1R8IA

Crystal structure of trac
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
187
structure length
187
Chain Sequence
b'TELIKQGEQLEQMAQQLEQLKSQLETQKNMYESMAKTTNLGDLLGTSTNTLANNLPDNWKEVYSDAMNSSSSVTPSVNSMMGQFNAEVDDMTPSEAIAYMNKKLAEKGAYDRVMAEKAYNNQMQELSDMQALTEQIKSTPDLKSIADLQARIQTSQGAIQGEQAKLNLMNMLQQSQDKLLRAQKDRA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TraC
molecule tags Structural protein
source organism Escherichia coli
publication title Structural and functional characterization of the VirB5 protein from the type IV secretion system encoded by the conjugative plasmid pKM101
pubmed doi rcsb
total genus 70
structure length 187
sequence length 187
ec nomenclature
pdb deposition date 2003-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07996 T4SS Type IV secretion system proteins
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.430 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Type IV secretion system, VirB5-domain 1r8iA00
1R8IA
chains in the Genus database with same CATH superfamily
3N2OA 2PBIA 4HWDA 1KF6A 2JQQA 2LHRA 2LLYA 2L9QA 2R6GF 5ABGA 5L3GB 2Z6EA 4IDQA 1E2AA 2UXBT 2A3DA 4U72A 2M67A 3FBLA 3RYIE 3VR8A 1XMQT 1XZYA 3VHLA 2I6HA 5ABHA 2EHOB 4DV2T 4O4JE 3EUHA 3N9QA 5CJ5A 4YT0A 4CI1B 4P0BA 4DV5T 3TLUA 2VK9A 3IF8B 2Q9QB 3U3IA 5AQOB 2VKHA 3E08A 3KBUA 2DCFA 3BQIA 2YU1A 2ZLYA 3KINB 4AISA 3RIAA 5IUXA 1J5WA 4PJNA 4QX8B 4YLHA 1U4QA 5EK4A 5LGTB 4A98A 4EZHA 4DR3T 1N32T 3IA3A 1MNDA 2ACXA 2VKJA 4IDOA 3RYHE 4CXWA 5IWAT 4LFBT 1FEWA 4HFDA 3HKBE 4YJ2E 1YKHB 5JH7E 3K3NA 1Z8UA 1XMOT 3B57A 5JDFA 5LBQB 4ILBA 4TWFA 2Q9QC 1LVKA 2K3WA 5FP3A 5FVKA 4UVCB 2A72A 4UVBB 2XQ7A 3FB2A 3RPUA 2H7VC 3P4PA 3L3PA 3VRBA 4DVDA 2KSRA 3FZLB 2LM2A 1JNRA 5DJQC 2BS2A 3TLVA 2EHOC 3QB5K 4EZ4A 3ZMZB 2YEVC 2M6BA 1HX1B 1SA0E 2XQYA 2Y8DA 4ZI7E 5C3JA 1KEYA 2XUEA 4X20E 5FXWA 2E9XA 3LJCA 4GK5E 3TLTA 1OEDC 3PDYA 4PJMA 5L3CB 2YDRA 1MMGA 5LJNA 2V5DA 4YY3T 3RRCA 4X66T 3O4XE 2MBGA 4B3TT 1W0BA 3AECA 3LBXB 4DV6T 4HWCA 2X9YA 3UU5A 3SFDA 1KFYA 2LSIA 5LBMA 2XY8B 2V7LA 4DV7T 3ETUA 5IYZE 3PV0F 4KI0F 2V7IA 1KNPA 3N9OA 2IMLA 1T8BA 2C5IT 2K9AA 2VKDA 1D1CA 1UK5A 2N2NA 2WB5A 3K3QC 3NRXA 5AQIB 3ZMVB 3RI5A 5L3DB 2KNDA 4ADZA 4AKGA 2N1GA 2DLRA 1YQ3A 2W67A 4QX7B 3ZCIA 3WAJA 3L39A 4GKJT 4LFCT 4CI3B 2B76A 2J47A 4GYSA 3RKGA 4HFHA 2WWVA 4O4LE 3PUSA 5FY1A 4FI5A 3W15B 2L8KA 2E8IA 4UXNB 3A5XA 2E5LT 2BG9C 2G0UA 1W0AA 4QH5A 1W9RA 2LSGA 3LK2B 2XAGB 1US7B 2K48A 3M3ZB 4WW0A 1XNQT 4AKIA 3ZC0A 2CA5A 5LJMA 5HEUA 5FXVA 1S94A 5F8PA 3RX6A 4EB6E 5EK2A 3N9PA 3UU6A 3Q5WA 3H37A 2LJLA 5J2TE 1CHUA 2IC6A 2M6IA 1YW0A 4X1KE 4TX5A 4CN1A 4JYAT 1BR4A 1MIYA 1HTJF 1OXZA 3PUQA 1WR6A 4YFSA 3ZKRA 2RP4A 4A97A 2X51A 4JI0T 1D1BA 2NP9A 5AQJB 3AE8A 1QLBA 3AVRA 2VVNA 3CMLA 3DTOA 4UR9A 5L4HA 1CUNA 4PFPA 3R6NA 3AEGA 2X9HA 1W09A 2A9UA 4ZS3A 5EZYE 4H9SE 3ZN0B 4EIWA 1OWAA 4L5GA 2P9BA 1R8IA 1WR0A 2BZBA 5FY7A 3HKEE 3P4RA 3AA1B 4HN9A 4TWHA 5H6QB 4AKRB 4IE5A 3EDUA 4IE7A 5FY0A 5CFBA 2CM0A 2FJAA 2OLTA 5L2LA 2LOSA 3UULA 3AB3B 3F57A 4K0UA 5HCJA 1B7TA 2PG8A 2XHEB 4OX9T 2LSJA 3FBZA 4HFIA 3T8OA 5LNKA 4U33A 4O4IE 2YDSA 1L0VA 2WS3A 4WBOA 3RGLA 3UU3A 5JR9B 4JI1T 2XQAA 4KX6A 4PK6A 2V7KA 1T98A 2Y48B 2IUBA 2LOPA 2WQYA 3EHZA 2CLYB 2FJEA 1UUSA 2MTQA 4DR5T 2IAKA 5EK3A 2C5JA 3AA0B 2MYSA 2IC9A 5BR8T 1BR2A 5FL1A 1KNRA 2CMRA 3TLWA 4HFEA 1HNZT 3CWZB 4ILUA 4DR6T 4JEHB 2XQ3A 3PUYF 4B3MT 3EABA 5HAXA 2ZM2A 4ZI3D 4IREA 4WNKA 1D1AA 2X0LB 2BKNA 1VCTA 3FXDB 4OYJA 4H9NC 4BJNA 1ZHCA 2AE9A 3C4XA 3WI3A 5CGMA 4AXPA 5ABFA 1XNRT 4AQGA 2WY2A 2WWUA 2XQ4A 2W00A 4HWHA 1GQEA 2VKOA 3ESLA 2LT3A 4X5TA 3AVSA 3IBPA 2WM9A 1D0XA 4NPPA 3P50A 5JR9A 4EOZB 1AJ3A 2CXLA 5AQUB 1X79A 2PJQA 2YOEA 4JBWF 5HEGA 3Q5XA 1UX5A 2PFVA 4YTMA 3ZT7A 4F6RC 1IJ6A 4H9OC 4JEUB 2D9DA 3ZSSA 5L3EB 4QXBB 2X0YA 2BBJA 3NZPA 4JUYA 5AFUL 4GOUA 2WZIA 3D0TA 4TWDA 5CA1E 4LF6T 4TUYE 4JI4T 3CQXC 2RPAA 2WZHA 4YSXA 4N78D 3HR0A 4IE6A 3RIFA 3ZSTA 4H63V 2H3RA 4TV9E 2DWGA 2LRKA 2V1DB 5AQGB 3L09A 1J1JA 3JAEA 3JCFA 4LMJA 4Q25A 4PJJA 2D0UA 3HI2A 3RC8A 5CB4E 4TV8E 2CBIA 5E0OA 2CBJA 3K1SA 5ABEA 1UGOA 1MMAA 4HGAA 4OHFA 3VRAA 2KLQA 1KK7A 2NTYA 4P09A 5FKYA 5LG4A 3ZJ2A 4H9RC 2DHRA 2JMKA 3C64A 3VR9A 5HWYA 3X1DA 5AQHB 2KXPB 2LKHA 4YTPA 5HXHA 3B13A 1G73A 2WBLA 3RH3A 2WU5A 4EEBA 1ZP0A 4TZ4C 4HFCA 3K8PC 4UIGA 4O2BE 4UV8B 3NBXX 2LHNA 2ACZA 2XM2A 3CIRA 4Z90A 3AE4A 2D5UA 3V5UA 3Q5EA 2WMNA 3AAEB 2YU2A 3AA7B 3ZPOA 5AQPB 2JRKA 3KDSE 3ONJA 3PJAJ 2CXFA 3AE1A 4B6XA 4JI5T 1HS7A 2NWBA 4C91A 3AAIA 3WAKA 4JI8T 4DR7T 2C0SA 2W63A 4PK5A 3I9WA 3PTRB 3ZYLA 2J1DG 1DU2A 3UQ4A 2W4XA 3AE3A 4HFVA 4EYUA 2WDQA 3RC3A 3I9YA 4IHJE 4U7IA 1MIWA 5AQKB 2UUBT 2MPKA 4H63H 5HCMA 4ZS2A 1T72A 3K3OA 3GWHA 5FL0A 1VRBA 2LE8A 3Q5DA 2SPCA 4BJMA 3O9XA 2KZ7B 5LOVE 4CN6A 2D0TA 4DR2T 2Q9QA 1HFAA 4HWFA 3AE7A 2EHOD 3ZT6A 1E1HB 3UFGA 3NZQA 4C90A 4DR1T 4ASKA 2IDOB 4HFBA 3LBXA 2CWOA 2E9XB 3A8YC 3MKDA 4QH4A 4UELA 1ZEEA 4J2CA 3ZT5A 2NOXA 3KV6A 3QB5A 2BKOA 2KWIB 3N9LA 4I50E 4EAHA 1Y64B 1I6ZA 4WYVA 4X64T 2W2UA 3GA8A 3VKGA 2UU9T 2IHR1 3KVBA 1T7SA 2X66A 4DUYT 3EDVA 3HA4A 3O1IA 2V6YA 1VOMA 2LSKA 4EV6A 1OEDA 3ZJ1A 1IBKT 1IZNB 3MXZA 4DMVA 2KINB 1WFDA 3BQKA 4MALA 4MBQA 5DQWA 5HYAA 2X68A 5JRCB 2NW7A 2CE7A 1MMNA 4QH1A 1S35A 4ZI3C 4KUMB 2FJBA 2J4GA 4LF8T 4CXXA 4GKKT 1D0ZA 3F31A 2XAFB 3SFEA 4BAYB 4LF4T 1BR0A 2I0MA 2JQKA 4ZZCA 4WZXA 5BMVE 5LGUB 4MLKA 3P8CD 3AEDA 4GYRA 3ZC1A 4A56A 2V5CA 3I1AA 2V26A 4KHPT 3CX8B 5TAOA 1NAFA 2BS3A 3JC6C 4H9QC 4AQFA 1MIVA 2YDQA 1IJ5A 3ETVA 1N34T 5AQNB 4ZZBA 3R84B 2BG9E 3LK42 3CQCB 4PK4A 1KNZA 3AEBA 3LK3B 4AQFC 1NWMX 2WAUA 1MMDA 1O3XA 3AXJA 3RRWA 4YTNA 5LG3A 3C4WA 3P4SA 4IGUA 5LHHB 3B5MA 3LFMA 3ANWB 4XBFB 3PUVF 4CN4A 3C50A 1UX4A 5AQVB 2VQFT 3LDQB 3Q2MA 3EAMA 3OBVE 3UT5E 1SE7A 3UUMA 5J2UE 2UUCT 4BA9A 2UXXB 3IEEA 3ONLC 5FYMA 3JC6D 4O2AE 4V1Av 2CLYC 2UXNB 3O1HA 4LMKA 2WU2A 5AQRB 2CPTA 3MJXA 3RYCE 1M7KA 2NTXA 3AXJB 1G8XA 5KX5E 5C8YE 5JDHA 5JREA 2ZMAA 2F4VT 3OTOT 1LVFA 4DBQA 1NEKA 4ISTA 1WLXA 5JDNA 3ZMTB 5KMGP 2CHNA 4KMCA 2V7MA 4G2AA 1HX8A 4IE0A 4ILAA 3AAAB 4KP3C 3UUBA 5JDGA 4CXYA 3UFEA 3UTKA 3FZFB 4P0AA 4U7YA 4WBNE 5L3FB 3FZKB 2IW5B 2FUPA 2WSSV 2K24A 3MK7C 2DNXA 4HE8A 2ZM6T 2LRLA 2WCAA 2OA5A 3O1JA 3QNUA 5ADXL 3PE0A 4I4TE 4U2ZA 4UF0B 2BG9A 3I0QA 5ETWA 3KFWX 1FMWA 4DBRA 4AI6A 1ZKEA 1LKXA 3KV9A 4JI2T 3AE2A 2XQ5A 3EVYA 2ZM0A 1BR1A 3FZMB 2BVLA 4CI2B 2IIUA 3PU8A 2E9XD 1M62A 1VCSA 2X9XA 3PJAA 4YXDA 5A1LA 1OEDB 4B3ST 3CPZA 2CWYA 3BK9A 3SWHA 2V7JA 1YD8G 4EGWA 5H6RB 2CEAA 3CX6B 1I94T 2WDRA 5LYJE 3OYXA 3C98B 4IL4A 1E7PA 3PUGA 2L3LA 1QUUA 1IAPA 2QVAA 3AE9A 1HG5A 1HCIA 2EHOA 3AEEA 4FJOA 2C5KT 3HL6A 2Q9QD 2H89A 2CCQA 1WCRA 3ANWA 2J62A 3C51A 3OKQA 3PUZF 4PNIA 3S4UA 2XQ6A 2VQET 1XWMA 4UEMA 2D2SA 3UQ7A 1HNXT 2E9XC 3NWIA 4GIWA 2VL8A 3DJBA 2W62A 4AKLA 4DO0A 2QYWA 2WP9A 5LA6E 2QRXA 3PUWF 1IBLT 3T1YT 1N33T 4X62T 5HWXA 2GK9A 4PAGA 2HH7A 3KVAA 2W61A 2ODVA 2ES0A 4UV9B 5AQLB 4O8SA 2LSYA 4YSZA 1YKEB 5FXXA 1HF8A 5AQTB 3JAFA 3UUXB 2BBHA 1ZV4X 2XAHB 3F2EA 5FXZA 2CHOA 2CXDA 3MACA 4XZCA 3TKLB 2QGSA 2JQ9A 3ZYKA 3ZN1B 3C4ZA 3HKCE 5LHIB 3L8RA 2XM1A 3AEFA 5JTGA 5JDMA 4DV1T 4A5XA 4LFAT 1EZ3A 1LRZA 3ONXA 3ZCJA 4E7ZA 1UURA 5JRCA 5LGNB 5LXTE 1HG2A 1XDOA 1WYCA 3ZYMA 2XZEA 2VASA 2Y6XA 3AA6B 5HXEA 2V8SV 1Z0PA 4TNVA 5HEOA 4IE4A 4DV0T 4L0RA 4JI7T 3QOFA 4OK0A 3PUXF 2JQHA 2V6YB 3H3AA 2WDVA 1OEDE 2B1EA 3IHRA 1V9DA 2KT9A 3NRYA 4CZZB 3KV4A 3OVUA 4O4HE 2X9WA 3LG7A 4NUUA 3J7Yq 3UU4A 4MFRA 4YHJA 4JLEA 5HEJA 1JNZA 3RKOA 2I59A 1MNEA 3RIUA 4ANJA 3ZEFB 4AKHA 2VWAA 3RQUA 2YK0A 4U74A 4EXTA 1X9BA 4X65T 2H88A 2RA1A 3FHNA 5DQVA 3T1HT 5IHYA 3RIUC 2YKSA 3OJAA 2BDEA 3FZHB 5HEHA 4AIUA 4ZI2D 5J0ZA 4JI6T 5HXCA 2UUAT 1FJGT 2DWKA 5JQGE 4CQIA 2LEHA 3GN5B 2CRBA 3CK6A 4M1PA 4NUVA 2XSBA 3ZLIA 5KDMC 3N9MA 1XDPA 2JPFA 2YN6A 3A7MA 4IL9A 4EEDA 4ERRA 2ZM8A 4LF5T 3PUAA 5JDQA 4OYKA 2K5BB 4U3CA 1H7CA 4QWNB 2KWHA 2MOZA 4IDPA 3PURA 1ZOYA 3QUJA 2H7OA 4UVAB 5AQMB 4DV3T 2UXDT 5JVDE 1WRDA 2HPLA 2LM9A 4LMLA 3AE5A 2XAQB 4HKAA 4KHZF 5ABFB 2VB6A 2XJ7A 4NXNT 3OYZA 3ABVA 4HEAA 5LB7B 4QXHB 2BS4A 4IDZA 4AQYT 3KBTA 2W66A 4ZOLE 4JV5T 3I0OA 4YJ3E 4LF7T 4DR4T 5FMNA 3RLFF 3TLSA 3PU3A 3RYFE 4GK0E 3CVRA 4L9IA 3CQGB 5L47A 2JMHA 1UCUA 1Y01A 2MAWA 2W0GA 1FIOA 4PFOA 3RF1A 5LHGB 4XAXB 5L3BB 1IBMT 5LMNT 4K0KT 5KXJA 1HR0T 4B3RT 2LKGA 3E0ZA 5GONE 3SS1A 2HHHT 3OPCA 4HTEA 5FNVE 4HWIB 2BVMA 4QXCB 4DV4T 3QC9A 5JR9C 4DIDB 4U2YA 3H3MA 2V6XA 3E22E 2XTLA 4ISSA 1YQ4A 1D0YA 2AXDS 2XSAA 2DL1A 5J1GA 3UUNA 4JI3T 3P4QA 5LP6E 4MHCA 4I0UA 5DABA 2XPKA 3V5SA 2E2AA 4ZI2C 3ZMSB 5F3JA 3QK6A 1YXRA 4Z91A 3RQWA 2BKPA 3AEAA 4EYYR 4YHHT 2HN1A 3N5LA 3P4WA 3P7IA 5LCYA 4QKNA 1WYBA 4DUZT 4PJLA 4NXMT 5C2TA 5HXRA 5CA0E 3DP7A 2WMOA 1U5PA 2HN2A 2QA7A 2X0HA 2NW9A 4IIJE 5L4EA 2PTFA 2KMFA 3N9NA 4G63A 1N36T 3M65A 2NW8A 3SRZA 3NVOA 4ZHQE 4TN7B 3VKHA 5F5WA 3MZKB 4NIQA 5AQFB 3EI0A 3KV5A 1J5ET 3SOLA 2JIWA 4ZXLA 2NR4A 4P1NA 3N2KE 1SUMB 4QHOA 3ZMUB 3CKDA 3NKZA 4ZEYA 4TNWA 4I55E 4YSYA 2FBWA 2X67A 2XQ8A 4Z8XA 3J9X1 2VVSA 2UXCT 1QSDA 3HKDE 4IDNA 3UU8A 3U78A 2JJ9A 2N9DA 3MA9A 5AQSB 2BG9B 2YINA 4E7SA 5FVLA 1NENA 2XQ9A 4U31A 3N2GE 4X1IE 4KBMB 2ODUA 4OFZA 3JADA 5LMUT 2VURA 2HPJA 2E5VA 2FJDA 3G06A 4F8HA 2VL0A 4ILCA 1HNWT 4H9PC 2XAJB 4UF0A 1SHZC 1FMVA 2OV9A 3BQLA 2A2FX 3CX7B 5M4YA 4I43B 4PW8A 2DI4A 3GN5A 5AQQB 5JDLA 3RHWA 4DNDA 2XASB 3AE6A 3FXEB 3VU7H 4COFA 4LF9T 3Q9DA 4DMWA 5HXSA 3LSVA 4IT4A 4X1YE 3GMIA
chains in the Genus database with same CATH topology
1R8IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1R8I A; 
#chains in the Genus database with same CATH topology
 3N2O A;  2PBI A;  4HWD A;  1KF6 A;  2JQQ A;  2LHR A;  2LLY A;  2L9Q A;  2R6G F;  5ABG A;  5L3G B;  2Z6E A;  4IDQ A;  1E2A A;  2UXB T;  2A3D A;  4U72 A;  2M67 A;  3FBL A;  3RYI E;  3VR8 A;  1XMQ T;  1XZY A;  3VHL A;  2I6H A;  5ABH A;  2EHO B;  4DV2 T;  4O4J E;  3EUH A;  3N9Q A;  5CJ5 A;  4YT0 A;  4CI1 B;  4P0B A;  4DV5 T;  3TLU A;  2VK9 A;  3IF8 B;  2Q9Q B;  3U3I A;  5AQO B;  2VKH A;  3E08 A;  3KBU A;  2DCF A;  3BQI A;  2YU1 A;  2ZLY A;  3KIN B;  4AIS A;  3RIA A;  5IUX A;  1J5W A;  4PJN A;  4QX8 B;  4YLH A;  1U4Q A;  5EK4 A;  5LGT B;  4A98 A;  4EZH A;  4DR3 T;  1N32 T;  3IA3 A;  1MND A;  2ACX A;  2VKJ A;  4IDO A;  3RYH E;  4CXW A;  5IWA T;  4LFB T;  1FEW A;  4HFD A;  3HKB E;  4YJ2 E;  1YKH B;  5JH7 E;  3K3N A;  1Z8U A;  1XMO T;  3B57 A;  5JDF A;  5LBQ B;  4ILB A;  4TWF A;  2Q9Q C;  1LVK A;  2K3W A;  5FP3 A;  5FVK A;  4UVC B;  2A72 A;  4UVB B;  2XQ7 A;  3FB2 A;  3RPU A;  2H7V C;  3P4P A;  3L3P A;  3VRB A;  4DVD A;  2KSR A;  3FZL B;  2LM2 A;  1JNR A;  5DJQ C;  2BS2 A;  3TLV A;  2EHO C;  3QB5 K;  4EZ4 A;  3ZMZ B;  2YEV C;  2M6B A;  1HX1 B;  1SA0 E;  2XQY A;  2Y8D A;  4ZI7 E;  5C3J A;  1KEY A;  2XUE A;  4X20 E;  5FXW A;  2E9X A;  3LJC A;  4GK5 E;  3TLT A;  1OED C;  3PDY A;  4PJM A;  5L3C B;  2YDR A;  1MMG A;  5LJN A;  2V5D A;  4YY3 T;  3RRC A;  4X66 T;  3O4X E;  2MBG A;  4B3T T;  1W0B A;  3AEC A;  3LBX B;  4DV6 T;  4HWC A;  2X9Y A;  3UU5 A;  3SFD A;  1KFY A;  2LSI A;  5LBM A;  2XY8 B;  2V7L A;  4DV7 T;  3ETU A;  5IYZ E;  3PV0 F;  4KI0 F;  2V7I A;  1KNP A;  3N9O A;  2IML A;  1T8B A;  2C5I T;  2K9A A;  2VKD A;  1D1C A;  1UK5 A;  2N2N A;  2WB5 A;  3K3Q C;  3NRX A;  5AQI B;  3ZMV B;  3RI5 A;  5L3D B;  2KND A;  4ADZ A;  4AKG A;  2N1G A;  2DLR A;  1YQ3 A;  2W67 A;  4QX7 B;  3ZCI A;  3WAJ A;  3L39 A;  4GKJ T;  4LFC T;  4CI3 B;  2B76 A;  2J47 A;  4GYS A;  3RKG A;  4HFH A;  2WWV A;  4O4L E;  3PUS A;  5FY1 A;  4FI5 A;  3W15 B;  2L8K A;  2E8I A;  4UXN B;  3A5X A;  2E5L T;  2BG9 C;  2G0U A;  1W0A A;  4QH5 A;  1W9R A;  2LSG A;  3LK2 B;  2XAG B;  1US7 B;  2K48 A;  3M3Z B;  4WW0 A;  1XNQ T;  4AKI A;  3ZC0 A;  2CA5 A;  5LJM A;  5HEU A;  5FXV A;  1S94 A;  5F8P A;  3RX6 A;  4EB6 E;  5EK2 A;  3N9P A;  3UU6 A;  3Q5W A;  3H37 A;  2LJL A;  5J2T E;  1CHU A;  2IC6 A;  2M6I A;  1YW0 A;  4X1K E;  4TX5 A;  4CN1 A;  4JYA T;  1BR4 A;  1MIY A;  1HTJ F;  1OXZ A;  3PUQ A;  1WR6 A;  4YFS A;  3ZKR A;  2RP4 A;  4A97 A;  2X51 A;  4JI0 T;  1D1B A;  2NP9 A;  5AQJ B;  3AE8 A;  1QLB A;  3AVR A;  2VVN A;  3CML A;  3DTO A;  4UR9 A;  5L4H A;  1CUN A;  4PFP A;  3R6N A;  3AEG A;  2X9H A;  1W09 A;  2A9U A;  4ZS3 A;  5EZY E;  4H9S E;  3ZN0 B;  4EIW A;  1OWA A;  4L5G A;  2P9B A;  1R8I A;  1WR0 A;  2BZB A;  5FY7 A;  3HKE E;  3P4R A;  3AA1 B;  4HN9 A;  4TWH A;  5H6Q B;  4AKR B;  4IE5 A;  3EDU A;  4IE7 A;  5FY0 A;  5CFB A;  2CM0 A;  2FJA A;  2OLT A;  5L2L A;  2LOS A;  3UUL A;  3AB3 B;  3F57 A;  4K0U A;  5HCJ A;  1B7T A;  2PG8 A;  2XHE B;  4OX9 T;  2LSJ A;  3FBZ A;  4HFI A;  3T8O A;  5LNK A;  4U33 A;  4O4I E;  2YDS A;  1L0V A;  2WS3 A;  4WBO A;  3RGL A;  3UU3 A;  5JR9 B;  4JI1 T;  2XQA A;  4KX6 A;  4PK6 A;  2V7K A;  1T98 A;  2Y48 B;  2IUB A;  2LOP A;  2WQY A;  3EHZ A;  2CLY B;  2FJE A;  1UUS A;  2MTQ A;  4DR5 T;  2IAK A;  5EK3 A;  2C5J A;  3AA0 B;  2MYS A;  2IC9 A;  5BR8 T;  1BR2 A;  5FL1 A;  1KNR A;  2CMR A;  3TLW A;  4HFE A;  1HNZ T;  3CWZ B;  4ILU A;  4DR6 T;  4JEH B;  2XQ3 A;  3PUY F;  4B3M T;  3EAB A;  5HAX A;  2ZM2 A;  4ZI3 D;  4IRE A;  4WNK A;  1D1A A;  2X0L B;  2BKN A;  1VCT A;  3FXD B;  4OYJ A;  4H9N C;  4BJN A;  1ZHC A;  2AE9 A;  3C4X A;  3WI3 A;  5CGM A;  4AXP A;  5ABF A;  1XNR T;  4AQG A;  2WY2 A;  2WWU A;  2XQ4 A;  2W00 A;  4HWH A;  1GQE A;  2VKO A;  3ESL A;  2LT3 A;  4X5T A;  3AVS A;  3IBP A;  2WM9 A;  1D0X A;  4NPP A;  3P50 A;  5JR9 A;  4EOZ B;  1AJ3 A;  2CXL A;  5AQU B;  1X79 A;  2PJQ A;  2YOE A;  4JBW F;  5HEG A;  3Q5X A;  1UX5 A;  2PFV A;  4YTM A;  3ZT7 A;  4F6R C;  1IJ6 A;  4H9O C;  4JEU B;  2D9D A;  3ZSS A;  5L3E B;  4QXB B;  2X0Y A;  2BBJ A;  3NZP A;  4JUY A;  5AFU L;  4GOU A;  2WZI A;  3D0T A;  4TWD A;  5CA1 E;  4LF6 T;  4TUY E;  4JI4 T;  3CQX C;  2RPA A;  2WZH A;  4YSX A;  4N78 D;  3HR0 A;  4IE6 A;  3RIF A;  3ZST A;  4H63 V;  2H3R A;  4TV9 E;  2DWG A;  2LRK A;  2V1D B;  5AQG B;  3L09 A;  1J1J A;  3JAE A;  3JCF A;  4LMJ A;  4Q25 A;  4PJJ A;  2D0U A;  3HI2 A;  3RC8 A;  5CB4 E;  4TV8 E;  2CBI A;  5E0O A;  2CBJ A;  3K1S A;  5ABE A;  1UGO A;  1MMA A;  4HGA A;  4OHF A;  3VRA A;  2KLQ A;  1KK7 A;  2NTY A;  4P09 A;  5FKY A;  5LG4 A;  3ZJ2 A;  4H9R C;  2DHR A;  2JMK A;  3C64 A;  3VR9 A;  5HWY A;  3X1D A;  5AQH B;  2KXP B;  2LKH A;  4YTP A;  5HXH A;  3B13 A;  1G73 A;  2WBL A;  3RH3 A;  2WU5 A;  4EEB A;  1ZP0 A;  4TZ4 C;  4HFC A;  3K8P C;  4UIG A;  4O2B E;  4UV8 B;  3NBX X;  2LHN A;  2ACZ A;  2XM2 A;  3CIR A;  4Z90 A;  3AE4 A;  2D5U A;  3V5U A;  3Q5E A;  2WMN A;  3AAE B;  2YU2 A;  3AA7 B;  3ZPO A;  5AQP B;  2JRK A;  3KDS E;  3ONJ A;  3PJA J;  2CXF A;  3AE1 A;  4B6X A;  4JI5 T;  1HS7 A;  2NWB A;  4C91 A;  3AAI A;  3WAK A;  4JI8 T;  4DR7 T;  2C0S A;  2W63 A;  4PK5 A;  3I9W A;  3PTR B;  3ZYL A;  2J1D G;  1DU2 A;  3UQ4 A;  2W4X A;  3AE3 A;  4HFV A;  4EYU A;  2WDQ A;  3RC3 A;  3I9Y A;  4IHJ E;  4U7I A;  1MIW A;  5AQK B;  2UUB T;  2MPK A;  4H63 H;  5HCM A;  4ZS2 A;  1T72 A;  3K3O A;  3GWH A;  5FL0 A;  1VRB A;  2LE8 A;  3Q5D A;  2SPC A;  4BJM A;  3O9X A;  2KZ7 B;  5LOV E;  4CN6 A;  2D0T A;  4DR2 T;  2Q9Q A;  1HFA A;  4HWF A;  3AE7 A;  2EHO D;  3ZT6 A;  1E1H B;  3UFG A;  3NZQ A;  4C90 A;  4DR1 T;  4ASK A;  2IDO B;  4HFB A;  3LBX A;  2CWO A;  2E9X B;  3A8Y C;  3MKD A;  4QH4 A;  4UEL A;  1ZEE A;  4J2C A;  3ZT5 A;  2NOX A;  3KV6 A;  3QB5 A;  2BKO A;  2KWI B;  3N9L A;  4I50 E;  4EAH A;  1Y64 B;  1I6Z A;  4WYV A;  4X64 T;  2W2U A;  3GA8 A;  3VKG A;  2UU9 T;  2IHR 1;  3KVB A;  1T7S A;  2X66 A;  4DUY T;  3EDV A;  3HA4 A;  3O1I A;  2V6Y A;  1VOM A;  2LSK A;  4EV6 A;  1OED A;  3ZJ1 A;  1IBK T;  1IZN B;  3MXZ A;  4DMV A;  2KIN B;  1WFD A;  3BQK A;  4MAL A;  4MBQ A;  5DQW A;  5HYA A;  2X68 A;  5JRC B;  2NW7 A;  2CE7 A;  1MMN A;  4QH1 A;  1S35 A;  4ZI3 C;  4KUM B;  2FJB A;  2J4G A;  4LF8 T;  4CXX A;  4GKK T;  1D0Z A;  3F31 A;  2XAF B;  3SFE A;  4BAY B;  4LF4 T;  1BR0 A;  2I0M A;  2JQK A;  4ZZC A;  4WZX A;  5BMV E;  5LGU B;  4MLK A;  3P8C D;  3AED A;  4GYR A;  3ZC1 A;  4A56 A;  2V5C A;  3I1A A;  2V26 A;  4KHP T;  3CX8 B;  5TAO A;  1NAF A;  2BS3 A;  3JC6 C;  4H9Q C;  4AQF A;  1MIV A;  2YDQ A;  1IJ5 A;  3ETV A;  1N34 T;  5AQN B;  4ZZB A;  3R84 B;  2BG9 E;  3LK4 2;  3CQC B;  4PK4 A;  1KNZ A;  3AEB A;  3LK3 B;  4AQF C;  1NWM X;  2WAU A;  1MMD A;  1O3X A;  3AXJ A;  3RRW A;  4YTN A;  5LG3 A;  3C4W A;  3P4S A;  4IGU A;  5LHH B;  3B5M A;  3LFM A;  3ANW B;  4XBF B;  3PUV F;  4CN4 A;  3C50 A;  1UX4 A;  5AQV B;  2VQF T;  3LDQ B;  3Q2M A;  3EAM A;  3OBV E;  3UT5 E;  1SE7 A;  3UUM A;  5J2U E;  2UUC T;  4BA9 A;  2UXX B;  3IEE A;  3ONL C;  5FYM A;  3JC6 D;  4O2A E;  4V1A v;  2CLY C;  2UXN B;  3O1H A;  4LMK A;  2WU2 A;  5AQR B;  2CPT A;  3MJX A;  3RYC E;  1M7K A;  2NTX A;  3AXJ B;  1G8X A;  5KX5 E;  5C8Y E;  5JDH A;  5JRE A;  2ZMA A;  2F4V T;  3OTO T;  1LVF A;  4DBQ A;  1NEK A;  4IST A;  1WLX A;  5JDN A;  3ZMT B;  5KMG P;  2CHN A;  4KMC A;  2V7M A;  4G2A A;  1HX8 A;  4IE0 A;  4ILA A;  3AAA B;  4KP3 C;  3UUB A;  5JDG A;  4CXY A;  3UFE A;  3UTK A;  3FZF B;  4P0A A;  4U7Y A;  4WBN E;  5L3F B;  3FZK B;  2IW5 B;  2FUP A;  2WSS V;  2K24 A;  3MK7 C;  2DNX A;  4HE8 A;  2ZM6 T;  2LRL A;  2WCA A;  2OA5 A;  3O1J A;  3QNU A;  5ADX L;  3PE0 A;  4I4T E;  4U2Z A;  4UF0 B;  2BG9 A;  3I0Q A;  5ETW A;  3KFW X;  1FMW A;  4DBR A;  4AI6 A;  1ZKE A;  1LKX A;  3KV9 A;  4JI2 T;  3AE2 A;  2XQ5 A;  3EVY A;  2ZM0 A;  1BR1 A;  3FZM B;  2BVL A;  4CI2 B;  2IIU A;  3PU8 A;  2E9X D;  1M62 A;  1VCS A;  2X9X A;  3PJA A;  4YXD A;  5A1L A;  1OED B;  4B3S T;  3CPZ A;  2CWY A;  3BK9 A;  3SWH A;  2V7J A;  1YD8 G;  4EGW A;  5H6R B;  2CEA A;  3CX6 B;  1I94 T;  2WDR A;  5LYJ E;  3OYX A;  3C98 B;  4IL4 A;  1E7P A;  3PUG A;  2L3L A;  1QUU A;  1IAP A;  2QVA A;  3AE9 A;  1HG5 A;  1HCI A;  2EHO A;  3AEE A;  4FJO A;  2C5K T;  3HL6 A;  2Q9Q D;  2H89 A;  2CCQ A;  1WCR A;  3ANW A;  2J62 A;  3C51 A;  3OKQ A;  3PUZ F;  4PNI A;  3S4U A;  2XQ6 A;  2VQE T;  1XWM A;  4UEM A;  2D2S A;  3UQ7 A;  1HNX T;  2E9X C;  3NWI A;  4GIW A;  2VL8 A;  3DJB A;  2W62 A;  4AKL A;  4DO0 A;  2QYW A;  2WP9 A;  5LA6 E;  2QRX A;  3PUW F;  1IBL T;  3T1Y T;  1N33 T;  4X62 T;  5HWX A;  2GK9 A;  4PAG A;  2HH7 A;  3KVA A;  2W61 A;  2ODV A;  2ES0 A;  4UV9 B;  5AQL B;  4O8S A;  2LSY A;  4YSZ A;  1YKE B;  5FXX A;  1HF8 A;  5AQT B;  3JAF A;  3UUX B;  2BBH A;  1ZV4 X;  2XAH B;  3F2E A;  5FXZ A;  2CHO A;  2CXD A;  3MAC A;  4XZC A;  3TKL B;  2QGS A;  2JQ9 A;  3ZYK A;  3ZN1 B;  3C4Z A;  3HKC E;  5LHI B;  3L8R A;  2XM1 A;  3AEF A;  5JTG A;  5JDM A;  4DV1 T;  4A5X A;  4LFA T;  1EZ3 A;  1LRZ A;  3ONX A;  3ZCJ A;  4E7Z A;  1UUR A;  5JRC A;  5LGN B;  5LXT E;  1HG2 A;  1XDO A;  1WYC A;  3ZYM A;  2XZE A;  2VAS A;  2Y6X A;  3AA6 B;  5HXE A;  2V8S V;  1Z0P A;  4TNV A;  5HEO A;  4IE4 A;  4DV0 T;  4L0R A;  4JI7 T;  3QOF A;  4OK0 A;  3PUX F;  2JQH A;  2V6Y B;  3H3A A;  2WDV A;  1OED E;  2B1E A;  3IHR A;  1V9D A;  2KT9 A;  3NRY A;  4CZZ B;  3KV4 A;  3OVU A;  4O4H E;  2X9W A;  3LG7 A;  4NUU A;  3J7Y q;  3UU4 A;  4MFR A;  4YHJ A;  4JLE A;  5HEJ A;  1JNZ A;  3RKO A;  2I59 A;  1MNE A;  3RIU A;  4ANJ A;  3ZEF B;  4AKH A;  2VWA A;  3RQU A;  2YK0 A;  4U74 A;  4EXT A;  1X9B A;  4X65 T;  2H88 A;  2RA1 A;  3FHN A;  5DQV A;  3T1H T;  5IHY A;  3RIU C;  2YKS A;  3OJA A;  2BDE A;  3FZH B;  5HEH A;  4AIU A;  4ZI2 D;  5J0Z A;  4JI6 T;  5HXC A;  2UUA T;  1FJG T;  2DWK A;  5JQG E;  4CQI A;  2LEH A;  3GN5 B;  2CRB A;  3CK6 A;  4M1P A;  4NUV A;  2XSB A;  3ZLI A;  5KDM C;  3N9M A;  1XDP A;  2JPF A;  2YN6 A;  3A7M A;  4IL9 A;  4EED A;  4ERR A;  2ZM8 A;  4LF5 T;  3PUA A;  5JDQ A;  4OYK A;  2K5B B;  4U3C A;  1H7C A;  4QWN B;  2KWH A;  2MOZ A;  4IDP A;  3PUR A;  1ZOY A;  3QUJ A;  2H7O A;  4UVA B;  5AQM B;  4DV3 T;  2UXD T;  5JVD E;  1WRD A;  2HPL A;  2LM9 A;  4LML A;  3AE5 A;  2XAQ B;  4HKA A;  4KHZ F;  5ABF B;  2VB6 A;  2XJ7 A;  4NXN T;  3OYZ A;  3ABV A;  4HEA A;  5LB7 B;  4QXH B;  2BS4 A;  4IDZ A;  4AQY T;  3KBT A;  2W66 A;  4ZOL E;  4JV5 T;  3I0O A;  4YJ3 E;  4LF7 T;  4DR4 T;  5FMN A;  3RLF F;  3TLS A;  3PU3 A;  3RYF E;  4GK0 E;  3CVR A;  4L9I A;  3CQG B;  5L47 A;  2JMH A;  1UCU A;  1Y01 A;  2MAW A;  2W0G A;  1FIO A;  4PFO A;  3RF1 A;  5LHG B;  4XAX B;  5L3B B;  1IBM T;  5LMN T;  4K0K T;  5KXJ A;  1HR0 T;  4B3R T;  2LKG A;  3E0Z A;  5GON E;  3SS1 A;  2HHH T;  3OPC A;  4HTE A;  5FNV E;  4HWI B;  2BVM A;  4QXC B;  4DV4 T;  3QC9 A;  5JR9 C;  4DID B;  4U2Y A;  3H3M A;  2V6X A;  3E22 E;  2XTL A;  4ISS A;  1YQ4 A;  1D0Y A;  2AXD S;  2XSA A;  2DL1 A;  5J1G A;  3UUN A;  4JI3 T;  3P4Q A;  5LP6 E;  4MHC A;  4I0U A;  5DAB A;  2XPK A;  3V5S A;  2E2A A;  4ZI2 C;  3ZMS B;  5F3J A;  3QK6 A;  1YXR A;  4Z91 A;  3RQW A;  2BKP A;  3AEA A;  4EYY R;  4YHH T;  2HN1 A;  3N5L A;  3P4W A;  3P7I A;  5LCY A;  4QKN A;  1WYB A;  4DUZ T;  4PJL A;  4NXM T;  5C2T A;  5HXR A;  5CA0 E;  3DP7 A;  2WMO A;  1U5P A;  2HN2 A;  2QA7 A;  2X0H A;  2NW9 A;  4IIJ E;  5L4E A;  2PTF A;  2KMF A;  3N9N A;  4G63 A;  1N36 T;  3M65 A;  2NW8 A;  3SRZ A;  3NVO A;  4ZHQ E;  4TN7 B;  3VKH A;  5F5W A;  3MZK B;  4NIQ A;  5AQF B;  3EI0 A;  3KV5 A;  1J5E T;  3SOL A;  2JIW A;  4ZXL A;  2NR4 A;  4P1N A;  3N2K E;  1SUM B;  4QHO A;  3ZMU B;  3CKD A;  3NKZ A;  4ZEY A;  4TNW A;  4I55 E;  4YSY A;  2FBW A;  2X67 A;  2XQ8 A;  4Z8X A;  3J9X 1;  2VVS A;  2UXC T;  1QSD A;  3HKD E;  4IDN A;  3UU8 A;  3U78 A;  2JJ9 A;  2N9D A;  3MA9 A;  5AQS B;  2BG9 B;  2YIN A;  4E7S A;  5FVL A;  1NEN A;  2XQ9 A;  4U31 A;  3N2G E;  4X1I E;  4KBM B;  2ODU A;  4OFZ A;  3JAD A;  5LMU T;  2VUR A;  2HPJ A;  2E5V A;  2FJD A;  3G06 A;  4F8H A;  2VL0 A;  4ILC A;  1HNW T;  4H9P C;  2XAJ B;  4UF0 A;  1SHZ C;  1FMV A;  2OV9 A;  3BQL A;  2A2F X;  3CX7 B;  5M4Y A;  4I43 B;  4PW8 A;  2DI4 A;  3GN5 A;  5AQQ B;  5JDL A;  3RHW A;  4DND A;  2XAS B;  3AE6 A;  3FXE B;  3VU7 H;  4COF A;  4LF9 T;  3Q9D A;  4DMW A;  5HXS A;  3LSV A;  4IT4 A;  4X1Y E;  3GMI A; 
#chains in the Genus database with same CATH homology
 1R8I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...