4DUZT

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, u13c, bound with streptomycin
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
99
structure length
99
Chain Sequence
b'RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome/antibiotic
total genus 36
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 4duzT00
1IBKT 4LF6T 1HNZT 1XMQT 2UUAT 4DUYT 4DR6T 4DR2T 4DR3T 3T1HT 2UXCT 4DV1T 4DR7T 4B3MT 4JI3T 4AQYT 1XNQT 4DV0T 4DV5T 1IBMT 4LFAT 4JI6T 2VQFT 1HNXT 4DV4T 1IBLT 2UU9T 4DR4T 2UXBT 3T1YT 3OTOT 1N36T 4LFBT 1N33T 4DV6T 4JI0T 4B3ST 4DV7T 4JV5T 5BR8T 5IWAT 4KHPT 4B3RT 2HHHT 4X66T 4GKJT 1J5ET 4LFCT 4JYAT 2UUCT 4NXMT 2VQET 5LMUT 2ZM6T 4JI1T 4JI5T 4B3TT 2F4VT 4OX9T 4X62T 4LF9T 4JI2T 4LF4T 4YY3T 4DR1T 1FJGT 1XMOT 4DV2T 4NXNT 4LF7T 1I94T 4LF8T 1N34T 2UUBT 1HNWT 4DV3T 1XNRT 2UXDT 1HR0T 4DUZT 1N32T 2E5LT 4K0KT 4X65T 4JI4T 4JI7T 4GKKT 4YHHT 4X64T 5LMNT 4LF5T 4DR5T 4JI8T
chains in the Genus database with same CATH superfamily
3AEEA 2NOXA 4P09A 3AB3B 1WYCA 3PUVF 4KP3C 5TAOA 5LBQB 5FVLA 4F8HA 1VCSA 3AE6A 4U31A 3FB2A 2CCQA 3J9X1 3C4XA 2BVMA 2HH7A 4ASKA 2KWHA 3PUQA 4HEAA 4UVBB 5L3CB 3AE4A 5FY1A 3S4UA 5JR9B 2IHR1 3TLWA 1MMDA 4NXMT 3UU6A 2LOPA 1ZP0A 4X5TA 3PURA 1LVFA 5ABEA 3ZYMA 1IJ6A 5AFUL 2V8SV 2J1DG 1HS7A 3KV4A 2JJ9A 3GN5B 4EV6A 4HE8A 2XAJB 3AE1A 4QX7B 1HR0T 4TUYE 1O3XA 4H9SE 3IHRA 2BKNA 2VKOA 3NWIA 2BVLA 2JMHA 2V7JA 4IE6A 4ANJA 1W0AA 3F2EA 2LRKA 2BDEA 2I59A 4DO0A 5L3GB 2C0SA 4LF5T 2XSAA 2FJAA 2I6HA 2WMNA 2BBJA 2BG9B 3ZJ2A 3PU8A 3T1HT 4DV1T 2WWUA 4GIWA 4DR7T 3O4XE 2YU2A 4H9OC 4EAHA 3EUHA 4QWNB 2UXBT 4LFBT 1D0XA 5FY0A 3PUSA 4A97A 4IHJE 2H7VC 3ZN0B 5HWYA 3Q9DA 2KSRA 2D0UA 5DABA 3AA6B 2WZHA 2EHOD 4B3TT 3PDYA 5ETWA 3RIUA 2ZM0A 1MNDA 5JDHA 3U78A 2M67A 3GWHA 2XY8B 4U74A 3P4PA 3FXEB 3FZMB 3RC8A 2LLYA 2UXDT 4CXYA 4TNWA 2X9HA 3AA7B 1BR4A 3RYCE 1J1JA 2VB6A 3LK3B 3ZPOA 2BS2A 3KVBA 1QUUA 4CI2B 3B13A 4HFVA 3W15B 4DR5T 2K24A 4JBWF 4JI8T 3L09A 2HPLA 1WRDA 4KI0F 4YJ2E 4PJJA 1HG5A 2IIUA 3LFMA 3I9WA 1QLBA 4TV9E 4QX8B 3N9OA 5LXTE 4WZXA 3P7IA 2WBLA 3RH3A 3HI2A 2BKPA 5FXZA 3AAEB 4KMCA 4JI6T 5AQHB 3CX7B 2LT3A 4CQIA 2XQ9A 3T8OA 3IBPA 2CPTA 1J5ET 4LFCT 3UUXB 5LGUB 5C2TA 4PNIA 2UXXB 1G73A 2X9WA 2VKJA 4HFCA 5AQLB 4JI5T 3N2OA 4XAXB 5AQNB 3AAAB 3CWZB 4UV8B 4WBNE 2FUPA 2E9XB 3RQUA 3O9XA 4DBRA 3LK42 4OHFA 2YKSA 1HNWT 4DVDA 4UR9A 2V6XA 2EHOB 1VOMA 4MALA 5H6RB 1YD8G 1WYBA 2YINA 3ZCJA 4X1IE 4IDQA 2RA1A 5L3EB 4O4JE 4YXDA 3NKZA 5AQMB 3KINB 1US7B 1KF6A 3K3NA 3DJBA 4LF6T 1FMWA 2QVAA 5EK4A 5FP3A 2IW5B 2LM2A 4DR2T 2E5VA 3RYHE 1T98A 2YEVC 3UU8A 4OYKA 4DV4T 4KX6A 3Q5XA 4V1Av 5M4YA 2XQ6A 4M1PA 1UX5A 2XM1A 4TWHA 2WP9A 5LB7B 5AQGB 3ZYLA 4IE0A 4P0AA 3AA1B 4H9NC 4WYVA 4KHPT 4PAGA 3BQIA 5ABGA 3L39A 1D1AA 5ADXL 1W0BA 2A2FX 3CK6A 2KWIB 3VRAA 1W09A 3SFEA 4ZXLA 4IE4A 3ESLA 4YSYA 1HFAA 2XAHB 3N9MA 3RI5A 4UELA 2WDRA 3RPUA 2LSIA 2KLQA 4LF8T 4AKHA 2OLTA 4XBFB 4FJOA 1XDPA 2QYWA 4QXCB 2OV9A 3JC6C 3AAIA 4U2YA 4ZOLE 2BZBA 2CBJA 1IAPA 2WU5A 1OXZA 4X64T 4NUVA 4YLHA 3TLUA 4GYRA 3QNUA 4HGAA 4HFEA 3Q5EA 2JQHA 2C5IT 2XQ8A 2MBGA 1U4QA 5FL1A 1FIOA 1OEDC 1XNQT 2CXDA 3RC3A 2VQFT 2VKHA 3UFEA 5L3DB 3T1YT 4DV6T 4MFRA 3ZMSB 5L4EA 3PUAA 1Z8UA 3PUYF 4X1YE 2HHHT 2V5CA 4EEBA 2RPAA 1T72A 1XDOA 2VQET 4WBOA 3JAEA 2LHRA 3C4WA 2H3RA 2LHNA 2XZEA 4LF9T 2LSYA 2JPFA 4EZHA 5FY7A 3CQCB 2X68A 1XZYA 4QH1A 2DNXA 4DV2T 2ZM8A 4AI6A 1I94T 2X0LB 5LHGB 2CWYA 1S35A 3R6NA 1Y01A 2FJDA 4JEHB 4DUZT 4AXPA 4UVAB 5LNKA 1T7SA 4X65T 3KVAA 2DWGA 2OA5A 3CVRA 3IA3A 4NUUA 2CWOA 4XZCA 2Q9QA 2BBHA 4JEUB 3G06A 3SS1A 4IDPA 4JUYA 3C64A 1IBKT 2ES0A 2V7IA 2WB5A 1VRBA 2VK9A 3SWHA 3ANWB 4DR3T 3P4WA 2WAUA 4F6RC 3ZT5A 4IDOA 2HN2A 1L0VA 3QB5K 3NRYA 2YOEA 5FVKA 3TLSA 2IUBA 1HX8A 2LKGA 3KDSE 2DL1A 2BS3A 3RGLA 4ZI7E 1CHUA 5A1LA 3E0ZA 2BG9E 2G0UA 3ZMZB 1YKHB 2NP9A 1MMGA 2SPCA 1GQEA 4BJMA 3ZKRA 1N34T 4YTMA 5CGMA 2YK0A 2K9AA 5FKYA 3ZYKA 2ACZA 3AEBA 3M65A 3WAJA 4EEDA 2QRXA 4BJNA 2VVNA 2WMOA 5ABFA 1WCRA 2H89A 3ZSTA 3VHLA 2C5JA 4GKKT 4YHHT 2X9YA 2V6YA 3ONJA 5LMNT 3BQKA 2CXFA 1YQ3A 2AXDS 1ZV4X 3GA8A 4G63A 3JC6D 3FBZA 3AECA 4I4TE 3A8YC 4AKIA 3OYZA 3A5XA 4WNKA 1NWMX 4CN4A 1MNEA 4PFOA 2Y48B 2QGSA 5DJQC 4CI1B 3EABA 1EZ3A 4YHJA 3MA9A 4DV5T 2YDSA 4ZS2A 5AQIB 3V5UA 1SA0E 3UQ7A 3KV6A 2ODVA 2P9BA 3PUXF 5L47A 4B3ST 1LVKA 2WU2A 2E2AA 3ZT6A 2V5DA 5HXHA 5LGTB 4OYJA 4DIDB 2UXNB 2LSJA 5CB4E 4AKLA 4ZZBA 1E1HB 5JDQA 4Q25A 5L2LA 2VVSA 4HN9A 1G8XA 2LM9A 4LMJA 4Z8XA 4P1NA 4ZZCA 2N9DA 3PJAJ 2WS3A 1S94A 2JMKA 3RIUC 1ZKEA 2Y6XA 2CLYC 4YTPA 3NVOA 2H88A 2XAGB 3I0QA 1HCIA 3O1IA 3HR0A 4JI4T 3R84B 5KDMC 2I0MA 3RX6A 3AVRA 5HEGA 3Q5WA 3ETUA 4ADZA 4G2AA 2ODUA 4EIWA 2K3WA 3OKQA 3AXJA 2YDQA 3HL6A 3KBUA 5JDNA 4QXHB 5F5WA 2W4XA 2A3DA 1M62A 2DHRA 5GONE 4N78D 2WCAA 2ZMAA 3I1AA 2KNDA 3ZC1A 3RYFE 4A98A 3PUWF 1N33T 2E8IA 4UV9B 4QKNA 5JDFA 4L5GA 4YSXA 4B3RT 2X0HA 4EYYR 5LG3A 1H7CA 3NRXA 2MYSA 3NZQA 2CEAA 3ONLC 4UXNB 2LRLA 3JADA 5EK2A 5FNVE 1U5PA 4PW8A 3EI0A 5HWXA 2XASB 4CZZB 3AEGA 1FJGT 3ONXA 4U7YA 2M6BA 5JR9A 2XSBA 1MMAA 1OEDB 4DMWA 1N32T 5AQQB 2NTXA 3MK7C 2RP4A 4MLKA 4H9RC 5H6QB 4EYUA 3N9QA 2B76A 2WSSV 4JI7T 4PK6A 2C5KT 3I0OA 2V7KA 2MTQA 2W67A 2XQYA 1MIWA 4L9IA 3LBXB 4ZI2D 1HNZT 5EZYE 1SHZC 4DR6T 1KNZA 3PJAA 3EDUA 4GK0E 1HX1B 1X79A 1IZNB 4E7ZA 1IBLT 4TX5A 3UT5E 2X0YA 1M7KA 1UUSA 4P0BA 4HKAA 5CFBA 3FZHB 2DCFA 5LGNB 3FXDB 4JV5T 1JNZA 2CE7A 5J0ZA 1NENA 2N1GA 5AQTB 4HWFA 4X66T 4TWDA 4ERRA 5LHHB 3RIFA 4QH4A 3B57A 4HWHA 3FZLB 4H9PC 5HXRA 3J7Yq 4TV8E 4HTEA 2PG8A 5JDLA 2XJ7A 3NZPA 3O1HA 3WAKA 4PFPA 3RF1A 5AQPB 3PU3A 3ZMTB 1HTJF 2WM9A 1ZHCA 4HFBA 2XPKA 3B5MA 2LEHA 4PJNA 3KV9A 3ZC0A 2CMRA 4J2CA 5IYZE 5C3JA 3N5LA 4AQGA 3RLFF 4B3MT 2W66A 2K5BB 2MOZA 4EXTA 3KV5A 5EK3A 3LG7A 3N2GE 4HFHA 4I55E 1V9DA 5JRCA 3EVYA 3RQWA 4ZS3A 3ZEFB 4YFSA 3AEDA 5ABFB 5LA6E 3ZT7A 2KMFA 2W61A 1T8BA 4GKJT 3CQGB 4UF0A 2ZM6T 2XQ3A 2CHOA 2WWVA 3UUBA 4LF4T 2JIWA 1DU2A 4YT0A 3LJCA 2FJEA 1LKXA 4DV3T 3UU4A 3VR8A 3PE0A 1SE7A 1J5WA 2E5LT 3VR9A 1ZEEA 3MXZA 3ZSSA 1I6ZA 5HEUA 2NWBA 3LK2B 2WY2A 2E9XA 5JDGA 1YXRA 3F57A 2A72A 1SUMB 3O1JA 4B6XA 2EHOA 3AE5A 1ZOYA 1JNRA 5KMGP 5JDMA 3TKLB 3IEEA 4LMKA 3PV0F 2YU1A 2UXCT 2Q9QC 5AQKB 1E7PA 3VU7H 5ABHA 4JI3T 1IBMT 4LFAT 4I50E 4MBQA 4CXXA 2LKHA 1MIYA 3OTOT 5HYAA 3ETVA 3OVUA 3GMIA 2CLYB 3MKDA 1WFDA 4CXWA 3QC9A 5CA1E 1UCUA 4ISSA 3C98B 2XTLA 4U2ZA 2QA7A 4NIQA 2UUCT 3PUZF 3H3MA 3H37A 5HEJA 2CXLA 4GK5E 2DWKA 5IHYA 2JRKA 3L8RA 2L3LA 2L9QA 4IL4A 2J47A 3CQXC 2UUBT 2VURA 3FZKB 3QB5A 1NEKA 5F8PA 4H9QC 4JLEA 4Z90A 2PJQA 3RRCA 3P4QA 3PUGA 2N2NA 1MIVA 2VWAA 4U3CA 3BQLA 3MACA 2IAKA 5FXWA 2D9DA 4ZI2C 2CRBA 1KEYA 5JQGE 3RKOA 3H3AA 4HWIB 2LOSA 3ZMVB 5JH7E 4ISTA 2BKOA 2W00A 4U72A 2XQ5A 3SFDA 5FXVA 2CBIA 2UU9T 4DR4T 5LP6E 2LSKA 2XUEA 3AA0B 2ZM2A 2M6IA 4CI3B 3Q5DA 5IWAT 5KX5E 4JYAT 4ZEYA 4A56A 1KNPA 2XHEB 5FXXA 1WLXA 3CKDA 2V26A 2X51A 3LSVA 4U7IA 4YY3T 3M3ZB 1UGOA 2W62A 4MHCA 3AE9A 5KXJA 1XMOT 4LF7T 4AKGA 1XNRT 3EDVA 4CN6A 2LJLA 3VKHA 4K0KT 3K3QC 2XAFB 4U33A 2JQQA 1R8IA 2KT9A 3C4ZA 3A7MA 2V7MA 3VKGA 3EHZA 3UUNA 3L3PA 2LSGA 4DBQA 1FEWA 1D1CA 3U3IA 5L3BB 3EAMA 3TLTA 5FMNA 4DUYT 3HKDE 1HF8A 1X9BA 4GOUA 2A9UA 1BR1A 5LYJE 3ZLIA 2E9XD 3LDQB 4IREA 4EOZB 3UU3A 1QSDA 1D0ZA 4AQYT 3E22E 1OEDE 3AE8A 2FBWA 4OFZA 2PFVA 3UFGA 2IC9A 3P50A 4Z91A 5HCMA 3FBLA 2D0TA 3ANWA 3DP7A 1E2AA 4TNVA 4OK0A 4YJ3E 3UUMA 3Q2MA 4YSZA 5HXEA 2Q9QD 1UURA 3MJXA 2L8KA 3AEFA 3E08A 3UULA 5LBMA 5LMUT 4EGWA 2YDRA 4UIGA 2F4VT 4X62T 5JTGA 3P8CD 3HA4A 4TN7B 3RIAA 4AIUA 4IT4A 4DR1T 5BMVE 2B1EA 2CHNA 4ZI3C 1Z0PA 4UVCB 3QOFA 4NXNT 2X66A 1KNRA 4CN1A 5CJ5A 3C51A 3HKBE 5E0OA 5FYMA 1KK7A 2XM2A 4C90A 5JRCB 5HXCA 2VASA 5JR9C 2D5UA 1CUNA 1KFYA 2MPKA 3N2KE 4UF0B 4A5XA 2FJBA 4IE5A 3SOLA 1XMQT 2UUAT 1OWAA 4TZ4C 1YKEB 1IJ5A 4GYSA 3RKGA 2KXPB 2KZ7B 4C91A 3F31A 4IDNA 4O4IE 2HN1A 2J4GA 4O4LE 3N9PA 5J2UE 3I9YA 2W2UA 3GN5A 2BS4A 3QUJA 4ILAA 4ILUA 4DMVA 3RRWA 1N36T 2MAWA 4PK4A 4BA9A 4DV7T 2AE9A 2CA5A 5BR8T 2JQKA 2XAQB 4O2AE 5AQFB 4AKRB 4IGUA 2Y8DA 2LE8A 5CA0E 3FZFB 4I43B 4COFA 5JVDE 3OYXA 2BG9C 2BG9A 2WZIA 2WDVA 3AE2A 3WI3A 4X20E 4JI2T 1NAFA 2CM0A 2WQYA 3IF8B 3MZKB 3BK9A 2XQ4A 4LMLA 2X67A 4YTNA 1FMVA 5LJMA 2Q9QB 1AJ3A 1YQ4A 3P4SA 2W0GA 4PJLA 5LCYA 5FL0A 3K8PC 2VL8A 5LOVE 2XQAA 1UX4A 3ABVA 4QH5A 4KUMB 2HPJA 5L4HA 5LG4A 5JREA 4KHZF 5HXSA 1WR6A 3UU5A 2PTFA 3KFWX 3ZCIA 2IDOB 4BAYB 1B7TA 4DV0T 2XQ7A 1HNXT 2IMLA 5J1GA 3CIRA 4O2BE 2NTYA 4JI0T 4AISA 3RHWA 3FHNA 1BR0A 4HFIA 2YN6A 4QXBB 3D0TA 3NBXX 3QK6A 4EZ4A 4DNDA 4OX9T 5J2TE 2DI4A 2VKDA 2VL0A 4ILBA 2KINB 3JCFA 2PBIA 4HWCA 4IL9A 1D1BA 2W63A 1MMNA 3CX8B 3JAFA 3OPCA 3UQ4A 2V7LA 1HG2A 3AVSA 3K3OA 4H63V 2NW8A 2V6YB 5DQWA 5AQOB 3AE3A 5HCJA 3N9NA 3TLVA 4X1KE 1UK5A 5AQRB 4ZI3D 4AQFC 4AQFA 1OEDA 2NW9A 3SRZA 3ZN1B 4HWDA 1LRZA 5AQJB 3VRBA 3ZMUB 4K0UA 2K48A 2E9XC 5HEHA 4FI5A 2Z6EA 3OBVE 3N9LA 4PJMA 3OJAA 4TWFA 1YW0A 4NPPA 2EHOC 4WW0A 4I0UA 2D2SA 3LBXA 2H7OA 2V1DB 1D0YA 4UEMA 3CX6B 5IUXA 5DQVA 5C8YE 4E7SA 3KBTA 2ACXA 4ILCA 2X9XA 3CPZA 2R6GF 4IE7A 3K1SA 4KBMB 1BR2A 4JI1T 3CMLA 2NW7A 3X1DA 3C50A 4ZHQE 5HEOA 5AQUB 2GK9A 3HKEE 5AQVB 5L3FB 4QHOA 5LHIB 3DTOA 3ZJ1A 1VCTA 3HKCE 3P4RA 2WDQA 4IIJE 2ZLYA 2J62A 4PK5A 4O8SA 3AXJB 1WR0A 4IDZA 3V5SA 2JQ9A 5HAXA 2DLRA 3RYIE 5F3JA 4H63H 3PTRB 2IC6A 2NR4A 1XWMA 1Y64B 4L0RA 4O4HE 5LJNA 3AE7A 3AEAA 4EB6E 4HFDA 1W9RA 3UTKA 5AQSB
chains in the Genus database with same CATH topology
1IBKT 4LF6T 1HNZT 1XMQT 2UUAT 4DUYT 4DR6T 4DR2T 4DR3T 3T1HT 2UXCT 4DV1T 4DR7T 4B3MT 4JI3T 4AQYT 1XNQT 4DV0T 4DV5T 1IBMT 4LFAT 4JI6T 2VQFT 1HNXT 4DV4T 1IBLT 2UU9T 4DR4T 2UXBT 3T1YT 3OTOT 1N36T 4LFBT 1N33T 4DV6T 4JI0T 4B3ST 4DV7T 4JV5T 5BR8T 5IWAT 4KHPT 4B3RT 2HHHT 4X66T 4GKJT 1J5ET 4LFCT 4JYAT 2UUCT 4NXMT 2VQET 5LMUT 2ZM6T 4JI1T 4JI5T 4B3TT 2F4VT 4OX9T 4X62T 4LF9T 4JI2T 4LF4T 4YY3T 4DR1T 1FJGT 1XMOT 4DV2T 4NXNT 4LF7T 1I94T 4LF8T 1N34T 2UUBT 1HNWT 4DV3T 1XNRT 2UXDT 1HR0T 4DUZT 1N32T 2E5LT 4K0KT 4X65T 4JI4T 4JI7T 4GKKT 4YHHT 4X64T 5LMNT 4LF5T 4DR5T 4JI8T
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IBK T;  4LF6 T;  1HNZ T;  1XMQ T;  2UUA T;  4DUY T;  4DR6 T;  4DR2 T;  4DR3 T;  3T1H T;  2UXC T;  4DV1 T;  4DR7 T;  4B3M T;  4JI3 T;  4AQY T;  1XNQ T;  4DV0 T;  4DV5 T;  1IBM T;  4LFA T;  4JI6 T;  2VQF T;  1HNX T;  4DV4 T;  1IBL T;  2UU9 T;  4DR4 T;  2UXB T;  3T1Y T;  3OTO T;  1N36 T;  4LFB T;  1N33 T;  4DV6 T;  4JI0 T;  4B3S T;  4DV7 T;  4JV5 T;  5BR8 T;  5IWA T;  4KHP T;  4B3R T;  2HHH T;  4X66 T;  4GKJ T;  1J5E T;  4LFC T;  4JYA T;  2UUC T;  4NXM T;  2VQE T;  5LMU T;  2ZM6 T;  4JI1 T;  4JI5 T;  4B3T T;  2F4V T;  4OX9 T;  4X62 T;  4LF9 T;  4JI2 T;  4LF4 T;  4YY3 T;  4DR1 T;  1FJG T;  1XMO T;  4DV2 T;  4NXN T;  4LF7 T;  1I94 T;  4LF8 T;  1N34 T;  2UUB T;  1HNW T;  4DV3 T;  1XNR T;  2UXD T;  1HR0 T;  4DUZ T;  1N32 T;  2E5L T;  4K0K T;  4X65 T;  4JI4 T;  4JI7 T;  4GKK T;  4YHH T;  4X64 T;  5LMN T;  4LF5 T;  4DR5 T;  4JI8 T; 
#chains in the Genus database with same CATH topology
 3AEE A;  2NOX A;  4P09 A;  3AB3 B;  1WYC A;  3PUV F;  4KP3 C;  5TAO A;  5LBQ B;  5FVL A;  4F8H A;  1VCS A;  3AE6 A;  4U31 A;  3FB2 A;  2CCQ A;  3J9X 1;  3C4X A;  2BVM A;  2HH7 A;  4ASK A;  2KWH A;  3PUQ A;  4HEA A;  4UVB B;  5L3C B;  3AE4 A;  5FY1 A;  3S4U A;  5JR9 B;  2IHR 1;  3TLW A;  1MMD A;  4NXM T;  3UU6 A;  2LOP A;  1ZP0 A;  4X5T A;  3PUR A;  1LVF A;  5ABE A;  3ZYM A;  1IJ6 A;  5AFU L;  2V8S V;  2J1D G;  1HS7 A;  3KV4 A;  2JJ9 A;  3GN5 B;  4EV6 A;  4HE8 A;  2XAJ B;  3AE1 A;  4QX7 B;  1HR0 T;  4TUY E;  1O3X A;  4H9S E;  3IHR A;  2BKN A;  2VKO A;  3NWI A;  2BVL A;  2JMH A;  2V7J A;  4IE6 A;  4ANJ A;  1W0A A;  3F2E A;  2LRK A;  2BDE A;  2I59 A;  4DO0 A;  5L3G B;  2C0S A;  4LF5 T;  2XSA A;  2FJA A;  2I6H A;  2WMN A;  2BBJ A;  2BG9 B;  3ZJ2 A;  3PU8 A;  3T1H T;  4DV1 T;  2WWU A;  4GIW A;  4DR7 T;  3O4X E;  2YU2 A;  4H9O C;  4EAH A;  3EUH A;  4QWN B;  2UXB T;  4LFB T;  1D0X A;  5FY0 A;  3PUS A;  4A97 A;  4IHJ E;  2H7V C;  3ZN0 B;  5HWY A;  3Q9D A;  2KSR A;  2D0U A;  5DAB A;  3AA6 B;  2WZH A;  2EHO D;  4B3T T;  3PDY A;  5ETW A;  3RIU A;  2ZM0 A;  1MND A;  5JDH A;  3U78 A;  2M67 A;  3GWH A;  2XY8 B;  4U74 A;  3P4P A;  3FXE B;  3FZM B;  3RC8 A;  2LLY A;  2UXD T;  4CXY A;  4TNW A;  2X9H A;  3AA7 B;  1BR4 A;  3RYC E;  1J1J A;  2VB6 A;  3LK3 B;  3ZPO A;  2BS2 A;  3KVB A;  1QUU A;  4CI2 B;  3B13 A;  4HFV A;  3W15 B;  4DR5 T;  2K24 A;  4JBW F;  4JI8 T;  3L09 A;  2HPL A;  1WRD A;  4KI0 F;  4YJ2 E;  4PJJ A;  1HG5 A;  2IIU A;  3LFM A;  3I9W A;  1QLB A;  4TV9 E;  4QX8 B;  3N9O A;  5LXT E;  4WZX A;  3P7I A;  2WBL A;  3RH3 A;  3HI2 A;  2BKP A;  5FXZ A;  3AAE B;  4KMC A;  4JI6 T;  5AQH B;  3CX7 B;  2LT3 A;  4CQI A;  2XQ9 A;  3T8O A;  3IBP A;  2CPT A;  1J5E T;  4LFC T;  3UUX B;  5LGU B;  5C2T A;  4PNI A;  2UXX B;  1G73 A;  2X9W A;  2VKJ A;  4HFC A;  5AQL B;  4JI5 T;  3N2O A;  4XAX B;  5AQN B;  3AAA B;  3CWZ B;  4UV8 B;  4WBN E;  2FUP A;  2E9X B;  3RQU A;  3O9X A;  4DBR A;  3LK4 2;  4OHF A;  2YKS A;  1HNW T;  4DVD A;  4UR9 A;  2V6X A;  2EHO B;  1VOM A;  4MAL A;  5H6R B;  1YD8 G;  1WYB A;  2YIN A;  3ZCJ A;  4X1I E;  4IDQ A;  2RA1 A;  5L3E B;  4O4J E;  4YXD A;  3NKZ A;  5AQM B;  3KIN B;  1US7 B;  1KF6 A;  3K3N A;  3DJB A;  4LF6 T;  1FMW A;  2QVA A;  5EK4 A;  5FP3 A;  2IW5 B;  2LM2 A;  4DR2 T;  2E5V A;  3RYH E;  1T98 A;  2YEV C;  3UU8 A;  4OYK A;  4DV4 T;  4KX6 A;  3Q5X A;  4V1A v;  5M4Y A;  2XQ6 A;  4M1P A;  1UX5 A;  2XM1 A;  4TWH A;  2WP9 A;  5LB7 B;  5AQG B;  3ZYL A;  4IE0 A;  4P0A A;  3AA1 B;  4H9N C;  4WYV A;  4KHP T;  4PAG A;  3BQI A;  5ABG A;  3L39 A;  1D1A A;  5ADX L;  1W0B A;  2A2F X;  3CK6 A;  2KWI B;  3VRA A;  1W09 A;  3SFE A;  4ZXL A;  4IE4 A;  3ESL A;  4YSY A;  1HFA A;  2XAH B;  3N9M A;  3RI5 A;  4UEL A;  2WDR A;  3RPU A;  2LSI A;  2KLQ A;  4LF8 T;  4AKH A;  2OLT A;  4XBF B;  4FJO A;  1XDP A;  2QYW A;  4QXC B;  2OV9 A;  3JC6 C;  3AAI A;  4U2Y A;  4ZOL E;  2BZB A;  2CBJ A;  1IAP A;  2WU5 A;  1OXZ A;  4X64 T;  4NUV A;  4YLH A;  3TLU A;  4GYR A;  3QNU A;  4HGA A;  4HFE A;  3Q5E A;  2JQH A;  2C5I T;  2XQ8 A;  2MBG A;  1U4Q A;  5FL1 A;  1FIO A;  1OED C;  1XNQ T;  2CXD A;  3RC3 A;  2VQF T;  2VKH A;  3UFE A;  5L3D B;  3T1Y T;  4DV6 T;  4MFR A;  3ZMS B;  5L4E A;  3PUA A;  1Z8U A;  3PUY F;  4X1Y E;  2HHH T;  2V5C A;  4EEB A;  2RPA A;  1T72 A;  1XDO A;  2VQE T;  4WBO A;  3JAE A;  2LHR A;  3C4W A;  2H3R A;  2LHN A;  2XZE A;  4LF9 T;  2LSY A;  2JPF A;  4EZH A;  5FY7 A;  3CQC B;  2X68 A;  1XZY A;  4QH1 A;  2DNX A;  4DV2 T;  2ZM8 A;  4AI6 A;  1I94 T;  2X0L B;  5LHG B;  2CWY A;  1S35 A;  3R6N A;  1Y01 A;  2FJD A;  4JEH B;  4DUZ T;  4AXP A;  4UVA B;  5LNK A;  1T7S A;  4X65 T;  3KVA A;  2DWG A;  2OA5 A;  3CVR A;  3IA3 A;  4NUU A;  2CWO A;  4XZC A;  2Q9Q A;  2BBH A;  4JEU B;  3G06 A;  3SS1 A;  4IDP A;  4JUY A;  3C64 A;  1IBK T;  2ES0 A;  2V7I A;  2WB5 A;  1VRB A;  2VK9 A;  3SWH A;  3ANW B;  4DR3 T;  3P4W A;  2WAU A;  4F6R C;  3ZT5 A;  4IDO A;  2HN2 A;  1L0V A;  3QB5 K;  3NRY A;  2YOE A;  5FVK A;  3TLS A;  2IUB A;  1HX8 A;  2LKG A;  3KDS E;  2DL1 A;  2BS3 A;  3RGL A;  4ZI7 E;  1CHU A;  5A1L A;  3E0Z A;  2BG9 E;  2G0U A;  3ZMZ B;  1YKH B;  2NP9 A;  1MMG A;  2SPC A;  1GQE A;  4BJM A;  3ZKR A;  1N34 T;  4YTM A;  5CGM A;  2YK0 A;  2K9A A;  5FKY A;  3ZYK A;  2ACZ A;  3AEB A;  3M65 A;  3WAJ A;  4EED A;  2QRX A;  4BJN A;  2VVN A;  2WMO A;  5ABF A;  1WCR A;  2H89 A;  3ZST A;  3VHL A;  2C5J A;  4GKK T;  4YHH T;  2X9Y A;  2V6Y A;  3ONJ A;  5LMN T;  3BQK A;  2CXF A;  1YQ3 A;  2AXD S;  1ZV4 X;  3GA8 A;  4G63 A;  3JC6 D;  3FBZ A;  3AEC A;  4I4T E;  3A8Y C;  4AKI A;  3OYZ A;  3A5X A;  4WNK A;  1NWM X;  4CN4 A;  1MNE A;  4PFO A;  2Y48 B;  2QGS A;  5DJQ C;  4CI1 B;  3EAB A;  1EZ3 A;  4YHJ A;  3MA9 A;  4DV5 T;  2YDS A;  4ZS2 A;  5AQI B;  3V5U A;  1SA0 E;  3UQ7 A;  3KV6 A;  2ODV A;  2P9B A;  3PUX F;  5L47 A;  4B3S T;  1LVK A;  2WU2 A;  2E2A A;  3ZT6 A;  2V5D A;  5HXH A;  5LGT B;  4OYJ A;  4DID B;  2UXN B;  2LSJ A;  5CB4 E;  4AKL A;  4ZZB A;  1E1H B;  5JDQ A;  4Q25 A;  5L2L A;  2VVS A;  4HN9 A;  1G8X A;  2LM9 A;  4LMJ A;  4Z8X A;  4P1N A;  4ZZC A;  2N9D A;  3PJA J;  2WS3 A;  1S94 A;  2JMK A;  3RIU C;  1ZKE A;  2Y6X A;  2CLY C;  4YTP A;  3NVO A;  2H88 A;  2XAG B;  3I0Q A;  1HCI A;  3O1I A;  3HR0 A;  4JI4 T;  3R84 B;  5KDM C;  2I0M A;  3RX6 A;  3AVR A;  5HEG A;  3Q5W A;  3ETU A;  4ADZ A;  4G2A A;  2ODU A;  4EIW A;  2K3W A;  3OKQ A;  3AXJ A;  2YDQ A;  3HL6 A;  3KBU A;  5JDN A;  4QXH B;  5F5W A;  2W4X A;  2A3D A;  1M62 A;  2DHR A;  5GON E;  4N78 D;  2WCA A;  2ZMA A;  3I1A A;  2KND A;  3ZC1 A;  3RYF E;  4A98 A;  3PUW F;  1N33 T;  2E8I A;  4UV9 B;  4QKN A;  5JDF A;  4L5G A;  4YSX A;  4B3R T;  2X0H A;  4EYY R;  5LG3 A;  1H7C A;  3NRX A;  2MYS A;  3NZQ A;  2CEA A;  3ONL C;  4UXN B;  2LRL A;  3JAD A;  5EK2 A;  5FNV E;  1U5P A;  4PW8 A;  3EI0 A;  5HWX A;  2XAS B;  4CZZ B;  3AEG A;  1FJG T;  3ONX A;  4U7Y A;  2M6B A;  5JR9 A;  2XSB A;  1MMA A;  1OED B;  4DMW A;  1N32 T;  5AQQ B;  2NTX A;  3MK7 C;  2RP4 A;  4MLK A;  4H9R C;  5H6Q B;  4EYU A;  3N9Q A;  2B76 A;  2WSS V;  4JI7 T;  4PK6 A;  2C5K T;  3I0O A;  2V7K A;  2MTQ A;  2W67 A;  2XQY A;  1MIW A;  4L9I A;  3LBX B;  4ZI2 D;  1HNZ T;  5EZY E;  1SHZ C;  4DR6 T;  1KNZ A;  3PJA A;  3EDU A;  4GK0 E;  1HX1 B;  1X79 A;  1IZN B;  4E7Z A;  1IBL T;  4TX5 A;  3UT5 E;  2X0Y A;  1M7K A;  1UUS A;  4P0B A;  4HKA A;  5CFB A;  3FZH B;  2DCF A;  5LGN B;  3FXD B;  4JV5 T;  1JNZ A;  2CE7 A;  5J0Z A;  1NEN A;  2N1G A;  5AQT B;  4HWF A;  4X66 T;  4TWD A;  4ERR A;  5LHH B;  3RIF A;  4QH4 A;  3B57 A;  4HWH A;  3FZL B;  4H9P C;  5HXR A;  3J7Y q;  4TV8 E;  4HTE A;  2PG8 A;  5JDL A;  2XJ7 A;  3NZP A;  3O1H A;  3WAK A;  4PFP A;  3RF1 A;  5AQP B;  3PU3 A;  3ZMT B;  1HTJ F;  2WM9 A;  1ZHC A;  4HFB A;  2XPK A;  3B5M A;  2LEH A;  4PJN A;  3KV9 A;  3ZC0 A;  2CMR A;  4J2C A;  5IYZ E;  5C3J A;  3N5L A;  4AQG A;  3RLF F;  4B3M T;  2W66 A;  2K5B B;  2MOZ A;  4EXT A;  3KV5 A;  5EK3 A;  3LG7 A;  3N2G E;  4HFH A;  4I55 E;  1V9D A;  5JRC A;  3EVY A;  3RQW A;  4ZS3 A;  3ZEF B;  4YFS A;  3AED A;  5ABF B;  5LA6 E;  3ZT7 A;  2KMF A;  2W61 A;  1T8B A;  4GKJ T;  3CQG B;  4UF0 A;  2ZM6 T;  2XQ3 A;  2CHO A;  2WWV A;  3UUB A;  4LF4 T;  2JIW A;  1DU2 A;  4YT0 A;  3LJC A;  2FJE A;  1LKX A;  4DV3 T;  3UU4 A;  3VR8 A;  3PE0 A;  1SE7 A;  1J5W A;  2E5L T;  3VR9 A;  1ZEE A;  3MXZ A;  3ZSS A;  1I6Z A;  5HEU A;  2NWB A;  3LK2 B;  2WY2 A;  2E9X A;  5JDG A;  1YXR A;  3F57 A;  2A72 A;  1SUM B;  3O1J A;  4B6X A;  2EHO A;  3AE5 A;  1ZOY A;  1JNR A;  5KMG P;  5JDM A;  3TKL B;  3IEE A;  4LMK A;  3PV0 F;  2YU1 A;  2UXC T;  2Q9Q C;  5AQK B;  1E7P A;  3VU7 H;  5ABH A;  4JI3 T;  1IBM T;  4LFA T;  4I50 E;  4MBQ A;  4CXX A;  2LKH A;  1MIY A;  3OTO T;  5HYA A;  3ETV A;  3OVU A;  3GMI A;  2CLY B;  3MKD A;  1WFD A;  4CXW A;  3QC9 A;  5CA1 E;  1UCU A;  4ISS A;  3C98 B;  2XTL A;  4U2Z A;  2QA7 A;  4NIQ A;  2UUC T;  3PUZ F;  3H3M A;  3H37 A;  5HEJ A;  2CXL A;  4GK5 E;  2DWK A;  5IHY A;  2JRK A;  3L8R A;  2L3L A;  2L9Q A;  4IL4 A;  2J47 A;  3CQX C;  2UUB T;  2VUR A;  3FZK B;  3QB5 A;  1NEK A;  5F8P A;  4H9Q C;  4JLE A;  4Z90 A;  2PJQ A;  3RRC A;  3P4Q A;  3PUG A;  2N2N A;  1MIV A;  2VWA A;  4U3C A;  3BQL A;  3MAC A;  2IAK A;  5FXW A;  2D9D A;  4ZI2 C;  2CRB A;  1KEY A;  5JQG E;  3RKO A;  3H3A A;  4HWI B;  2LOS A;  3ZMV B;  5JH7 E;  4IST A;  2BKO A;  2W00 A;  4U72 A;  2XQ5 A;  3SFD A;  5FXV A;  2CBI A;  2UU9 T;  4DR4 T;  5LP6 E;  2LSK A;  2XUE A;  3AA0 B;  2ZM2 A;  2M6I A;  4CI3 B;  3Q5D A;  5IWA T;  5KX5 E;  4JYA T;  4ZEY A;  4A56 A;  1KNP A;  2XHE B;  5FXX A;  1WLX A;  3CKD A;  2V26 A;  2X51 A;  3LSV A;  4U7I A;  4YY3 T;  3M3Z B;  1UGO A;  2W62 A;  4MHC A;  3AE9 A;  5KXJ A;  1XMO T;  4LF7 T;  4AKG A;  1XNR T;  3EDV A;  4CN6 A;  2LJL A;  3VKH A;  4K0K T;  3K3Q C;  2XAF B;  4U33 A;  2JQQ A;  1R8I A;  2KT9 A;  3C4Z A;  3A7M A;  2V7M A;  3VKG A;  3EHZ A;  3UUN A;  3L3P A;  2LSG A;  4DBQ A;  1FEW A;  1D1C A;  3U3I A;  5L3B B;  3EAM A;  3TLT A;  5FMN A;  4DUY T;  3HKD E;  1HF8 A;  1X9B A;  4GOU A;  2A9U A;  1BR1 A;  5LYJ E;  3ZLI A;  2E9X D;  3LDQ B;  4IRE A;  4EOZ B;  3UU3 A;  1QSD A;  1D0Z A;  4AQY T;  3E22 E;  1OED E;  3AE8 A;  2FBW A;  4OFZ A;  2PFV A;  3UFG A;  2IC9 A;  3P50 A;  4Z91 A;  5HCM A;  3FBL A;  2D0T A;  3ANW A;  3DP7 A;  1E2A A;  4TNV A;  4OK0 A;  4YJ3 E;  3UUM A;  3Q2M A;  4YSZ A;  5HXE A;  2Q9Q D;  1UUR A;  3MJX A;  2L8K A;  3AEF A;  3E08 A;  3UUL A;  5LBM A;  5LMU T;  4EGW A;  2YDR A;  4UIG A;  2F4V T;  4X62 T;  5JTG A;  3P8C D;  3HA4 A;  4TN7 B;  3RIA A;  4AIU A;  4IT4 A;  4DR1 T;  5BMV E;  2B1E A;  2CHN A;  4ZI3 C;  1Z0P A;  4UVC B;  3QOF A;  4NXN T;  2X66 A;  1KNR A;  4CN1 A;  5CJ5 A;  3C51 A;  3HKB E;  5E0O A;  5FYM A;  1KK7 A;  2XM2 A;  4C90 A;  5JRC B;  5HXC A;  2VAS A;  5JR9 C;  2D5U A;  1CUN A;  1KFY A;  2MPK A;  3N2K E;  4UF0 B;  4A5X A;  2FJB A;  4IE5 A;  3SOL A;  1XMQ T;  2UUA T;  1OWA A;  4TZ4 C;  1YKE B;  1IJ5 A;  4GYS A;  3RKG A;  2KXP B;  2KZ7 B;  4C91 A;  3F31 A;  4IDN A;  4O4I E;  2HN1 A;  2J4G A;  4O4L E;  3N9P A;  5J2U E;  3I9Y A;  2W2U A;  3GN5 A;  2BS4 A;  3QUJ A;  4ILA A;  4ILU A;  4DMV A;  3RRW A;  1N36 T;  2MAW A;  4PK4 A;  4BA9 A;  4DV7 T;  2AE9 A;  2CA5 A;  5BR8 T;  2JQK A;  2XAQ B;  4O2A E;  5AQF B;  4AKR B;  4IGU A;  2Y8D A;  2LE8 A;  5CA0 E;  3FZF B;  4I43 B;  4COF A;  5JVD E;  3OYX A;  2BG9 C;  2BG9 A;  2WZI A;  2WDV A;  3AE2 A;  3WI3 A;  4X20 E;  4JI2 T;  1NAF A;  2CM0 A;  2WQY A;  3IF8 B;  3MZK B;  3BK9 A;  2XQ4 A;  4LML A;  2X67 A;  4YTN A;  1FMV A;  5LJM A;  2Q9Q B;  1AJ3 A;  1YQ4 A;  3P4S A;  2W0G A;  4PJL A;  5LCY A;  5FL0 A;  3K8P C;  2VL8 A;  5LOV E;  2XQA A;  1UX4 A;  3ABV A;  4QH5 A;  4KUM B;  2HPJ A;  5L4H A;  5LG4 A;  5JRE A;  4KHZ F;  5HXS A;  1WR6 A;  3UU5 A;  2PTF A;  3KFW X;  3ZCI A;  2IDO B;  4BAY B;  1B7T A;  4DV0 T;  2XQ7 A;  1HNX T;  2IML A;  5J1G A;  3CIR A;  4O2B E;  2NTY A;  4JI0 T;  4AIS A;  3RHW A;  3FHN A;  1BR0 A;  4HFI A;  2YN6 A;  4QXB B;  3D0T A;  3NBX X;  3QK6 A;  4EZ4 A;  4DND A;  4OX9 T;  5J2T E;  2DI4 A;  2VKD A;  2VL0 A;  4ILB A;  2KIN B;  3JCF A;  2PBI A;  4HWC A;  4IL9 A;  1D1B A;  2W63 A;  1MMN A;  3CX8 B;  3JAF A;  3OPC A;  3UQ4 A;  2V7L A;  1HG2 A;  3AVS A;  3K3O A;  4H63 V;  2NW8 A;  2V6Y B;  5DQW A;  5AQO B;  3AE3 A;  5HCJ A;  3N9N A;  3TLV A;  4X1K E;  1UK5 A;  5AQR B;  4ZI3 D;  4AQF C;  4AQF A;  1OED A;  2NW9 A;  3SRZ A;  3ZN1 B;  4HWD A;  1LRZ A;  5AQJ B;  3VRB A;  3ZMU B;  4K0U A;  2K48 A;  2E9X C;  5HEH A;  4FI5 A;  2Z6E A;  3OBV E;  3N9L A;  4PJM A;  3OJA A;  4TWF A;  1YW0 A;  4NPP A;  2EHO C;  4WW0 A;  4I0U A;  2D2S A;  3LBX A;  2H7O A;  2V1D B;  1D0Y A;  4UEM A;  3CX6 B;  5IUX A;  5DQV A;  5C8Y E;  4E7S A;  3KBT A;  2ACX A;  4ILC A;  2X9X A;  3CPZ A;  2R6G F;  4IE7 A;  3K1S A;  4KBM B;  1BR2 A;  4JI1 T;  3CML A;  2NW7 A;  3X1D A;  3C50 A;  4ZHQ E;  5HEO A;  5AQU B;  2GK9 A;  3HKE E;  5AQV B;  5L3F B;  4QHO A;  5LHI B;  3DTO A;  3ZJ1 A;  1VCT A;  3HKC E;  3P4R A;  2WDQ A;  4IIJ E;  2ZLY A;  2J62 A;  4PK5 A;  4O8S A;  3AXJ B;  1WR0 A;  4IDZ A;  3V5S A;  2JQ9 A;  5HAX A;  2DLR A;  3RYI E;  5F3J A;  4H63 H;  3PTR B;  2IC6 A;  2NR4 A;  1XWM A;  1Y64 B;  4L0R A;  4O4H E;  5LJN A;  3AE7 A;  3AEA A;  4EB6 E;  4HFD A;  1W9R A;  3UTK A;  5AQS B; 
#chains in the Genus database with same CATH homology
 1IBK T;  4LF6 T;  1HNZ T;  1XMQ T;  2UUA T;  4DUY T;  4DR6 T;  4DR2 T;  4DR3 T;  3T1H T;  2UXC T;  4DV1 T;  4DR7 T;  4B3M T;  4JI3 T;  4AQY T;  1XNQ T;  4DV0 T;  4DV5 T;  1IBM T;  4LFA T;  4JI6 T;  2VQF T;  1HNX T;  4DV4 T;  1IBL T;  2UU9 T;  4DR4 T;  2UXB T;  3T1Y T;  3OTO T;  1N36 T;  4LFB T;  1N33 T;  4DV6 T;  4JI0 T;  4B3S T;  4DV7 T;  4JV5 T;  5BR8 T;  5IWA T;  4KHP T;  4B3R T;  2HHH T;  4X66 T;  4GKJ T;  1J5E T;  4LFC T;  4JYA T;  2UUC T;  4NXM T;  2VQE T;  5LMU T;  2ZM6 T;  4JI1 T;  4JI5 T;  4B3T T;  2F4V T;  4OX9 T;  4X62 T;  4LF9 T;  4JI2 T;  4LF4 T;  4YY3 T;  4DR1 T;  1FJG T;  1XMO T;  4DV2 T;  4NXN T;  4LF7 T;  1I94 T;  4LF8 T;  1N34 T;  2UUB T;  1HNW T;  4DV3 T;  1XNR T;  2UXD T;  1HR0 T;  4DUZ T;  1N32 T;  2E5L T;  4K0K T;  4X65 T;  4JI4 T;  4JI7 T;  4GKK T;  4YHH T;  4X64 T;  5LMN T;  4LF5 T;  4DR5 T;  4JI8 T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...