4DUZT

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, u13c, bound with streptomycin
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 36
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 4duzT00
1IBMT 4JI1T 1IBKT 4DUZT 4DR1T 4LF4T 4LF6T 4LF7T 4X62T 4KHPT 4X64T 1IBLT 4LFBT 1XMOT 3T1HT 1XNRT 5IWAT 4LFAT 2HHHT 4NXNT 5LMUT 4JV5T 3OTOT 5BR8T 4X65T 4DV5T 4DV7T 4DR3T 2UXCT 1HNWT 4DR2T 2UUAT 2ZM6T 4GKJT 4YY3T 4DV2T 1N32T 4LFCT 4DV1T 4JI6T 2UXBT 4YHHT 1N36T 4LF5T 4DR4T 1J5ET 4JI3T 2VQET 1XNQT 4JI4T 4JYAT 4X66T 4DUYT 4K0KT 1N33T 4JI5T 4DR5T 4B3MT 2UUCT 2E5LT 2F4VT 4LF8T 2UXDT 4NXMT 1XMQT 2VQFT 1N34T 4OX9T 4DR7T 4AQYT 4DV6T 3T1YT 4JI8T 1HNXT 5LMNT 4B3RT 1I94T 4JI0T 4GKKT 4DV4T 1HNZT 4B3ST 2UUBT 4JI7T 2UU9T 1HR0T 1FJGT 4DR6T 4DV0T 4B3TT 4JI2T 4DV3T 4LF9T
chains in the Genus database with same CATH superfamily
1IBMT 3DTOA 3EAMA 4X1YE 3N2OA 4IL4A 1W0AA 2LOSA 3ONLC 2A72A 3ONJA 3PUVF 3RQUA 2VVNA 1D1CA 3EHZA 4OHFA 3ZN1B 2FJBA 5LGUB 2WWUA 3CK6A 5IYZE 3ZMUB 1IBLT 2D2SA 1D1BA 3NRYA 4ILBA 3UUBA 1G8XA 5HEHA 3RYIE 3P4SA 3PJAJ 4LFBT 2W61A 5JDFA 4PJJA 2IC9A 2J62A 2E5VA 3HI2A 3RC3A 4IDZA 4P09A 4TWDA 3ZEFB 1CHUA 3T1HT 4AKHA 4EAHA 2CEAA 5C3JA 1SUMB 2VVSA 5JRCA 2WAUA 4UR9A 4PFOA 2JIWA 3C4ZA 4MLKA 2JPFA 3ETUA 3AEFA 4H9SE 5GONE 3KBTA 5FVKA 1UCUA 4LMJA 5AQGB 4CZZB 5KX5E 4Q25A 2V8SV 5AQPB 1BR1A 4OK0A 2A2FX 5LBMA 2UXNB 2V26A 3C51A 4EEBA 3OTOT 3N5LA 4I55E 2BS2A 3K3NA 2BBJA 5HXRA 2OV9A 1KNRA 3OYXA 4EB6E 5HXEA 1U5PA 3RF1A 5EK2A 5JDQA 4ZXLA 5KXJA 3BQKA 1OEDC 1HNWT 4AKGA 2VKJA 1HFAA 4ZEYA 1W0BA 2W00A 5CA0E 4UF0A 3N9QA 1KNPA 5LCYA 3UFGA 3ZYMA 3ZT6A 2LHRA 4QH5A 1G73A 1MNEA 2VKHA 3Q9DA 2C0SA 1NENA 4IDNA 4ILUA 3SRZA 3M65A 3ZMVB 5LOVE 3E22E 2V7MA 3UT5E 3E0ZA 4IREA 1VOMA 5AQSB 3JADA 4H9NC 4EGWA 3ZC0A 4DV1T 2QGSA 2BKNA 3MACA 4H9OC 4U7YA 4JI6T 4IE5A 5HXHA 3CKDA 2CWYA 2DLRA 4HFVA 1KK7A 3RIUA 2WP9A 4UVBB 1OWAA 3L8RA 2UXXB 3LFMA 5FXZA 3GN5A 5L3EB 1WR0A 4LF5T 2VWAA 1DU2A 4DR4T 3P4WA 3ANWA 3CX6B 4LMLA 3U78A 3AE3A 3AE6A 3M3ZB 5AQQB 3ZCIA 3K3QC 4I50E 1ZEEA 2NW7A 2W63A 3PUZF 2CXLA 2A9UA 2CE7A 1WCRA 3O1IA 2LSGA 4FJOA 4UELA 3VRBA 4EV6A 2Y8DA 2WB5A 3LBXB 3LSVA 4QWNB 4YSXA 3A7MA 4MHCA 4ERRA 4JI4T 4GKJT 3AE9A 3BK9A 4ZZCA 5LHIB 1YQ3A 2XQ4A 2XUEA 4ISTA 4DUYT 1V9DA 2KWIB 2XAJB 3I0OA 5AQNB 3O9XA 5ABFB 1SE7A 3K1SA 2WDQA 2YEVC 4NPPA 4IDPA 3ZMTB 4AKRB 2F4VT 3TLVA 1YKHB 2IHR1 3A5XA 3SOLA 2CHOA 2HPJA 2MOZA 2YK0A 4N78D 4QH4A 3FZFB 3FB2A 4QXHB 3QC9A 4UIGA 4H63V 3ETVA 4U33A 4EIWA 3SFDA 4DV6T 2UXDT 1XZYA 5EK3A 4KUMB 1MMNA 2JQQA 4ILAA 1KF6A 4ISSA 4PK4A 4L9IA 4E7SA 4ZI7E 1LKXA 4CXYA 2WZIA 4NUUA 4A5XA 2H89A 4BAYB 2M6BA 3EUHA 4JI8T 4QX8B 3AEDA 2RPAA 1U4QA 3F2EA 4NUVA 5JQGE 2HN2A 3ZT7A 4YJ2E 2XQYA 4ZI2D 2FUPA 5L47A 4HWFA 2NR4A 4HFIA 5JR9B 4JI0T 3FXDB 2J47A 2YN6A 3AB3B 3FXEB 5HEUA 4ZHQE 4GKKT 3RH3A 2IMLA 3WI3A 5L3DB 2XQ3A 3AE7A 2ODVA 2VKOA 4UVCB 3FBLA 2WDRA 4CN6A 2UU9T 4WBNE 3RHWA 2V5DA 2W2UA 2IUBA 3CQXC 3LK42 3AVRA 1W09A 1LVFA 3H3MA 5JDNA 1FMWA 5JREA 5IHYA 4TWHA 3TLWA 4CQIA 4BJMA 3EDUA 2KT9A 4OYKA 4U3CA 4JUYA 5CJ5A 4TWFA 3E08A 5LB7B 2E9XB 2LRKA 3KFWX 4MBQA 1IBKT 2BS3A 3BQIA 2XSBA 3FZLB 4JI1T 1HTJF 3C64A 2CRBA 3HA4A 5ABHA 3N9PA 2EHOD 5HWYA 3UU6A 4F6RC 2ACZA 3CMLA 5AQMB 4CXWA 4X64T 2XQAA 2LT3A 4IE7A 4CXXA 2JQ9A 3RC8A 3G06A 2BBHA 5AQLB 4AQFA 2XHEB 2CHNA 2Y48B 3UUNA 1HS7A 1XMOT 2LKGA 2H7VC 1WLXA 2ZM2A 3AE2A 3HKCE 2IDOB 4WBOA 2QRXA 5J2UE 3RRCA 4AKLA 5AQIB 5C2TA 1WRDA 3JC6D 3KINB 3TLSA 5IWAT 2PBIA 3H37A 3ZMZB 2HHHT 2VL8A 2LEHA 1BR4A 2E2AA 1S35A 2ZMAA 4I4TE 3VU7H 4DBQA 2D0TA 3FZHB 2J4GA 2YKSA 2WMOA 3Q5DA 1AJ3A 5J0ZA 2XAFB 4MFRA 4TZ4C 2XQ5A 3AECA 4A56A 2X0LB 3NBXX 1MMGA 3C50A 3EI0A 3L09A 4HTEA 3AA7B 4V1Av 1E1HB 2LHNA 5JR9A 3AEGA 3GN5B 2G0UA 1WYCA 5FL0A 2XQ9A 3J9X1 2VL0A 4PAGA 4DR2T 3RKOA 2ZLYA 4XBFB 3GWHA 2UUAT 4UVAB 5CB4E 4YTPA 3RIUC 5C8YE 4YY3T 4X1KE 1HX8A 4IDQA 4ZS3A 3X1DA 3Q5XA 4DV2T 4AI6A 3CPZA 3QOFA 2UXBT 2LSYA 3LK3B 4E7ZA 2NTYA 4OFZA 4UF0B 1FIOA 4HEAA 2FJEA 3AEAA 4HKAA 4F8HA 5JH7E 1WFDA 1X79A 1VCSA 4O4JE 1J5ET 3HKBE 4PK5A 4CN4A 5JDMA 2JQHA 4YT0A 2CLYB 4O4LE 1XNQT 2WU5A 3R84B 2L3LA 4H9RC 4Z8XA 5LBQB 2MBGA 1J1JA 1ZOYA 4JYAT 2H7OA 4O2AE 4P1NA 3S4UA 3N2KE 4K0KT 5LNKA 2Y6XA 2WWVA 3ZSSA 1FEWA 2JMHA 2WMNA 3FBZA 3MKDA 2DWGA 4IHJE 5M4YA 3AAAB 4DR5T 3DJBA 3ZSTA 4B3MT 3DP7A 4HWHA 4HFBA 4IIJE 2MYSA 4QHOA 5LXTE 3GMIA 3CQGB 3VRAA 5ABEA 3N2GE 2WDVA 1ZHCA 1MNDA 4WW0A 5JVDE 3RGLA 3TLTA 4KHZF 1IAPA 2BZBA 2X9YA 3I0QA 3KV4A 2YDSA 3QK6A 4HFEA 5AQTB 3SWHA 2YU2A 5BMVE 2NWBA 2CPTA 2WU2A 2XZEA 5AQJB 1ZV4X 2BKOA 4EXTA 4TN7B 1N34T 5AQHB 4OX9T 2D9DA 2N2NA 3AXJB 3NZPA 4TUYE 5H6QB 5HEGA 3UFEA 2ODUA 4HFCA 5AFUL 4Z90A 4Z91A 5LYJE 2EHOB 2WY2A 4ILCA 5FXWA 1HNXT 2D5UA 4GYSA 3UULA 4JLEA 1LVKA 4G63A 4PJLA 5LMNT 3MJXA 5LHGB 2RA1A 5AQUB 4DV4T 2LE8A 2VASA 4UEMA 1QLBA 4UXNB 2IIUA 3A8YC 3OJAA 5LA6E 4YTNA 2XQ8A 4U2ZA 4DIDB 3PU8A 2LRLA 4K0UA 2C5JA 1JNRA 2VKDA 5CGMA 4DR6T 2W4XA 3I9YA 1GQEA 2K9AA 4EZHA 2BG9B 3ONXA 2R6GF 3AE5A 5FL1A 4G2AA 4DV0T 2NTXA 1QSDA 1XWMA 1QUUA 1YXRA 5AQVB 4IDOA 3CX7B 5L4HA 3L3PA 4CI1B 3PV0F 4JI2T 1T8BA 1WR6A 2KLQA 1T72A 4U72A 3UU4A 4I43B 4ANJA 1YD8G 3AA0B 3OVUA 2ZM8A 2K48A 3I9WA 4A98A 3U3IA 1Z0PA 1MIYA 2FBWA 4DR1T 2BG9A 2CLYC 2YDRA 4XAXB 4X62T 4LF7T 3P4QA 5DABA 4C91A 1YKEB 3N9NA 2OLTA 2XSAA 3NWIA 3UU8A 3N9OA 3IBPA 5DJQC 3CVRA 2Q9QD 3MA9A 5J1GA 3SS1A 4DO0A 1R8IA 4JEHB 3TKLB 3ZPOA 2DWKA 1L0VA 5J2TE 3AA6B 1Z8UA 4PJMA 2NP9A 2YDQA 3HR0A 2WQYA 4H9QC 5JR9C 1H7CA 3UU5A 3CWZB 4WYVA 4O2BE 3KDSE 1S94A 4YFSA 1Y64B 3KV6A 3QUJA 4NXNT 2PFVA 1VRBA 2KZ7B 3MZKB 4X1IE 2XM2A 5LGTB 2H3RA 3FZKB 3MK7C 3RYCE 4JV5T 4PFPA 2WBLA 3Q5WA 5BR8T 3C4WA 2KWHA 4HGAA 4HWIB 3VHLA 2NW9A 3PUSA 1T98A 4TX5A 2E9XC 5F8PA 2W62A 2M6IA 4DR3T 3K3OA 3N9MA 3N9LA 2XPKA 2CA5A 3IF8B 2UXCT 4YXDA 5AQFB 5DQWA 2GK9A 3RYHE 1FMVA 3AVSA 2FJDA 3OKQA 2I59A 4DBRA 3HKDE 2W66A 4I0UA 5HAXA 2LKHA 3NKZA 3VR9A 3PTRB 2K5BB 2WM9A 4HN9A 5AQKB 2KNDA 5HEOA 5HXCA 2QA7A 3P50A 5DQVA 2DCFA 3AXJA 4GIWA 4ADZA 4B6XA 4HFHA 1MMDA 4UV9B 1UX5A 4KX6A 2XQ7A 4U31A 1KFYA 1W9RA 1D0ZA 3ZYLA 2IW5B 2QYWA 1M7KA 5IUXA 5FXVA 4U2YA 3OPCA 3ZC1A 5FYMA 3ZCJA 3F31A 4TNWA 5HWXA 2CXDA 1E2AA 4JI3T 1BR0A 1UX4A 1E7PA 1XDOA 2Q9QC 2V6YA 3LG7A 2VQET 2V7LA 2LSJA 3P7IA 3QB5K 3TLUA 3AE4A 5FKYA 3KV9A 3PJAA 5HCJA 4DVDA 5AQOB 2AXDS 2PG8A 2KINB 1OXZA 5F5WA 4EOZB 5L3BB 5KDMC 1D1AA 2LLYA 2XTLA 3T8OA 2N9DA 1BR2A 3Q2MA 2DNXA 2XQ6A 2KMFA 3B57A 2E9XD 3PU3A 3ZJ2A 1ZKEA 5F3JA 2X51A 5EK4A 3B13A 1HCIA 5L2LA 3BQLA 2E5LT 3NRXA 2I6HA 4IE0A 3GA8A 2XASB 1UUSA 4IL9A 4L5GA 4AKIA 3O1JA 2EHOC 3SFEA 3KVAA 3OYZA 5A1LA 2DHRA 4PK6A 1X9BA 2BKPA 4AXPA 2LM2A 3WAJA 4KBMB 5JDLA 2ACXA 2D0UA 3Q5EA 4QX7B 3ABVA 4ZS2A 2W67A 4O4IE 3CQCB 4WNKA 4U7IA 2BDEA 2K24A 2XAHB 2X9WA 3OBVE 4AQFC 5JDGA 2XAQB 4AQYT 4ZOLE 5L3CB 3ZYKA 1NAFA 3B5MA 4IGUA 5HEJA 3UTKA 3O4XE 3NZQA 3JC6C 2C5IT 2B76A 2BG9E 5E0OA 3RYFE 4BA9A 1HNZT 3C4XA 4CN1A 2HN1A 4AQGA 4QXCB 5L4EA 2V7KA 2UUBT 4B3ST 4JI7T 2IC6A 5HCMA 5FY7A 3AEEA 3V5SA 2A3DA 4COFA 4AISA 5ABFA 5L3FB 2OA5A 1O3XA 3JAEA 3AE8A 2FJAA 4FI5A 4KMCA 3RQWA 2V7JA 3WAKA 2H88A 2MAWA 3RKGA 4AIUA 2C5KT 2V7IA 4IE6A 4QXBB 5ABGA 3I1AA 4EZ4A 4EYYR 3AAEB 3UUXB 4EYUA 3H3AA 1HG2A 2Q9QA 3P4PA 4LF9T 1EZ3A 1HX1B 3MXZA 1HG5A 4EEDA 4ZI3D 2W0GA 3V5UA 4DUZT 1CUNA 1B7TA 5JRCB 3EVYA 4ZZBA 3ZN0B 3RLFF 4LF6T 2IAKA 5FVLA 1XDPA 2KXPB 2PJQA 3CX8B 4KHPT 1UK5A 4HE8A 5LMUT 1YQ4A 4LMKA 4TV8E 3RPUA 4GK5E 4X5TA 3ZKRA 3ZJ1A 3VKGA 1J5WA 2CBJA 1KEYA 2J1DG 4KI0F 4ZI2C 5JDHA 1XNRT 1OEDA 2JJ9A 4YJ3E 2EHOA 3ZLIA 2HPLA 3FHNA 3PUGA 2VURA 4QKNA 4LFAT 2MPKA 4YLHA 5LG4A 1N32T 2AE9A 2E9XA 3AA1B 3JAFA 3PURA 2BS4A 2M67A 3QNUA 5CFBA 1D0YA 1IJ6A 5FXXA 3IA3A 3F57A 3K8PC 3KBUA 3LDQB 1WYBA 2X0HA 4PNIA 3L39A 4KP3C 5LJMA 4XZCA 3O1HA 4CI3B 3QB5A 5HYAA 1OEDB 2CWOA 1NEKA 4GK0E 4X65T 3HKEE 3UQ4A 4DV5T 2DI4A 4DV7T 1SHZC 4O8SA 1MIVA 2NOXA 4O4HE 4J2CA 3ZT5A 2VB6A 3KVBA 3PUAA 4YHJA 4DR7T 2HH7A 3PDYA 2I0MA 4P0BA 2VK9A 1OEDE 4OYJA 5EZYE 1M62A 3AAIA 5TAOA 1IJ5A 4YTMA 2LM9A 3HL6A 2X0YA 3FZMB 5JTGA 2XAGB 5LJNA 5FY1A 3RIAA 2ZM6T 3RX6A 1Y01A 2CXFA 5CA1E 5LHHB 4P0AA 4JBWF 4LFCT 3KV5A 4U74A 3PUXF 2V5CA 2X66A 3ESLA 3P8CD 2P9BA 2CBIA 3D0TA 5ADXL 3RI5A 5L3GB 4YHHT 1N36T 2ES0A 4M1PA 2B1EA 1MIWA 3ANWB 2JQKA 1IZNB 3CIRA 2WSSV 5AQRB 4DMWA 3JCFA 5FMNA 4GYRA 5H6RB 4CI2B 3C98B 4ASKA 3W15B 4YSYA 4LF4T 5ETWA 3AEBA 3UQ7A 1YW0A 4HWDA 2XM1A 3LBXA 4HFDA 1MMAA 3R6NA 5LG3A 3NVOA 1NWMX 4L0RA 4X66T 2RP4A 3ZMSB 3LJCA 2NW8A 2E8IA 2N1GA 4H9PC 4A97A 1N33T 4JI5T 3LK2B 2LSIA 1ZP0A 4H63H 2JMKA 4WZXA 4X20E 2V1DB 3RRWA 4DMVA 2UUCT 1HF8A 2V6XA 2V6YB 3RIFA 1KNZA 2QVAA 2ZM0A 3AE1A 1LRZA 2L8KA 2JRKA 5HXSA 2XY8B 4LF8T 3PUQA 2X9XA 1UURA 2YOEA 1T7SA 2CM0A 3EDVA 4IE4A 4UV8B 4DNDA 2KSRA 4NXMT 2LOPA 2VQFT 3IHRA 4MALA 2SPCA 1XMQT 2Z6EA 3P4RA 2XJ7A 4JEUB 2CMRA 4QH1A 3UU3A 3VR8A 5KMGP 3T1YT 5FNVE 5FP3A 1I6ZA 2K3WA 3PUWF 2BG9C 2DL1A 5LGNB 4B3RT 4PJNA 1I94T 2Q9QB 2CCQA 1D0XA 2WS3A 2MTQA 4YSZA 2X67A 3UUMA 1US7B 2BVMA 3PUYF 1VCTA 5FY0A 4ZI3C 1SA0E 2L9QA 3VKHA 3J7Yq 4NIQA 2WCAA 4PW8A 2WZHA 4C90A 1HR0T 5LP6E 1FJGT 2X9HA 4GOUA 4TV9E 2LSKA 2BVLA 2LJLA 4BJNA 2YU1A 4HWCA 4IT4A 4B3TT 3EABA 2PTFA 2X68A 4TNVA 1UGOA 3PE0A 2YINA 1JNZA 4DV3T 3IEEA
chains in the Genus database with same CATH topology
1IBMT 4JI1T 1IBKT 4DUZT 4DR1T 4LF4T 4LF6T 4LF7T 4X62T 4KHPT 4X64T 1IBLT 4LFBT 1XMOT 3T1HT 1XNRT 5IWAT 4LFAT 2HHHT 4NXNT 5LMUT 4JV5T 3OTOT 5BR8T 4X65T 4DV5T 4DV7T 4DR3T 2UXCT 1HNWT 4DR2T 2UUAT 2ZM6T 4GKJT 4YY3T 4DV2T 1N32T 4LFCT 4DV1T 4JI6T 2UXBT 4YHHT 1N36T 4LF5T 4DR4T 1J5ET 4JI3T 2VQET 1XNQT 4JI4T 4JYAT 4X66T 4DUYT 4K0KT 1N33T 4JI5T 4DR5T 4B3MT 2UUCT 2E5LT 2F4VT 4LF8T 2UXDT 4NXMT 1XMQT 2VQFT 1N34T 4OX9T 4DR7T 4AQYT 4DV6T 3T1YT 4JI8T 1HNXT 5LMNT 4B3RT 1I94T 4JI0T 4GKKT 4DV4T 1HNZT 4B3ST 2UUBT 4JI7T 2UU9T 1HR0T 1FJGT 4DR6T 4DV0T 4B3TT 4JI2T 4DV3T 4LF9T
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IBM T;  4JI1 T;  1IBK T;  4DUZ T;  4DR1 T;  4LF4 T;  4LF6 T;  4LF7 T;  4X62 T;  4KHP T;  4X64 T;  1IBL T;  4LFB T;  1XMO T;  3T1H T;  1XNR T;  5IWA T;  4LFA T;  2HHH T;  4NXN T;  5LMU T;  4JV5 T;  3OTO T;  5BR8 T;  4X65 T;  4DV5 T;  4DV7 T;  4DR3 T;  2UXC T;  1HNW T;  4DR2 T;  2UUA T;  2ZM6 T;  4GKJ T;  4YY3 T;  4DV2 T;  1N32 T;  4LFC T;  4DV1 T;  4JI6 T;  2UXB T;  4YHH T;  1N36 T;  4LF5 T;  4DR4 T;  1J5E T;  4JI3 T;  2VQE T;  1XNQ T;  4JI4 T;  4JYA T;  4X66 T;  4DUY T;  4K0K T;  1N33 T;  4JI5 T;  4DR5 T;  4B3M T;  2UUC T;  2E5L T;  2F4V T;  4LF8 T;  2UXD T;  4NXM T;  1XMQ T;  2VQF T;  1N34 T;  4OX9 T;  4DR7 T;  4AQY T;  4DV6 T;  3T1Y T;  4JI8 T;  1HNX T;  5LMN T;  4B3R T;  1I94 T;  4JI0 T;  4GKK T;  4DV4 T;  1HNZ T;  4B3S T;  2UUB T;  4JI7 T;  2UU9 T;  1HR0 T;  1FJG T;  4DR6 T;  4DV0 T;  4B3T T;  4JI2 T;  4DV3 T;  4LF9 T; 
#chains in the Genus database with same CATH topology
 1IBM T;  3DTO A;  3EAM A;  4X1Y E;  3N2O A;  4IL4 A;  1W0A A;  2LOS A;  3ONL C;  2A72 A;  3ONJ A;  3PUV F;  3RQU A;  2VVN A;  1D1C A;  3EHZ A;  4OHF A;  3ZN1 B;  2FJB A;  5LGU B;  2WWU A;  3CK6 A;  5IYZ E;  3ZMU B;  1IBL T;  2D2S A;  1D1B A;  3NRY A;  4ILB A;  3UUB A;  1G8X A;  5HEH A;  3RYI E;  3P4S A;  3PJA J;  4LFB T;  2W61 A;  5JDF A;  4PJJ A;  2IC9 A;  2J62 A;  2E5V A;  3HI2 A;  3RC3 A;  4IDZ A;  4P09 A;  4TWD A;  3ZEF B;  1CHU A;  3T1H T;  4AKH A;  4EAH A;  2CEA A;  5C3J A;  1SUM B;  2VVS A;  5JRC A;  2WAU A;  4UR9 A;  4PFO A;  2JIW A;  3C4Z A;  4MLK A;  2JPF A;  3ETU A;  3AEF A;  4H9S E;  5GON E;  3KBT A;  5FVK A;  1UCU A;  4LMJ A;  5AQG B;  4CZZ B;  5KX5 E;  4Q25 A;  2V8S V;  5AQP B;  1BR1 A;  4OK0 A;  2A2F X;  5LBM A;  2UXN B;  2V26 A;  3C51 A;  4EEB A;  3OTO T;  3N5L A;  4I55 E;  2BS2 A;  3K3N A;  2BBJ A;  5HXR A;  2OV9 A;  1KNR A;  3OYX A;  4EB6 E;  5HXE A;  1U5P A;  3RF1 A;  5EK2 A;  5JDQ A;  4ZXL A;  5KXJ A;  3BQK A;  1OED C;  1HNW T;  4AKG A;  2VKJ A;  1HFA A;  4ZEY A;  1W0B A;  2W00 A;  5CA0 E;  4UF0 A;  3N9Q A;  1KNP A;  5LCY A;  3UFG A;  3ZYM A;  3ZT6 A;  2LHR A;  4QH5 A;  1G73 A;  1MNE A;  2VKH A;  3Q9D A;  2C0S A;  1NEN A;  4IDN A;  4ILU A;  3SRZ A;  3M65 A;  3ZMV B;  5LOV E;  3E22 E;  2V7M A;  3UT5 E;  3E0Z A;  4IRE A;  1VOM A;  5AQS B;  3JAD A;  4H9N C;  4EGW A;  3ZC0 A;  4DV1 T;  2QGS A;  2BKN A;  3MAC A;  4H9O C;  4U7Y A;  4JI6 T;  4IE5 A;  5HXH A;  3CKD A;  2CWY A;  2DLR A;  4HFV A;  1KK7 A;  3RIU A;  2WP9 A;  4UVB B;  1OWA A;  3L8R A;  2UXX B;  3LFM A;  5FXZ A;  3GN5 A;  5L3E B;  1WR0 A;  4LF5 T;  2VWA A;  1DU2 A;  4DR4 T;  3P4W A;  3ANW A;  3CX6 B;  4LML A;  3U78 A;  3AE3 A;  3AE6 A;  3M3Z B;  5AQQ B;  3ZCI A;  3K3Q C;  4I50 E;  1ZEE A;  2NW7 A;  2W63 A;  3PUZ F;  2CXL A;  2A9U A;  2CE7 A;  1WCR A;  3O1I A;  2LSG A;  4FJO A;  4UEL A;  3VRB A;  4EV6 A;  2Y8D A;  2WB5 A;  3LBX B;  3LSV A;  4QWN B;  4YSX A;  3A7M A;  4MHC A;  4ERR A;  4JI4 T;  4GKJ T;  3AE9 A;  3BK9 A;  4ZZC A;  5LHI B;  1YQ3 A;  2XQ4 A;  2XUE A;  4IST A;  4DUY T;  1V9D A;  2KWI B;  2XAJ B;  3I0O A;  5AQN B;  3O9X A;  5ABF B;  1SE7 A;  3K1S A;  2WDQ A;  2YEV C;  4NPP A;  4IDP A;  3ZMT B;  4AKR B;  2F4V T;  3TLV A;  1YKH B;  2IHR 1;  3A5X A;  3SOL A;  2CHO A;  2HPJ A;  2MOZ A;  2YK0 A;  4N78 D;  4QH4 A;  3FZF B;  3FB2 A;  4QXH B;  3QC9 A;  4UIG A;  4H63 V;  3ETV A;  4U33 A;  4EIW A;  3SFD A;  4DV6 T;  2UXD T;  1XZY A;  5EK3 A;  4KUM B;  1MMN A;  2JQQ A;  4ILA A;  1KF6 A;  4ISS A;  4PK4 A;  4L9I A;  4E7S A;  4ZI7 E;  1LKX A;  4CXY A;  2WZI A;  4NUU A;  4A5X A;  2H89 A;  4BAY B;  2M6B A;  3EUH A;  4JI8 T;  4QX8 B;  3AED A;  2RPA A;  1U4Q A;  3F2E A;  4NUV A;  5JQG E;  2HN2 A;  3ZT7 A;  4YJ2 E;  2XQY A;  4ZI2 D;  2FUP A;  5L47 A;  4HWF A;  2NR4 A;  4HFI A;  5JR9 B;  4JI0 T;  3FXD B;  2J47 A;  2YN6 A;  3AB3 B;  3FXE B;  5HEU A;  4ZHQ E;  4GKK T;  3RH3 A;  2IML A;  3WI3 A;  5L3D B;  2XQ3 A;  3AE7 A;  2ODV A;  2VKO A;  4UVC B;  3FBL A;  2WDR A;  4CN6 A;  2UU9 T;  4WBN E;  3RHW A;  2V5D A;  2W2U A;  2IUB A;  3CQX C;  3LK4 2;  3AVR A;  1W09 A;  1LVF A;  3H3M A;  5JDN A;  1FMW A;  5JRE A;  5IHY A;  4TWH A;  3TLW A;  4CQI A;  4BJM A;  3EDU A;  2KT9 A;  4OYK A;  4U3C A;  4JUY A;  5CJ5 A;  4TWF A;  3E08 A;  5LB7 B;  2E9X B;  2LRK A;  3KFW X;  4MBQ A;  1IBK T;  2BS3 A;  3BQI A;  2XSB A;  3FZL B;  4JI1 T;  1HTJ F;  3C64 A;  2CRB A;  3HA4 A;  5ABH A;  3N9P A;  2EHO D;  5HWY A;  3UU6 A;  4F6R C;  2ACZ A;  3CML A;  5AQM B;  4CXW A;  4X64 T;  2XQA A;  2LT3 A;  4IE7 A;  4CXX A;  2JQ9 A;  3RC8 A;  3G06 A;  2BBH A;  5AQL B;  4AQF A;  2XHE B;  2CHN A;  2Y48 B;  3UUN A;  1HS7 A;  1XMO T;  2LKG A;  2H7V C;  1WLX A;  2ZM2 A;  3AE2 A;  3HKC E;  2IDO B;  4WBO A;  2QRX A;  5J2U E;  3RRC A;  4AKL A;  5AQI B;  5C2T A;  1WRD A;  3JC6 D;  3KIN B;  3TLS A;  5IWA T;  2PBI A;  3H37 A;  3ZMZ B;  2HHH T;  2VL8 A;  2LEH A;  1BR4 A;  2E2A A;  1S35 A;  2ZMA A;  4I4T E;  3VU7 H;  4DBQ A;  2D0T A;  3FZH B;  2J4G A;  2YKS A;  2WMO A;  3Q5D A;  1AJ3 A;  5J0Z A;  2XAF B;  4MFR A;  4TZ4 C;  2XQ5 A;  3AEC A;  4A56 A;  2X0L B;  3NBX X;  1MMG A;  3C50 A;  3EI0 A;  3L09 A;  4HTE A;  3AA7 B;  4V1A v;  1E1H B;  2LHN A;  5JR9 A;  3AEG A;  3GN5 B;  2G0U A;  1WYC A;  5FL0 A;  2XQ9 A;  3J9X 1;  2VL0 A;  4PAG A;  4DR2 T;  3RKO A;  2ZLY A;  4XBF B;  3GWH A;  2UUA T;  4UVA B;  5CB4 E;  4YTP A;  3RIU C;  5C8Y E;  4YY3 T;  4X1K E;  1HX8 A;  4IDQ A;  4ZS3 A;  3X1D A;  3Q5X A;  4DV2 T;  4AI6 A;  3CPZ A;  3QOF A;  2UXB T;  2LSY A;  3LK3 B;  4E7Z A;  2NTY A;  4OFZ A;  4UF0 B;  1FIO A;  4HEA A;  2FJE A;  3AEA A;  4HKA A;  4F8H A;  5JH7 E;  1WFD A;  1X79 A;  1VCS A;  4O4J E;  1J5E T;  3HKB E;  4PK5 A;  4CN4 A;  5JDM A;  2JQH A;  4YT0 A;  2CLY B;  4O4L E;  1XNQ T;  2WU5 A;  3R84 B;  2L3L A;  4H9R C;  4Z8X A;  5LBQ B;  2MBG A;  1J1J A;  1ZOY A;  4JYA T;  2H7O A;  4O2A E;  4P1N A;  3S4U A;  3N2K E;  4K0K T;  5LNK A;  2Y6X A;  2WWV A;  3ZSS A;  1FEW A;  2JMH A;  2WMN A;  3FBZ A;  3MKD A;  2DWG A;  4IHJ E;  5M4Y A;  3AAA B;  4DR5 T;  3DJB A;  3ZST A;  4B3M T;  3DP7 A;  4HWH A;  4HFB A;  4IIJ E;  2MYS A;  4QHO A;  5LXT E;  3GMI A;  3CQG B;  3VRA A;  5ABE A;  3N2G E;  2WDV A;  1ZHC A;  1MND A;  4WW0 A;  5JVD E;  3RGL A;  3TLT A;  4KHZ F;  1IAP A;  2BZB A;  2X9Y A;  3I0Q A;  3KV4 A;  2YDS A;  3QK6 A;  4HFE A;  5AQT B;  3SWH A;  2YU2 A;  5BMV E;  2NWB A;  2CPT A;  2WU2 A;  2XZE A;  5AQJ B;  1ZV4 X;  2BKO A;  4EXT A;  4TN7 B;  1N34 T;  5AQH B;  4OX9 T;  2D9D A;  2N2N A;  3AXJ B;  3NZP A;  4TUY E;  5H6Q B;  5HEG A;  3UFE A;  2ODU A;  4HFC A;  5AFU L;  4Z90 A;  4Z91 A;  5LYJ E;  2EHO B;  2WY2 A;  4ILC A;  5FXW A;  1HNX T;  2D5U A;  4GYS A;  3UUL A;  4JLE A;  1LVK A;  4G63 A;  4PJL A;  5LMN T;  3MJX A;  5LHG B;  2RA1 A;  5AQU B;  4DV4 T;  2LE8 A;  2VAS A;  4UEM A;  1QLB A;  4UXN B;  2IIU A;  3A8Y C;  3OJA A;  5LA6 E;  4YTN A;  2XQ8 A;  4U2Z A;  4DID B;  3PU8 A;  2LRL A;  4K0U A;  2C5J A;  1JNR A;  2VKD A;  5CGM A;  4DR6 T;  2W4X A;  3I9Y A;  1GQE A;  2K9A A;  4EZH A;  2BG9 B;  3ONX A;  2R6G F;  3AE5 A;  5FL1 A;  4G2A A;  4DV0 T;  2NTX A;  1QSD A;  1XWM A;  1QUU A;  1YXR A;  5AQV B;  4IDO A;  3CX7 B;  5L4H A;  3L3P A;  4CI1 B;  3PV0 F;  4JI2 T;  1T8B A;  1WR6 A;  2KLQ A;  1T72 A;  4U72 A;  3UU4 A;  4I43 B;  4ANJ A;  1YD8 G;  3AA0 B;  3OVU A;  2ZM8 A;  2K48 A;  3I9W A;  4A98 A;  3U3I A;  1Z0P A;  1MIY A;  2FBW A;  4DR1 T;  2BG9 A;  2CLY C;  2YDR A;  4XAX B;  4X62 T;  4LF7 T;  3P4Q A;  5DAB A;  4C91 A;  1YKE B;  3N9N A;  2OLT A;  2XSA A;  3NWI A;  3UU8 A;  3N9O A;  3IBP A;  5DJQ C;  3CVR A;  2Q9Q D;  3MA9 A;  5J1G A;  3SS1 A;  4DO0 A;  1R8I A;  4JEH B;  3TKL B;  3ZPO A;  2DWK A;  1L0V A;  5J2T E;  3AA6 B;  1Z8U A;  4PJM A;  2NP9 A;  2YDQ A;  3HR0 A;  2WQY A;  4H9Q C;  5JR9 C;  1H7C A;  3UU5 A;  3CWZ B;  4WYV A;  4O2B E;  3KDS E;  1S94 A;  4YFS A;  1Y64 B;  3KV6 A;  3QUJ A;  4NXN T;  2PFV A;  1VRB A;  2KZ7 B;  3MZK B;  4X1I E;  2XM2 A;  5LGT B;  2H3R A;  3FZK B;  3MK7 C;  3RYC E;  4JV5 T;  4PFP A;  2WBL A;  3Q5W A;  5BR8 T;  3C4W A;  2KWH A;  4HGA A;  4HWI B;  3VHL A;  2NW9 A;  3PUS A;  1T98 A;  4TX5 A;  2E9X C;  5F8P A;  2W62 A;  2M6I A;  4DR3 T;  3K3O A;  3N9M A;  3N9L A;  2XPK A;  2CA5 A;  3IF8 B;  2UXC T;  4YXD A;  5AQF B;  5DQW A;  2GK9 A;  3RYH E;  1FMV A;  3AVS A;  2FJD A;  3OKQ A;  2I59 A;  4DBR A;  3HKD E;  2W66 A;  4I0U A;  5HAX A;  2LKH A;  3NKZ A;  3VR9 A;  3PTR B;  2K5B B;  2WM9 A;  4HN9 A;  5AQK B;  2KND A;  5HEO A;  5HXC A;  2QA7 A;  3P50 A;  5DQV A;  2DCF A;  3AXJ A;  4GIW A;  4ADZ A;  4B6X A;  4HFH A;  1MMD A;  4UV9 B;  1UX5 A;  4KX6 A;  2XQ7 A;  4U31 A;  1KFY A;  1W9R A;  1D0Z A;  3ZYL A;  2IW5 B;  2QYW A;  1M7K A;  5IUX A;  5FXV A;  4U2Y A;  3OPC A;  3ZC1 A;  5FYM A;  3ZCJ A;  3F31 A;  4TNW A;  5HWX A;  2CXD A;  1E2A A;  4JI3 T;  1BR0 A;  1UX4 A;  1E7P A;  1XDO A;  2Q9Q C;  2V6Y A;  3LG7 A;  2VQE T;  2V7L A;  2LSJ A;  3P7I A;  3QB5 K;  3TLU A;  3AE4 A;  5FKY A;  3KV9 A;  3PJA A;  5HCJ A;  4DVD A;  5AQO B;  2AXD S;  2PG8 A;  2KIN B;  1OXZ A;  5F5W A;  4EOZ B;  5L3B B;  5KDM C;  1D1A A;  2LLY A;  2XTL A;  3T8O A;  2N9D A;  1BR2 A;  3Q2M A;  2DNX A;  2XQ6 A;  2KMF A;  3B57 A;  2E9X D;  3PU3 A;  3ZJ2 A;  1ZKE A;  5F3J A;  2X51 A;  5EK4 A;  3B13 A;  1HCI A;  5L2L A;  3BQL A;  2E5L T;  3NRX A;  2I6H A;  4IE0 A;  3GA8 A;  2XAS B;  1UUS A;  4IL9 A;  4L5G A;  4AKI A;  3O1J A;  2EHO C;  3SFE A;  3KVA A;  3OYZ A;  5A1L A;  2DHR A;  4PK6 A;  1X9B A;  2BKP A;  4AXP A;  2LM2 A;  3WAJ A;  4KBM B;  5JDL A;  2ACX A;  2D0U A;  3Q5E A;  4QX7 B;  3ABV A;  4ZS2 A;  2W67 A;  4O4I E;  3CQC B;  4WNK A;  4U7I A;  2BDE A;  2K24 A;  2XAH B;  2X9W A;  3OBV E;  4AQF C;  5JDG A;  2XAQ B;  4AQY T;  4ZOL E;  5L3C B;  3ZYK A;  1NAF A;  3B5M A;  4IGU A;  5HEJ A;  3UTK A;  3O4X E;  3NZQ A;  3JC6 C;  2C5I T;  2B76 A;  2BG9 E;  5E0O A;  3RYF E;  4BA9 A;  1HNZ T;  3C4X A;  4CN1 A;  2HN1 A;  4AQG A;  4QXC B;  5L4E A;  2V7K A;  2UUB T;  4B3S T;  4JI7 T;  2IC6 A;  5HCM A;  5FY7 A;  3AEE A;  3V5S A;  2A3D A;  4COF A;  4AIS A;  5ABF A;  5L3F B;  2OA5 A;  1O3X A;  3JAE A;  3AE8 A;  2FJA A;  4FI5 A;  4KMC A;  3RQW A;  2V7J A;  3WAK A;  2H88 A;  2MAW A;  3RKG A;  4AIU A;  2C5K T;  2V7I A;  4IE6 A;  4QXB B;  5ABG A;  3I1A A;  4EZ4 A;  4EYY R;  3AAE B;  3UUX B;  4EYU A;  3H3A A;  1HG2 A;  2Q9Q A;  3P4P A;  4LF9 T;  1EZ3 A;  1HX1 B;  3MXZ A;  1HG5 A;  4EED A;  4ZI3 D;  2W0G A;  3V5U A;  4DUZ T;  1CUN A;  1B7T A;  5JRC B;  3EVY A;  4ZZB A;  3ZN0 B;  3RLF F;  4LF6 T;  2IAK A;  5FVL A;  1XDP A;  2KXP B;  2PJQ A;  3CX8 B;  4KHP T;  1UK5 A;  4HE8 A;  5LMU T;  1YQ4 A;  4LMK A;  4TV8 E;  3RPU A;  4GK5 E;  4X5T A;  3ZKR A;  3ZJ1 A;  3VKG A;  1J5W A;  2CBJ A;  1KEY A;  2J1D G;  4KI0 F;  4ZI2 C;  5JDH A;  1XNR T;  1OED A;  2JJ9 A;  4YJ3 E;  2EHO A;  3ZLI A;  2HPL A;  3FHN A;  3PUG A;  2VUR A;  4QKN A;  4LFA T;  2MPK A;  4YLH A;  5LG4 A;  1N32 T;  2AE9 A;  2E9X A;  3AA1 B;  3JAF A;  3PUR A;  2BS4 A;  2M67 A;  3QNU A;  5CFB A;  1D0Y A;  1IJ6 A;  5FXX A;  3IA3 A;  3F57 A;  3K8P C;  3KBU A;  3LDQ B;  1WYB A;  2X0H A;  4PNI A;  3L39 A;  4KP3 C;  5LJM A;  4XZC A;  3O1H A;  4CI3 B;  3QB5 A;  5HYA A;  1OED B;  2CWO A;  1NEK A;  4GK0 E;  4X65 T;  3HKE E;  3UQ4 A;  4DV5 T;  2DI4 A;  4DV7 T;  1SHZ C;  4O8S A;  1MIV A;  2NOX A;  4O4H E;  4J2C A;  3ZT5 A;  2VB6 A;  3KVB A;  3PUA A;  4YHJ A;  4DR7 T;  2HH7 A;  3PDY A;  2I0M A;  4P0B A;  2VK9 A;  1OED E;  4OYJ A;  5EZY E;  1M62 A;  3AAI A;  5TAO A;  1IJ5 A;  4YTM A;  2LM9 A;  3HL6 A;  2X0Y A;  3FZM B;  5JTG A;  2XAG B;  5LJN A;  5FY1 A;  3RIA A;  2ZM6 T;  3RX6 A;  1Y01 A;  2CXF A;  5CA1 E;  5LHH B;  4P0A A;  4JBW F;  4LFC T;  3KV5 A;  4U74 A;  3PUX F;  2V5C A;  2X66 A;  3ESL A;  3P8C D;  2P9B A;  2CBI A;  3D0T A;  5ADX L;  3RI5 A;  5L3G B;  4YHH T;  1N36 T;  2ES0 A;  4M1P A;  2B1E A;  1MIW A;  3ANW B;  2JQK A;  1IZN B;  3CIR A;  2WSS V;  5AQR B;  4DMW A;  3JCF A;  5FMN A;  4GYR A;  5H6R B;  4CI2 B;  3C98 B;  4ASK A;  3W15 B;  4YSY A;  4LF4 T;  5ETW A;  3AEB A;  3UQ7 A;  1YW0 A;  4HWD A;  2XM1 A;  3LBX A;  4HFD A;  1MMA A;  3R6N A;  5LG3 A;  3NVO A;  1NWM X;  4L0R A;  4X66 T;  2RP4 A;  3ZMS B;  3LJC A;  2NW8 A;  2E8I A;  2N1G A;  4H9P C;  4A97 A;  1N33 T;  4JI5 T;  3LK2 B;  2LSI A;  1ZP0 A;  4H63 H;  2JMK A;  4WZX A;  4X20 E;  2V1D B;  3RRW A;  4DMV A;  2UUC T;  1HF8 A;  2V6X A;  2V6Y B;  3RIF A;  1KNZ A;  2QVA A;  2ZM0 A;  3AE1 A;  1LRZ A;  2L8K A;  2JRK A;  5HXS A;  2XY8 B;  4LF8 T;  3PUQ A;  2X9X A;  1UUR A;  2YOE A;  1T7S A;  2CM0 A;  3EDV A;  4IE4 A;  4UV8 B;  4DND A;  2KSR A;  4NXM T;  2LOP A;  2VQF T;  3IHR A;  4MAL A;  2SPC A;  1XMQ T;  2Z6E A;  3P4R A;  2XJ7 A;  4JEU B;  2CMR A;  4QH1 A;  3UU3 A;  3VR8 A;  5KMG P;  3T1Y T;  5FNV E;  5FP3 A;  1I6Z A;  2K3W A;  3PUW F;  2BG9 C;  2DL1 A;  5LGN B;  4B3R T;  4PJN A;  1I94 T;  2Q9Q B;  2CCQ A;  1D0X A;  2WS3 A;  2MTQ A;  4YSZ A;  2X67 A;  3UUM A;  1US7 B;  2BVM A;  3PUY F;  1VCT A;  5FY0 A;  4ZI3 C;  1SA0 E;  2L9Q A;  3VKH A;  3J7Y q;  4NIQ A;  2WCA A;  4PW8 A;  2WZH A;  4C90 A;  1HR0 T;  5LP6 E;  1FJG T;  2X9H A;  4GOU A;  4TV9 E;  2LSK A;  2BVL A;  2LJL A;  4BJN A;  2YU1 A;  4HWC A;  4IT4 A;  4B3T T;  3EAB A;  2PTF A;  2X68 A;  4TNV A;  1UGO A;  3PE0 A;  2YIN A;  1JNZ A;  4DV3 T;  3IEE A; 
#chains in the Genus database with same CATH homology
 1IBM T;  4JI1 T;  1IBK T;  4DUZ T;  4DR1 T;  4LF4 T;  4LF6 T;  4LF7 T;  4X62 T;  4KHP T;  4X64 T;  1IBL T;  4LFB T;  1XMO T;  3T1H T;  1XNR T;  5IWA T;  4LFA T;  2HHH T;  4NXN T;  5LMU T;  4JV5 T;  3OTO T;  5BR8 T;  4X65 T;  4DV5 T;  4DV7 T;  4DR3 T;  2UXC T;  1HNW T;  4DR2 T;  2UUA T;  2ZM6 T;  4GKJ T;  4YY3 T;  4DV2 T;  1N32 T;  4LFC T;  4DV1 T;  4JI6 T;  2UXB T;  4YHH T;  1N36 T;  4LF5 T;  4DR4 T;  1J5E T;  4JI3 T;  2VQE T;  1XNQ T;  4JI4 T;  4JYA T;  4X66 T;  4DUY T;  4K0K T;  1N33 T;  4JI5 T;  4DR5 T;  4B3M T;  2UUC T;  2E5L T;  2F4V T;  4LF8 T;  2UXD T;  4NXM T;  1XMQ T;  2VQF T;  1N34 T;  4OX9 T;  4DR7 T;  4AQY T;  4DV6 T;  3T1Y T;  4JI8 T;  1HNX T;  5LMN T;  4B3R T;  1I94 T;  4JI0 T;  4GKK T;  4DV4 T;  1HNZ T;  4B3S T;  2UUB T;  4JI7 T;  2UU9 T;  1HR0 T;  1FJG T;  4DR6 T;  4DV0 T;  4B3T T;  4JI2 T;  4DV3 T;  4LF9 T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...