1R8IA

Crystal structure of trac
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
187
structure length
187
Chain Sequence
b'TELIKQGEQLEQMAQQLEQLKSQLETQKNMYESMAKTTNLGDLLGTSTNTLANNLPDNWKEVYSDAMNSSSSVTPSVNSMMGQFNAEVDDMTPSEAIAYMNKKLAEKGAYDRVMAEKAYNNQMQELSDMQALTEQIKSTPDLKSIADLQARIQTSQGAIQGEQAKLNLMNMLQQSQDKLLRAQKDRA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TraC
publication title Structural and functional characterization of the VirB5 protein from the type IV secretion system encoded by the conjugative plasmid pKM101
pubmed doi rcsb
source organism Escherichia coli
molecule tags Structural protein
total genus 70
structure length 187
sequence length 187
ec nomenclature
pdb deposition date 2003-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07996 T4SS Type IV secretion system proteins
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.430 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Type IV secretion system, VirB5-domain 1r8iA00
1R8IA
chains in the Genus database with same CATH superfamily
4AISA 3ZPOA 3NKZA 1YW0A 5HYAA 2XZEA 3I9YA 2A2FX 2LKGA 2VL8A 3X1DA 3NRXA 5HEUA 2JMKA 4JBWF 2JIWA 3N2OA 2H7VC 3A7MA 2YN6A 5LGTB 4IHJE 4C91A 3KV6A 2ODUA 4NUUA 3CIRA 4TN7B 4PNIA 3UFGA 4NPPA 3N2GE 2JQQA 4IE6A 1D1AA 3Q5DA 2HH7A 4HGAA 5IHYA 3PURA 2NW7A 3A5XA 1CUNA 2YINA 3AA0B 3O1HA 3BQIA 3F2EA 5HWYA 4GIWA 2BS3A 2L9QA 2CXLA 2LHRA 4DR5T 5JTGA 3OTOT 3PUQA 1N32T 4CN4A 1X79A 1IBKT 2HPJA 4YHJA 1XMQT 4CXYA 4LMJA 1FEWA 2D2SA 3C98B 2V26A 5AQTB 1U5PA 1X9BA 2ZM0A 5ETWA 5JDQA 4UVAB 4LF7T 3P4SA 5IUXA 1KNZA 4DUYT 2YU2A 1ZV4X 2IUBA 5LNKA 1HS7A 3AE3A 2BKPA 2NW8A 1H7CA 3MZKB 3GMIA 2NW9A 3JC6C 2MPKA 1M7KA 4CZZB 4IE0A 3P4QA 4CN1A 4JI6T 1OEDE 4JEHB 3HR0A 3LK2B 4IGUA 1T98A 3LK3B 2LOPA 3IF8B 3K8PC 3SFDA 4EEDA 3ONJA 5FXXA 5L3GB 1BR4A 2X9XA 1LVFA 1CHUA 3PUZF 3JADA 3ABVA 5HXEA 3RF1A 3UT5E 4JI8T 5BMVE 4ZS2A 3S4UA 3CMLA 4DO0A 2OA5A 2V7KA 2CHOA 3BK9A 2DNXA 2UXBT 4PFOA 2I0MA 2W0GA 3CX8B 1VOMA 5JR9A 1YKHB 3O1JA 2VKDA 4H9OC 2EHOD 4QX7B 2X66A 5AQFB 2N1GA 4NUVA 3EDVA 2XQ6A 3PUVF 1HG5A 4BAYB 4WBOA 4QH1A 4PFPA 5L3EB 5CGMA 3NWIA 5FVLA 5EK2A 3R84B 3FXEB 1KF6A 1NEKA 3RHWA 1YQ4A 2CEAA 3C4WA 5JR9C 1QLBA 2XM1A 2KZ7B 3QK6A 4IL9A 3MA9A 2IC9A 2VL0A 2CWOA 2V5DA 2CHNA 2X0YA 1SUMB 3EUHA 5FYMA 2K5BB 3TKLB 4OK0A 2X51A 4TWHA 3J9X1 4MALA 3I0OA 2DWGA 2EHOA 2UXXB 3RH3A 4DMWA 2E5LT 1Y01A 3DJBA 3N9PA 3O4XE 4OHFA 4G63A 3PU8A 4Q25A 1J1JA 5JR9B 4ZI3D 1QSDA 3K3NA 3H37A 5KX5E 2WDQA 3UQ7A 4IE7A 4X1IE 1AJ3A 2N9DA 1OXZA 3VRBA 4YFSA 3P4RA 4UV8B 2BVMA 4X20E 4U72A 2HN1A 3FBZA 3UUNA 3I9WA 4DR2T 5DQVA 5FNVE 2V7MA 3CQXC 3LBXA 2EHOC 1OWAA 2RP4A 2LEHA 2H3RA 3ZMTB 2XJ7A 4I50E 2J62A 2WMNA 2V1DB 1Y64B 1IZNB 2LLYA 3CPZA 5LOVE 3UU3A 2FJEA 2V5CA 1MNEA 2ACXA 1UUSA 3ZMUB 4NXMT 2JPFA 5L3BB 2WU5A 4JI2T 2W2UA 3UULA 2D5UA 2EHOB 2NP9A 2LSKA 4KHPT 1W0AA 4AKHA 3ZJ1A 4DV3T 3AA7B 1E7PA 4DIDB 3UQ4A 4DR7T 1MIWA 4C90A 4EGWA 4UEMA 4IE5A 4IT4A 1UGOA 4EZ4A 3OPCA 4JI7T 4ZZCA 4P09A 3I0QA 2KMFA 4EEBA 2K24A 3RYFE 5FXVA 1UK5A 3AECA 4ISSA 4G2AA 5FY1A 4ZI3C 4TNWA 3FZKB 3B13A 4TNVA 4KHZF 2VK9A 2LE8A 1GQEA 4ADZA 3ZCIA 4ASKA 1OEDA 2VQFT 5ABEA 3O1IA 4O4LE 4JI3T 5LCYA 4AXPA 5JREA 4QXHB 3NZPA 1WLXA 2VURA 5BR8T 3C4XA 2VVSA 2ES0A 3D0TA 3P50A 5HXSA 2YU1A 3NZQA 3CVRA 1N34T 1DU2A 3UU8A 3QNUA 2WZIA 3EVYA 4TV8E 5LXTE 2A72A 3UU5A 2XPKA 5AQUB 4AKRB 3QB5K 3ZT5A 4GOUA 2LJLA 4I4TE 1ZOYA 3KVAA 3QB5A 3WAKA 4ILCA 5KMGP 1I6ZA 1WYCA 1ZHCA 2KWIB 5KXJA 3RIAA 2MBGA 2LT3A 4JI0T 4QXBB 3PE0A 2DLRA 2LSJA 3MXZA 4IDZA 2JJ9A 3N9NA 3EHZA 1JNZA 3AVRA 4YT0A 2LHNA 4E7SA 3VRAA 2DCFA 4EZHA 3RRWA 1HR0T 2WWVA 1KNPA 3GN5B 3HKBE 4DV2T 2XQ7A 5J1GA 4X1KE 4ZOLE 4UVBB 5LHGB 1XDPA 2X9HA 4UIGA 4B3ST 5CA0E 2CBJA 3JC6D 3OYZA 4PK4A 4DBRA 1T7SA 4PJJA 2Y6XA 4A56A 2B1EA 4ILAA 2PFVA 2D0UA 4O4IE 3SS1A 2XASB 5GONE 4MBQA 4U2ZA 4Z91A 1T8BA 3RPUA 4IREA 3AEBA 1N33T 2PTFA 4KUMB 3NRYA 5L3CB 4KP3C 3GWHA 3AE7A 3W15B 3N5LA 3Q5WA 3N9QA 2K9AA 2QYWA 4ZI7E 1MNDA 4HFCA 4HFVA 4ZEYA 4ZHQE 1HF8A 2W4XA 3AA6B 3AEAA 4FJOA 3LDQB 3SOLA 5HEGA 1HX8A 4EXTA 2CM0A 5L3FB 3KINB 2XQYA 2V7IA 5CA1E 1ZKEA 2AE9A 2Y8DA 4YXDA 2WP9A 5JRCA 4WYVA 5FL1A 3MACA 2NTYA 2FJDA 4A97A 2X0HA 4ZS3A 3QC9A 3AE8A 3ZC0A 2WM9A 3P4PA 4X62T 4EAHA 2CE7A 2DL1A 2BS4A 3VKGA 2B76A 3ANWA 5ABHA 5M4YA 2V6YA 1B7TA 4WBNE 4K0UA 5AQLB 2KSRA 5C3JA 2VKOA 5AQIB 3UU4A 4DV6T 4F6RC 4U33A 5ABGA 3OVUA 3E08A 5JDNA 2BKNA 2QRXA 3UU6A 2VKHA 3EDUA 1V9DA 5LHIB 4TV9E 2R6GF 2CPTA 1BR1A 5JDFA 1NWMX 5L3DB 5HEOA 2WWUA 1D0ZA 3ZSSA 4AI6A 3ZYLA 2Q9QC 3N9OA 4PK6A 2BZBA 2V8SV 2JQKA 2WU2A 3ZCJA 5HEJA 1HNWT 3C4ZA 2XAHB 3ZC1A 1U4QA 5JRCB 2NWBA 4O8SA 2SPCA 3VR8A 5L4EA 3FZMB 4ERRA 1WYBA 2IHR1 2UU9T 1WCRA 3ZMVB 2ZM2A 5FL0A 2XQ9A 3KV9A 3RX6A 4UELA 5FXWA 2YEVC 4QX8B 5LP6E 3ZT7A 4KX6A 1HTJF 3UFEA 3ANWB 3FZLB 4O4JE 2V6YB 4XAXB 2Q9QB 1WRDA 3Q5EA 1G73A 1EZ3A 3AB3B 3NBXX 4H9SE 1IAPA 4EB6E 2XAGB 3ZT6A 4QXCB 2CXDA 3FBLA 2WZHA 3AEGA 1BR0A 4Z8XA 3N9LA 3KBTA 5C8YE 5JDLA 4TWDA 4AKIA 2WBLA 4ZZBA 3C50A 5EK4A 4JYAT 2IMLA 4J2CA 2Z6EA 2W61A 1FIOA 4DV4T 2MAWA 4H9RC 1E1HB 1HG2A 4O2AE 4ANJA 1UCUA 3T1HT 3B5MA 4FI5A 3KV5A 3HI2A 3RKGA 3JCFA 4B3MT 3KBUA 2XAFB 3HKCE 5DJQC 4ZXLA 1FJGT 2K48A 4QHOA 2UUBT 3LK42 1D0XA 5CFBA 4H9NC 3SFEA 4HKAA 4U3CA 3RGLA 2YDRA 2DHRA 4LFAT 2BVLA 2PBIA 1SHZC 5FVKA 1L0VA 4DR6T 2JMHA 4YLHA 1UURA 5AQJB 2E5VA 4H63H 4AKGA 4JEUB 2YKSA 2BDEA 3OYXA 5HXCA 4ILBA 1SA0E 3VU7H 1WFDA 4YSYA 4EV6A 4PW8A 2W66A 4IIJE 2XAQB 2NR4A 1XNRT 3OJAA 2YDQA 4Z90A 2WCAA 5A1LA 3ZYMA 3AAAB 4JI5T 4X65T 3TLUA 2P9BA 2X9WA 4YJ2E 3LG7A 3E22E 5FY0A 3ETUA 1S35A 4L5GA 2BBHA 2N2NA 3HL6A 1VCTA 2CWYA 2LRLA 1XMOT 2L8KA 3P4WA 4QH5A 2H89A 3LFMA 5LHHB 3KFWX 5CB4E 4YY3T 3PV0F 3NVOA 3KVBA 4UVCB 3AXJA 5IWAT 2XQ8A 3GN5A 3FZFB 3QOFA 2E2AA 2L3LA 4PK5A 4JLEA 1HNZT 3EAMA 4U2YA 4AIUA 4KI0F 4HFIA 3TLTA 2PJQA 1WR0A 2QA7A 4ZI2C 5L4HA 5LYJE 4HWHA 5AQSB 3FHNA 2HN2A 3RLFF 4IDQA 2VVNA 4DR4T 4GK0E 3G06A 4WNKA 4BJMA 3UTKA 1D0YA 1MMGA 4IDNA 5TAOA 3PUAA 4BA9A 3FB2A 3L09A 4HEAA 4LMLA 2WDRA 3PUWF 4DR3T 3OBVE 3AE2A 2MTQA 5AFUL 5HAXA 3AE1A 5KDMC 1M62A 2LOSA 2CBIA 5AQPB 3T8OA 4DV7T 3KV4A 3RQWA 4HFEA 2LSIA 5L2LA 2WDVA 3KDSE 2JQHA 1QUUA 2J1DG 2FUPA 3AXJB 2J4GA 2C5KT 3CX6B 2W00A 5H6QB 4K0KT 4PJLA 5LJNA 3ZEFB 4WZXA 1NAFA 4DVDA 3PUXF 3VR9A 3IHRA 2XQAA 2XSAA 2IC6A 3PUGA 4HFHA 2XQ5A 2XM2A 3M3ZB 3PTRB 4AQFA 5IYZE 3PDYA 3AE5A 3VKHA 2HHHT 2I59A 3CWZB 1VRBA 2E9XC 2IAKA 2LSYA 3LSVA 3EI0A 4DMVA 2ZLYA 4YSXA 2BG9C 4YJ3E 5AQOB 4EIWA 5JQGE 4O2BE 3K3OA 2CMRA 3ZN1B 3ETVA 1BR2A 3L3PA 2V7LA 3OKQA 2M6IA 2D9DA 2DWKA 3AAIA 2YK0A 4AQFC 3AVSA 2Q9QD 3CQCB 3CX7B 2WS3A 2Y48B 3C51A 4A98A 2E9XB 2WQYA 5LB7B 5LGUB 4MFRA 4HWIB 2LM2A 5HWXA 3F31A 2FBWA 2BKOA 2JRKA 2BG9B 1HCIA 3ZMSB 5HCJA 2I6HA 3ZJ2A 3HKDE 2LRKA 3SRZA 4AQYT 1R8IA 4TWFA 4I0UA 5HEHA 4E7ZA 3J7Yq 4NIQA 4X5TA 4YTNA 4H9PC 1I94T 4LF4T 1MMNA 2OV9A 3AE4A 3ZSTA 3UUXB 1KK7A 3RC8A 2XAJB 3ZLIA 2XHEB 2ODVA 1IJ6A 3N9MA 5LGNB 1FMWA 3L39A 3CQGB 2NTXA 3A8YC 3Q5XA 1G8XA 2XQ3A 2XSBA 4U7IA 5J0ZA 1KFYA 5EZYE 1VCSA 5AQRB 5JH7E 3O9XA 3RKOA 4MLKA 4U74A 3F57A 3PU3A 3RQUA 3U3IA 5FP3A 4ISTA 5LJMA 4CI1B 4CI3B 4COFA 3K3QC 2Q9QA 5LG3A 1HFAA 4WW0A 1YQ3A 3L8RA 1D1BA 4M1PA 1HNXT 3UUBA 2VQET 1XZYA 4MHCA 4L0RA 4DNDA 2YDSA 2KXPB 5AQKB 1JNRA 4DV1T 3AE9A 2WSSV 3CKDA 1US7B 3PJAJ 3MK7C 3V5SA 4CQIA 1IJ5A 5CJ5A 1YXRA 4IDOA 4LFCT 4I55E 4B3RT 4CXWA 2BBJA 5DQWA 4LF6T 3RYIE 2QGSA 1J5WA 3PUYF 3RC3A 1W9RA 3QUJA 4LFBT 2W63A 4F8HA 2MOZA 2ZM6T 2PG8A 4IE4A 1D1CA 4GYSA 2RA1A 2WB5A 2MYSA 3PJAA 2HPLA 3HKEE 3TLWA 5F3JA 3MKDA 2VB6A 4TX5A 3DP7A 2BG9E 1YKEB 1LKXA 5FXZA 3AEFA 3AEDA 5J2UE 2XY8B 3DTOA 5ABFA 2QVAA 2V6XA 5FKYA 1NENA 3ONLC 2GK9A 4TUYE 5F8PA 4P0AA 3Q9DA 2H7OA 2FJBA 2UUCT 4QWNB 5LA6E 3M65A 4I43B 4U7YA 2W67A 3T1YT 2UXNB 4HTEA 5ADXL 1UX4A 1WR6A 2C0SA 4LMKA 1W0BA 5C2TA 3VHLA 2CCQA 4QKNA 3LJCA 4PJNA 2IDOB 5LMUT 1MIYA 5F5WA 2UXCT 4DV0T 2YOEA 4V1Av 4O4HE 3CK6A 4UR9A 3AE6A 2A9UA 3JAFA 3Q2MA 4DR1T 3ZMZB 2UUAT 4HWFA 3P7IA 3C64A 5JDGA 2OLTA 1XNQT 2C5JA 1KEYA 4YHHT 4ZI2D 3BQKA 3H3MA 5DABA 2C5IT 4X64T 2CLYC 4UXNB 2XUEA 1IBMT 4HFDA 3GA8A 5AQMB 1SE7A 2DI4A 4X66T 2X67A 2X0LB 5LMNT 5HXHA 5ABFB 2BS2A 4NXNT 4CN6A 4LF5T 2A3DA 4BJNA 3RIUA 4HWCA 1MIVA 4B3TT 3ONXA 3K1SA 2KLQA 3B57A 3TLVA 4P1NA 3FXDB 5LBMA 3WAJA 2WMOA 4DUZT 1W09A 4PJMA 4HWDA 5JVDE 5AQQB 4X1YE 4KBMB 4U31A 2CXFA 2CLYB 4B6XA 4GKJT 3RIFA 3AEEA 5J2TE 5H6RB 4YSZA 2M6BA 1T72A 1J5ET 5JDHA 3ZYKA 3WI3A 5FY7A 2VWAA 5AQNB 4GYRA 4UV9B 2WY2A 3RIUC 4JV5T 2ZMAA 1LRZA 1LVKA 1KNRA 2E8IA 4LF8T 5HCMA 4OYJA 3MJXA 2M67A 2LM9A 5LG4A 3P8CD 4YTMA 3AA1B 4OFZA 1HX1B 2IW5B 5LBQB 4AKLA 1S94A 3PUSA 2E9XD 4H9QC 5AQHB 1O3XA 2CA5A 4QH4A 3U78A 1ZP0A 3N2KE 3JAEA 2RPAA 4HFBA 4CI2B 1MMDA 3V5UA 2W62A 1IBLT 3LBXB 4L9IA 2V7JA 4IDPA 2AXDS 4A5XA 4AQGA 4UF0A 2IIUA 4KMCA 4YTPA 4HE8A 4N78D 2G0UA 3IEEA 3FZHB 4DV5T 2ACZA 1XDOA 3HA4A 1FMVA 4EYYR 4H63V 3IBPA 2XQ4A 2XTLA 4DBQA 5FMNA 4LF9T 3E0ZA 3UUMA 1Z8UA 4TZ4C 3ESLA 5E0OA 4XBFB 1N36T 4CXXA 2UXDT 4P0BA 1YD8G 4IL4A 2KWHA 3RYCE 4JUYA 2E9XA 1OEDC 5HXRA 3BQLA 3ZN0B 4JI4T 2LSGA 3AAEB 2KNDA 4OX9T 2VASA 2LKHA 2FJAA 3I1AA 2BG9A 3EABA 4OYKA 3H3AA 4HN9A 2D0TA 2X68A 1UX5A 4PAGA 5L47A 4XZCA 1MMAA 3IA3A 3R6NA 2NOXA 4ILUA 2X9YA 3ZKRA 2H88A 1Z0PA 1E2AA 1XWMA 5EK3A 4EYUA 2KT9A 4GKKT 2WAUA 2KINB 5JDMA 3TLSA 2F4VT 3RRCA 5AQVB 3RYHE 4EOZB 4GK5E 3SWHA 2CRBA 4UF0B 1OEDB 2J47A 5AQGB 2VKJA 4JI1T 2ZM8A 2JQ9A 3RI5A 1ZEEA 2K3WA
chains in the Genus database with same CATH topology
1R8IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1R8I A; 
#chains in the Genus database with same CATH topology
 4AIS A;  3ZPO A;  3NKZ A;  1YW0 A;  5HYA A;  2XZE A;  3I9Y A;  2A2F X;  2LKG A;  2VL8 A;  3X1D A;  3NRX A;  5HEU A;  2JMK A;  4JBW F;  2JIW A;  3N2O A;  2H7V C;  3A7M A;  2YN6 A;  5LGT B;  4IHJ E;  4C91 A;  3KV6 A;  2ODU A;  4NUU A;  3CIR A;  4TN7 B;  4PNI A;  3UFG A;  4NPP A;  3N2G E;  2JQQ A;  4IE6 A;  1D1A A;  3Q5D A;  2HH7 A;  4HGA A;  5IHY A;  3PUR A;  2NW7 A;  3A5X A;  1CUN A;  2YIN A;  3AA0 B;  3O1H A;  3BQI A;  3F2E A;  5HWY A;  4GIW A;  2BS3 A;  2L9Q A;  2CXL A;  2LHR A;  4DR5 T;  5JTG A;  3OTO T;  3PUQ A;  1N32 T;  4CN4 A;  1X79 A;  1IBK T;  2HPJ A;  4YHJ A;  1XMQ T;  4CXY A;  4LMJ A;  1FEW A;  2D2S A;  3C98 B;  2V26 A;  5AQT B;  1U5P A;  1X9B A;  2ZM0 A;  5ETW A;  5JDQ A;  4UVA B;  4LF7 T;  3P4S A;  5IUX A;  1KNZ A;  4DUY T;  2YU2 A;  1ZV4 X;  2IUB A;  5LNK A;  1HS7 A;  3AE3 A;  2BKP A;  2NW8 A;  1H7C A;  3MZK B;  3GMI A;  2NW9 A;  3JC6 C;  2MPK A;  1M7K A;  4CZZ B;  4IE0 A;  3P4Q A;  4CN1 A;  4JI6 T;  1OED E;  4JEH B;  3HR0 A;  3LK2 B;  4IGU A;  1T98 A;  3LK3 B;  2LOP A;  3IF8 B;  3K8P C;  3SFD A;  4EED A;  3ONJ A;  5FXX A;  5L3G B;  1BR4 A;  2X9X A;  1LVF A;  1CHU A;  3PUZ F;  3JAD A;  3ABV A;  5HXE A;  3RF1 A;  3UT5 E;  4JI8 T;  5BMV E;  4ZS2 A;  3S4U A;  3CML A;  4DO0 A;  2OA5 A;  2V7K A;  2CHO A;  3BK9 A;  2DNX A;  2UXB T;  4PFO A;  2I0M A;  2W0G A;  3CX8 B;  1VOM A;  5JR9 A;  1YKH B;  3O1J A;  2VKD A;  4H9O C;  2EHO D;  4QX7 B;  2X66 A;  5AQF B;  2N1G A;  4NUV A;  3EDV A;  2XQ6 A;  3PUV F;  1HG5 A;  4BAY B;  4WBO A;  4QH1 A;  4PFP A;  5L3E B;  5CGM A;  3NWI A;  5FVL A;  5EK2 A;  3R84 B;  3FXE B;  1KF6 A;  1NEK A;  3RHW A;  1YQ4 A;  2CEA A;  3C4W A;  5JR9 C;  1QLB A;  2XM1 A;  2KZ7 B;  3QK6 A;  4IL9 A;  3MA9 A;  2IC9 A;  2VL0 A;  2CWO A;  2V5D A;  2CHN A;  2X0Y A;  1SUM B;  3EUH A;  5FYM A;  2K5B B;  3TKL B;  4OK0 A;  2X51 A;  4TWH A;  3J9X 1;  4MAL A;  3I0O A;  2DWG A;  2EHO A;  2UXX B;  3RH3 A;  4DMW A;  2E5L T;  1Y01 A;  3DJB A;  3N9P A;  3O4X E;  4OHF A;  4G63 A;  3PU8 A;  4Q25 A;  1J1J A;  5JR9 B;  4ZI3 D;  1QSD A;  3K3N A;  3H37 A;  5KX5 E;  2WDQ A;  3UQ7 A;  4IE7 A;  4X1I E;  1AJ3 A;  2N9D A;  1OXZ A;  3VRB A;  4YFS A;  3P4R A;  4UV8 B;  2BVM A;  4X20 E;  4U72 A;  2HN1 A;  3FBZ A;  3UUN A;  3I9W A;  4DR2 T;  5DQV A;  5FNV E;  2V7M A;  3CQX C;  3LBX A;  2EHO C;  1OWA A;  2RP4 A;  2LEH A;  2H3R A;  3ZMT B;  2XJ7 A;  4I50 E;  2J62 A;  2WMN A;  2V1D B;  1Y64 B;  1IZN B;  2LLY A;  3CPZ A;  5LOV E;  3UU3 A;  2FJE A;  2V5C A;  1MNE A;  2ACX A;  1UUS A;  3ZMU B;  4NXM T;  2JPF A;  5L3B B;  2WU5 A;  4JI2 T;  2W2U A;  3UUL A;  2D5U A;  2EHO B;  2NP9 A;  2LSK A;  4KHP T;  1W0A A;  4AKH A;  3ZJ1 A;  4DV3 T;  3AA7 B;  1E7P A;  4DID B;  3UQ4 A;  4DR7 T;  1MIW A;  4C90 A;  4EGW A;  4UEM A;  4IE5 A;  4IT4 A;  1UGO A;  4EZ4 A;  3OPC A;  4JI7 T;  4ZZC A;  4P09 A;  3I0Q A;  2KMF A;  4EEB A;  2K24 A;  3RYF E;  5FXV A;  1UK5 A;  3AEC A;  4ISS A;  4G2A A;  5FY1 A;  4ZI3 C;  4TNW A;  3FZK B;  3B13 A;  4TNV A;  4KHZ F;  2VK9 A;  2LE8 A;  1GQE A;  4ADZ A;  3ZCI A;  4ASK A;  1OED A;  2VQF T;  5ABE A;  3O1I A;  4O4L E;  4JI3 T;  5LCY A;  4AXP A;  5JRE A;  4QXH B;  3NZP A;  1WLX A;  2VUR A;  5BR8 T;  3C4X A;  2VVS A;  2ES0 A;  3D0T A;  3P50 A;  5HXS A;  2YU1 A;  3NZQ A;  3CVR A;  1N34 T;  1DU2 A;  3UU8 A;  3QNU A;  2WZI A;  3EVY A;  4TV8 E;  5LXT E;  2A72 A;  3UU5 A;  2XPK A;  5AQU B;  4AKR B;  3QB5 K;  3ZT5 A;  4GOU A;  2LJL A;  4I4T E;  1ZOY A;  3KVA A;  3QB5 A;  3WAK A;  4ILC A;  5KMG P;  1I6Z A;  1WYC A;  1ZHC A;  2KWI B;  5KXJ A;  3RIA A;  2MBG A;  2LT3 A;  4JI0 T;  4QXB B;  3PE0 A;  2DLR A;  2LSJ A;  3MXZ A;  4IDZ A;  2JJ9 A;  3N9N A;  3EHZ A;  1JNZ A;  3AVR A;  4YT0 A;  2LHN A;  4E7S A;  3VRA A;  2DCF A;  4EZH A;  3RRW A;  1HR0 T;  2WWV A;  1KNP A;  3GN5 B;  3HKB E;  4DV2 T;  2XQ7 A;  5J1G A;  4X1K E;  4ZOL E;  4UVB B;  5LHG B;  1XDP A;  2X9H A;  4UIG A;  4B3S T;  5CA0 E;  2CBJ A;  3JC6 D;  3OYZ A;  4PK4 A;  4DBR A;  1T7S A;  4PJJ A;  2Y6X A;  4A56 A;  2B1E A;  4ILA A;  2PFV A;  2D0U A;  4O4I E;  3SS1 A;  2XAS B;  5GON E;  4MBQ A;  4U2Z A;  4Z91 A;  1T8B A;  3RPU A;  4IRE A;  3AEB A;  1N33 T;  2PTF A;  4KUM B;  3NRY A;  5L3C B;  4KP3 C;  3GWH A;  3AE7 A;  3W15 B;  3N5L A;  3Q5W A;  3N9Q A;  2K9A A;  2QYW A;  4ZI7 E;  1MND A;  4HFC A;  4HFV A;  4ZEY A;  4ZHQ E;  1HF8 A;  2W4X A;  3AA6 B;  3AEA A;  4FJO A;  3LDQ B;  3SOL A;  5HEG A;  1HX8 A;  4EXT A;  2CM0 A;  5L3F B;  3KIN B;  2XQY A;  2V7I A;  5CA1 E;  1ZKE A;  2AE9 A;  2Y8D A;  4YXD A;  2WP9 A;  5JRC A;  4WYV A;  5FL1 A;  3MAC A;  2NTY A;  2FJD A;  4A97 A;  2X0H A;  4ZS3 A;  3QC9 A;  3AE8 A;  3ZC0 A;  2WM9 A;  3P4P A;  4X62 T;  4EAH A;  2CE7 A;  2DL1 A;  2BS4 A;  3VKG A;  2B76 A;  3ANW A;  5ABH A;  5M4Y A;  2V6Y A;  1B7T A;  4WBN E;  4K0U A;  5AQL B;  2KSR A;  5C3J A;  2VKO A;  5AQI B;  3UU4 A;  4DV6 T;  4F6R C;  4U33 A;  5ABG A;  3OVU A;  3E08 A;  5JDN A;  2BKN A;  2QRX A;  3UU6 A;  2VKH A;  3EDU A;  1V9D A;  5LHI B;  4TV9 E;  2R6G F;  2CPT A;  1BR1 A;  5JDF A;  1NWM X;  5L3D B;  5HEO A;  2WWU A;  1D0Z A;  3ZSS A;  4AI6 A;  3ZYL A;  2Q9Q C;  3N9O A;  4PK6 A;  2BZB A;  2V8S V;  2JQK A;  2WU2 A;  3ZCJ A;  5HEJ A;  1HNW T;  3C4Z A;  2XAH B;  3ZC1 A;  1U4Q A;  5JRC B;  2NWB A;  4O8S A;  2SPC A;  3VR8 A;  5L4E A;  3FZM B;  4ERR A;  1WYB A;  2IHR 1;  2UU9 T;  1WCR A;  3ZMV B;  2ZM2 A;  5FL0 A;  2XQ9 A;  3KV9 A;  3RX6 A;  4UEL A;  5FXW A;  2YEV C;  4QX8 B;  5LP6 E;  3ZT7 A;  4KX6 A;  1HTJ F;  3UFE A;  3ANW B;  3FZL B;  4O4J E;  2V6Y B;  4XAX B;  2Q9Q B;  1WRD A;  3Q5E A;  1G73 A;  1EZ3 A;  3AB3 B;  3NBX X;  4H9S E;  1IAP A;  4EB6 E;  2XAG B;  3ZT6 A;  4QXC B;  2CXD A;  3FBL A;  2WZH A;  3AEG A;  1BR0 A;  4Z8X A;  3N9L A;  3KBT A;  5C8Y E;  5JDL A;  4TWD A;  4AKI A;  2WBL A;  4ZZB A;  3C50 A;  5EK4 A;  4JYA T;  2IML A;  4J2C A;  2Z6E A;  2W61 A;  1FIO A;  4DV4 T;  2MAW A;  4H9R C;  1E1H B;  1HG2 A;  4O2A E;  4ANJ A;  1UCU A;  3T1H T;  3B5M A;  4FI5 A;  3KV5 A;  3HI2 A;  3RKG A;  3JCF A;  4B3M T;  3KBU A;  2XAF B;  3HKC E;  5DJQ C;  4ZXL A;  1FJG T;  2K48 A;  4QHO A;  2UUB T;  3LK4 2;  1D0X A;  5CFB A;  4H9N C;  3SFE A;  4HKA A;  4U3C A;  3RGL A;  2YDR A;  2DHR A;  4LFA T;  2BVL A;  2PBI A;  1SHZ C;  5FVK A;  1L0V A;  4DR6 T;  2JMH A;  4YLH A;  1UUR A;  5AQJ B;  2E5V A;  4H63 H;  4AKG A;  4JEU B;  2YKS A;  2BDE A;  3OYX A;  5HXC A;  4ILB A;  1SA0 E;  3VU7 H;  1WFD A;  4YSY A;  4EV6 A;  4PW8 A;  2W66 A;  4IIJ E;  2XAQ B;  2NR4 A;  1XNR T;  3OJA A;  2YDQ A;  4Z90 A;  2WCA A;  5A1L A;  3ZYM A;  3AAA B;  4JI5 T;  4X65 T;  3TLU A;  2P9B A;  2X9W A;  4YJ2 E;  3LG7 A;  3E22 E;  5FY0 A;  3ETU A;  1S35 A;  4L5G A;  2BBH A;  2N2N A;  3HL6 A;  1VCT A;  2CWY A;  2LRL A;  1XMO T;  2L8K A;  3P4W A;  4QH5 A;  2H89 A;  3LFM A;  5LHH B;  3KFW X;  5CB4 E;  4YY3 T;  3PV0 F;  3NVO A;  3KVB A;  4UVC B;  3AXJ A;  5IWA T;  2XQ8 A;  3GN5 A;  3FZF B;  3QOF A;  2E2A A;  2L3L A;  4PK5 A;  4JLE A;  1HNZ T;  3EAM A;  4U2Y A;  4AIU A;  4KI0 F;  4HFI A;  3TLT A;  2PJQ A;  1WR0 A;  2QA7 A;  4ZI2 C;  5L4H A;  5LYJ E;  4HWH A;  5AQS B;  3FHN A;  2HN2 A;  3RLF F;  4IDQ A;  2VVN A;  4DR4 T;  4GK0 E;  3G06 A;  4WNK A;  4BJM A;  3UTK A;  1D0Y A;  1MMG A;  4IDN A;  5TAO A;  3PUA A;  4BA9 A;  3FB2 A;  3L09 A;  4HEA A;  4LML A;  2WDR A;  3PUW F;  4DR3 T;  3OBV E;  3AE2 A;  2MTQ A;  5AFU L;  5HAX A;  3AE1 A;  5KDM C;  1M62 A;  2LOS A;  2CBI A;  5AQP B;  3T8O A;  4DV7 T;  3KV4 A;  3RQW A;  4HFE A;  2LSI A;  5L2L A;  2WDV A;  3KDS E;  2JQH A;  1QUU A;  2J1D G;  2FUP A;  3AXJ B;  2J4G A;  2C5K T;  3CX6 B;  2W00 A;  5H6Q B;  4K0K T;  4PJL A;  5LJN A;  3ZEF B;  4WZX A;  1NAF A;  4DVD A;  3PUX F;  3VR9 A;  3IHR A;  2XQA A;  2XSA A;  2IC6 A;  3PUG A;  4HFH A;  2XQ5 A;  2XM2 A;  3M3Z B;  3PTR B;  4AQF A;  5IYZ E;  3PDY A;  3AE5 A;  3VKH A;  2HHH T;  2I59 A;  3CWZ B;  1VRB A;  2E9X C;  2IAK A;  2LSY A;  3LSV A;  3EI0 A;  4DMV A;  2ZLY A;  4YSX A;  2BG9 C;  4YJ3 E;  5AQO B;  4EIW A;  5JQG E;  4O2B E;  3K3O A;  2CMR A;  3ZN1 B;  3ETV A;  1BR2 A;  3L3P A;  2V7L A;  3OKQ A;  2M6I A;  2D9D A;  2DWK A;  3AAI A;  2YK0 A;  4AQF C;  3AVS A;  2Q9Q D;  3CQC B;  3CX7 B;  2WS3 A;  2Y48 B;  3C51 A;  4A98 A;  2E9X B;  2WQY A;  5LB7 B;  5LGU B;  4MFR A;  4HWI B;  2LM2 A;  5HWX A;  3F31 A;  2FBW A;  2BKO A;  2JRK A;  2BG9 B;  1HCI A;  3ZMS B;  5HCJ A;  2I6H A;  3ZJ2 A;  3HKD E;  2LRK A;  3SRZ A;  4AQY T;  1R8I A;  4TWF A;  4I0U A;  5HEH A;  4E7Z A;  3J7Y q;  4NIQ A;  4X5T A;  4YTN A;  4H9P C;  1I94 T;  4LF4 T;  1MMN A;  2OV9 A;  3AE4 A;  3ZST A;  3UUX B;  1KK7 A;  3RC8 A;  2XAJ B;  3ZLI A;  2XHE B;  2ODV A;  1IJ6 A;  3N9M A;  5LGN B;  1FMW A;  3L39 A;  3CQG B;  2NTX A;  3A8Y C;  3Q5X A;  1G8X A;  2XQ3 A;  2XSB A;  4U7I A;  5J0Z A;  1KFY A;  5EZY E;  1VCS A;  5AQR B;  5JH7 E;  3O9X A;  3RKO A;  4MLK A;  4U74 A;  3F57 A;  3PU3 A;  3RQU A;  3U3I A;  5FP3 A;  4IST A;  5LJM A;  4CI1 B;  4CI3 B;  4COF A;  3K3Q C;  2Q9Q A;  5LG3 A;  1HFA A;  4WW0 A;  1YQ3 A;  3L8R A;  1D1B A;  4M1P A;  1HNX T;  3UUB A;  2VQE T;  1XZY A;  4MHC A;  4L0R A;  4DND A;  2YDS A;  2KXP B;  5AQK B;  1JNR A;  4DV1 T;  3AE9 A;  2WSS V;  3CKD A;  1US7 B;  3PJA J;  3MK7 C;  3V5S A;  4CQI A;  1IJ5 A;  5CJ5 A;  1YXR A;  4IDO A;  4LFC T;  4I55 E;  4B3R T;  4CXW A;  2BBJ A;  5DQW A;  4LF6 T;  3RYI E;  2QGS A;  1J5W A;  3PUY F;  3RC3 A;  1W9R A;  3QUJ A;  4LFB T;  2W63 A;  4F8H A;  2MOZ A;  2ZM6 T;  2PG8 A;  4IE4 A;  1D1C A;  4GYS A;  2RA1 A;  2WB5 A;  2MYS A;  3PJA A;  2HPL A;  3HKE E;  3TLW A;  5F3J A;  3MKD A;  2VB6 A;  4TX5 A;  3DP7 A;  2BG9 E;  1YKE B;  1LKX A;  5FXZ A;  3AEF A;  3AED A;  5J2U E;  2XY8 B;  3DTO A;  5ABF A;  2QVA A;  2V6X A;  5FKY A;  1NEN A;  3ONL C;  2GK9 A;  4TUY E;  5F8P A;  4P0A A;  3Q9D A;  2H7O A;  2FJB A;  2UUC T;  4QWN B;  5LA6 E;  3M65 A;  4I43 B;  4U7Y A;  2W67 A;  3T1Y T;  2UXN B;  4HTE A;  5ADX L;  1UX4 A;  1WR6 A;  2C0S A;  4LMK A;  1W0B A;  5C2T A;  3VHL A;  2CCQ A;  4QKN A;  3LJC A;  4PJN A;  2IDO B;  5LMU T;  1MIY A;  5F5W A;  2UXC T;  4DV0 T;  2YOE A;  4V1A v;  4O4H E;  3CK6 A;  4UR9 A;  3AE6 A;  2A9U A;  3JAF A;  3Q2M A;  4DR1 T;  3ZMZ B;  2UUA T;  4HWF A;  3P7I A;  3C64 A;  5JDG A;  2OLT A;  1XNQ T;  2C5J A;  1KEY A;  4YHH T;  4ZI2 D;  3BQK A;  3H3M A;  5DAB A;  2C5I T;  4X64 T;  2CLY C;  4UXN B;  2XUE A;  1IBM T;  4HFD A;  3GA8 A;  5AQM B;  1SE7 A;  2DI4 A;  4X66 T;  2X67 A;  2X0L B;  5LMN T;  5HXH A;  5ABF B;  2BS2 A;  4NXN T;  4CN6 A;  4LF5 T;  2A3D A;  4BJN A;  3RIU A;  4HWC A;  1MIV A;  4B3T T;  3ONX A;  3K1S A;  2KLQ A;  3B57 A;  3TLV A;  4P1N A;  3FXD B;  5LBM A;  3WAJ A;  2WMO A;  4DUZ T;  1W09 A;  4PJM A;  4HWD A;  5JVD E;  5AQQ B;  4X1Y E;  4KBM B;  4U31 A;  2CXF A;  2CLY B;  4B6X A;  4GKJ T;  3RIF A;  3AEE A;  5J2T E;  5H6R B;  4YSZ A;  2M6B A;  1T72 A;  1J5E T;  5JDH A;  3ZYK A;  3WI3 A;  5FY7 A;  2VWA A;  5AQN B;  4GYR A;  4UV9 B;  2WY2 A;  3RIU C;  4JV5 T;  2ZMA A;  1LRZ A;  1LVK A;  1KNR A;  2E8I A;  4LF8 T;  5HCM A;  4OYJ A;  3MJX A;  2M67 A;  2LM9 A;  5LG4 A;  3P8C D;  4YTM A;  3AA1 B;  4OFZ A;  1HX1 B;  2IW5 B;  5LBQ B;  4AKL A;  1S94 A;  3PUS A;  2E9X D;  4H9Q C;  5AQH B;  1O3X A;  2CA5 A;  4QH4 A;  3U78 A;  1ZP0 A;  3N2K E;  3JAE A;  2RPA A;  4HFB A;  4CI2 B;  1MMD A;  3V5U A;  2W62 A;  1IBL T;  3LBX B;  4L9I A;  2V7J A;  4IDP A;  2AXD S;  4A5X A;  4AQG A;  4UF0 A;  2IIU A;  4KMC A;  4YTP A;  4HE8 A;  4N78 D;  2G0U A;  3IEE A;  3FZH B;  4DV5 T;  2ACZ A;  1XDO A;  3HA4 A;  1FMV A;  4EYY R;  4H63 V;  3IBP A;  2XQ4 A;  2XTL A;  4DBQ A;  5FMN A;  4LF9 T;  3E0Z A;  3UUM A;  1Z8U A;  4TZ4 C;  3ESL A;  5E0O A;  4XBF B;  1N36 T;  4CXX A;  2UXD T;  4P0B A;  1YD8 G;  4IL4 A;  2KWH A;  3RYC E;  4JUY A;  2E9X A;  1OED C;  5HXR A;  3BQL A;  3ZN0 B;  4JI4 T;  2LSG A;  3AAE B;  2KND A;  4OX9 T;  2VAS A;  2LKH A;  2FJA A;  3I1A A;  2BG9 A;  3EAB A;  4OYK A;  3H3A A;  4HN9 A;  2D0T A;  2X68 A;  1UX5 A;  4PAG A;  5L47 A;  4XZC A;  1MMA A;  3IA3 A;  3R6N A;  2NOX A;  4ILU A;  2X9Y A;  3ZKR A;  2H88 A;  1Z0P A;  1E2A A;  1XWM A;  5EK3 A;  4EYU A;  2KT9 A;  4GKK T;  2WAU A;  2KIN B;  5JDM A;  3TLS A;  2F4V T;  3RRC A;  5AQV B;  3RYH E;  4EOZ B;  4GK5 E;  3SWH A;  2CRB A;  4UF0 B;  1OED B;  2J47 A;  5AQG B;  2VKJ A;  4JI1 T;  2ZM8 A;  2JQ9 A;  3RI5 A;  1ZEE A;  2K3W A; 
#chains in the Genus database with same CATH homology
 1R8I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...