4DUZT

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, u13c, bound with streptomycin
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
total genus 36
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 4duzT00
5LMUT 4DR4T 4DR5T 1J5ET 1IBMT 1IBKT 4DV7T 2UUBT 4LF8T 4NXMT 1XMQT 2HHHT 4DV5T 4GKKT 4OX9T 4DV1T 2VQET 1HR0T 5LMNT 5BR8T 4DV2T 2VQFT 4DV3T 4JI6T 1XNRT 2F4VT 4B3TT 4YY3T 4LFAT 4B3RT 4LF9T 4JI7T 4LFBT 4JI5T 4X62T 1IBLT 4B3MT 4NXNT 4KHPT 2UXBT 4JV5T 4DR6T 4YHHT 2ZM6T 1N34T 4JI3T 2E5LT 4JI8T 4JI0T 3T1HT 2UU9T 1I94T 4LF5T 4DUZT 1N36T 2UXCT 1N32T 4DV4T 4K0KT 4X66T 4DV0T 4X65T 4X64T 4JI4T 1HNZT 1XNQT 2UUCT 4DR1T 5IWAT 2UUAT 4LFCT 4JI1T 1FJGT 2UXDT 4JYAT 3OTOT 1N33T 4B3ST 4DV6T 4AQYT 4DR2T 1HNXT 4LF7T 4DUYT 4GKJT 1XMOT 4DR7T 3T1YT 1HNWT 4JI2T 4DR3T 4LF6T 4LF4T
chains in the Genus database with same CATH superfamily
3EAMA 3K3NA 5LHHB 1KNRA 3RYFE 3OYXA 4QXCB 3UUNA 2BKNA 2LHNA 4I55E 3IBPA 3RIUA 1S94A 5LMNT 4DV2T 3VKHA 2CM0A 1X9BA 5L4EA 2XAJB 3JAFA 4WBOA 4DBRA 2CPTA 3GMIA 3RLFF 3CPZA 3ZMVB 4DMVA 5EK2A 5IUXA 2UXBT 2WM9A 2W2UA 4YHHT 4CXXA 1J1JA 3FZKB 3ANWA 1KNPA 3C4ZA 2VKJA 2UU9T 2NP9A 3N9QA 2CHNA 5AQFB 2DL1A 5TAOA 2X68A 3NZPA 4IGUA 2X9HA 4MHCA 4ZOLE 4IDOA 1UUSA 4GYRA 3CVRA 3UFEA 4AQGA 2BG9A 3CX6B 4OYJA 4YSZA 4UXNB 5CFBA 3SFDA 3HKBE 1ZP0A 4UEMA 4UVCB 3I1AA 3ZMUB 3TLWA 4X20E 5AQJB 4A98A 2Q9QC 5FXZA 5ABFB 5LXTE 4U2YA 4OX9T 3ZCJA 4A97A 2B1EA 2EHOD 4JBWF 3B5MA 3AE4A 4TV9E 2KWIB 4PK5A 4IE5A 5CB4E 4HFIA 3CMLA 2JQ9A 3KINB 3ZMTB 3JADA 5LB7B 3BQKA 1D0ZA 3NBXX 5JRCA 1E1HB 3FHNA 2CMRA 2WDVA 2MBGA 4UF0B 4CXYA 5JDGA 3R6NA 3ANWB 3L8RA 4M1PA 5J2UE 4IE6A 5JREA 2VVNA 3UU8A 1D1BA 2XQ9A 2ZMAA 3AAAB 4JEHB 5FXWA 2UUAT 4JI1T 5L47A 4DR2T 2VKDA 3LBXA 4I4TE 4Z8XA 3KV4A 1VCTA 2XAGB 2WZIA 2CBIA 1T98A 2FBWA 5AQMB 2BKOA 3UU3A 4UVAB 2C5KT 4PK6A 3LK2B 2W00A 4C90A 2WQYA 2V7KA 4QXHB 2HHHT 2KWHA 3RYHE 1D0XA 4DBQA 4PJNA 4ILUA 4C91A 1MIVA 4EOZB 1Y64B 4HWFA 2NWBA 1VCSA 2XQ5A 3O1JA 4NUVA 1HF8A 1B7TA 3PURA 3I9WA 4UELA 2IC9A 3Q2MA 4DNDA 3L39A 4ERRA 1HFAA 4HFHA 4LFBT 2CA5A 2V8SV 5C8YE 2E5VA 4BAYB 3P4SA 1G8XA 2A9UA 4ILAA 3QB5A 3HKCE 3QK6A 4PNIA 4JV5T 4CI1B 4ZZCA 4ILBA 5HXRA 3I0QA 5EK4A 4H9RC 2HPJA 2DI4A 1T72A 3EVYA 1L0VA 3ZEFB 2H7VC 4EGWA 2KLQA 4N78D 4JI4T 2LSJA 2KT9A 2UUCT 2WS3A 4AXPA 2AXDS 2CBJA 4ISSA 4O4LE 1D0YA 3H3MA 5JDHA 3J7Yq 3U78A 3LBXB 3E08A 2V5DA 2V6XA 5DQVA 4LMKA 3UUBA 4YJ2E 3MZKB 4HWCA 4HWHA 3MA9A 5FYMA 2V7LA 3IF8B 4DV7T 2XQ3A 2WBLA 2HN2A 2LRKA 4IE4A 2WU5A 2N1GA 3SRZA 5LA6E 3IEEA 3ABVA 2VQFT 3O1HA 1WYBA 4IT4A 2IC6A 3WI3A 2X0YA 5AQOB 1UCUA 2BS2A 2YINA 2H7OA 3RKGA 3Q5WA 4KX6A 3AE2A 4TNVA 4O4JE 1LVKA 2CWYA 3K1SA 4GYSA 2NTYA 5HEGA 1DU2A 3M3ZB 5FMNA 3ETUA 4B6XA 3U3IA 2LSKA 4CZZB 5FVKA 3QB5K 3C4WA 1QLBA 2V6YA 2PG8A 4OFZA 3FZLB 3A5XA 4X64T 3RGLA 3HI2A 2RP4A 3SFEA 2R6GF 5M4YA 1WYCA 4CN6A 3N2OA 2V7MA 2W63A 2MTQA 4PFPA 5AQQB 5L3BB 3ZN1B 1VOMA 4DR7T 3T1YT 2ACZA 4OHFA 5LGUB 1FMWA 1FMVA 3N9OA 5JDNA 1XWMA 4AKRB 1BR2A 3EDVA 5LCYA 4O2BE 2XUEA 3PUQA 3LK42 3LK3B 2XQ8A 5AQIB 2LKHA 5J1GA 1HR0T 3N9MA 3SS1A 2VKOA 3KVBA 3UTKA 5JDQA 5AQUB 2XTLA 4YSXA 3NZQA 2IIUA 4LFAT 3VR9A 2QRXA 4HN9A 4X62T 1JNZA 5H6QB 5AQRB 3P50A 2V7IA 5LG3A 4EAHA 1BR1A 4DVDA 4BJNA 2D2SA 2I0MA 3KFWX 1V9DA 3PE0A 2LT3A 3RYIE 4H9NC 4PAGA 5F8PA 1N32T 2V6YB 2BDEA 2JQHA 1HNZT 4DR1T 3AB3B 2SPCA 2V5CA 4A56A 4QXBB 3TLSA 1M7KA 2UXDT 4TWHA 3GN5A 4DV6T 3KBUA 3G06A 1MMGA 4H9SE 4GKJT 1E7PA 2UXXB 2MAWA 1XMOT 3VKGA 3KV5A 2YU2A 3VU7H 2OLTA 5LBQB 3TLTA 2DWKA 3HL6A 4LF4T 1S35A 1Z0PA 4DR5T 3QC9A 3B57A 5HXHA 3TKLB 4NXMT 5LGTB 4TX5A 2X0LB 3EABA 4EZ4A 2XJ7A 2XPKA 1R8IA 5AQHB 1T8BA 5LYJE 4QH1A 3BQLA 3P4QA 5LHIB 3E22E 5FXVA 3O9XA 1LVFA 2PTFA 2ZM0A 4HFEA 4QH5A 2E9XA 3PUGA 2XAFB 1OEDE 1HS7A 5LHGB 2WMNA 4A5XA 1WRDA 5ABEA 4ZXLA 5AQLB 4G2AA 1KF6A 1UURA 4U7IA 1YW0A 1AJ3A 3RC3A 2NR4A 2IHR1 3P8CD 3QNUA 3PTRB 2UXCT 4O4HE 2BKPA 2VURA 3AEBA 4EYUA 3CK6A 3CQCB 4MLKA 1XNQT 5ADXL 3O1IA 3J9X1 4JYAT 1N33T 1HNXT 3GN5B 2D9DA 1YD8G 4DUYT 5FXXA 4L5GA 2XQYA 1U5PA 4E7ZA 3HA4A 2CXDA 4UVBB 2YDQA 4NUUA 3LDQB 2A72A 3F31A 4J2CA 4OYKA 2LJLA 4COFA 4EZHA 4P09A 4PFOA 5CA1E 2UUBT 4GK0E 1XDPA 2MYSA 5L3CB 5FY1A 3UUXB 4PJJA 2YOEA 4KI0F 3AEAA 2XZEA 2D0UA 2WB5A 2XQ4A 4QX7B 4IDZA 5FY0A 4WW0A 2QGSA 2K48A 2X51A 1MNDA 2E9XB 4QHOA 2X66A 5BMVE 2E8IA 2ZM8A 4Z90A 3KVAA 4H9OC 2M6BA 3EI0A 4F6RC 5C2TA 3Q5EA 3T1HT 3EHZA 3AXJA 2FUPA 2XAQB 2EHOC 4YTPA 3KV6A 4DV4T 3N2GE 5IHYA 1LKXA 2N9DA 1T7SA 1J5WA 2CLYC 3X1DA 2LSIA 4WNKA 3Q5XA 2CHOA 4TZ4C 2KINB 3VRAA 2CCQA 4WBNE 4IDNA 3EUHA 2LLYA 3ZC0A 3MK7C 4CN4A 3OKQA 3ZT7A 3DJBA 4IIJE 1MIYA 4U7YA 2VVSA 4ISTA 1J5ET 5HYAA 4PJLA 2IAKA 2L3LA 1MMDA 2OA5A 4LF8T 2BG9B 1NWMX 3BK9A 2LOPA 3CKDA 3ONJA 4EB6E 5LP6E 3OVUA 1EZ3A 2XHEB 3PUZF 2XY8B 2LM9A 4JI7T 3RRCA 2H88A 3N9PA 2P9BA 2FJEA 3P4PA 2FJBA 3UU6A 1HX1B 2WP9A 1OEDC 4UR9A 3O4XE 1ZHCA 3NRXA 3NWIA 2W4XA 4CI3B 2V1DB 3V5SA 2NW9A 4JI3T 4WYVA 4UV8B 3AXJB 4IREA 5ABGA 4YXDA 3RF1A 2I6HA 2Y48B 2NW7A 5JRCB 2C5IT 4L0RA 4YT0A 5ETWA 3H3AA 2DLRA 2LE8A 2X9WA 4ZI2D 2V7JA 2W61A 3RX6A 3AAEB 3WAKA 2VB6A 1GQEA 1HG2A 2E9XD 4DO0A 2ZM2A 3KV9A 1IJ6A 3PV0F 1W0BA 2H3RA 4ZI3D 5J0ZA 1JNRA 4KMCA 3ZT6A 4YSYA 2A2FX 5HEJA 4GIWA 1XZYA 5AQKB 4HFBA 1WR0A 2XSBA 3CX7B 1X79A 3AEGA 3ZPOA 3A8YC 3PUSA 3T8OA 4ANJA 2HPLA 3Q5DA 3RIAA 2WWUA 4HTEA 2XQ7A 1IAPA 3AA6B 5FY7A 4TV8E 3Q9DA 3PJAA 1IBLT 2L8KA 1NAFA 2UXNB 2FJDA 3ZYKA 1NENA 2A3DA 4DR6T 5DJQC 1WLXA 5DABA 3K3QC 2JPFA 5LNKA 2QA7A 3FXDB 3BQIA 5C3JA 1KEYA 2LSGA 4TUYE 4U31A 5IWAT 2C5JA 2PJQA 5JVDE 3A7MA 2ACXA 4TWFA 1BR0A 5AQPB 3D0TA 3AE7A 4EEDA 4AKHA 1WFDA 4ZS3A 2PFVA 2KNDA 3QOFA 3AE9A 2XM2A 3ESLA 5L3GB 2Q9QA 3UULA 4DV5T 2J1DG 2JMKA 5FP3A 2BS4A 5FNVE 4DV1T 4UIGA 2DHRA 2BS3A 1HCIA 2JQKA 4GOUA 3RRWA 3ZMSB 2DWGA 4GK5E 1E2AA 2YN6A 4TN7B 4YLHA 3PU3A 4P0AA 3JAEA 2XM1A 1YXRA 1NEKA 3PUAA 4EEBA 2L9QA 3SOLA 1W9RA 1W0AA 4AKIA 1XDOA 3QUJA 1SHZC 3AE5A 1I94T 2XAHB 5HEOA 3L09A 2IUBA 1H7CA 1UGOA 3N5LA 3C4XA 3RKOA 3JC6D 5HCMA 2AE9A 2VKHA 5A1LA 4G63A 5AQSB 4IHJE 2Z6EA 3HKDE 3JCFA 3KBTA 3PUWF 3IHRA 5GONE 3AA0B 2BZBA 4JI2T 4O8SA 2YDRA 4DR3T 5LMUT 1UX5A 1OWAA 2WZHA 2HH7A 4TWDA 4O4IE 1IBMT 2YKSA 4CQIA 4K0UA 3DP7A 2Q9QB 3OYZA 1QSDA 3PDYA 3ZSSA 1OEDA 2VQET 2HN1A 4JLEA 3MXZA 4AQFC 1XNRT 5FL1A 4ZZBA 2BVLA 3ZT5A 4B3RT 2Y6XA 1U4QA 4LF9T 5L4HA 3AA7B 1HTJF 3ZSTA 2PBIA 2KXPB 1ZV4X 2X67A 2ZLYA 4CI2B 2E2AA 1IZNB 4HFCA 4H9QC 1N34T 3OPCA 3K3OA 5E0OA 5LOVE 3C64A 2J4GA 3FZMB 4ADZA 4DUZT 1N36T 4MALA 4ZS2A 3AVSA 3UFGA 3FBZA 5FKYA 3AEFA 5HEHA 4X65T 3LFMA 3F57A 4LFCT 3CIRA 2LRLA 2IMLA 2RPAA 2K3WA 3AAIA 5ABFA 4BA9A 4QWNB 3OBVE 2X9YA 1W09A 3ZMZB 3RYCE 5L3DB 2CXFA 2G0UA 2KZ7B 4PW8A 3NKZA 5CGMA 4P1NA 4H63H 3M65A 1CHUA 1SE7A 2LHRA 2CWOA 4DR4T 2J47A 1ZOYA 5AQTB 1IBKT 5JR9C 2ODVA 3UU5A 4WZXA 4AI6A 3C50A 3RQWA 4ZI7E 3PUVF 4UF0A 2VL8A 1OEDB 2LEHA 3GA8A 4O2AE 1UX4A 2CRBA 3ZJ2A 3CQGB 3RHWA 2F4VT 2WWVA 3FZFB 3C98B 5L3EB 4LMJA 5HXCA 1FEWA 4JUYA 1FIOA 1MNEA 4P0BA 3CQXC 2WAUA 4B3MT 3PU8A 4TNWA 2D5UA 4ZEYA 3I9YA 4IDPA 2WY2A 2ZM6T 2E5LT 3IA3A 1KNZA 2DNXA 3RH3A 2XSAA 3DTOA 2W67A 2VL0A 4AIUA 4K0KT 2Q9QD 4HKAA 5AQNB 3ZC1A 5JTGA 2MOZA 3VRBA 1SUMB 3NRYA 3FXEB 5KX5E 2K24A 4MBQA 3B13A 4MFRA 4HFVA 3UUMA 4QKNA 1KFYA 4DIDB 2YU1A 5HAXA 3TLVA 1US7B 3NVOA 2NW8A 5HXSA 2V26A 2YDSA 4HWDA 3AEDA 4LF6T 1I6ZA 2BG9E 3ZCIA 5HXEA 1XMQT 4GKKT 3ZKRA 2WCAA 3V5UA 2LM2A 4EXTA 5KXJA 4IL9A 3GWHA 4XAXB 2LSYA 5JQGE 5BR8T 5AQGB 2CE7A 4X1IE 4H63V 3UT5E 4YHJA 4E7SA 4KUMB 3P4RA 3AEEA 4YY3T 3K8PC 3KDSE 4KP3C 3HKEE 3FBLA 1MMNA 2JMHA 4HE8A 5FVLA 1WCRA 3RI5A 4U72A 4NXNT 2JQQA 4YFSA 3UQ7A 3LSVA 5L2LA 2KMFA 2LKGA 3AECA 2NTXA 3S4UA 3PUXF 3ZYMA 5JDFA 2Y8DA 4PJMA 5AQVB 2B76A 3VR8A 4NPPA 4EV6A 3FZHB 3AVRA 4I0UA 3ONLC 3AE6A 1UK5A 3RC8A 4X5TA 3ETVA 5HEUA 1HX8A 4AQFA 4QH4A 1LRZA 1MMAA 3UQ4A 5LJMA 3W15B 4FI5A 4U74A 4BJMA 2BVMA 2BBHA 2M6IA 1ZKEA 2KSRA 4I43B 4JI6T 2XASB 4ZI2C 2WMOA 3R84B 2JIWA 4H9PC 1YKEB 2K9AA 4X1YE 2GK9A 4HWIB 2J62A 2E9XC 5EZYE 5CA0E 2JJ9A 2WDQA 3N9NA 1M62A 2X9XA 4IE7A 3RIUC 4YJ3E 5JDLA 4EIWA 2W62A 4ZI3C 2M67A 2WU2A 4AISA 4LMLA 4Z91A 5J2TE 4V1Av 3RIFA 5HCJA 4PK4A 5LBMA 4HEAA 3OJAA 3OTOT 1Z8UA 5L3FB 4U3CA 5JR9A 5LG4A 3PUYF 2H89A 2DCFA 3CX8B 2W66A 4OK0A 1HNWT 5JH7E 2XQAA 4DMWA 1CUNA 4U2ZA 3I0OA 3WAJA 1D1CA 4XBFB 1KK7A 1BR4A 4EYYR 3AE1A 2BG9C 4UV9B 2QYWA 4CXWA 5KMGP 2JRKA 4IE0A 1IJ5A 3P4WA 3SWHA 2WDRA 1HG5A 4B3TT 1YQ3A 2BBJA 2VWAA 4AKLA 2D0TA 4YTMA 3AA1B 3MKDA 2FJAA 3ONXA 2W0GA 2IW5B 1OXZA 2LOSA 1ZEEA 4HFDA 5DQWA 1SA0E 4JI8T 3HR0A 2OV9A 4YTNA 3MJXA 3FB2A 4IDQA 2EHOA 4U33A 4X66T 2N2NA 4DV0T 3MACA 5ABHA 5LGNB 1YKHB 3AE3A 1VRBA 4Q25A 2NOXA 3H37A 1FJGT 2CEAA 4B3ST 2YEVC 4IL4A 5JR9B 4X1KE 4LF7T 3ZN0B 2VK9A 1QUUA 3VHLA 4L9IA 1WR6A 3C51A 2K5BB 3AE8A 1O3XA 2RA1A 3LJCA 3LG7A 3F2EA 3E0ZA 2I59A 5IYZE 4QX8B 3ZJ1A 2VASA 1D1AA 4AKGA 4F8HA 3JC6C 1G73A 2ODUA 2ES0A 2WSSV 3EDUA 2MPKA 3P7IA 4DV3T 4ASKA 3RQUA 4KHZF 2X0HA 4NIQA 2C0SA 3UU4A 4JI5T 3N2KE 5EK3A 4CN1A 3ZLIA 5CJ5A 3TLUA 4ZHQE 5AFUL 4KHPT 5HWXA 2XQ6A 4JI0T 3CWZB 4HGAA 5FL0A 2CXLA 2IDOB 4LF5T 5HWYA 4XZCA 3PJAJ 2EHOB 5KDMC 1YQ4A 5F5WA 2YK0A 2CLYB 3N9LA 4I50E 3L3PA 4ILCA 4AQYT 1MIWA 4JEUB 4KBMB 3RPUA 5H6RB 1Y01A 5F3JA 2QVAA 3ZYLA 5JDMA 4FJOA 5LJNA
chains in the Genus database with same CATH topology
5LMUT 4DR4T 4DR5T 1J5ET 1IBMT 1IBKT 4DV7T 2UUBT 4LF8T 4NXMT 1XMQT 2HHHT 4DV5T 4GKKT 4OX9T 4DV1T 2VQET 1HR0T 5LMNT 5BR8T 4DV2T 2VQFT 4DV3T 4JI6T 1XNRT 2F4VT 4B3TT 4YY3T 4LFAT 4B3RT 4LF9T 4JI7T 4LFBT 4JI5T 4X62T 1IBLT 4B3MT 4NXNT 4KHPT 2UXBT 4JV5T 4DR6T 4YHHT 2ZM6T 1N34T 4JI3T 2E5LT 4JI8T 4JI0T 3T1HT 2UU9T 1I94T 4LF5T 4DUZT 1N36T 2UXCT 1N32T 4DV4T 4K0KT 4X66T 4DV0T 4X65T 4X64T 4JI4T 1HNZT 1XNQT 2UUCT 4DR1T 5IWAT 2UUAT 4LFCT 4JI1T 1FJGT 2UXDT 4JYAT 3OTOT 1N33T 4B3ST 4DV6T 4AQYT 4DR2T 1HNXT 4LF7T 4DUYT 4GKJT 1XMOT 4DR7T 3T1YT 1HNWT 4JI2T 4DR3T 4LF6T 4LF4T
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LMU T;  4DR4 T;  4DR5 T;  1J5E T;  1IBM T;  1IBK T;  4DV7 T;  2UUB T;  4LF8 T;  4NXM T;  1XMQ T;  2HHH T;  4DV5 T;  4GKK T;  4OX9 T;  4DV1 T;  2VQE T;  1HR0 T;  5LMN T;  5BR8 T;  4DV2 T;  2VQF T;  4DV3 T;  4JI6 T;  1XNR T;  2F4V T;  4B3T T;  4YY3 T;  4LFA T;  4B3R T;  4LF9 T;  4JI7 T;  4LFB T;  4JI5 T;  4X62 T;  1IBL T;  4B3M T;  4NXN T;  4KHP T;  2UXB T;  4JV5 T;  4DR6 T;  4YHH T;  2ZM6 T;  1N34 T;  4JI3 T;  2E5L T;  4JI8 T;  4JI0 T;  3T1H T;  2UU9 T;  1I94 T;  4LF5 T;  4DUZ T;  1N36 T;  2UXC T;  1N32 T;  4DV4 T;  4K0K T;  4X66 T;  4DV0 T;  4X65 T;  4X64 T;  4JI4 T;  1HNZ T;  1XNQ T;  2UUC T;  4DR1 T;  5IWA T;  2UUA T;  4LFC T;  4JI1 T;  1FJG T;  2UXD T;  4JYA T;  3OTO T;  1N33 T;  4B3S T;  4DV6 T;  4AQY T;  4DR2 T;  1HNX T;  4LF7 T;  4DUY T;  4GKJ T;  1XMO T;  4DR7 T;  3T1Y T;  1HNW T;  4JI2 T;  4DR3 T;  4LF6 T;  4LF4 T; 
#chains in the Genus database with same CATH topology
 3EAM A;  3K3N A;  5LHH B;  1KNR A;  3RYF E;  3OYX A;  4QXC B;  3UUN A;  2BKN A;  2LHN A;  4I55 E;  3IBP A;  3RIU A;  1S94 A;  5LMN T;  4DV2 T;  3VKH A;  2CM0 A;  1X9B A;  5L4E A;  2XAJ B;  3JAF A;  4WBO A;  4DBR A;  2CPT A;  3GMI A;  3RLF F;  3CPZ A;  3ZMV B;  4DMV A;  5EK2 A;  5IUX A;  2UXB T;  2WM9 A;  2W2U A;  4YHH T;  4CXX A;  1J1J A;  3FZK B;  3ANW A;  1KNP A;  3C4Z A;  2VKJ A;  2UU9 T;  2NP9 A;  3N9Q A;  2CHN A;  5AQF B;  2DL1 A;  5TAO A;  2X68 A;  3NZP A;  4IGU A;  2X9H A;  4MHC A;  4ZOL E;  4IDO A;  1UUS A;  4GYR A;  3CVR A;  3UFE A;  4AQG A;  2BG9 A;  3CX6 B;  4OYJ A;  4YSZ A;  4UXN B;  5CFB A;  3SFD A;  3HKB E;  1ZP0 A;  4UEM A;  4UVC B;  3I1A A;  3ZMU B;  3TLW A;  4X20 E;  5AQJ B;  4A98 A;  2Q9Q C;  5FXZ A;  5ABF B;  5LXT E;  4U2Y A;  4OX9 T;  3ZCJ A;  4A97 A;  2B1E A;  2EHO D;  4JBW F;  3B5M A;  3AE4 A;  4TV9 E;  2KWI B;  4PK5 A;  4IE5 A;  5CB4 E;  4HFI A;  3CML A;  2JQ9 A;  3KIN B;  3ZMT B;  3JAD A;  5LB7 B;  3BQK A;  1D0Z A;  3NBX X;  5JRC A;  1E1H B;  3FHN A;  2CMR A;  2WDV A;  2MBG A;  4UF0 B;  4CXY A;  5JDG A;  3R6N A;  3ANW B;  3L8R A;  4M1P A;  5J2U E;  4IE6 A;  5JRE A;  2VVN A;  3UU8 A;  1D1B A;  2XQ9 A;  2ZMA A;  3AAA B;  4JEH B;  5FXW A;  2UUA T;  4JI1 T;  5L47 A;  4DR2 T;  2VKD A;  3LBX A;  4I4T E;  4Z8X A;  3KV4 A;  1VCT A;  2XAG B;  2WZI A;  2CBI A;  1T98 A;  2FBW A;  5AQM B;  2BKO A;  3UU3 A;  4UVA B;  2C5K T;  4PK6 A;  3LK2 B;  2W00 A;  4C90 A;  2WQY A;  2V7K A;  4QXH B;  2HHH T;  2KWH A;  3RYH E;  1D0X A;  4DBQ A;  4PJN A;  4ILU A;  4C91 A;  1MIV A;  4EOZ B;  1Y64 B;  4HWF A;  2NWB A;  1VCS A;  2XQ5 A;  3O1J A;  4NUV A;  1HF8 A;  1B7T A;  3PUR A;  3I9W A;  4UEL A;  2IC9 A;  3Q2M A;  4DND A;  3L39 A;  4ERR A;  1HFA A;  4HFH A;  4LFB T;  2CA5 A;  2V8S V;  5C8Y E;  2E5V A;  4BAY B;  3P4S A;  1G8X A;  2A9U A;  4ILA A;  3QB5 A;  3HKC E;  3QK6 A;  4PNI A;  4JV5 T;  4CI1 B;  4ZZC A;  4ILB A;  5HXR A;  3I0Q A;  5EK4 A;  4H9R C;  2HPJ A;  2DI4 A;  1T72 A;  3EVY A;  1L0V A;  3ZEF B;  2H7V C;  4EGW A;  2KLQ A;  4N78 D;  4JI4 T;  2LSJ A;  2KT9 A;  2UUC T;  2WS3 A;  4AXP A;  2AXD S;  2CBJ A;  4ISS A;  4O4L E;  1D0Y A;  3H3M A;  5JDH A;  3J7Y q;  3U78 A;  3LBX B;  3E08 A;  2V5D A;  2V6X A;  5DQV A;  4LMK A;  3UUB A;  4YJ2 E;  3MZK B;  4HWC A;  4HWH A;  3MA9 A;  5FYM A;  2V7L A;  3IF8 B;  4DV7 T;  2XQ3 A;  2WBL A;  2HN2 A;  2LRK A;  4IE4 A;  2WU5 A;  2N1G A;  3SRZ A;  5LA6 E;  3IEE A;  3ABV A;  2VQF T;  3O1H A;  1WYB A;  4IT4 A;  2IC6 A;  3WI3 A;  2X0Y A;  5AQO B;  1UCU A;  2BS2 A;  2YIN A;  2H7O A;  3RKG A;  3Q5W A;  4KX6 A;  3AE2 A;  4TNV A;  4O4J E;  1LVK A;  2CWY A;  3K1S A;  4GYS A;  2NTY A;  5HEG A;  1DU2 A;  3M3Z B;  5FMN A;  3ETU A;  4B6X A;  3U3I A;  2LSK A;  4CZZ B;  5FVK A;  3QB5 K;  3C4W A;  1QLB A;  2V6Y A;  2PG8 A;  4OFZ A;  3FZL B;  3A5X A;  4X64 T;  3RGL A;  3HI2 A;  2RP4 A;  3SFE A;  2R6G F;  5M4Y A;  1WYC A;  4CN6 A;  3N2O A;  2V7M A;  2W63 A;  2MTQ A;  4PFP A;  5AQQ B;  5L3B B;  3ZN1 B;  1VOM A;  4DR7 T;  3T1Y T;  2ACZ A;  4OHF A;  5LGU B;  1FMW A;  1FMV A;  3N9O A;  5JDN A;  1XWM A;  4AKR B;  1BR2 A;  3EDV A;  5LCY A;  4O2B E;  2XUE A;  3PUQ A;  3LK4 2;  3LK3 B;  2XQ8 A;  5AQI B;  2LKH A;  5J1G A;  1HR0 T;  3N9M A;  3SS1 A;  2VKO A;  3KVB A;  3UTK A;  5JDQ A;  5AQU B;  2XTL A;  4YSX A;  3NZQ A;  2IIU A;  4LFA T;  3VR9 A;  2QRX A;  4HN9 A;  4X62 T;  1JNZ A;  5H6Q B;  5AQR B;  3P50 A;  2V7I A;  5LG3 A;  4EAH A;  1BR1 A;  4DVD A;  4BJN A;  2D2S A;  2I0M A;  3KFW X;  1V9D A;  3PE0 A;  2LT3 A;  3RYI E;  4H9N C;  4PAG A;  5F8P A;  1N32 T;  2V6Y B;  2BDE A;  2JQH A;  1HNZ T;  4DR1 T;  3AB3 B;  2SPC A;  2V5C A;  4A56 A;  4QXB B;  3TLS A;  1M7K A;  2UXD T;  4TWH A;  3GN5 A;  4DV6 T;  3KBU A;  3G06 A;  1MMG A;  4H9S E;  4GKJ T;  1E7P A;  2UXX B;  2MAW A;  1XMO T;  3VKG A;  3KV5 A;  2YU2 A;  3VU7 H;  2OLT A;  5LBQ B;  3TLT A;  2DWK A;  3HL6 A;  4LF4 T;  1S35 A;  1Z0P A;  4DR5 T;  3QC9 A;  3B57 A;  5HXH A;  3TKL B;  4NXM T;  5LGT B;  4TX5 A;  2X0L B;  3EAB A;  4EZ4 A;  2XJ7 A;  2XPK A;  1R8I A;  5AQH B;  1T8B A;  5LYJ E;  4QH1 A;  3BQL A;  3P4Q A;  5LHI B;  3E22 E;  5FXV A;  3O9X A;  1LVF A;  2PTF A;  2ZM0 A;  4HFE A;  4QH5 A;  2E9X A;  3PUG A;  2XAF B;  1OED E;  1HS7 A;  5LHG B;  2WMN A;  4A5X A;  1WRD A;  5ABE A;  4ZXL A;  5AQL B;  4G2A A;  1KF6 A;  1UUR A;  4U7I A;  1YW0 A;  1AJ3 A;  3RC3 A;  2NR4 A;  2IHR 1;  3P8C D;  3QNU A;  3PTR B;  2UXC T;  4O4H E;  2BKP A;  2VUR A;  3AEB A;  4EYU A;  3CK6 A;  3CQC B;  4MLK A;  1XNQ T;  5ADX L;  3O1I A;  3J9X 1;  4JYA T;  1N33 T;  1HNX T;  3GN5 B;  2D9D A;  1YD8 G;  4DUY T;  5FXX A;  4L5G A;  2XQY A;  1U5P A;  4E7Z A;  3HA4 A;  2CXD A;  4UVB B;  2YDQ A;  4NUU A;  3LDQ B;  2A72 A;  3F31 A;  4J2C A;  4OYK A;  2LJL A;  4COF A;  4EZH A;  4P09 A;  4PFO A;  5CA1 E;  2UUB T;  4GK0 E;  1XDP A;  2MYS A;  5L3C B;  5FY1 A;  3UUX B;  4PJJ A;  2YOE A;  4KI0 F;  3AEA A;  2XZE A;  2D0U A;  2WB5 A;  2XQ4 A;  4QX7 B;  4IDZ A;  5FY0 A;  4WW0 A;  2QGS A;  2K48 A;  2X51 A;  1MND A;  2E9X B;  4QHO A;  2X66 A;  5BMV E;  2E8I A;  2ZM8 A;  4Z90 A;  3KVA A;  4H9O C;  2M6B A;  3EI0 A;  4F6R C;  5C2T A;  3Q5E A;  3T1H T;  3EHZ A;  3AXJ A;  2FUP A;  2XAQ B;  2EHO C;  4YTP A;  3KV6 A;  4DV4 T;  3N2G E;  5IHY A;  1LKX A;  2N9D A;  1T7S A;  1J5W A;  2CLY C;  3X1D A;  2LSI A;  4WNK A;  3Q5X A;  2CHO A;  4TZ4 C;  2KIN B;  3VRA A;  2CCQ A;  4WBN E;  4IDN A;  3EUH A;  2LLY A;  3ZC0 A;  3MK7 C;  4CN4 A;  3OKQ A;  3ZT7 A;  3DJB A;  4IIJ E;  1MIY A;  4U7Y A;  2VVS A;  4IST A;  1J5E T;  5HYA A;  4PJL A;  2IAK A;  2L3L A;  1MMD A;  2OA5 A;  4LF8 T;  2BG9 B;  1NWM X;  3BK9 A;  2LOP A;  3CKD A;  3ONJ A;  4EB6 E;  5LP6 E;  3OVU A;  1EZ3 A;  2XHE B;  3PUZ F;  2XY8 B;  2LM9 A;  4JI7 T;  3RRC A;  2H88 A;  3N9P A;  2P9B A;  2FJE A;  3P4P A;  2FJB A;  3UU6 A;  1HX1 B;  2WP9 A;  1OED C;  4UR9 A;  3O4X E;  1ZHC A;  3NRX A;  3NWI A;  2W4X A;  4CI3 B;  2V1D B;  3V5S A;  2NW9 A;  4JI3 T;  4WYV A;  4UV8 B;  3AXJ B;  4IRE A;  5ABG A;  4YXD A;  3RF1 A;  2I6H A;  2Y48 B;  2NW7 A;  5JRC B;  2C5I T;  4L0R A;  4YT0 A;  5ETW A;  3H3A A;  2DLR A;  2LE8 A;  2X9W A;  4ZI2 D;  2V7J A;  2W61 A;  3RX6 A;  3AAE B;  3WAK A;  2VB6 A;  1GQE A;  1HG2 A;  2E9X D;  4DO0 A;  2ZM2 A;  3KV9 A;  1IJ6 A;  3PV0 F;  1W0B A;  2H3R A;  4ZI3 D;  5J0Z A;  1JNR A;  4KMC A;  3ZT6 A;  4YSY A;  2A2F X;  5HEJ A;  4GIW A;  1XZY A;  5AQK B;  4HFB A;  1WR0 A;  2XSB A;  3CX7 B;  1X79 A;  3AEG A;  3ZPO A;  3A8Y C;  3PUS A;  3T8O A;  4ANJ A;  2HPL A;  3Q5D A;  3RIA A;  2WWU A;  4HTE A;  2XQ7 A;  1IAP A;  3AA6 B;  5FY7 A;  4TV8 E;  3Q9D A;  3PJA A;  1IBL T;  2L8K A;  1NAF A;  2UXN B;  2FJD A;  3ZYK A;  1NEN A;  2A3D A;  4DR6 T;  5DJQ C;  1WLX A;  5DAB A;  3K3Q C;  2JPF A;  5LNK A;  2QA7 A;  3FXD B;  3BQI A;  5C3J A;  1KEY A;  2LSG A;  4TUY E;  4U31 A;  5IWA T;  2C5J A;  2PJQ A;  5JVD E;  3A7M A;  2ACX A;  4TWF A;  1BR0 A;  5AQP B;  3D0T A;  3AE7 A;  4EED A;  4AKH A;  1WFD A;  4ZS3 A;  2PFV A;  2KND A;  3QOF A;  3AE9 A;  2XM2 A;  3ESL A;  5L3G B;  2Q9Q A;  3UUL A;  4DV5 T;  2J1D G;  2JMK A;  5FP3 A;  2BS4 A;  5FNV E;  4DV1 T;  4UIG A;  2DHR A;  2BS3 A;  1HCI A;  2JQK A;  4GOU A;  3RRW A;  3ZMS B;  2DWG A;  4GK5 E;  1E2A A;  2YN6 A;  4TN7 B;  4YLH A;  3PU3 A;  4P0A A;  3JAE A;  2XM1 A;  1YXR A;  1NEK A;  3PUA A;  4EEB A;  2L9Q A;  3SOL A;  1W9R A;  1W0A A;  4AKI A;  1XDO A;  3QUJ A;  1SHZ C;  3AE5 A;  1I94 T;  2XAH B;  5HEO A;  3L09 A;  2IUB A;  1H7C A;  1UGO A;  3N5L A;  3C4X A;  3RKO A;  3JC6 D;  5HCM A;  2AE9 A;  2VKH A;  5A1L A;  4G63 A;  5AQS B;  4IHJ E;  2Z6E A;  3HKD E;  3JCF A;  3KBT A;  3PUW F;  3IHR A;  5GON E;  3AA0 B;  2BZB A;  4JI2 T;  4O8S A;  2YDR A;  4DR3 T;  5LMU T;  1UX5 A;  1OWA A;  2WZH A;  2HH7 A;  4TWD A;  4O4I E;  1IBM T;  2YKS A;  4CQI A;  4K0U A;  3DP7 A;  2Q9Q B;  3OYZ A;  1QSD A;  3PDY A;  3ZSS A;  1OED A;  2VQE T;  2HN1 A;  4JLE A;  3MXZ A;  4AQF C;  1XNR T;  5FL1 A;  4ZZB A;  2BVL A;  3ZT5 A;  4B3R T;  2Y6X A;  1U4Q A;  4LF9 T;  5L4H A;  3AA7 B;  1HTJ F;  3ZST A;  2PBI A;  2KXP B;  1ZV4 X;  2X67 A;  2ZLY A;  4CI2 B;  2E2A A;  1IZN B;  4HFC A;  4H9Q C;  1N34 T;  3OPC A;  3K3O A;  5E0O A;  5LOV E;  3C64 A;  2J4G A;  3FZM B;  4ADZ A;  4DUZ T;  1N36 T;  4MAL A;  4ZS2 A;  3AVS A;  3UFG A;  3FBZ A;  5FKY A;  3AEF A;  5HEH A;  4X65 T;  3LFM A;  3F57 A;  4LFC T;  3CIR A;  2LRL A;  2IML A;  2RPA A;  2K3W A;  3AAI A;  5ABF A;  4BA9 A;  4QWN B;  3OBV E;  2X9Y A;  1W09 A;  3ZMZ B;  3RYC E;  5L3D B;  2CXF A;  2G0U A;  2KZ7 B;  4PW8 A;  3NKZ A;  5CGM A;  4P1N A;  4H63 H;  3M65 A;  1CHU A;  1SE7 A;  2LHR A;  2CWO A;  4DR4 T;  2J47 A;  1ZOY A;  5AQT B;  1IBK T;  5JR9 C;  2ODV A;  3UU5 A;  4WZX A;  4AI6 A;  3C50 A;  3RQW A;  4ZI7 E;  3PUV F;  4UF0 A;  2VL8 A;  1OED B;  2LEH A;  3GA8 A;  4O2A E;  1UX4 A;  2CRB A;  3ZJ2 A;  3CQG B;  3RHW A;  2F4V T;  2WWV A;  3FZF B;  3C98 B;  5L3E B;  4LMJ A;  5HXC A;  1FEW A;  4JUY A;  1FIO A;  1MNE A;  4P0B A;  3CQX C;  2WAU A;  4B3M T;  3PU8 A;  4TNW A;  2D5U A;  4ZEY A;  3I9Y A;  4IDP A;  2WY2 A;  2ZM6 T;  2E5L T;  3IA3 A;  1KNZ A;  2DNX A;  3RH3 A;  2XSA A;  3DTO A;  2W67 A;  2VL0 A;  4AIU A;  4K0K T;  2Q9Q D;  4HKA A;  5AQN B;  3ZC1 A;  5JTG A;  2MOZ A;  3VRB A;  1SUM B;  3NRY A;  3FXE B;  5KX5 E;  2K24 A;  4MBQ A;  3B13 A;  4MFR A;  4HFV A;  3UUM A;  4QKN A;  1KFY A;  4DID B;  2YU1 A;  5HAX A;  3TLV A;  1US7 B;  3NVO A;  2NW8 A;  5HXS A;  2V26 A;  2YDS A;  4HWD A;  3AED A;  4LF6 T;  1I6Z A;  2BG9 E;  3ZCI A;  5HXE A;  1XMQ T;  4GKK T;  3ZKR A;  2WCA A;  3V5U A;  2LM2 A;  4EXT A;  5KXJ A;  4IL9 A;  3GWH A;  4XAX B;  2LSY A;  5JQG E;  5BR8 T;  5AQG B;  2CE7 A;  4X1I E;  4H63 V;  3UT5 E;  4YHJ A;  4E7S A;  4KUM B;  3P4R A;  3AEE A;  4YY3 T;  3K8P C;  3KDS E;  4KP3 C;  3HKE E;  3FBL A;  1MMN A;  2JMH A;  4HE8 A;  5FVL A;  1WCR A;  3RI5 A;  4U72 A;  4NXN T;  2JQQ A;  4YFS A;  3UQ7 A;  3LSV A;  5L2L A;  2KMF A;  2LKG A;  3AEC A;  2NTX A;  3S4U A;  3PUX F;  3ZYM A;  5JDF A;  2Y8D A;  4PJM A;  5AQV B;  2B76 A;  3VR8 A;  4NPP A;  4EV6 A;  3FZH B;  3AVR A;  4I0U A;  3ONL C;  3AE6 A;  1UK5 A;  3RC8 A;  4X5T A;  3ETV A;  5HEU A;  1HX8 A;  4AQF A;  4QH4 A;  1LRZ A;  1MMA A;  3UQ4 A;  5LJM A;  3W15 B;  4FI5 A;  4U74 A;  4BJM A;  2BVM A;  2BBH A;  2M6I A;  1ZKE A;  2KSR A;  4I43 B;  4JI6 T;  2XAS B;  4ZI2 C;  2WMO A;  3R84 B;  2JIW A;  4H9P C;  1YKE B;  2K9A A;  4X1Y E;  2GK9 A;  4HWI B;  2J62 A;  2E9X C;  5EZY E;  5CA0 E;  2JJ9 A;  2WDQ A;  3N9N A;  1M62 A;  2X9X A;  4IE7 A;  3RIU C;  4YJ3 E;  5JDL A;  4EIW A;  2W62 A;  4ZI3 C;  2M67 A;  2WU2 A;  4AIS A;  4LML A;  4Z91 A;  5J2T E;  4V1A v;  3RIF A;  5HCJ A;  4PK4 A;  5LBM A;  4HEA A;  3OJA A;  3OTO T;  1Z8U A;  5L3F B;  4U3C A;  5JR9 A;  5LG4 A;  3PUY F;  2H89 A;  2DCF A;  3CX8 B;  2W66 A;  4OK0 A;  1HNW T;  5JH7 E;  2XQA A;  4DMW A;  1CUN A;  4U2Z A;  3I0O A;  3WAJ A;  1D1C A;  4XBF B;  1KK7 A;  1BR4 A;  4EYY R;  3AE1 A;  2BG9 C;  4UV9 B;  2QYW A;  4CXW A;  5KMG P;  2JRK A;  4IE0 A;  1IJ5 A;  3P4W A;  3SWH A;  2WDR A;  1HG5 A;  4B3T T;  1YQ3 A;  2BBJ A;  2VWA A;  4AKL A;  2D0T A;  4YTM A;  3AA1 B;  3MKD A;  2FJA A;  3ONX A;  2W0G A;  2IW5 B;  1OXZ A;  2LOS A;  1ZEE A;  4HFD A;  5DQW A;  1SA0 E;  4JI8 T;  3HR0 A;  2OV9 A;  4YTN A;  3MJX A;  3FB2 A;  4IDQ A;  2EHO A;  4U33 A;  4X66 T;  2N2N A;  4DV0 T;  3MAC A;  5ABH A;  5LGN B;  1YKH B;  3AE3 A;  1VRB A;  4Q25 A;  2NOX A;  3H37 A;  1FJG T;  2CEA A;  4B3S T;  2YEV C;  4IL4 A;  5JR9 B;  4X1K E;  4LF7 T;  3ZN0 B;  2VK9 A;  1QUU A;  3VHL A;  4L9I A;  1WR6 A;  3C51 A;  2K5B B;  3AE8 A;  1O3X A;  2RA1 A;  3LJC A;  3LG7 A;  3F2E A;  3E0Z A;  2I59 A;  5IYZ E;  4QX8 B;  3ZJ1 A;  2VAS A;  1D1A A;  4AKG A;  4F8H A;  3JC6 C;  1G73 A;  2ODU A;  2ES0 A;  2WSS V;  3EDU A;  2MPK A;  3P7I A;  4DV3 T;  4ASK A;  3RQU A;  4KHZ F;  2X0H A;  4NIQ A;  2C0S A;  3UU4 A;  4JI5 T;  3N2K E;  5EK3 A;  4CN1 A;  3ZLI A;  5CJ5 A;  3TLU A;  4ZHQ E;  5AFU L;  4KHP T;  5HWX A;  2XQ6 A;  4JI0 T;  3CWZ B;  4HGA A;  5FL0 A;  2CXL A;  2IDO B;  4LF5 T;  5HWY A;  4XZC A;  3PJA J;  2EHO B;  5KDM C;  1YQ4 A;  5F5W A;  2YK0 A;  2CLY B;  3N9L A;  4I50 E;  3L3P A;  4ILC A;  4AQY T;  1MIW A;  4JEU B;  4KBM B;  3RPU A;  5H6R B;  1Y01 A;  5F3J A;  2QVA A;  3ZYL A;  5JDM A;  4FJO A;  5LJN A; 
#chains in the Genus database with same CATH homology
 5LMU T;  4DR4 T;  4DR5 T;  1J5E T;  1IBM T;  1IBK T;  4DV7 T;  2UUB T;  4LF8 T;  4NXM T;  1XMQ T;  2HHH T;  4DV5 T;  4GKK T;  4OX9 T;  4DV1 T;  2VQE T;  1HR0 T;  5LMN T;  5BR8 T;  4DV2 T;  2VQF T;  4DV3 T;  4JI6 T;  1XNR T;  2F4V T;  4B3T T;  4YY3 T;  4LFA T;  4B3R T;  4LF9 T;  4JI7 T;  4LFB T;  4JI5 T;  4X62 T;  1IBL T;  4B3M T;  4NXN T;  4KHP T;  2UXB T;  4JV5 T;  4DR6 T;  4YHH T;  2ZM6 T;  1N34 T;  4JI3 T;  2E5L T;  4JI8 T;  4JI0 T;  3T1H T;  2UU9 T;  1I94 T;  4LF5 T;  4DUZ T;  1N36 T;  2UXC T;  1N32 T;  4DV4 T;  4K0K T;  4X66 T;  4DV0 T;  4X65 T;  4X64 T;  4JI4 T;  1HNZ T;  1XNQ T;  2UUC T;  4DR1 T;  5IWA T;  2UUA T;  4LFC T;  4JI1 T;  1FJG T;  2UXD T;  4JYA T;  3OTO T;  1N33 T;  4B3S T;  4DV6 T;  4AQY T;  4DR2 T;  1HNX T;  4LF7 T;  4DUY T;  4GKJ T;  1XMO T;  4DR7 T;  3T1Y T;  1HNW T;  4JI2 T;  4DR3 T;  4LF6 T;  4LF4 T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...