6B A;  4HFI A;  3OPC A;  2EHO B;  4L0R A;  1XDO A;  1MMG A;  4ZI7 E;  4HFV A;  2V7L A;  3ABV A;  1UUR A;  4G2A A;  3C4Z A;  1YW0 A;  2WWV A;  3CX8 B;  5AQL B;  5AQG B;  5ADX L;  1LKX A;  2LSJ A;  3UQ4 A;  2V5C A;  2WB5 A;  3LJC A;  4COF A;  2UU9 T;  2YU2 A;  5AQJ B;  5FVK A;  4LFB T;  2BKP A;  2XQ7 A;  3LG7 A;  3P8C D;  4O8S A;  5FP3 A;  2XUE A;  5HWY A;  5LBM A;  4EAH A;  2C0S A;  4X62 T;  3FZF B;  5AQU B;  4IDP A;  2Y8D A;  2HPJ A;  1VOM A;  2VVS A;  1ZHC A;  2JQH A;  2BS3 A;  4M1P A;  3Q5W A;  2LEH A;  4GKJ T;  3VU7 H;  2A2F X;  2QRX A;  3G06 A;  5DJQ C;  1MIV A;  2LOP A;  4QXH B;  4TWD A;  3VHL A;  4CI1 B;  1XNR T;  2E9X A;  4DR1 T;  3M3Z B;  4TUY E;  5FNV E;  1HR0 T;  3HR0 A;  4CN4 A;  3K3Q C;  2ODU A;  3KV4 A;  2AE9 A;  4OK0 A;  5HAX A;  4X66 T;  3R6N A;  4CXX A;  1ZOY A;  3P4R A;  2YK0 A;  3L09 A;  3P50 A;  3RH3 A;  5JDM A;  1IJ5 A;  4PK4 A;  1FMW A;  4HE8 A;  3MAC A;  3UU8 A;  3PUS A;  3RRC A;  5JDN A;  4DV2 T;  3MZK B;  5J0Z A;  5HXS A;  1WYC A;  1WRD A;  5ABF B;  3EDU A;  4CXY A;  2BVM A;  2XAG B;  2MYS A;  3RQU A;  3P4W A;  4HTE A;  3H37 A;  4U74 A;  4ZXL A;  4EGW A;  2YDQ A;  2YN6 A;  3I0O A;  3OKQ A;  4N78 D;  3PV0 F;  5F5W A;  3AEA A;  4AKL A;  2K3W A;  2FJB A;  2KXP B;  1XNQ T;  2I59 A;  2WZI A;  3LDQ B;  3PUG A;  4QWN B;  3ZSS A;  1U4Q A;  2VKD A;  5JDH A;  3WAJ A;  4KBM B;  5JRE A;  3SFE A;  4ZZB A;  1T8B A;  2XAH B;  3K3O A;  1T7S A;  3KV5 A;  4OYK A;  3DTO A;  4BJM A;  3EI0 A;  4IE0 A;  5IYZ E;  2LSK A;  5AQT B;  2IC6 A;  3FBZ A;  4A98 A;  4AQF A;  2HN1 A;  1IAP A;  4LF4 T;  2BDE A;  2LT3 A;  2VUR A;  2X0L B;  4HFC A;  5C3J A;  4B3M T;  4ANJ A;  4F8H A;  3N9N A;  3QK6 A;  4KMC A;  5L47 A;  2HH7 A;  4NIQ A;  4P09 A;  4ZHQ E;  2BZB A;  1T72 A;  4LML A;  5AQI B;  5IWA T;  2WMN A;  3RIU C;  4V1A v;  4ZI2 D;  4UXN B;  4ZS3 A;  4ZI3 D;  2W2U A;  2MTQ A;  1MMD A;  1UK5 A;  5LGT B;  1KK7 A;  3ZT7 A;  2XHE B;  4HWF A;  2B1E A;  5BR8 T;  2K24 A;  3PUW F;  5LHI B;  2D0T A;  2Q9Q C;  5L3E B;  3UU6 A;  2ZM2 A;  5LA6 E;  1YQ3 A;  4DR3 T;  3RPU A;  2AXD S;  2WWU A;  3FZK B;  3N9Q A;  5GON E;  4PAG A;  4CI3 B;  3J7Y q;  3AXJ A;  3LK3 B;  3N5L A;  4EV6 A;  4U2Z A;  3HKC E;  4QH5 A;  4AKR B;  4U31 A;  4JI2 T;  4ZOL E;  2UXX B;  2K5B B;  4UVA B;  1MIW A;  2H89 A;  2OA5 A;  1NEN A;  2BKO A;  4X5T A;  3KBU A;  1O3X A;  5HXC A;  2J47 A;  5IHY A;  4QX7 B;  5HCM A;  2BS4 A;  4JBW F;  1S94 A;  4WNK A;  5JQG E;  3N9L A;  4X20 E;  2XAJ B;  2QYW A;  1YXR A;  2XZE A;  3RIA A;  4XZC A;  4DV7 T;  1I6Z A;  1HFA A;  1Z8U A;  4EZH A;  2D9D A;  3N2G E;  4IIJ E;  4Z91 A;  5ETW A;  2IML A;  4WBN E;  1HTJ F;  1W09 A;  2CLY B;  3U3I A;  5LMU T;  3IBP A;  4TNV A;  5AQO B;  4EYU A;  4EZ4 A;  4IRE A;  4EEB A;  4H63 H;  3ZKR A;  1JNR A;  2LOS A;  4WZX A;  3PUY F;  2VQF T;  3RYF E;  3FZL B;  5LXT E;  2E9X C;  3RRW A;  3EAB A;  2CM0 A;  2HPL A;  4YJ3 E;  5FXV A;  2M67 A;  5HEG A;  5TAO A;  4F6R C;  2IHR 1;  4GIW A;  4O4J E;  5FY7 A;  3PJA A;  2LRK A;  3QB5 K;  1N32 T;  3RIF A;  5HEJ A;  3ZCJ A;  2H3R A;  5KXJ A;  2KMF A;  4IE7 A;  1ZV4 X;  2Z6E A;  2YOE A;  2E9X D;  3LBX B;  4Z8X A;  3QNU A;  1D1C A;  2BBJ A;  2SPC A;  1CHU A;  3AE6 A;  5JDL A;  4PK6 A;  1BR2 A;  4DVD A;  4KHP T;  3BK9 A;  1S35 A;  4PJN A;  4U2Y A;  3UTK A;  4L5G A;  2FJD A;  3JAD A;  3ZJ1 A;  4IT4 A;  2XTL A;  4CN1 A;  2WMO A;  3JAF A;  4DMW A;  3BQK A;  2YDR A;  2LSI A;  1I94 T;  1NAF A;  2DL1 A;  2GK9 A;  3FXD B;  3AA7 B;  3GWH A;  4LFA T;  5JDG A;  3MJX A;  4DV1 T;  2IUB A;  3CQX C;  3C4X A;  3K3N A;  1OED C;  4DV4 T;  2F4V T;  2WDQ A;  4MHC A;  4U33 A;  2CRB A;  2I0M A;  3S4U A;  3VRB A;  5BMV E;  1M62 A;  4X1Y E;  4FI5 A;  5LG3 A;  4DV0 T;  1Z0P A;  1XMQ T;  5HWX A;  5AQS B;  1X79 A;  4AI6 A;  4HGA A;  4LF6 T;  2WP9 A;  2XAS B;  1HNZ T;  3LK4 2;  5LHG B;  2J4G A;  2H88 A;  3WI3 A;  2Q9Q A;  1XDP A;  1UGO A;  2B76 A;  3AE3 A;  5JDQ A;  1OWA A;  2H7O A;  4GK0 E;  5JH7 E;  2J62 A;  2NW9 A;  3H3M A;  1FEW A;  3ANW B;  5HEH A;  4MAL A;  4PFO A;  2BKN A;  3KV6 A;  2Q9Q B;  4YTM A;  5FVL A;  3RF1 A;  2XQA A;  4FJO A;  3RGL A;  4DID B;  4YHH T;  4GK5 E;  1OXZ A;  2LM9 A;  4YTN A;  5LCY A;  1VCS A;  2XAQ B;  2PFV A;  3OYX A;  4LFC T;  5FMN A;  4A56 A;  4CN6 A;  4ZI2 C;  4ILU A;  4JV5 T;  2JPF A;  2VAS A;  4JEH B;  1M7K A;  3X1D A;  4WYV A;  3HL6 A;  2KSR A;  5LGN B;  4P0A A;  4GKK T;  4YY3 T;  1IJ6 A;  1HX8 A;  1BR0 A;  1NEK A;  2IAK A;  3AVS A;  5LG4 A;  4DO0 A;  4QH4 A;  3WAK A;  4QX8 B;  1W9R A;  3AEF A;  5DQW A;  3D0T A;  2CHO A;  2K9A A;  3LFM A;  5FXW A;  2MBG A;  3UU4 A;  4DBQ A;  3JC6 D;  3RI5 A;  2MPK A;  3I1A A;  3AVR A;  3V5S A;  5LJN A;  1D1B A;  1OED A;  3NBX X;  4TX5 A;  3SS1 A;  1N34 T;  1HF8 A;  3CIR A;  3RQW A;  3NWI A;  2CWY A;  1JNZ A;  3C51 A;  3GN5 B;  4PJL A;  1R8I A;  3UU3 A;  3VRA A;  2HHH T;  5FXX A;  3RIU A;  4NXN T;  4JI1 T;  2QA7 A;  2W63 A;  3VKG A;  2CCQ A;  4P0B A;  5JVD E;  2BG9 E;  3JC6 C;  2HN2 A;  3PUX F;  2BBH A;  5HXR A;  4JI5 T;  4B3R T;  3KBT A;  4DND A;  5L4E A;  3AE2 A;  4UR9 A;  4OYJ A;  4MFR A;  3F2E A;  4DR4 T;  3AE9 A;  1MMA A;  1E2A A;  2W00 A;  4HWI B;  4WW0 A;  3UUX B;  4DV6 T;  1QUU A;  1VCT A;  1MNE A;  2NWB A;  5EK2 A;  4PK5 A;  4PW8 A;  3NRY A;  4EED A;  2A3D A;  4IHJ E;  3ZYL A;  3PUA A;  4ILA A;  3ZC0 A;  5FKY A;  5HXH A;  3RKG A;  4EOZ B;  1HNW T;  3CVR A;  2C5K T;  2J1D G;  2YKS A;  3PUV F;  1WYB A;  2WCA A;  5AQK B;  3UUB A;  4JI0 T;  4IGU A;  2L8K A;  1BR1 A;  4OFZ A;  1QLB A;  3HKB E;  3E0Z A;  4I4T E;  4IDQ A;  4O4L E;  2RP4 A;  3ZPO A;  2OV9 A;  3RHW A;  4H9O C;  2Y6X A;  4J2C A;  1IBM T;  4AKI A;  2ODV A;  1MMN A;  2UUC T;  3AEG A;  4Z90 A;  1SHZ C;  5LOV E;  5AQR B;  3ZMU B;  5LJM A;  4TWH A;  2CXL A;  3EVY A;  1UX5 A;  3A5X A;  4QKN A;  5C8Y E;  4YXD A;  2VKJ A;  3L8R A;  3PDY A;  1YQ4 A;  3QUJ A;  2WQY A;  2ACZ A;  3UQ7 A;  4UVC B;  2KND A;  4OHF A;  3HA4 A;  4U7Y A;  2UXD T;  3ONJ A;  3V5U A;  2LRL A;  3P4P A;  2IIU A;  2XQ3 A;  5AFU L;  3ESL A;  4I50 E;  3CPZ A;  4H9P C;  2E8I A;  2IW5 B;  2CBI A;  2JRK A;  2D5U A;  2V8S V;  3ZN1 B;  3O1J A;  3AE7 A;  1HG2 A;  4BJN A;  3PE0 A;  2E5V A;  2KWH A;  2VWA A;  2IC9 A;  4BA9 A;  1IZN B;  5JR9 B;  4IDN A;  5L3B B;  1FJG T;  2D0U A;  4I43 B;  5KX5 E;  3RC8 A;  3ZYK A;  3T1Y T;  2CPT A;  2XQ9 A;  1KFY A;  3AED A;  4KHZ F;  3VR8 A;  2WS3 A;  4ERR A;  2OLT A;  1YKH B;  2V7I A;  2LHR A;  4IL9 A;  3RC3 A;  5JTG A;  4YSZ A;  3ZT6 A;  5AQM B;  3T8O A;  3TKL B;  3RLF F;  2FJA A;  3AEE A;  4MBQ A;  1YD8 G;  4NUU A;  4HN9 A;  5EK3 A;  4DMV A;  4DR2 T;  2NP9 A;  3E22 E;  2DWK A;  4UEM A;  5DAB A;  5HEU A;  3N2O A;  3N9O A;  4IE4 A;  3AA0 B;  4EB6 E;  4YSX A;  1IBL T;  3EDV A;  3L3P A;  2XSB A;  2BG9 A;  1QSD A;  2X51 A;  4DUZ T;  2FJE A;  3ONX A;  4IST A;  3OTO T;  3F31 A;  2KLQ A;  4CQI A;  4DUY T;  4YSY A;  4B3S T;  2XJ7 A;  3Q2M A;  5AQN B;  1UUS A;  3ZC1 A;  4JI8 T;  1WFD A;  3CQG B;  2UUA T;  2XAF B;  1J5W A;  1WR6 A;  3OBV E;  4IE5 A;  3ONL C;  4O4I E;  4DBR A;  2WZH A;  3M65 A;  4GOU A;  3IF8 B;  4IDO A;  4YHJ A;  3KIN B;  3UUL A;  3PUR A;  5M4Y A;  4PJM A;  2CXD A;  3KFW X;  3Q5E A;  2V6Y B;  3NRX A;  3AXJ B;  3AAI A;  3CQC B;  3O4X E;  4IE6 A;  1E1H B;  1MIY A;  5AQH B;  1J1J A;  2IDO B;  5KMG P;  4X64 T;  3QB5 A;  3Q5X A;  2WDV A;  2XSA A;  3IEE A; 
#chains in the Genus database with same CATH homology
 1R8I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...