2DWGA

Run domain of rap2 interacting protein x, crystallized in p2(1)2(1)2(1) space group
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
165
structure length
158
Chain Sequence
b'MANERMNLMNMAKLSIKGLIESALNLGRTLDSDYAPLQQFFVVMEHCLKHGLKANKSFWGPLELVEKLVPEAAEITASVKDLPGLKTPVGRGRAWLRLALMQKKLSEYMKALINKKELLSEFYEVNALMMEEEGAIIAGLLVGLNVIDANFCMKGEDL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein RUFY3
molecule tags Protein binding
source organism Mus musculus
publication title Crystal Structure of the RUN Domain of the RAP2-interacting Protein x
pubmed doi rcsb
total genus 48
structure length 158
sequence length 165
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02759 RUN RUN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.900 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2dwgA00
3CWZB 2DWKA 2DWGA 2CXFA 4GIWA 2CXLA
chains in the Genus database with same CATH superfamily
2RPAA 1M7KA 2HH7A 2XAHB 3AEBA 3OBVE 5FVKA 1BR1A 4PFOA 5LBQB 2RA1A 4AXPA 4E7SA 4EXTA 4OHFA 2N1GA 4YHJA 2A2FX 2JQKA 3IBPA 2NOXA 3UQ4A 1XMOT 2JQHA 5L3DB 1YKEB 5LGTB 1FEWA 4Z91A 3L8RA 4DUZT 2EHOB 2WS3A 3EHZA 4GK5E 2L9QA 1WFDA 1HF8A 3C50A 3J9X1 2YK0A 1KF6A 2IAKA 2JPFA 1G73A 2VURA 4YTMA 3CQCB 4JI5T 4JI3T 3CX8B 4HGAA 2BKOA 1T8BA 4QXCB 5AFUL 4AKIA 4JEUB 4WYVA 5JDGA 5FY1A 1N33T 1MNEA 2C5IT 4HE8A 5HAXA 5JDHA 5L3EB 1DU2A 2LHNA 3QNUA 3SFEA 3QB5K 3N9OA 2E9XB 4QH1A 1WR6A 4JI8T 1MIYA 4M1PA 5HXSA 1UGOA 2CWYA 2JQ9A 4IGUA 5ABFA 2X66A 5AQHB 3NRXA 3UU4A 4IDQA 4C90A 5LHGB 2NTXA 2XJ7A 3AA7B 1B7TA 2D5UA 5C2TA 5E0OA 3P4QA 2N9DA 3PUZF 4U33A 2BS4A 5IWAT 2X9XA 3EUHA 1T7SA 3OPCA 5BMVE 5F8PA 3B13A 3PUWF 2KSRA 4X1KE 5LOVE 1J5ET 3CPZA 2LEHA 4UEMA 2WWVA 3UUBA 5LGNB 4JI6T 2K48A 3UU8A 3Q2MA 3UU6A 2CCQA 2QGSA 3AEAA 3TLUA 4ADZA 4AKLA 4CN4A 2LM2A 5HEJA 3NKZA 4JEHB 4EZHA 3BK9A 1U4QA 3ETUA 2WMOA 3CQXC 3NZPA 3Q5EA 4XAXB 5JDFA 2WAUA 1IZNB 2PTFA 1N34T 4PK4A 3UU5A 3PUVF 2FUPA 3O1JA 3OJAA 2XAGB 3PUSA 4HWIB 4DO0A 3F2EA 1M62A 4KI0F 3KV4A 2B76A 1E7PA 4LF5T 1FJGT 4JV5T 2ZM2A 3JC6C 1VCSA 4TV9E 4AKRB 4ZZBA 2H3RA 3ANWA 4DR6T 2V7LA 3CMLA 1XWMA 1LVKA 4EYYR 5LG4A 3RRCA 5EK3A 3ZN1B 5LJNA 2X51A 2JMHA 3LBXB 2MPKA 1S94A 2BZBA 2WWUA 2YKSA 4PAGA 2JMKA 4KMCA 4TV8E 4YSXA 4O4IE 2F4VT 2UXCT 2EHOD 3X1DA 2HN2A 2V6YB 4LFBT 4F6RC 2YDSA 2VQET 5KXJA 4X5TA 1FMVA 2BG9B 2X9YA 3CQGB 5HCJA 3TLSA 1FMWA 2ZM8A 4ZHQE 3P4PA 2CBJA 2XSBA 1G8XA 1YQ4A 3O4XE 4I43B 5LCYA 4LFCT 4IE7A 2W4XA 2QRXA 2K24A 2YN6A 3MJXA 4ZI2C 2OA5A 1D0YA 1OEDA 5CA0E 1IAPA 2KINB 3VU7H 4UXNB 3ZN0B 1QSDA 2PG8A 2Q9QC 1YQ3A 4DNDA 4TNWA 5HXHA 2D0TA 3EDUA 2V7MA 3HL6A 1JNRA 4DV2T 1MMDA 5L3GB 2XQAA 5ABHA 2NTYA 2X0YA 2KNDA 2LSJA 4DV6T 1N32T 2CLYB 1JNZA 1MMGA 2WM9A 3UULA 5HCMA 1U5PA 4IHJE 4KP3C 4AI6A 2W67A 4U7IA 2UXBT 4KX6A 2M67A 1D1CA 4CZZB 4U7YA 5JDLA 4DV1T 4MALA 3GWHA 3UTKA 4NPPA 1WRDA 4LF8T 3VKGA 3UU3A 3ZEFB 2CXLA 2C0SA 2LHRA 2W63A 1E1HB 4G63A 5HEHA 5J2TE 3RRWA 3RC8A 3VKHA 1XDOA 2MOZA 5CJ5A 1YKHB 1MIWA 4HFCA 1Z0PA 1LVFA 3P50A 4QWNB 2D2SA 2CLYC 3UQ7A 5HEUA 2MTQA 4AIUA 4DV5T 1KNPA 3A7MA 5AQGB 4ILAA 1D1BA 4DV3T 2WCAA 2E2AA 4IDNA 3ZT7A 4EYUA 5JRCB 5JVDE 4IDPA 3ZMVB 3AA1B 3VR8A 4DMWA 3MK7C 2XQYA 3LK3B 2X9WA 2C5JA 3LFMA 5AQOB 5FNVE 4PJNA 3PDYA 5L4HA 4X1YE 3JCFA 3WAJA 4X66T 5J0ZA 2BS3A 4H9RC 3CKDA 4AKHA 4AKGA 4V1Av 2ACXA 3WAKA 1HFAA 3ZMSB 3B57A 4E7ZA 5L47A 5L3FB 3OYZA 2LRLA 1W0AA 1GQEA 1UK5A 2VL8A 2LLYA 2XSAA 5FXXA 3RH3A 3AEGA 2VVSA 2OV9A 3L39A 5AQFB 5CFBA 5DQWA 1HNWT 2LSIA 5FL0A 3JAFA 3L09A 4BJNA 5HYAA 4NUUA 2VWAA 3ONLC 4YSYA 4GYRA 4AISA 3T1HT 5ADXL 1WYBA 4UVAB 3NBXX 4HFBA 1SA0E 2NW7A 1O3XA 2XQ5A 2BKPA 1R8IA 2Y48B 3O1HA 1UURA 4H63V 4UELA 3ZYLA 4EB6E 2XAQB 1QUUA 5ETWA 3IA3A 3JAEA 2ES0A 2VKJA 4ZI7E 2X68A 2BS2A 2WZHA 3VRBA 5TAOA 4OK0A 3ZMTB 2JIWA 4IT4A 1VOMA 2X0LB 3I9WA 2Y6XA 3EVYA 4LF7T 3RIFA 2NR4A 1WCRA 2C5KT 2B1EA 2XHEB 3ZKRA 4DIDB 3ZPOA 3HI2A 4QHOA 1HX8A 3AAEB 1OEDE 2H88A 2ZLYA 4LMJA 4DR4T 3ZMUB 3VRAA 2W00A 3ZT6A 4EIWA 4H9NC 2BVLA 5KMGP 4DR5T 2CXFA 3RIUC 3I0OA 3EI0A 3MKDA 3FZMB 4G2AA 1OXZA 3FB2A 3IF8B 4BA9A 3E0ZA 5LNKA 2V6XA 1HNZT 5JRCA 2BDEA 4ISTA 4MHCA 5CB4E 4DR7T 4DV4T 4QX7B 2BVMA 2EHOC 2P9BA 3PUGA 5L3BB 1D0ZA 3KBUA 3ONXA 4NUVA 4I55E 3A5XA 3AE9A 5FXWA 2DNXA 1IBLT 2WY2A 2ODVA 5KX5E 1N36T 1XNRT 3RYIE 2NW8A 3F31A 4HFDA 4QKNA 3U78A 4YY3T 3LK42 2CXDA 4YFSA 2HPJA 2CE7A 4PK6A 3RGLA 1OEDC 2A72A 3AE8A 5A1LA 1XZYA 2A3DA 3KVBA 2XY8B 3PU3A 3FBZA 4TN7B 3MZKB 3TKLB 2JRKA 2LSGA 2Q9QD 1W09A 3LK2B 3V5SA 5C3JA 3ZYKA 2G0UA 4CXXA 1J1JA 2ZM6T 5AQRB 2L8KA 4KHZF 5FYMA 4YLHA 2YDRA 1KNZA 3CIRA 4MFRA 2VASA 2DI4A 3AECA 3DTOA 1UUSA 4QX8B 1OEDB 1US7B 5L3CB 2XQ6A 2VKHA 3CX6B 2IMLA 4H9QC 4UR9A 3ZLIA 5FP3A 5AQJB 1XDPA 3QK6A 4I50E 4O4HE 3WI3A 4YJ2E 5JQGE 2DHRA 3R84B 2VKDA 2BG9A 5ABEA 3RX6A 1EZ3A 5AQLB 5AQMB 5DABA 2XASB 4Z8XA 4UV9B 2CEAA 2V6YA 3ABVA 3V5UA 2WBLA 2XZEA 4U2YA 4WZXA 3ZCIA 5LXTE 2XTLA 1IBKT 2CHNA 2UU9T 4JI7T 2XQ4A 2LKHA 3AE3A 2E9XA 3SRZA 5IHYA 3RC3A 3TLVA 2FJDA 2YEVC 2LE8A 3PUQA 4YT0A 3K3NA 3P4RA 4IL4A 5LHHB 5FMNA 3AAIA 4PJLA 4B6XA 3BQIA 5JR9C 1BR2A 2M6IA 4X64T 3MA9A 4B3MT 2X9HA 1VRBA 4LFAT 4O4JE 3PTRB 4ZS3A 1HS7A 4GK0E 1HNXT 4XBFB 4U3CA 4EV6A 3PE0A 3AA6B 3AAAB 1Y64B 4IE0A 3ZMZB 4B3TT 3N9MA 1SHZC 4JBWF 4O2BE 4C91A 1HR0T 5HXRA 3CWZB 2WDRA 1D1AA 4GYSA 2H7VC 2CBIA 1UX5A 2Y8DA 3ZC1A 2KWHA 3GMIA 4CN6A 1T72A 1T98A 4O8SA 3SWHA 1ZKEA 5AQUB 3T8OA 2CM0A 2KMFA 3L3PA 4H63H 4O2AE 4WBNE 1YXRA 2K9AA 1OWAA 4YHHT 4I4TE 4DV7T 2E5VA 2W2UA 2LRKA 4U31A 2MYSA 3K1SA 5FKYA 3R6NA 3UFEA 4DR3T 4ZEYA 5EK4A 4IE4A 3N2GE 4DBQA 2WSSV 1X79A 2CWOA 5AQNB 4ASKA 4H9PC 4GKJT 2XM1A 4HKAA 2I59A 4IL9A 4HTEA 3SS1A 2DWKA 1V9DA 1NENA 3KINB 3PURA 1ZV4X 4IE5A 2CA5A 4Z90A 4H9OC 3E22E 3Q5WA 1CHUA 4EEBA 5DJQC 3ZJ1A 4HFVA 3ZJ2A 4GIWA 4ZZCA 4DR1T 2ZM0A 3C4WA 3N2OA 2LM9A 1E2AA 1KFYA 2UXNB 3OKQA 3KBTA 3UUMA 2I6HA 1WLXA 5FL1A 5JH7E 3ANWB 5AQVB 5LJMA 4AQGA 1LRZA 5AQTB 1S35A 5LB7B 3SFDA 1ZP0A 4JI0T 3OVUA 4HWCA 2V1DB 3PUYF 4J2CA 5AQQB 4A98A 4AQFA 4AQYT 2QA7A 1UCUA 2WU2A 2N2NA 4P0AA 4HFHA 5HWYA 3RLFF 4COFA 1NEKA 3AA0B 3O9XA 1HG5A 2BG9E 4Q25A 3HA4A 1XNQT 4EAHA 4JUYA 4N78D 4L5GA 5LA6E 3ZCJA 4YTPA 4OX9T 3DJBA 5F5WA 2FBWA 2IC6A 5JREA 5LYJE 2VQFT 3NRYA 2R6GF 4LMKA 2IIUA 3P8CD 4ZOLE 5IYZE 3DP7A 2FJBA 2WP9A 1HX1B 2FJAA 4F8HA 3PUAA 3HKCE 4UIGA 4UVCB 3N9PA 3AB3B 5H6RB 3S4UA 4AQFC 4DBRA 4A5XA 2HHHT 4KUMB 2SPCA 2L3LA 2IHR1 3LSVA 2BBJA 2KWIB 1D0XA 4WNKA 3M65A 2VKOA 2E9XD 3QUJA 4QXHB 4DVDA 1YW0A 2H7OA 3KFWX 5LG3A 2XUEA 3FXDB 3ONJA 1MMAA 2BG9C 2PFVA 4H9SE 2IDOB 2J1DG 3RKOA 4BAYB 3QB5A 4ILCA 4EGWA 2UUBT 2JQQA 2J4GA 1CUNA 2KXPB 2E8IA 2W62A 3C51A 3FXEB 3LBXA 2QYWA 4TX5A 1WR0A 4TWFA 4QH4A 2V8SV 4X62T 3QC9A 3VR9A 5M4YA 3RKGA 3LDQB 4ERRA 2YDQA 3EAMA 5HWXA 3LG7A 5CGMA 2IC9A 3RIUA 3H3MA 4BJMA 1KNRA 2WB5A 4QXBB 2MBGA 5EK2A 3EABA 3O1IA 4U72A 1IJ6A 2ODUA 2CMRA 3AE4A 3AVSA 3P4WA 3AE7A 4KBMB 4UF0A 3FHNA 4CN1A 2HPLA 4ZI2D 5JDNA 4CXYA 3FBLA 5LP6E 3AXJB 5LHIB 1KEYA 5IUXA 3JADA 2VK9A 2XQ7A 2ZMAA 4MBQA 1AJ3A 2ACZA 3Q5XA 4HWHA 4EOZB 4LF9T 3CX7B 3HKDE 2DLRA 3KDSE 4CXWA 4NIQA 5J2UE 4X65T 1FIOA 2A9UA 3AEFA 4PFPA 5AQPB 2JJ9A 5FXVA 5HEGA 5AQSB 3I0QA 2YU2A 3KV9A 3ZSSA 4JYAT 5ABFB 2J62A 2W61A 5JDMA 2NW9A 3ESLA 2UXXB 4TUYE 2YOEA 4LF6T 4X20E 2X67A 3PJAA 3M3ZB 4K0UA 4HN9A 5FY0A 4P0BA 2UXDT 2KZ7B 2W66A 3PV0F 4X1IE 4ILBA 3HKBE 2LSYA 5HXCA 4YTNA 3PJAJ 4ZI3D 1HTJF 3RPUA 4NXNT 3KV6A 1L0VA 2Q9QA 3D0TA 1XMQT 3MXZA 3AVRA 2PJQA 3P7IA 4TNVA 4DUYT 2CRBA 2EHOA 3I1AA 3LJCA 5GONE 3ZYMA 2OLTA 3AE2A 5AQKB 4DR2T 4IREA 2DL1A 2V7KA 1X9BA 2BBHA 2DCFA 2RP4A 2FJEA 3CVRA 1ZOYA 4ILUA 1W0BA 3ZC0A 3GN5B 3AXJA 3FZFB 3FZKB 3N9LA 4ISSA 5JDQA 3NWIA 2K3WA 2WZIA 3CK6A 4IE6A 2Z6EA 3UFGA 2GK9A 2W0GA 2XQ9A 2LT3A 1HCIA 4UF0B 4HFEA 4WW0A 5FY7A 4EZ4A 1BR0A 2WU5A 1MMNA 2PBIA 4XZCA 2V7JA 3RIAA 3C98B 4IDOA 5LBMA 3AEEA 5H6QB 3AE6A 3T1YT 2M6BA 3FZLB 3N5LA 4TZ4C 2D0UA 2D9DA 3GA8A 5DQVA 1Z8UA 4ZS2A 3RF1A 1MIVA 3EDVA 4FI5A 1SE7A 2LSKA 4ZXLA 4TWDA 3FZHB 3RYHE 1IJ5A 2VVNA 3K3QC 4CI2B 3K3OA 3JC6D 1W9RA 2Q9QB 2XPKA 4ANJA 3OYXA 3BQLA 3UUXB 4L0RA 4UV8B 1NAFA 2XAJB 5FXZA 2LOPA 4DMVA 4I0UA 4U74A 1J5WA 4HEAA 3U3IA 1QLBA 2WMNA 1I94T 2NP9A 3QOFA 3AE1A 1MNDA 1YD8G 2MAWA 4GOUA 3OTOT 4LF4T 1KK7A 4IIJE 4L9IA 4P09A 1IBMT 4PNIA 2QVAA 4P1NA 3RYCE 5C8YE 5JTGA 3MACA 4HWDA 4OFZA 2X0HA 5LGUB 4GKKT 3J7Yq 2UUAT 3NVOA 3RYFE 4JI4T 1SUMB 4A56A 4CI1B 2V26A 2XM2A 4QH5A 3BQKA 3K8PC 5CA1E 2H89A 3ZSTA 2V7IA 4CQIA 4HWFA 5KDMC 4K0KT 3G06A 3HR0A 2AXDS 3C4XA 4OYKA 4PJJA 5JR9A 3UT5E 3A8YC 2K5BB 3TLWA 1Y01A 5LMNT 2YU1A 3GN5A 4WBOA 3IEEA 1WYCA 5JR9B 2WDVA 4PK5A 2YINA 3C64A 4A97A 5L4EA 4PJMA 5F3JA 2J47A 3UUNA 5ABGA 1ZEEA 4JLEA 3AEDA 3AE5A 5EZYE 5FVLA 3RHWA 4DV0T 3TLTA 3H37A 4HFIA 2V5CA 4FJOA 1HG2A 2AE9A 5HEOA 2VL0A 2I0MA 1LKXA 4O4LE 2E9XC 3N9QA 2CPTA 2CHOA 3C4ZA 1ZHCA 3Q9DA 2BKNA 3P4SA 3ZT5A 3ETVA 4OYJA 3PU8A 4YXDA 5J1GA 2XQ8A 2DWGA 2HN1A 3NZQA 2LKGA 2XQ3A 3IHRA 2E5LT 3H3AA 4JI2T 2VB6A 1UX4A 3RI5A 3HKEE 2WQYA 4U2ZA 4B3ST 4LMLA 4KHPT 4UVBB 3VHLA 5LMUT 2NWBA 3PUXF 1I6ZA 3B5MA 1H7CA 4TWHA 2XAFB 4YSZA 3W15B 2IUBA 3E08A 2LOSA 3F57A 5BR8T 3Q5DA 3RQUA 4B3RT 4PW8A 2V5DA 2WDQA 5L2LA 2UUCT 4NXMT 5AQIB 4JI1T 3KV5A 1VCTA 3SOLA 3N9NA 1BR4A 3KVAA 4YJ3E 2IW5B 5HXEA 4IDZA 2KT9A 4ZI3C 3RQWA 1NWMX 4EEDA 3I9YA 4MLKA 2KLQA 4CI3B 3N2KE 2LJLA
chains in the Genus database with same CATH topology
2HH7A 2XAHB 5LBQB 3OBVE 4AXPA 4E7SA 1BR1A 4PFOA 5LJNA 2RA1A 4EXTA 4OHFA 2N1GA 4YHJA 2A2FX 3IBPA 2NOXA 5L3DB 1YKEB 5LGTB 1FEWA 2EHOB 4GK5E 2L9QA 1HF8A 3C50A 3J9X1 2YK0A 2IAKA 2JPFA 1G73A 3CQCB 3CX8B 4HGAA 4QXCB 4AKIA 5AFUL 4JEUB 5JDGA 5FY1A 1MNEA 2C5IT 4HE8A 5HAXA 5JDHA 5L3EB 2LHNA 3N9OA 2E9XB 1WR6A 1MIYA 4M1PA 5HXSA 2CWYA 4IGUA 2X66A 3NRXA 4C90A 5LHGB 3AA7B 2NTXA 1B7TA 2D5UA 5E0OA 2N9DA 2X9XA 3EUHA 5BMVE 5F8PA 3B13A 4X1KE 5LOVE 3CPZA 2LEHA 4UEMA 5LGNB 2K48A 3Q2MA 2CCQA 2QGSA 4ADZA 4AKLA 4JEHB 4EZHA 3BK9A 1U4QA 3ETUA 2WMOA 3CQXC 3NZPA 4XAXB 5JDFA 2WAUA 1IZNB 4PK4A 3O1JA 3OJAA 2XAGB 3PUSA 4DO0A 3F2EA 3KV4A 2ZM2A 3JC6C 4TV9E 4AKRB 2H3RA 3ANWA 2V7LA 3CMLA 5LG4A 1LVKA 4EYYR 3RRCA 5EK3A 3ZN1B 2X51A 2JMHA 3LBXB 1S94A 2BZBA 2WWUA 4PAGA 2JMKA 4KMCA 4TV8E 4O4IE 2EHOD 4F6RC 1FMVA 2X9YA 3CQGB 1FMWA 2ZM8A 4ZHQE 1G8XA 3O4XE 4I43B 5LCYA 4IE7A 4ZI2C 3MJXA 2K24A 5CA0E 2OA5A 1D0YA 1IAPA 2KINB 3VU7H 4UXNB 3ZN0B 1QSDA 2PG8A 2Q9QC 4DNDA 5HXHA 2D0TA 3EDUA 2V7MA 3HL6A 1MMDA 5L3GB 2NTYA 2KNDA 2LSJA 2CLYB 2WM9A 1MMGA 3UULA 1U5PA 4IHJE 4KP3C 4AI6A 2M67A 1D1CA 4CZZB 5JDLA 4MALA 3GWHA 3UTKA 1WRDA 3VKGA 3ZEFB 2CXLA 2C0SA 2LHRA 2W63A 1E1HB 4G63A 5J2TE 3RC8A 3RRWA 3VKHA 2MOZA 1YKHB 1MIWA 4QWNB 1Z0PA 1LVFA 2D2SA 2CLYC 2MTQA 1D1BA 5JRCB 4EYUA 5JVDE 3ZMVB 3AA1B 4DMWA 3MK7C 2XQYA 3LK3B 2X9WA 2C5JA 3LFMA 5FNVE 4PJNA 3PDYA 4X1YE 3WAJA 4H9RC 3CKDA 4AKHA 4AKGA 4V1Av 2ACXA 3WAKA 1HFAA 3ZMSB 3B57A 4E7ZA 5L3FB 3OYZA 5FXXA 2VL8A 3RH3A 5DQWA 2LSIA 4BJNA 3L09A 5HYAA 4NUUA 2VWAA 4GYRA 5ADXL 1WYBA 4UVAB 3NBXX 1SA0E 2NW7A 1O3XA 2Y48B 3O1HA 4H63V 4UELA 3UUXB 3ZYLA 4EB6E 5LHHB 2XAQB 1QUUA 5ETWA 2ES0A 2VKJA 4ZI7E 2X68A 5TAOA 4OK0A 3ZMTB 1VOMA 2X0LB 3I9WA 2Y6XA 3EVYA 2C5KT 2B1EA 2XHEB 3ZPOA 3HI2A 4QHOA 1HX8A 3AAEB 2ZLYA 3ZMUB 2W00A 5KMGP 4EIWA 4H9NC 2BVLA 2CXFA 3I0OA 3MKDA 4G2AA 1OXZA 3FB2A 3IF8B 4BA9A 3E0ZA 5LNKA 5JRCA 2BDEA 4ISTA 4MHCA 5CB4E 4QX7B 2BVMA 2EHOC 2P9BA 3PUGA 5L3BB 1D0ZA 3KBUA 3ONXA 4NUVA 4I55E 3A5XA 5FXWA 2DNXA 2ODVA 5KX5E 3RYIE 2NW8A 3F31A 4QKNA 3U78A 3LK42 2CXDA 4YFSA 2HPJA 2CE7A 4PK6A 2A72A 5A1LA 2A3DA 3KVBA 3PU3A 3FBZA 4TN7B 3MZKB 3TKLB 2JRKA 2LSGA 2Q9QD 3LK2B 3V5SA 3ZYKA 2G0UA 2L8KA 5FYMA 4YLHA 1KNZA 4MFRA 2VASA 2DI4A 3DTOA 4QX8B 1US7B 5L3CB 3CX6B 2VKHA 4H9QC 3ZLIA 5FP3A 5JQGE 4O4HE 3QK6A 4I50E 3WI3A 4YJ2E 2DHRA 3R84B 2VKDA 3RX6A 1EZ3A 5DABA 2XASB 4Z8XA 4UV9B 2CEAA 3V5UA 2WBLA 3ZCIA 5LXTE 2XTLA 2E9XA 3SRZA 5IHYA 3RC3A 2YEVC 2LE8A 3PUQA 3K3NA 5FMNA 3AAIA 4PJLA 4B6XA 3BQIA 5JR9C 1BR2A 3MA9A 2X9HA 1VRBA 4O4JE 3PTRB 4ZS3A 1HS7A 4GK0E 4XBFB 3PE0A 3AA6B 3AAAB 1Y64B 4IE0A 3ZMZB 3N9MA 1SHZC 4O2BE 4C91A 5HXRA 3CWZB 1D1AA 4GYSA 2H7VC 1UX5A 2Y8DA 3ZC1A 2KWHA 3GMIA 1T98A 4O8SA 3SWHA 1ZKEA 3T8OA 2CM0A 2KMFA 3L3PA 4H63H 4O2AE 4WBNE 2K9AA 1OWAA 4I4TE 2MYSA 3R6NA 3UFEA 5EK4A 4IE4A 3N2GE 4DBQA 2WSSV 1X79A 2CWOA 4ASKA 4H9PC 4HKAA 2I59A 3SS1A 4HTEA 2DWKA 1V9DA 3PURA 3KINB 4IE5A 1ZV4X 2CA5A 4H9OC 3E22E 3Q5WA 5DJQC 3ZJ1A 4HFVA 3ZJ2A 4GIWA 2ZM0A 3C4WA 3N2OA 2LM9A 2UXNB 3OKQA 3UUMA 3KBTA 1WLXA 5JH7E 3ANWB 5LJMA 4AQGA 1LRZA 1S35A 2V1DB 4J2CA 4AQFA 2QA7A 1UCUA 2N2NA 4P0AA 5HWYA 3AA0B 3O9XA 1HG5A 3HA4A 4EAHA 4JUYA 4N78D 4L5GA 5LA6E 3ZCJA 3DJBA 2IC6A 5JREA 5LYJE 3NRYA 3P8CD 4ZOLE 5IYZE 3DP7A 3PUAA 3HKCE 4UIGA 4UVCB 3N9PA 3AB3B 5H6RB 3S4UA 4AQFC 4DBRA 4KUMB 2SPCA 2L3LA 2KWIB 1D0XA 4WNKA 3M65A 2VKOA 2E9XD 3QUJA 4QXHB 4DVDA 1YW0A 2H7OA 3KFWX 2XUEA 3FXDB 1MMAA 4H9SE 2PFVA 3RKOA 2J1DG 4BAYB 2JQQA 2KXPB 1CUNA 2W62A 2E8IA 3C51A 3FXEB 3LBXA 4TX5A 3QC9A 5M4YA 4ERRA 5HWXA 3LG7A 2IC9A 4BJMA 4QXBB 2MBGA 5EK2A 3O1IA 4U72A 1IJ6A 2ODUA 2CMRA 3AVSA 4KBMB 4UF0A 3FHNA 2HPLA 4ZI2D 5JDNA 4CXYA 3FBLA 5LP6E 5LHIB 2VK9A 2ZMAA 4MBQA 1AJ3A 3Q5XA 4EOZB 3CX7B 3HKDE 2DLRA 3KDSE 4CXWA 5J2UE 1FIOA 4PFPA 2JJ9A 5FXVA 3I0QA 2YU2A 3KV9A 2W61A 5JDMA 2NW9A 3ESLA 2UXXB 4TUYE 4X20E 2X67A 4K0UA 4HN9A 5FY0A 4P0BA 2KZ7B 4X1IE 3HKBE 2LSYA 5HXCA 4ZI3D 1HTJF 3RPUA 3KV6A 2Q9QA 3D0TA 3MXZA 3AVRA 2PJQA 3P7IA 2EHOA 3LJCA 3I1AA 5GONE 3ZYMA 2V7KA 2DCFA 2RP4A 4ILUA 3ZC0A 3CVRA 3GN5B 3N9LA 4ISSA 5JDQA 4IE6A 2Z6EA 2GK9A 2W0GA 4UF0B 2LT3A 1HCIA 4WW0A 5FY7A 4EZ4A 1BR0A 1MMNA 2PBIA 4XZCA 2V7JA 3C98B 5LBMA 5H6QB 3N5LA 4TZ4C 2D0UA 5DQVA 3GA8A 4ZS2A 1MIVA 3EDVA 4FI5A 2LSKA 3RYHE 4CI2B 1IJ5A 3K3QC 3K3OA 3JC6D 2Q9QB 4ANJA 3OYXA 3BQLA 4L0RA 4UV8B 1NAFA 2XAJB 5FXZA 2LOPA 4DMVA 3U3IA 4U74A 4HEAA 2WMNA 2NP9A 4GOUA 1MNDA 1YD8G 1KK7A 4IIJE 4L9IA 4P09A 4PNIA 3RYCE 5C8YE 3MACA 4OFZA 5LGUB 3J7Yq 3RYFE 4A56A 4CI1B 2V26A 3BQKA 3K8PC 5CA1E 2V7IA 4CQIA 5KDMC 3HR0A 3C4XA 3UT5E 4OYKA 4PJJA 5JR9A 2K5BB 2YU1A 3GN5A 4WBOA 3IEEA 1WYCA 5JR9B 4PK5A 2YINA 3C64A 4PJMA 5F3JA 3UUNA 1ZEEA 4JLEA 5EZYE 4CXXA 3H37A 4FJOA 1HG2A 1LKXA 4O4LE 2E9XC 3N9QA 3C4ZA 1ZHCA 3Q9DA 3ETVA 4OYJA 3PU8A 5J1GA 2DWGA 3NZQA 3IHRA 3H3AA 2VB6A 1UX4A 3HKEE 4UVBB 3VHLA 2NWBA 1H7CA 2XAFB 3W15B 3E08A 2LOSA 3F57A 4PW8A 5L2LA 3KV5A 3SOLA 3N9NA 1BR4A 3KVAA 4YJ3E 2IW5B 5HXEA 4IDZA 2KT9A 4ZI3C 1NWMX 3I9YA 4MLKA 2KLQA 4CI3B 3N2KE 2LJLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CWZ B;  2DWK A;  2DWG A;  2CXF A;  4GIW A;  2CXL A; 
#chains in the Genus database with same CATH topology
 2RPA A;  1M7K A;  2HH7 A;  2XAH B;  3AEB A;  3OBV E;  5FVK A;  1BR1 A;  4PFO A;  5LBQ B;  2RA1 A;  4AXP A;  4E7S A;  4EXT A;  4OHF A;  2N1G A;  4YHJ A;  2A2F X;  2JQK A;  3IBP A;  2NOX A;  3UQ4 A;  1XMO T;  2JQH A;  5L3D B;  1YKE B;  5LGT B;  1FEW A;  4Z91 A;  3L8R A;  4DUZ T;  2EHO B;  2WS3 A;  3EHZ A;  4GK5 E;  2L9Q A;  1WFD A;  1HF8 A;  3C50 A;  3J9X 1;  2YK0 A;  1KF6 A;  2IAK A;  2JPF A;  1G73 A;  2VUR A;  4YTM A;  3CQC B;  4JI5 T;  4JI3 T;  3CX8 B;  4HGA A;  2BKO A;  1T8B A;  4QXC B;  5AFU L;  4AKI A;  4JEU B;  4WYV A;  5JDG A;  5FY1 A;  1N33 T;  1MNE A;  2C5I T;  4HE8 A;  5HAX A;  5JDH A;  5L3E B;  1DU2 A;  2LHN A;  3QNU A;  3SFE A;  3QB5 K;  3N9O A;  2E9X B;  4QH1 A;  1WR6 A;  4JI8 T;  1MIY A;  4M1P A;  5HXS A;  1UGO A;  2CWY A;  2JQ9 A;  4IGU A;  5ABF A;  2X66 A;  5AQH B;  3NRX A;  3UU4 A;  4IDQ A;  4C90 A;  5LHG B;  2NTX A;  2XJ7 A;  3AA7 B;  1B7T A;  2D5U A;  5C2T A;  5E0O A;  3P4Q A;  2N9D A;  3PUZ F;  4U33 A;  2BS4 A;  5IWA T;  2X9X A;  3EUH A;  1T7S A;  3OPC A;  5BMV E;  5F8P A;  3B13 A;  3PUW F;  2KSR A;  4X1K E;  5LOV E;  1J5E T;  3CPZ A;  2LEH A;  4UEM A;  2WWV A;  3UUB A;  5LGN B;  4JI6 T;  2K48 A;  3UU8 A;  3Q2M A;  3UU6 A;  2CCQ A;  2QGS A;  3AEA A;  3TLU A;  4ADZ A;  4AKL A;  4CN4 A;  2LM2 A;  5HEJ A;  3NKZ A;  4JEH B;  4EZH A;  3BK9 A;  1U4Q A;  3ETU A;  2WMO A;  3CQX C;  3NZP A;  3Q5E A;  4XAX B;  5JDF A;  2WAU A;  1IZN B;  2PTF A;  1N34 T;  4PK4 A;  3UU5 A;  3PUV F;  2FUP A;  3O1J A;  3OJA A;  2XAG B;  3PUS A;  4HWI B;  4DO0 A;  3F2E A;  1M62 A;  4KI0 F;  3KV4 A;  2B76 A;  1E7P A;  4LF5 T;  1FJG T;  4JV5 T;  2ZM2 A;  3JC6 C;  1VCS A;  4TV9 E;  4AKR B;  4ZZB A;  2H3R A;  3ANW A;  4DR6 T;  2V7L A;  3CML A;  1XWM A;  1LVK A;  4EYY R;  5LG4 A;  3RRC A;  5EK3 A;  3ZN1 B;  5LJN A;  2X51 A;  2JMH A;  3LBX B;  2MPK A;  1S94 A;  2BZB A;  2WWU A;  2YKS A;  4PAG A;  2JMK A;  4KMC A;  4TV8 E;  4YSX A;  4O4I E;  2F4V T;  2UXC T;  2EHO D;  3X1D A;  2HN2 A;  2V6Y B;  4LFB T;  4F6R C;  2YDS A;  2VQE T;  5KXJ A;  4X5T A;  1FMV A;  2BG9 B;  2X9Y A;  3CQG B;  5HCJ A;  3TLS A;  1FMW A;  2ZM8 A;  4ZHQ E;  3P4P A;  2CBJ A;  2XSB A;  1G8X A;  1YQ4 A;  3O4X E;  4I43 B;  5LCY A;  4LFC T;  4IE7 A;  2W4X A;  2QRX A;  2K24 A;  2YN6 A;  3MJX A;  4ZI2 C;  2OA5 A;  1D0Y A;  1OED A;  5CA0 E;  1IAP A;  2KIN B;  3VU7 H;  4UXN B;  3ZN0 B;  1QSD A;  2PG8 A;  2Q9Q C;  1YQ3 A;  4DND A;  4TNW A;  5HXH A;  2D0T A;  3EDU A;  2V7M A;  3HL6 A;  1JNR A;  4DV2 T;  1MMD A;  5L3G B;  2XQA A;  5ABH A;  2NTY A;  2X0Y A;  2KND A;  2LSJ A;  4DV6 T;  1N32 T;  2CLY B;  1JNZ A;  1MMG A;  2WM9 A;  3UUL A;  5HCM A;  1U5P A;  4IHJ E;  4KP3 C;  4AI6 A;  2W67 A;  4U7I A;  2UXB T;  4KX6 A;  2M67 A;  1D1C A;  4CZZ B;  4U7Y A;  5JDL A;  4DV1 T;  4MAL A;  3GWH A;  3UTK A;  4NPP A;  1WRD A;  4LF8 T;  3VKG A;  3UU3 A;  3ZEF B;  2CXL A;  2C0S A;  2LHR A;  2W63 A;  1E1H B;  4G63 A;  5HEH A;  5J2T E;  3RRW A;  3RC8 A;  3VKH A;  1XDO A;  2MOZ A;  5CJ5 A;  1YKH B;  1MIW A;  4HFC A;  1Z0P A;  1LVF A;  3P50 A;  4QWN B;  2D2S A;  2CLY C;  3UQ7 A;  5HEU A;  2MTQ A;  4AIU A;  4DV5 T;  1KNP A;  3A7M A;  5AQG B;  4ILA A;  1D1B A;  4DV3 T;  2WCA A;  2E2A A;  4IDN A;  3ZT7 A;  4EYU A;  5JRC B;  5JVD E;  4IDP A;  3ZMV B;  3AA1 B;  3VR8 A;  4DMW A;  3MK7 C;  2XQY A;  3LK3 B;  2X9W A;  2C5J A;  3LFM A;  5AQO B;  5FNV E;  4PJN A;  3PDY A;  5L4H A;  4X1Y E;  3JCF A;  3WAJ A;  4X66 T;  5J0Z A;  2BS3 A;  4H9R C;  3CKD A;  4AKH A;  4AKG A;  4V1A v;  2ACX A;  3WAK A;  1HFA A;  3ZMS B;  3B57 A;  4E7Z A;  5L47 A;  5L3F B;  3OYZ A;  2LRL A;  1W0A A;  1GQE A;  1UK5 A;  2VL8 A;  2LLY A;  2XSA A;  5FXX A;  3RH3 A;  3AEG A;  2VVS A;  2OV9 A;  3L39 A;  5AQF B;  5CFB A;  5DQW A;  1HNW T;  2LSI A;  5FL0 A;  3JAF A;  3L09 A;  4BJN A;  5HYA A;  4NUU A;  2VWA A;  3ONL C;  4YSY A;  4GYR A;  4AIS A;  3T1H T;  5ADX L;  1WYB A;  4UVA B;  3NBX X;  4HFB A;  1SA0 E;  2NW7 A;  1O3X A;  2XQ5 A;  2BKP A;  1R8I A;  2Y48 B;  3O1H A;  1UUR A;  4H63 V;  4UEL A;  3ZYL A;  4EB6 E;  2XAQ B;  1QUU A;  5ETW A;  3IA3 A;  3JAE A;  2ES0 A;  2VKJ A;  4ZI7 E;  2X68 A;  2BS2 A;  2WZH A;  3VRB A;  5TAO A;  4OK0 A;  3ZMT B;  2JIW A;  4IT4 A;  1VOM A;  2X0L B;  3I9W A;  2Y6X A;  3EVY A;  4LF7 T;  3RIF A;  2NR4 A;  1WCR A;  2C5K T;  2B1E A;  2XHE B;  3ZKR A;  4DID B;  3ZPO A;  3HI2 A;  4QHO A;  1HX8 A;  3AAE B;  1OED E;  2H88 A;  2ZLY A;  4LMJ A;  4DR4 T;  3ZMU B;  3VRA A;  2W00 A;  3ZT6 A;  4EIW A;  4H9N C;  2BVL A;  5KMG P;  4DR5 T;  2CXF A;  3RIU C;  3I0O A;  3EI0 A;  3MKD A;  3FZM B;  4G2A A;  1OXZ A;  3FB2 A;  3IF8 B;  4BA9 A;  3E0Z A;  5LNK A;  2V6X A;  1HNZ T;  5JRC A;  2BDE A;  4IST A;  4MHC A;  5CB4 E;  4DR7 T;  4DV4 T;  4QX7 B;  2BVM A;  2EHO C;  2P9B A;  3PUG A;  5L3B B;  1D0Z A;  3KBU A;  3ONX A;  4NUV A;  4I55 E;  3A5X A;  3AE9 A;  5FXW A;  2DNX A;  1IBL T;  2WY2 A;  2ODV A;  5KX5 E;  1N36 T;  1XNR T;  3RYI E;  2NW8 A;  3F31 A;  4HFD A;  4QKN A;  3U78 A;  4YY3 T;  3LK4 2;  2CXD A;  4YFS A;  2HPJ A;  2CE7 A;  4PK6 A;  3RGL A;  1OED C;  2A72 A;  3AE8 A;  5A1L A;  1XZY A;  2A3D A;  3KVB A;  2XY8 B;  3PU3 A;  3FBZ A;  4TN7 B;  3MZK B;  3TKL B;  2JRK A;  2LSG A;  2Q9Q D;  1W09 A;  3LK2 B;  3V5S A;  5C3J A;  3ZYK A;  2G0U A;  4CXX A;  1J1J A;  2ZM6 T;  5AQR B;  2L8K A;  4KHZ F;  5FYM A;  4YLH A;  2YDR A;  1KNZ A;  3CIR A;  4MFR A;  2VAS A;  2DI4 A;  3AEC A;  3DTO A;  1UUS A;  4QX8 B;  1OED B;  1US7 B;  5L3C B;  2XQ6 A;  2VKH A;  3CX6 B;  2IML A;  4H9Q C;  4UR9 A;  3ZLI A;  5FP3 A;  5AQJ B;  1XDP A;  3QK6 A;  4I50 E;  4O4H E;  3WI3 A;  4YJ2 E;  5JQG E;  2DHR A;  3R84 B;  2VKD A;  2BG9 A;  5ABE A;  3RX6 A;  1EZ3 A;  5AQL B;  5AQM B;  5DAB A;  2XAS B;  4Z8X A;  4UV9 B;  2CEA A;  2V6Y A;  3ABV A;  3V5U A;  2WBL A;  2XZE A;  4U2Y A;  4WZX A;  3ZCI A;  5LXT E;  2XTL A;  1IBK T;  2CHN A;  2UU9 T;  4JI7 T;  2XQ4 A;  2LKH A;  3AE3 A;  2E9X A;  3SRZ A;  5IHY A;  3RC3 A;  3TLV A;  2FJD A;  2YEV C;  2LE8 A;  3PUQ A;  4YT0 A;  3K3N A;  3P4R A;  4IL4 A;  5LHH B;  5FMN A;  3AAI A;  4PJL A;  4B6X A;  3BQI A;  5JR9 C;  1BR2 A;  2M6I A;  4X64 T;  3MA9 A;  4B3M T;  2X9H A;  1VRB A;  4LFA T;  4O4J E;  3PTR B;  4ZS3 A;  1HS7 A;  4GK0 E;  1HNX T;  4XBF B;  4U3C A;  4EV6 A;  3PE0 A;  3AA6 B;  3AAA B;  1Y64 B;  4IE0 A;  3ZMZ B;  4B3T T;  3N9M A;  1SHZ C;  4JBW F;  4O2B E;  4C91 A;  1HR0 T;  5HXR A;  3CWZ B;  2WDR A;  1D1A A;  4GYS A;  2H7V C;  2CBI A;  1UX5 A;  2Y8D A;  3ZC1 A;  2KWH A;  3GMI A;  4CN6 A;  1T72 A;  1T98 A;  4O8S A;  3SWH A;  1ZKE A;  5AQU B;  3T8O A;  2CM0 A;  2KMF A;  3L3P A;  4H63 H;  4O2A E;  4WBN E;  1YXR A;  2K9A A;  1OWA A;  4YHH T;  4I4T E;  4DV7 T;  2E5V A;  2W2U A;  2LRK A;  4U31 A;  2MYS A;  3K1S A;  5FKY A;  3R6N A;  3UFE A;  4DR3 T;  4ZEY A;  5EK4 A;  4IE4 A;  3N2G E;  4DBQ A;  2WSS V;  1X79 A;  2CWO A;  5AQN B;  4ASK A;  4H9P C;  4GKJ T;  2XM1 A;  4HKA A;  2I59 A;  4IL9 A;  4HTE A;  3SS1 A;  2DWK A;  1V9D A;  1NEN A;  3KIN B;  3PUR A;  1ZV4 X;  4IE5 A;  2CA5 A;  4Z90 A;  4H9O C;  3E22 E;  3Q5W A;  1CHU A;  4EEB A;  5DJQ C;  3ZJ1 A;  4HFV A;  3ZJ2 A;  4GIW A;  4ZZC A;  4DR1 T;  2ZM0 A;  3C4W A;  3N2O A;  2LM9 A;  1E2A A;  1KFY A;  2UXN B;  3OKQ A;  3KBT A;  3UUM A;  2I6H A;  1WLX A;  5FL1 A;  5JH7 E;  3ANW B;  5AQV B;  5LJM A;  4AQG A;  1LRZ A;  5AQT B;  1S35 A;  5LB7 B;  3SFD A;  1ZP0 A;  4JI0 T;  3OVU A;  4HWC A;  2V1D B;  3PUY F;  4J2C A;  5AQQ B;  4A98 A;  4AQF A;  4AQY T;  2QA7 A;  1UCU A;  2WU2 A;  2N2N A;  4P0A A;  4HFH A;  5HWY A;  3RLF F;  4COF A;  1NEK A;  3AA0 B;  3O9X A;  1HG5 A;  2BG9 E;  4Q25 A;  3HA4 A;  1XNQ T;  4EAH A;  4JUY A;  4N78 D;  4L5G A;  5LA6 E;  3ZCJ A;  4YTP A;  4OX9 T;  3DJB A;  5F5W A;  2FBW A;  2IC6 A;  5JRE A;  5LYJ E;  2VQF T;  3NRY A;  2R6G F;  4LMK A;  2IIU A;  3P8C D;  4ZOL E;  5IYZ E;  3DP7 A;  2FJB A;  2WP9 A;  1HX1 B;  2FJA A;  4F8H A;  3PUA A;  3HKC E;  4UIG A;  4UVC B;  3N9P A;  3AB3 B;  5H6R B;  3S4U A;  4AQF C;  4DBR A;  4A5X A;  2HHH T;  4KUM B;  2SPC A;  2L3L A;  2IHR 1;  3LSV A;  2BBJ A;  2KWI B;  1D0X A;  4WNK A;  3M65 A;  2VKO A;  2E9X D;  3QUJ A;  4QXH B;  4DVD A;  1YW0 A;  2H7O A;  3KFW X;  5LG3 A;  2XUE A;  3FXD B;  3ONJ A;  1MMA A;  2BG9 C;  2PFV A;  4H9S E;  2IDO B;  2J1D G;  3RKO A;  4BAY B;  3QB5 A;  4ILC A;  4EGW A;  2UUB T;  2JQQ A;  2J4G A;  1CUN A;  2KXP B;  2E8I A;  2W62 A;  3C51 A;  3FXE B;  3LBX A;  2QYW A;  4TX5 A;  1WR0 A;  4TWF A;  4QH4 A;  2V8S V;  4X62 T;  3QC9 A;  3VR9 A;  5M4Y A;  3RKG A;  3LDQ B;  4ERR A;  2YDQ A;  3EAM A;  5HWX A;  3LG7 A;  5CGM A;  2IC9 A;  3RIU A;  3H3M A;  4BJM A;  1KNR A;  2WB5 A;  4QXB B;  2MBG A;  5EK2 A;  3EAB A;  3O1I A;  4U72 A;  1IJ6 A;  2ODU A;  2CMR A;  3AE4 A;  3AVS A;  3P4W A;  3AE7 A;  4KBM B;  4UF0 A;  3FHN A;  4CN1 A;  2HPL A;  4ZI2 D;  5JDN A;  4CXY A;  3FBL A;  5LP6 E;  3AXJ B;  5LHI B;  1KEY A;  5IUX A;  3JAD A;  2VK9 A;  2XQ7 A;  2ZMA A;  4MBQ A;  1AJ3 A;  2ACZ A;  3Q5X A;  4HWH A;  4EOZ B;  4LF9 T;  3CX7 B;  3HKD E;  2DLR A;  3KDS E;  4CXW A;  4NIQ A;  5J2U E;  4X65 T;  1FIO A;  2A9U A;  3AEF A;  4PFP A;  5AQP B;  2JJ9 A;  5FXV A;  5HEG A;  5AQS B;  3I0Q A;  2YU2 A;  3KV9 A;  3ZSS A;  4JYA T;  5ABF B;  2J62 A;  2W61 A;  5JDM A;  2NW9 A;  3ESL A;  2UXX B;  4TUY E;  2YOE A;  4LF6 T;  4X20 E;  2X67 A;  3PJA A;  3M3Z B;  4K0U A;  4HN9 A;  5FY0 A;  4P0B A;  2UXD T;  2KZ7 B;  2W66 A;  3PV0 F;  4X1I E;  4ILB A;  3HKB E;  2LSY A;  5HXC A;  4YTN A;  3PJA J;  4ZI3 D;  1HTJ F;  3RPU A;  4NXN T;  3KV6 A;  1L0V A;  2Q9Q A;  3D0T A;  1XMQ T;  3MXZ A;  3AVR A;  2PJQ A;  3P7I A;  4TNV A;  4DUY T;  2CRB A;  2EHO A;  3I1A A;  3LJC A;  5GON E;  3ZYM A;  2OLT A;  3AE2 A;  5AQK B;  4DR2 T;  4IRE A;  2DL1 A;  2V7K A;  1X9B A;  2BBH A;  2DCF A;  2RP4 A;  2FJE A;  3CVR A;  1ZOY A;  4ILU A;  1W0B A;  3ZC0 A;  3GN5 B;  3AXJ A;  3FZF B;  3FZK B;  3N9L A;  4ISS A;  5JDQ A;  3NWI A;  2K3W A;  2WZI A;  3CK6 A;  4IE6 A;  2Z6E A;  3UFG A;  2GK9 A;  2W0G A;  2XQ9 A;  2LT3 A;  1HCI A;  4UF0 B;  4HFE A;  4WW0 A;  5FY7 A;  4EZ4 A;  1BR0 A;  2WU5 A;  1MMN A;  2PBI A;  4XZC A;  2V7J A;  3RIA A;  3C98 B;  4IDO A;  5LBM A;  3AEE A;  5H6Q B;  3AE6 A;  3T1Y T;  2M6B A;  3FZL B;  3N5L A;  4TZ4 C;  2D0U A;  2D9D A;  3GA8 A;  5DQV A;  1Z8U A;  4ZS2 A;  3RF1 A;  1MIV A;  3EDV A;  4FI5 A;  1SE7 A;  2LSK A;  4ZXL A;  4TWD A;  3FZH B;  3RYH E;  1IJ5 A;  2VVN A;  3K3Q C;  4CI2 B;  3K3O A;  3JC6 D;  1W9R A;  2Q9Q B;  2XPK A;  4ANJ A;  3OYX A;  3BQL A;  3UUX B;  4L0R A;  4UV8 B;  1NAF A;  2XAJ B;  5FXZ A;  2LOP A;  4DMV A;  4I0U A;  4U74 A;  1J5W A;  4HEA A;  3U3I A;  1QLB A;  2WMN A;  1I94 T;  2NP9 A;  3QOF A;  3AE1 A;  1MND A;  1YD8 G;  2MAW A;  4GOU A;  3OTO T;  4LF4 T;  1KK7 A;  4IIJ E;  4L9I A;  4P09 A;  1IBM T;  4PNI A;  2QVA A;  4P1N A;  3RYC E;  5C8Y E;  5JTG A;  3MAC A;  4HWD A;  4OFZ A;  2X0H A;  5LGU B;  4GKK T;  3J7Y q;  2UUA T;  3NVO A;  3RYF E;  4JI4 T;  1SUM B;  4A56 A;  4CI1 B;  2V26 A;  2XM2 A;  4QH5 A;  3BQK A;  3K8P C;  5CA1 E;  2H89 A;  3ZST A;  2V7I A;  4CQI A;  4HWF A;  5KDM C;  4K0K T;  3G06 A;  3HR0 A;  2AXD S;  3C4X A;  4OYK A;  4PJJ A;  5JR9 A;  3UT5 E;  3A8Y C;  2K5B B;  3TLW A;  1Y01 A;  5LMN T;  2YU1 A;  3GN5 A;  4WBO A;  3IEE A;  1WYC A;  5JR9 B;  2WDV A;  4PK5 A;  2YIN A;  3C64 A;  4A97 A;  5L4E A;  4PJM A;  5F3J A;  2J47 A;  3UUN A;  5ABG A;  1ZEE A;  4JLE A;  3AED A;  3AE5 A;  5EZY E;  5FVL A;  3RHW A;  4DV0 T;  3TLT A;  3H37 A;  4HFI A;  2V5C A;  4FJO A;  1HG2 A;  2AE9 A;  5HEO A;  2VL0 A;  2I0M A;  1LKX A;  4O4L E;  2E9X C;  3N9Q A;  2CPT A;  2CHO A;  3C4Z A;  1ZHC A;  3Q9D A;  2BKN A;  3P4S A;  3ZT5 A;  3ETV A;  4OYJ A;  3PU8 A;  4YXD A;  5J1G A;  2XQ8 A;  2DWG A;  2HN1 A;  3NZQ A;  2LKG A;  2XQ3 A;  3IHR A;  2E5L T;  3H3A A;  4JI2 T;  2VB6 A;  1UX4 A;  3RI5 A;  3HKE E;  2WQY A;  4U2Z A;  4B3S T;  4LML A;  4KHP T;  4UVB B;  3VHL A;  5LMU T;  2NWB A;  3PUX F;  1I6Z A;  3B5M A;  1H7C A;  4TWH A;  2XAF B;  4YSZ A;  3W15 B;  2IUB A;  3E08 A;  2LOS A;  3F57 A;  5BR8 T;  3Q5D A;  3RQU A;  4B3R T;  4PW8 A;  2V5D A;  2WDQ A;  5L2L A;  2UUC T;  4NXM T;  5AQI B;  4JI1 T;  3KV5 A;  1VCT A;  3SOL A;  3N9N A;  1BR4 A;  3KVA A;  4YJ3 E;  2IW5 B;  5HXE A;  4IDZ A;  2KT9 A;  4ZI3 C;  3RQW A;  1NWM X;  4EED A;  3I9Y A;  4MLK A;  2KLQ A;  4CI3 B;  3N2K E;  2LJL A; 
#chains in the Genus database with same CATH homology
 2HH7 A;  2XAH B;  5LBQ B;  3OBV E;  4AXP A;  4E7S A;  1BR1 A;  4PFO A;  5LJN A;  2RA1 A;  4EXT A;  4OHF A;  2N1G A;  4YHJ A;  2A2F X;  3IBP A;  2NOX A;  5L3D B;  1YKE B;  5LGT B;  1FEW A;  2EHO B;  4GK5 E;  2L9Q A;  1HF8 A;  3C50 A;  3J9X 1;  2YK0 A;  2IAK A;  2JPF A;  1G73 A;  3CQC B;  3CX8 B;  4HGA A;  4QXC B;  4AKI A;  5AFU L;  4JEU B;  5JDG A;  5FY1 A;  1MNE A;  2C5I T;  4HE8 A;  5HAX A;  5JDH A;  5L3E B;  2LHN A;  3N9O A;  2E9X B;  1WR6 A;  1MIY A;  4M1P A;  5HXS A;  2CWY A;  4IGU A;  2X66 A;  3NRX A;  4C90 A;  5LHG B;  3AA7 B;  2NTX A;  1B7T A;  2D5U A;  5E0O A;  2N9D A;  2X9X A;  3EUH A;  5BMV E;  5F8P A;  3B13 A;  4X1K E;  5LOV E;  3CPZ A;  2LEH A;  4UEM A;  5LGN B;  2K48 A;  3Q2M A;  2CCQ A;  2QGS A;  4ADZ A;  4AKL A;  4JEH B;  4EZH A;  3BK9 A;  1U4Q A;  3ETU A;  2WMO A;  3CQX C;  3NZP A;  4XAX B;  5JDF A;  2WAU A;  1IZN B;  4PK4 A;  3O1J A;  3OJA A;  2XAG B;  3PUS A;  4DO0 A;  3F2E A;  3KV4 A;  2ZM2 A;  3JC6 C;  4TV9 E;  4AKR B;  2H3R A;  3ANW A;  2V7L A;  3CML A;  5LG4 A;  1LVK A;  4EYY R;  3RRC A;  5EK3 A;  3ZN1 B;  2X51 A;  2JMH A;  3LBX B;  1S94 A;  2BZB A;  2WWU A;  4PAG A;  2JMK A;  4KMC A;  4TV8 E;  4O4I E;  2EHO D;  4F6R C;  1FMV A;  2X9Y A;  3CQG B;  1FMW A;  2ZM8 A;  4ZHQ E;  1G8X A;  3O4X E;  4I43 B;  5LCY A;  4IE7 A;  4ZI2 C;  3MJX A;  2K24 A;  5CA0 E;  2OA5 A;  1D0Y A;  1IAP A;  2KIN B;  3VU7 H;  4UXN B;  3ZN0 B;  1QSD A;  2PG8 A;  2Q9Q C;  4DND A;  5HXH A;  2D0T A;  3EDU A;  2V7M A;  3HL6 A;  1MMD A;  5L3G B;  2NTY A;  2KND A;  2LSJ A;  2CLY B;  2WM9 A;  1MMG A;  3UUL A;  1U5P A;  4IHJ E;  4KP3 C;  4AI6 A;  2M67 A;  1D1C A;  4CZZ B;  5JDL A;  4MAL A;  3GWH A;  3UTK A;  1WRD A;  3VKG A;  3ZEF B;  2CXL A;  2C0S A;  2LHR A;  2W63 A;  1E1H B;  4G63 A;  5J2T E;  3RC8 A;  3RRW A;  3VKH A;  2MOZ A;  1YKH B;  1MIW A;  4QWN B;  1Z0P A;  1LVF A;  2D2S A;  2CLY C;  2MTQ A;  1D1B A;  5JRC B;  4EYU A;  5JVD E;  3ZMV B;  3AA1 B;  4DMW A;  3MK7 C;  2XQY A;  3LK3 B;  2X9W A;  2C5J A;  3LFM A;  5FNV E;  4PJN A;  3PDY A;  4X1Y E;  3WAJ A;  4H9R C;  3CKD A;  4AKH A;  4AKG A;  4V1A v;  2ACX A;  3WAK A;  1HFA A;  3ZMS B;  3B57 A;  4E7Z A;  5L3F B;  3OYZ A;  5FXX A;  2VL8 A;  3RH3 A;  5DQW A;  2LSI A;  4BJN A;  3L09 A;  5HYA A;  4NUU A;  2VWA A;  4GYR A;  5ADX L;  1WYB A;  4UVA B;  3NBX X;  1SA0 E;  2NW7 A;  1O3X A;  2Y48 B;  3O1H A;  4H63 V;  4UEL A;  3UUX B;  3ZYL A;  4EB6 E;  5LHH B;  2XAQ B;  1QUU A;  5ETW A;  2ES0 A;  2VKJ A;  4ZI7 E;  2X68 A;  5TAO A;  4OK0 A;  3ZMT B;  1VOM A;  2X0L B;  3I9W A;  2Y6X A;  3EVY A;  2C5K T;  2B1E A;  2XHE B;  3ZPO A;  3HI2 A;  4QHO A;  1HX8 A;  3AAE B;  2ZLY A;  3ZMU B;  2W00 A;  5KMG P;  4EIW A;  4H9N C;  2BVL A;  2CXF A;  3I0O A;  3MKD A;  4G2A A;  1OXZ A;  3FB2 A;  3IF8 B;  4BA9 A;  3E0Z A;  5LNK A;  5JRC A;  2BDE A;  4IST A;  4MHC A;  5CB4 E;  4QX7 B;  2BVM A;  2EHO C;  2P9B A;  3PUG A;  5L3B B;  1D0Z A;  3KBU A;  3ONX A;  4NUV A;  4I55 E;  3A5X A;  5FXW A;  2DNX A;  2ODV A;  5KX5 E;  3RYI E;  2NW8 A;  3F31 A;  4QKN A;  3U78 A;  3LK4 2;  2CXD A;  4YFS A;  2HPJ A;  2CE7 A;  4PK6 A;  2A72 A;  5A1L A;  2A3D A;  3KVB A;  3PU3 A;  3FBZ A;  4TN7 B;  3MZK B;  3TKL B;  2JRK A;  2LSG A;  2Q9Q D;  3LK2 B;  3V5S A;  3ZYK A;  2G0U A;  2L8K A;  5FYM A;  4YLH A;  1KNZ A;  4MFR A;  2VAS A;  2DI4 A;  3DTO A;  4QX8 B;  1US7 B;  5L3C B;  3CX6 B;  2VKH A;  4H9Q C;  3ZLI A;  5FP3 A;  5JQG E;  4O4H E;  3QK6 A;  4I50 E;  3WI3 A;  4YJ2 E;  2DHR A;  3R84 B;  2VKD A;  3RX6 A;  1EZ3 A;  5DAB A;  2XAS B;  4Z8X A;  4UV9 B;  2CEA A;  3V5U A;  2WBL A;  3ZCI A;  5LXT E;  2XTL A;  2E9X A;  3SRZ A;  5IHY A;  3RC3 A;  2YEV C;  2LE8 A;  3PUQ A;  3K3N A;  5FMN A;  3AAI A;  4PJL A;  4B6X A;  3BQI A;  5JR9 C;  1BR2 A;  3MA9 A;  2X9H A;  1VRB A;  4O4J E;  3PTR B;  4ZS3 A;  1HS7 A;  4GK0 E;  4XBF B;  3PE0 A;  3AA6 B;  3AAA B;  1Y64 B;  4IE0 A;  3ZMZ B;  3N9M A;  1SHZ C;  4O2B E;  4C91 A;  5HXR A;  3CWZ B;  1D1A A;  4GYS A;  2H7V C;  1UX5 A;  2Y8D A;  3ZC1 A;  2KWH A;  3GMI A;  1T98 A;  4O8S A;  3SWH A;  1ZKE A;  3T8O A;  2CM0 A;  2KMF A;  3L3P A;  4H63 H;  4O2A E;  4WBN E;  2K9A A;  1OWA A;  4I4T E;  2MYS A;  3R6N A;  3UFE A;  5EK4 A;  4IE4 A;  3N2G E;  4DBQ A;  2WSS V;  1X79 A;  2CWO A;  4ASK A;  4H9P C;  4HKA A;  2I59 A;  3SS1 A;  4HTE A;  2DWK A;  1V9D A;  3PUR A;  3KIN B;  4IE5 A;  1ZV4 X;  2CA5 A;  4H9O C;  3E22 E;  3Q5W A;  5DJQ C;  3ZJ1 A;  4HFV A;  3ZJ2 A;  4GIW A;  2ZM0 A;  3C4W A;  3N2O A;  2LM9 A;  2UXN B;  3OKQ A;  3UUM A;  3KBT A;  1WLX A;  5JH7 E;  3ANW B;  5LJM A;  4AQG A;  1LRZ A;  1S35 A;  2V1D B;  4J2C A;  4AQF A;  2QA7 A;  1UCU A;  2N2N A;  4P0A A;  5HWY A;  3AA0 B;  3O9X A;  1HG5 A;  3HA4 A;  4EAH A;  4JUY A;  4N78 D;  4L5G A;  5LA6 E;  3ZCJ A;  3DJB A;  2IC6 A;  5JRE A;  5LYJ E;  3NRY A;  3P8C D;  4ZOL E;  5IYZ E;  3DP7 A;  3PUA A;  3HKC E;  4UIG A;  4UVC B;  3N9P A;  3AB3 B;  5H6R B;  3S4U A;  4AQF C;  4DBR A;  4KUM B;  2SPC A;  2L3L A;  2KWI B;  1D0X A;  4WNK A;  3M65 A;  2VKO A;  2E9X D;  3QUJ A;  4QXH B;  4DVD A;  1YW0 A;  2H7O A;  3KFW X;  2XUE A;  3FXD B;  1MMA A;  4H9S E;  2PFV A;  3RKO A;  2J1D G;  4BAY B;  2JQQ A;  2KXP B;  1CUN A;  2W62 A;  2E8I A;  3C51 A;  3FXE B;  3LBX A;  4TX5 A;  3QC9 A;  5M4Y A;  4ERR A;  5HWX A;  3LG7 A;  2IC9 A;  4BJM A;  4QXB B;  2MBG A;  5EK2 A;  3O1I A;  4U72 A;  1IJ6 A;  2ODU A;  2CMR A;  3AVS A;  4KBM B;  4UF0 A;  3FHN A;  2HPL A;  4ZI2 D;  5JDN A;  4CXY A;  3FBL A;  5LP6 E;  5LHI B;  2VK9 A;  2ZMA A;  4MBQ A;  1AJ3 A;  3Q5X A;  4EOZ B;  3CX7 B;  3HKD E;  2DLR A;  3KDS E;  4CXW A;  5J2U E;  1FIO A;  4PFP A;  2JJ9 A;  5FXV A;  3I0Q A;  2YU2 A;  3KV9 A;  2W61 A;  5JDM A;  2NW9 A;  3ESL A;  2UXX B;  4TUY E;  4X20 E;  2X67 A;  4K0U A;  4HN9 A;  5FY0 A;  4P0B A;  2KZ7 B;  4X1I E;  3HKB E;  2LSY A;  5HXC A;  4ZI3 D;  1HTJ F;  3RPU A;  3KV6 A;  2Q9Q A;  3D0T A;  3MXZ A;  3AVR A;  2PJQ A;  3P7I A;  2EHO A;  3LJC A;  3I1A A;  5GON E;  3ZYM A;  2V7K A;  2DCF A;  2RP4 A;  4ILU A;  3ZC0 A;  3CVR A;  3GN5 B;  3N9L A;  4ISS A;  5JDQ A;  4IE6 A;  2Z6E A;  2GK9 A;  2W0G A;  4UF0 B;  2LT3 A;  1HCI A;  4WW0 A;  5FY7 A;  4EZ4 A;  1BR0 A;  1MMN A;  2PBI A;  4XZC A;  2V7J A;  3C98 B;  5LBM A;  5H6Q B;  3N5L A;  4TZ4 C;  2D0U A;  5DQV A;  3GA8 A;  4ZS2 A;  1MIV A;  3EDV A;  4FI5 A;  2LSK A;  3RYH E;  4CI2 B;  1IJ5 A;  3K3Q C;  3K3O A;  3JC6 D;  2Q9Q B;  4ANJ A;  3OYX A;  3BQL A;  4L0R A;  4UV8 B;  1NAF A;  2XAJ B;  5FXZ A;  2LOP A;  4DMV A;  3U3I A;  4U74 A;  4HEA A;  2WMN A;  2NP9 A;  4GOU A;  1MND A;  1YD8 G;  1KK7 A;  4IIJ E;  4L9I A;  4P09 A;  4PNI A;  3RYC E;  5C8Y E;  3MAC A;  4OFZ A;  5LGU B;  3J7Y q;  3RYF E;  4A56 A;  4CI1 B;  2V26 A;  3BQK A;  3K8P C;  5CA1 E;  2V7I A;  4CQI A;  5KDM C;  3HR0 A;  3C4X A;  3UT5 E;  4OYK A;  4PJJ A;  5JR9 A;  2K5B B;  2YU1 A;  3GN5 A;  4WBO A;  3IEE A;  1WYC A;  5JR9 B;  4PK5 A;  2YIN A;  3C64 A;  4PJM A;  5F3J A;  3UUN A;  1ZEE A;  4JLE A;  5EZY E;  4CXX A;  3H37 A;  4FJO A;  1HG2 A;  1LKX A;  4O4L E;  2E9X C;  3N9Q A;  3C4Z A;  1ZHC A;  3Q9D A;  3ETV A;  4OYJ A;  3PU8 A;  5J1G A;  2DWG A;  3NZQ A;  3IHR A;  3H3A A;  2VB6 A;  1UX4 A;  3HKE E;  4UVB B;  3VHL A;  2NWB A;  1H7C A;  2XAF B;  3W15 B;  3E08 A;  2LOS A;  3F57 A;  4PW8 A;  5L2L A;  3KV5 A;  3SOL A;  3N9N A;  1BR4 A;  3KVA A;  4YJ3 E;  2IW5 B;  5HXE A;  4IDZ A;  2KT9 A;  4ZI3 C;  1NWM X;  3I9Y A;  4MLK A;  2KLQ A;  4CI3 B;  3N2K E;  2LJL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...