2DWGA

Run domain of rap2 interacting protein x, crystallized in p2(1)2(1)2(1) space group
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
165
structure length
158
Chain Sequence
MANERMNLMNMAKLSIKGLIESALNLGRTLDSDYAPLQQFFVVMEHCLKHGLKANKSFWGPLELVEKLVPEAAEITASVKDLPGLKTPVGRGRAWLRLALMQKKLSEYMKALINKKELLSEFYEVNALMMEEEGAIIAGLLVGLNVIDANFCMKGEDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein RUFY3
publication title Crystal Structure of the RUN Domain of the RAP2-interacting Protein x
pubmed doi rcsb
source organism Mus musculus
molecule tags Protein binding
total genus 48
structure length 158
sequence length 165
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02759 RUN RUN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.900 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2dwgA00
2DWGA 3CWZB 2CXLA 2DWKA 2CXFA 4GIWA
chains in the Genus database with same CATH superfamily
4PK6A 1BR4A 5KMGP 1HX1B 2ZM6T 2PFVA 2CRBA 3MKDA 4XAXB 4QX7B 5H6QB 1YKHB 3ZT5A 2X67A 2WM9A 2B76A 4XZCA 4B3RT 2ES0A 3HI2A 4PJMA 2BS3A 2KT9A 3AA0B 4LFBT 3H3AA 5LHGB 1U4QA 3AB3B 2JQKA 4X66T 4IDPA 3OJAA 3LFMA 1XMQT 3JC6D 4DBRA 2MTQA 3PUXF 2I6HA 2UUAT 3V5SA 4PFPA 2CPTA 4KBMB 2X0HA 3ZSSA 3PUWF 3B5MA 2E9XD 2IAKA 4WBNE 4AI6A 5AQLB 4UVCB 2V7JA 3C4XA 5C8YE 3AECA 1BR2A 1IBKT 5JRCB 3UU4A 1UUSA 4DV7T 4HWIB 2NP9A 3UFGA 2UUBT 3FZFB 3PU3A 1IJ6A 2LJLA 2V6XA 3UUMA 2W67A 5JQGE 2N1GA 2NW7A 1QUUA 2FJAA 5HYAA 3PJAJ 2ODUA 2LHRA 4IDOA 2XQ4A 5LB7B 3ZYKA 3TKLB 2UUCT 2I0MA 4B3TT 2YU1A 5HCJA 3KINB 2KLQA 2MPKA 5JR9A 1X9BA 2XPKA 4QXCB 3NRXA 5L3EB 4UVAB 3R84B 1VOMA 3CQCB 3G06A 3IA3A 1XDPA 2UXXB 4OK0A 2CHNA 3ONLC 2CBJA 3AAEB 4JEUB 2Z6EA 3RYCE 1KF6A 1QSDA 3C64A 2G0UA 2BS2A 4BJMA 3P8CD 2H3RA 2H7VC 4UF0A 2C0SA 4GYRA 2LT3A 3TLVA 3C4WA 2PBIA 2C5KT 2NW8A 1FJGT 4H9OC 4DV6T 3VU7H 2Q9QD 3IF8B 3IEEA 4AKLA 5JH7E 1ZKEA 4O4IE 4TWDA 4JI5T 2CE7A 2DWGA 5LJNA 1FMWA 3PE0A 3Q9DA 2C5IT 4JI3T 4MFRA 4B6XA 5J2UE 2N9DA 2LSJA 4JV5T 2V26A 2XSBA 2BZBA 3JADA 4PK4A 3CK6A 5AQRB 4QXHB 3SFDA 4ZI2C 4IGUA 5L2LA 2WDRA 3IHRA 3VKHA 2CXLA 2ODVA 1I6ZA 5JDMA 3VR8A 1KNRA 3MJXA 2NTYA 4AKHA 4ADZA 5GONE 4ZS2A 3PURA 5LBMA 2CXDA 4M1PA 2LRLA 4ASKA 4EGWA 1ZEEA 4C90A 2IHR1 4LFCT 1JNRA 2WWVA 4HFVA 2WU2A 2X66A 1HNWT 3AVRA 2MYSA 4ERRA 5M4YA 3EDVA 3RIUC 2X9YA 1D0ZA 3RYHE 2CCQA 5CFBA 3LK3B 4FJOA 2XQ5A 3AA6B 4HE8A 2RA1A 4DV4T 1YKEB 5L3BB 2GK9A 4EYYR 2X0LB 4CXWA 3O9XA 3B57A 5LHHB 4B3ST 5FY7A 3ETUA 4UR9A 5CB4E 5LOVE 4YLHA 5L3GB 5JDNA 1ZP0A 1D1BA 2HN2A 5F5WA 4EIWA 2PJQA 3RH3A 1YQ3A 2QVAA 5DABA 5CGMA 5CA1E 4ILCA 3AEEA 3Q5DA 2BG9A 3EABA 4J2CA 4NUUA 2LEHA 4IE4A 4HFHA 4YY3T 2XQ9A 2VVSA 5AQFB 4G2AA 1LKXA 4H9RC 4Z91A 4GK0E 1DU2A 1D1AA 3AXJA 2HPJA 4ZI3D 4N78D 3ZSTA 4EV6A 4A98A 3HR0A 3ZMUB 3OKQA 1IZNB 2I59A 3P4RA 3CX8B 3TLWA 2P9BA 4AXPA 2XQ6A 4TUYE 5IUXA 1UK5A 4NIQA 2QA7A 1HR0T 4YXDA 3NVOA 1WRDA 3N5LA 2OLTA 1S35A 2CWOA 5KDMC 1KNZA 5BR8T 1WLXA 2RPAA 1T7SA 4DR3T 4IT4A 2VWAA 4ZHQE 2LSIA 4K0UA 3HKEE 2VK9A 4CI3B 5IYZE 4A5XA 1NENA 2K9AA 1WCRA 2IC6A 4IDNA 3W15B 3CPZA 4F8HA 3UQ4A 3O1IA 1Z8UA 4X1YE 4JI2T 3T1HT 2E9XA 5LG4A 3PJAA 4JI7T 4ANJA 3CVRA 3HA4A 2EHOC 4U7IA 5FXVA 4V1Av 3OYZA 5LGUB 1MMNA 5LMNT 3ESLA 1ZHCA 5L3FB 4U2ZA 2MAWA 4IIJE 3JAFA 2KNDA 3FB2A 4X65T 4DMVA 2V7LA 4WYVA 3RC3A 4HEAA 5LHIB 1OEDE 4IHJE 2L8KA 4AIUA 1EZ3A 3ZMSB 4GIWA 3KDSE 1L0VA 4KHPT 2QYWA 3GA8A 3FHNA 5J0ZA 4YT0A 1J1JA 3SWHA 4PJLA 3FZKB 1HG2A 2XQ3A 1US7B 1BR1A 3PUVF 2WU5A 4HFDA 3QK6A 5ABFB 1WR6A 1MMGA 3PUGA 2D5UA 4YSYA 3N9PA 4EEBA 5AQMB 5HCMA 2Q9QA 2B1EA 2BBHA 3OPCA 4PJJA 4IE5A 3ONXA 4A97A 2X51A 3KV4A 2WP9A 4IDZA 4E7SA 1LVFA 3UU8A 3RKGA 4OYKA 3BK9A 3F2EA 3NBXX 4YTMA 1XMOT 2L3LA 3ANWB 2WWUA 5ABEA 4ISSA 3TLUA 5LCYA 5BMVE 3OVUA 3PUYF 3RQWA 5JDHA 5HWYA 4DR5T 3ETVA 4CN1A 4H63V 4PFOA 4FI5A 3P4WA 2LRKA 3Q2MA 1OEDA 2W4XA 3M65A 4AKRB 4DR6T 4L0RA 2E5VA 3MK7C 1VRBA 1UX4A 4ZI7E 4AQFA 1D0XA 4JUYA 2K3WA 2NR4A 3ZYLA 1OWAA 3LSVA 5CA0E 3UU6A 2R6GF 4CN4A 5LA6E 2M6BA 2E5LT 4U2YA 3CQGB 4KI0F 2L9QA 3WAJA 2D0TA 2V6YA 2JQQA 2XTLA 2LKHA 2KMFA 2K48A 3Q5XA 4DR1T 4I43B 1NAFA 5FMNA 1B7TA 4IE7A 1SUMB 1Y64B 4YSXA 3PV0F 4YTNA 4I55E 5LP6E 4MALA 3CMLA 4X5TA 3P4PA 3RI5A 4YHHT 3LK2B 3OBVE 3FBLA 2CXFA 3QB5A 3AAAB 2VURA 1FIOA 1WFDA 3C51A 3U78A 4E7ZA 2JRKA 4C91A 3N2OA 2BDEA 4AISA 1KEYA 1I94T 3K3NA 3QOFA 3K1SA 3V5UA 2M6IA 4DVDA 3Q5WA 1LRZA 2K24A 1LVKA 1OXZA 3ZJ1A 3DTOA 4EEDA 5LBQB 5L47A 3L39A 2LLYA 4QHOA 4TZ4C 2ZM8A 3K8PC 3P4QA 4MLKA 2KWHA 5HEJA 4LFAT 2YK0A 3ZCIA 4QH1A 1D0YA 1W9RA 3AEGA 1HX8A 1HNXT 2LM9A 4WZXA 4GOUA 3VRAA 3K3QC 3EUHA 1QLBA 5EK4A 3UUNA 4YJ3E 3RRCA 2VB6A 3N2KE 2BBJA 4BAYB 2XASB 4DNDA 3EHZA 3LDQB 2WDQA 1GQEA 2FJBA 5DQWA 1IJ5A 5LYJE 4LMKA 3I9YA 2NTXA 3SRZA 2Y8DA 4A56A 4IE0A 2IMLA 3NZPA 3RHWA 4ZOLE 1NWMX 4I0UA 5AQTB 3RKOA 4JBWF 5L4HA 2H89A 2VKJA 3B13A 2UXDT 3AAIA 2JQHA 4YTPA 4U33A 2HH7A 3P4SA 5ADXL 2IC9A 2XQYA 4GK5E 4IE6A 4NXMT 2XY8B 2WBLA 4CZZB 2YN6A 1XNRT 2XAFB 4TWFA 5JR9C 1E7PA 2QRXA 3FXDB 2E2AA 4ZS3A 3ZJ2A 2AXDS 3EI0A 5HXRA 2DNXA 2VASA 3TLTA 2W00A 3A8YC 3MZKB 4PNIA 2X9WA 1WYBA 4DV1T 4ZI2D 3I0OA 5FKYA 4ILBA 3LJCA 1W0AA 4TX5A 5FY1A 5LXTE 4I50E 4XBFB 2N2NA 3QNUA 5KX5E 1T98A 5AFUL 4DIDB 1XZYA 1JNZA 3AEBA 3FXEB 5FXWA 4MHCA 3BQIA 2DL1A 2K5BB 3O1JA 2YDSA 5AQNB 2QGSA 3P7IA 3OTOT 3O4XE 2FJEA 3RPUA 2YEVC 1MIVA 2ZLYA 4WW0A 3E22E 3A7MA 3CIRA 4ILUA 2LHNA 3LG7A 2FUPA 3ZT6A 1N33T 4UV9B 5HXSA 2RP4A 3KVBA 4HFIA 2NWBA 3NZQA 4EAHA 3LK42 5C3JA 2WDVA 2JIWA 2LM2A 3OYXA 5JR9B 4LF4T 2UXCT 4U31A 5L3DB 4QKNA 2LKGA 5LMUT 5IHYA 3N2GE 4Q25A 5FL1A 4ZZBA 4HWFA 3PTRB 4COFA 4IREA 2LSGA 5JTGA 2V7KA 1T72A 3QUJA 1FEWA 3CWZB 4PK5A 5JDLA 1J5WA 4JYAT 2HPLA 2V7MA 3ZKRA 4KHZF 2A72A 4KMCA 4JEHB 2YDQA 2XUEA 5LNKA 5L4EA 2D0UA 3ZT7A 2JPFA 1ZV4X 4JI8T 1G73A 3PUAA 3U3IA 5JRCA 1D1CA 4TV9E 2WY2A 2BKNA 1YQ4A 4HKAA 4H9QC 2BVLA 3RIFA 1BR0A 3C98B 1VCSA 5LGNB 1J5ET 5FXZA 3ZN0B 3SOLA 3KVAA 3N9MA 4U7YA 4HWCA 2KINB 2D2SA 1Y01A 1CHUA 4OYJA 3NKZA 3CKDA 4DR2T 5FYMA 4JLEA 1T8BA 4JI1T 5AQKB 2BG9C 3ZCJA 2IDOB 1IAPA 2A2FX 2XM2A 2H7OA 3EAMA 3AE7A 2FBWA 4O4JE 3R6NA 2F4VT 5AQJB 2CM0A 2X9HA 5LG3A 3X1DA 5LJMA 4TNWA 4UEMA 3KFWX 4EZHA 2XQ8A 2V5DA 3AA1B 4X20E 4HFCA 3UU5A 1HG5A 3I1AA 4HGAA 3UT5E 1MIWA 2EHOD 2V7IA 2YKSA 2SPCA 4KP3C 4HWHA 4CQIA 4X64T 2VQET 4LF7T 3RX6A 2PG8A 4YJ2E 3AEAA 3VHLA 4K0KT 2KXPB 1MMDA 4DV0T 2EHOB 1UCUA 1FMVA 3UQ7A 4HWDA 4U72A 5TAOA 2UU9T 3AEFA 3PDYA 2V5CA 1KFYA 3JC6C 5AQIB 4UVBB 2BG9B 2WAUA 1O3XA 1XNQT 1XDOA 5A1LA 1HCIA 5EK2A 3HKDE 4ZEYA 4CXYA 2WB5A 3Q5EA 3JAEA 1HF8A 2DWKA 4UV8B 4QWNB 3MACA 2LSKA 4O2AE 3AXJB 5CJ5A 2MOZA 1YW0A 2E9XC 4AQYT 2VKHA 4EZ4A 2OV9A 2W62A 3D0TA 3GN5B 2MBGA 3FZHB 4O8SA 4OX9T 2JJ9A 3RYFE 3I9WA 1WYCA 4DO0A 3KV6A 5F3JA 3CX7B 3SFEA 3ZMTB 2WSSV 4TWHA 2M67A 3LBXB 2XSAA 3M3ZB 1M7KA 2CBIA 5JREA 3FZLB 5HWXA 3RRWA 3RYIE 4GKKT 2Y6XA 2V1DB 2KZ7B 4TNVA 2XHEB 2CMRA 4YHJA 1W0BA 1G8XA 1NEKA 2LOSA 4KUMB 2E9XB 4AKIA 4P0BA 3ZPOA 2X9XA 2VQFT 3UUBA 4MBQA 2CEAA 2ACXA 3NWIA 3AE4A 4F6RC 5AQVB 3BQLA 3ZC1A 3ZYMA 3T8OA 4CXXA 3ABVA 2XJ7A 2X68A 4LF6T 4DV3T 3RIUA 3F57A 5E0OA 5C2TA 2Q9QC 2J4GA 4QH5A 4TV8E 1M62A 5FXXA 1MMAA 5F8PA 2BS4A 3P50A 5J2TE 4AQGA 3E0ZA 1KK7A 4GYSA 3HL6A 3AE3A 3IBPA 5HAXA 1X79A 1HTJF 2HN1A 2NW9A 3AE5A 2WMNA 2WCAA 3PUQA 4WNKA 3N9QA 1E1HB 4X1IE 3AEDA 2YOEA 4P1NA 3VR9A 1KNPA 3RGLA 4GKJT 5HXEA 2DLRA 4IDQA 4OHFA 3ONJA 1HFAA 1OEDC 2UXBT 2YINA 3GMIA 4O4HE 5L3CB 5HEHA 2XAQB 3E08A 3H37A 2WQYA 4YSZA 4UIGA 4AQFC 4HTEA 2JQ9A 3KV9A 2DI4A 4PJNA 3UFEA 2BG9E 3CX6B 2YU2A 3SS1A 3RF1A 4O2BE 5HXHA 4WBOA 2WZIA 1SHZC 2XAGB 4DV5T 4IL9A 3DP7A 5J1GA 2Q9QB 5AQQB 2H88A 2ZM0A 4HFBA 1HNZT 4L5GA 5AQPB 3UUXB 3DJBA 5FVKA 3ZLIA 3FZMB 5DQVA 3AE9A 2XQ7A 5FY0A 4ZZCA 2E8IA 3BQKA 3PU8A 4LMLA 4UELA 3AVSA 4H9NC 4L9IA 2PTFA 2BKOA 2IIUA 2CLYC 1V9DA 3ZMZB 3RLFF 1HS7A 3T1YT 1AJ3A 4DUZT 3A5XA 4H9PC 4H9SE 2VL8A 1SA0E 3KBUA 2VVNA 3VRBA 4CI1B 3VKGA 3QC9A 1OEDB 1W09A 2WZHA 2DHRA 3FBZA 4JI6T 1N32T 1WR0A 4DUYT 3WAKA 3KBTA 5JVDE 3WI3A 2DCFA 2XAJB 3O1HA 3I0QA 5FNVE 4ZI3C 1IBMT 3H3MA 5AQUB 5EZYE 4P0AA 3L8RA 2WS3A 3GWHA 3AE1A 4EB6E 2WMOA 2EHOA 3J7Yq 5DJQC 2V6YB 5ABFA 4PW8A 4G63A 5FL0A 4JI4T 4H63H 2IW5B 2J47A 2CA5A 4AKGA 3KV5A 3ZN1B 4LMJA 2W0GA 2VKOA 2W63A 4P09A 1YXRA 1MNEA 4BJNA 1SE7A 2CLYB 1IBLT 3S4UA 4EXTA 3N9OA 4CI2B 5IWAT 3JCFA 2IUBA 3ANWA 2W2UA 4U3CA 2CWYA 2V8SV 3GN5A 1UURA 3C50A 5JDGA 3N9NA 4LF9T 2UXNB 2JMKA 2NOXA 2X0YA 4LF8T 1CUNA 4NXNT 4HFEA 2BKPA 4CN6A 4DV2T 1YD8G 5AQSB 4UF0B 2A9UA 3RC8A 1XWMA 2A3DA 4OFZA 2JMHA 1ZOYA 4PAGA 4ILAA 1S94A 4JI0T 5ETWA 2VKDA 4NUVA 5KXJA 1MNDA 3LBXA 4B3MT 2ACZA 1Z0PA 2XZEA 4I4TE 5HEOA 1UX5A 3RIAA 3L3PA 5H6RB 1N34T 2ZMAA 4UXNB 2LOPA 3AE2A 2KWIB 5HXCA 3UULA 4DR4T 3F31A 3UU3A 4LF5T 1R8IA 4NPPA 5HEGA 4DR7T 2AE9A 2ZM2A 4QXBB 4EOZB 4X1KE 2OA5A 3AE6A 3MXZA 3HKCE 2CHOA 1UGOA 3PUSA 3ZEFB 3EVYA 3ZMVB 4U74A 1MIYA 2Y48B 3C4ZA 3UTKA 1N36T 2FJDA 2J62A 5AQHB 2XM1A 5JDQA 2J1DG 3MA9A 4Z90A 5EK3A 5FVLA 3EDUA 4QH4A 5HEUA 5ABGA 4ISTA 2W61A 5AQOB 5ABHA 3N9LA 5JDFA 1H7CA 3PUZF 4O4LE 3L09A 2KSRA 2LSYA 2VL0A 2HHHT 3CQXC 4DMWA 5FP3A 2W66A 2YDRA 1U5PA 4BA9A 3J9X1 2BVMA 5LGTB 1E2AA 3TLSA 2XAHB 3ZC0A 3AA7B 4EYUA 3RQUA 5AQGB 2LE8A 3NRYA 4KX6A 4Z8XA 4QX8B 2D9DA 4ZXLA 3AE8A 3K3OA 4IL4A 4YFSA 2C5JA 3HKBE 4X62T 4TN7B 1VCTA 3QB5K 4DBQA 2XQAA 4HN9A
chains in the Genus database with same CATH topology
3F57A 5JR9C 5E0OA 3FXDB 4PK6A 1BR4A 2Q9QC 5KMGP 2K9AA 4ZS3A 3ZJ2A 2PFVA 4TV8E 5FXXA 3MKDA 4XAXB 2IC6A 1MMAA 5HXRA 5F8PA 2DNXA 2VASA 4QX7B 5H6QB 3W15B 1YKHB 2W00A 2X67A 3CPZA 4AQGA 3MZKB 5J2TE 3O1IA 2WM9A 3E0ZA 4PNIA 1KK7A 2X9WA 4GYSA 4X1YE 1WYBA 4XZCA 2ES0A 3HI2A 3HL6A 4PJMA 2KT9A 3AA0B 2E9XA 3IBPA 5HAXA 3I0OA 4ZI2D 1X79A 1HTJF 5LG4A 3H3AA 3LJCA 2NW9A 5LHGB 4TX5A 5FY1A 4ANJA 1U4QA 3CVRA 5LXTE 2WMNA 4I50E 4XBFB 2N2NA 3AB3B 3PUQA 4WNKA 3N9QA 3HA4A 5KX5E 5EK2A 2EHOC 1E1HB 5FXVA 3OJAA 4X1IE 1T98A 3LFMA 5AFUL 4V1Av 3JC6D 3FXEB 5FXWA 4MHCA 3BQIA 5HXEA 2K5BB 3O1JA 3OYZA 2DLRA 4DBRA 4OHFA 2QGSA 5LGUB 1HFAA 3P7IA 1MMNA 2MTQA 3ESLA 1ZHCA 5L3FB 3O4XE 3RPUA 2YEVC 2YINA 3GMIA 4IIJE 1MIVA 2ZLYA 4O4HE 2KNDA 4WW0A 3FB2A 5L3CB 3V5SA 2XAQB 4DMVA 3E22E 3E08A 4PFPA 4ILUA 2LHNA 3H37A 3LG7A 4KBMB 4UIGA 4AQFC 4HTEA 2V7LA 4UV9B 3KV9A 5HXSA 2DI4A 4PJNA 3RC3A 4HEAA 3UFEA 2E9XD 2IAKA 4WBNE 5LHIB 4IHJE 4AI6A 2RP4A 3CX6B 2YU2A 3SS1A 3KVBA 2L8KA 2NWBA 3NZQA 2V7JA 4UVCB 4O2BE 3C4XA 4EAHA 3LK42 5C8YE 1BR2A 5HXHA 4WBOA 5JRCB 1EZ3A 1SHZC 2XAGB 3OYXA 3ZMSB 5JR9B 4GIWA 3DP7A 5J1GA 5L3DB 4QKNA 3KDSE 2Q9QB 2NP9A 2ZM0A 5IHYA 3N2GE 3PU3A 3GA8A 1IJ6A 2LJLA 3FHNA 4L5GA 3SWHA 4PJLA 3UUXB 3UUMA 3DJBA 3PTRB 3ZLIA 2LSGA 5DQVA 5JQGE 1HG2A 2N1GA 2V7KA 3QUJA 1US7B 1FEWA 5FY0A 3CWZB 2E8IA 4PK5A 2NW7A 5JDLA 1QUUA 3BQKA 5HYAA 3PU8A 1BR1A 4UELA 2ODUA 3AVSA 2HPLA 4H9NC 2V7MA 4L9IA 2LHRA 2A72A 4KMCA 2CLYC 3QK6A 1V9DA 4JEHB 3ZMZB 3TKLB 3ZYKA 2XUEA 1WR6A 5LNKA 1HS7A 1MMGA 2D0UA 3PUGA 2JPFA 1ZV4X 1AJ3A 1G73A 3A5XA 2D5UA 4H9PC 2YU1A 3PUAA 4H9SE 2VL8A 3N9PA 1SA0E 3KBUA 3KINB 3U3IA 5JRCA 1D1CA 4TV9E 2KLQA 5JR9A 4CI1B 3QC9A 3VKGA 4HKAA 2Q9QA 2B1EA 4H9QC 2DHRA 3FBZA 4PJJA 4IE5A 3ONXA 3WAKA 2BVLA 3KBTA 4QXCB 5JVDE 1BR0A 2X51A 3KV4A 3WI3A 3NRXA 3C98B 5L3EB 2DCFA 4UVAB 3R84B 4IDZA 2XAJB 1LVFA 4E7SA 1VOMA 3O1HA 3CQCB 5LGNB 3I0QA 5FNVE 4ZI3C 4OYKA 5FXZA 3BK9A 3F2EA 3ZN0B 5EZYE 3NBXX 3SOLA 4P0AA 2L3LA 2UXXB 4OK0A 3ANWB 2WWUA 3AAEB 3KVAA 4ISSA 3N9MA 5LCYA 4JEUB 5BMVE 3GWHA 2Z6EA 3RYCE 2KINB 1QSDA 2D2SA 3C64A 2G0UA 4EB6E 2WMOA 2EHOA 4OYJA 4BJMA 3J7Yq 3P8CD 2H3RA 3CKDA 5FYMA 2H7VC 5DJQC 4UF0A 2C0SA 4PW8A 4G63A 4GYRA 4JLEA 2LT3A 3C4WA 5JDHA 4H63H 5HWYA 2PBIA 3ETVA 2C5KT 2IW5B 2NW8A 4H63V 2CA5A 4PFOA 3ZCJA 4AKGA 3KV5A 4FI5A 1IAPA 4H9OC 3ZN1B 2W0GA 3Q2MA 2VKOA 3M65A 2Q9QD 3IF8B 3VU7H 4AKRB 2A2FX 2W63A 4L0RA 3IEEA 4P09A 4AKLA 3MK7C 5JH7E 1MNEA 1ZKEA 4O4IE 1VRBA 2H7OA 1UX4A 4ZI7E 2CE7A 2DWGA 3R6NA 4O4JE 4AQFA 4BJNA 1D0XA 5LJNA 4JUYA 1FMWA 3PE0A 3Q9DA 2CLYB 3ZYLA 2CM0A 1OWAA 2X9HA 5LJMA 5CA0E 3S4UA 2C5IT 4MFRA 4B6XA 3N9OA 4UEMA 4CI2B 4EXTA 3KFWX 3ANWA 5J2UE 2N9DA 4EZHA 2LSJA 5LA6E 3AA1B 2V26A 4X20E 1HG5A 3I1AA 3CQGB 4HGAA 2CWYA 3UT5E 1MIWA 2EHOD 2L9QA 3WAJA 2V7IA 2D0TA 2BZBA 2SPCA 3GN5A 2JQQA 3C50A 4KP3C 4PK4A 4CQIA 5JDGA 3N9NA 3RX6A 2XTLA 2KMFA 2PG8A 2K48A 4QXHB 3Q5XA 2UXNB 4YJ2E 2JMKA 4ZI2C 2NOXA 4IGUA 5L2LA 3IHRA 4I43B 1CUNA 2CXLA 3VKHA 1NAFA 5FMNA 3VHLA 1B7TA 2ODVA 4IE7A 2KXPB 1Y64B 5JDMA 1MMDA 3MJXA 2NTYA 4I55E 1YD8G 4ADZA 4AKHA 2EHOB 5LP6E 1UCUA 5GONE 1FMVA 4ZS2A 3PURA 4MALA 4UF0B 5LBMA 2CXDA 3CMLA 4M1PA 4U72A 5TAOA 4ASKA 3RC8A 2A3DA 4OFZA 2JMHA 3PDYA 1ZEEA 4C90A 4PAGA 1S94A 3JC6C 3LK2B 3OBVE 4HFVA 5ETWA 3FBLA 2VKDA 4NUVA 2X66A 2CXFA 4UVBB 1MNDA 3LBXA 3AVRA 1Z0PA 2MYSA 4ERRA 5M4YA 3EDVA 2WAUA 3AAAB 1FIOA 2X9YA 3C51A 4I4TE 1O3XA 3U78A 1D0ZA 1UX5A 4E7ZA 3RYHE 2JRKA 5A1LA 2CCQA 1HCIA 3L3PA 3HKDE 3LK3B 3N2OA 4FJOA 4C91A 2BDEA 3AA6B 4HE8A 5H6RB 4CXYA 2RA1A 1YKEB 1HF8A 2ZMAA 2DWKA 3K3NA 4UXNB 5L3BB 3V5UA 4DVDA 2LOPA 3Q5WA 4UV8B 2GK9A 4QWNB 3MACA 1LRZA 2K24A 2KWIB 2LSKA 4EYYR 1LVKA 5HXCA 4O2AE 2X0LB 3UULA 4CXWA 2MOZA 3O9XA 1OXZA 3ZJ1A 1YW0A 2E9XC 3DTOA 3B57A 3F31A 5LHHB 5LBQB 5FY7A 3ETUA 4QHOA 4TZ4C 2ZM2A 2ZM8A 2VKHA 5CB4E 4QXBB 4EOZB 5LOVE 4EZ4A 4X1KE 2W62A 4YLHA 3K8PC 2OA5A 5L3GB 5JDNA 3D0TA 1D1BA 2KWHA 3GN5B 3MXZA 4MLKA 3HKCE 4EIWA 2YK0A 3PUSA 3ZEFB 3EVYA 2PJQA 4U74A 3ZCIA 3RH3A 3ZMVB 1MIYA 2Y48B 2MBGA 4O8SA 3C4ZA 5DABA 1D0YA 1HX8A 2JJ9A 3UTKA 2LM9A 5CA1E 3RYFE 4GOUA 3I9WA 3K3QC 3EUHA 1WYCA 5JDQA 4DO0A 2J1DG 3KV6A 3MA9A 4J2CA 4NUUA 2LEHA 4IE4A 5F3JA 5EK3A 3CX7B 3ZMTB 3EDUA 5EK4A 2WSSV 4ISTA 4G2AA 1LKXA 2W61A 3UUNA 4H9RC 4YJ3E 2M67A 4GK0E 3RRCA 2VB6A 3N9LA 5JDFA 3LBXB 1D1AA 3N2KE 2HPJA 4BAYB 1H7CA 2XASB 4ZI3D 4N78D 4O4LE 3L09A 3HR0A 4DNDA 5JREA 5HWXA 2LSYA 3ZMUB 3OKQA 1IZNB 2I59A 3RRWA 5DQWA 3RYIE 1IJ5A 5LYJE 2Y6XA 3CX8B 2V1DB 3I9YA 2NTXA 3SRZA 2Y8DA 4A56A 2KZ7B 4IE0A 2P9BA 3CQXC 2XHEB 4AXPA 4DMWA 3NZPA 2CMRA 5FP3A 4YHJA 1U5PA 4BA9A 3J9X1 1G8XA 1NWMX 2BVMA 4ZOLE 4TUYE 5LGTB 3RKOA 2XAHB 2QA7A 2LOSA 4KUMB 2E9XB 3ZC0A 1WRDA 2VKJA 3AA7B 4P0BA 4EYUA 4AKIA 3B13A 3ZPOA 2LE8A 3N5LA 2X9XA 3AAIA 4MBQA 3NRYA 2CEAA 4Z8XA 1S35A 2CWOA 4QX8B 2ACXA 5KDMC 1KNZA 1WLXA 2HH7A 3K3OA 5ADXL 2IC9A 2XQYA 4GK5E 4IE6A 4YFSA 4F6RC 2C5JA 2VWAA 2WBLA 3BQLA 4CZZB 3HKBE 3ZC1A 3ZYMA 4ZHQE 3T8OA 4TN7B 2LSIA 4K0UA 2XAFB 3HKEE 2VK9A 4CI3B 4CXXA 4DBQA 5IYZE 2X68A 4HN9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DWG A;  3CWZ B;  2CXL A;  2DWK A;  2CXF A;  4GIW A; 
#chains in the Genus database with same CATH topology
 4PK6 A;  1BR4 A;  5KMG P;  1HX1 B;  2ZM6 T;  2PFV A;  2CRB A;  3MKD A;  4XAX B;  4QX7 B;  5H6Q B;  1YKH B;  3ZT5 A;  2X67 A;  2WM9 A;  2B76 A;  4XZC A;  4B3R T;  2ES0 A;  3HI2 A;  4PJM A;  2BS3 A;  2KT9 A;  3AA0 B;  4LFB T;  3H3A A;  5LHG B;  1U4Q A;  3AB3 B;  2JQK A;  4X66 T;  4IDP A;  3OJA A;  3LFM A;  1XMQ T;  3JC6 D;  4DBR A;  2MTQ A;  3PUX F;  2I6H A;  2UUA T;  3V5S A;  4PFP A;  2CPT A;  4KBM B;  2X0H A;  3ZSS A;  3PUW F;  3B5M A;  2E9X D;  2IAK A;  4WBN E;  4AI6 A;  5AQL B;  4UVC B;  2V7J A;  3C4X A;  5C8Y E;  3AEC A;  1BR2 A;  1IBK T;  5JRC B;  3UU4 A;  1UUS A;  4DV7 T;  4HWI B;  2NP9 A;  3UFG A;  2UUB T;  3FZF B;  3PU3 A;  1IJ6 A;  2LJL A;  2V6X A;  3UUM A;  2W67 A;  5JQG E;  2N1G A;  2NW7 A;  1QUU A;  2FJA A;  5HYA A;  3PJA J;  2ODU A;  2LHR A;  4IDO A;  2XQ4 A;  5LB7 B;  3ZYK A;  3TKL B;  2UUC T;  2I0M A;  4B3T T;  2YU1 A;  5HCJ A;  3KIN B;  2KLQ A;  2MPK A;  5JR9 A;  1X9B A;  2XPK A;  4QXC B;  3NRX A;  5L3E B;  4UVA B;  3R84 B;  1VOM A;  3CQC B;  3G06 A;  3IA3 A;  1XDP A;  2UXX B;  4OK0 A;  2CHN A;  3ONL C;  2CBJ A;  3AAE B;  4JEU B;  2Z6E A;  3RYC E;  1KF6 A;  1QSD A;  3C64 A;  2G0U A;  2BS2 A;  4BJM A;  3P8C D;  2H3R A;  2H7V C;  4UF0 A;  2C0S A;  4GYR A;  2LT3 A;  3TLV A;  3C4W A;  2PBI A;  2C5K T;  2NW8 A;  1FJG T;  4H9O C;  4DV6 T;  3VU7 H;  2Q9Q D;  3IF8 B;  3IEE A;  4AKL A;  5JH7 E;  1ZKE A;  4O4I E;  4TWD A;  4JI5 T;  2CE7 A;  2DWG A;  5LJN A;  1FMW A;  3PE0 A;  3Q9D A;  2C5I T;  4JI3 T;  4MFR A;  4B6X A;  5J2U E;  2N9D A;  2LSJ A;  4JV5 T;  2V26 A;  2XSB A;  2BZB A;  3JAD A;  4PK4 A;  3CK6 A;  5AQR B;  4QXH B;  3SFD A;  4ZI2 C;  4IGU A;  5L2L A;  2WDR A;  3IHR A;  3VKH A;  2CXL A;  2ODV A;  1I6Z A;  5JDM A;  3VR8 A;  1KNR A;  3MJX A;  2NTY A;  4AKH A;  4ADZ A;  5GON E;  4ZS2 A;  3PUR A;  5LBM A;  2CXD A;  4M1P A;  2LRL A;  4ASK A;  4EGW A;  1ZEE A;  4C90 A;  2IHR 1;  4LFC T;  1JNR A;  2WWV A;  4HFV A;  2WU2 A;  2X66 A;  1HNW T;  3AVR A;  2MYS A;  4ERR A;  5M4Y A;  3EDV A;  3RIU C;  2X9Y A;  1D0Z A;  3RYH E;  2CCQ A;  5CFB A;  3LK3 B;  4FJO A;  2XQ5 A;  3AA6 B;  4HE8 A;  2RA1 A;  4DV4 T;  1YKE B;  5L3B B;  2GK9 A;  4EYY R;  2X0L B;  4CXW A;  3O9X A;  3B57 A;  5LHH B;  4B3S T;  5FY7 A;  3ETU A;  4UR9 A;  5CB4 E;  5LOV E;  4YLH A;  5L3G B;  5JDN A;  1ZP0 A;  1D1B A;  2HN2 A;  5F5W A;  4EIW A;  2PJQ A;  3RH3 A;  1YQ3 A;  2QVA A;  5DAB A;  5CGM A;  5CA1 E;  4ILC A;  3AEE A;  3Q5D A;  2BG9 A;  3EAB A;  4J2C A;  4NUU A;  2LEH A;  4IE4 A;  4HFH A;  4YY3 T;  2XQ9 A;  2VVS A;  5AQF B;  4G2A A;  1LKX A;  4H9R C;  4Z91 A;  4GK0 E;  1DU2 A;  1D1A A;  3AXJ A;  2HPJ A;  4ZI3 D;  4N78 D;  3ZST A;  4EV6 A;  4A98 A;  3HR0 A;  3ZMU B;  3OKQ A;  1IZN B;  2I59 A;  3P4R A;  3CX8 B;  3TLW A;  2P9B A;  4AXP A;  2XQ6 A;  4TUY E;  5IUX A;  1UK5 A;  4NIQ A;  2QA7 A;  1HR0 T;  4YXD A;  3NVO A;  1WRD A;  3N5L A;  2OLT A;  1S35 A;  2CWO A;  5KDM C;  1KNZ A;  5BR8 T;  1WLX A;  2RPA A;  1T7S A;  4DR3 T;  4IT4 A;  2VWA A;  4ZHQ E;  2LSI A;  4K0U A;  3HKE E;  2VK9 A;  4CI3 B;  5IYZ E;  4A5X A;  1NEN A;  2K9A A;  1WCR A;  2IC6 A;  4IDN A;  3W15 B;  3CPZ A;  4F8H A;  3UQ4 A;  3O1I A;  1Z8U A;  4X1Y E;  4JI2 T;  3T1H T;  2E9X A;  5LG4 A;  3PJA A;  4JI7 T;  4ANJ A;  3CVR A;  3HA4 A;  2EHO C;  4U7I A;  5FXV A;  4V1A v;  3OYZ A;  5LGU B;  1MMN A;  5LMN T;  3ESL A;  1ZHC A;  5L3F B;  4U2Z A;  2MAW A;  4IIJ E;  3JAF A;  2KND A;  3FB2 A;  4X65 T;  4DMV A;  2V7L A;  4WYV A;  3RC3 A;  4HEA A;  5LHI B;  1OED E;  4IHJ E;  2L8K A;  4AIU A;  1EZ3 A;  3ZMS B;  4GIW A;  3KDS E;  1L0V A;  4KHP T;  2QYW A;  3GA8 A;  3FHN A;  5J0Z A;  4YT0 A;  1J1J A;  3SWH A;  4PJL A;  3FZK B;  1HG2 A;  2XQ3 A;  1US7 B;  1BR1 A;  3PUV F;  2WU5 A;  4HFD A;  3QK6 A;  5ABF B;  1WR6 A;  1MMG A;  3PUG A;  2D5U A;  4YSY A;  3N9P A;  4EEB A;  5AQM B;  5HCM A;  2Q9Q A;  2B1E A;  2BBH A;  3OPC A;  4PJJ A;  4IE5 A;  3ONX A;  4A97 A;  2X51 A;  3KV4 A;  2WP9 A;  4IDZ A;  4E7S A;  1LVF A;  3UU8 A;  3RKG A;  4OYK A;  3BK9 A;  3F2E A;  3NBX X;  4YTM A;  1XMO T;  2L3L A;  3ANW B;  2WWU A;  5ABE A;  4ISS A;  3TLU A;  5LCY A;  5BMV E;  3OVU A;  3PUY F;  3RQW A;  5JDH A;  5HWY A;  4DR5 T;  3ETV A;  4CN1 A;  4H63 V;  4PFO A;  4FI5 A;  3P4W A;  2LRK A;  3Q2M A;  1OED A;  2W4X A;  3M65 A;  4AKR B;  4DR6 T;  4L0R A;  2E5V A;  3MK7 C;  1VRB A;  1UX4 A;  4ZI7 E;  4AQF A;  1D0X A;  4JUY A;  2K3W A;  2NR4 A;  3ZYL A;  1OWA A;  3LSV A;  5CA0 E;  3UU6 A;  2R6G F;  4CN4 A;  5LA6 E;  2M6B A;  2E5L T;  4U2Y A;  3CQG B;  4KI0 F;  2L9Q A;  3WAJ A;  2D0T A;  2V6Y A;  2JQQ A;  2XTL A;  2LKH A;  2KMF A;  2K48 A;  3Q5X A;  4DR1 T;  4I43 B;  1NAF A;  5FMN A;  1B7T A;  4IE7 A;  1SUM B;  1Y64 B;  4YSX A;  3PV0 F;  4YTN A;  4I55 E;  5LP6 E;  4MAL A;  3CML A;  4X5T A;  3P4P A;  3RI5 A;  4YHH T;  3LK2 B;  3OBV E;  3FBL A;  2CXF A;  3QB5 A;  3AAA B;  2VUR A;  1FIO A;  1WFD A;  3C51 A;  3U78 A;  4E7Z A;  2JRK A;  4C91 A;  3N2O A;  2BDE A;  4AIS A;  1KEY A;  1I94 T;  3K3N A;  3QOF A;  3K1S A;  3V5U A;  2M6I A;  4DVD A;  3Q5W A;  1LRZ A;  2K24 A;  1LVK A;  1OXZ A;  3ZJ1 A;  3DTO A;  4EED A;  5LBQ B;  5L47 A;  3L39 A;  2LLY A;  4QHO A;  4TZ4 C;  2ZM8 A;  3K8P C;  3P4Q A;  4MLK A;  2KWH A;  5HEJ A;  4LFA T;  2YK0 A;  3ZCI A;  4QH1 A;  1D0Y A;  1W9R A;  3AEG A;  1HX8 A;  1HNX T;  2LM9 A;  4WZX A;  4GOU A;  3VRA A;  3K3Q C;  3EUH A;  1QLB A;  5EK4 A;  3UUN A;  4YJ3 E;  3RRC A;  2VB6 A;  3N2K E;  2BBJ A;  4BAY B;  2XAS B;  4DND A;  3EHZ A;  3LDQ B;  2WDQ A;  1GQE A;  2FJB A;  5DQW A;  1IJ5 A;  5LYJ E;  4LMK A;  3I9Y A;  2NTX A;  3SRZ A;  2Y8D A;  4A56 A;  4IE0 A;  2IML A;  3NZP A;  3RHW A;  4ZOL E;  1NWM X;  4I0U A;  5AQT B;  3RKO A;  4JBW F;  5L4H A;  2H89 A;  2VKJ A;  3B13 A;  2UXD T;  3AAI A;  2JQH A;  4YTP A;  4U33 A;  2HH7 A;  3P4S A;  5ADX L;  2IC9 A;  2XQY A;  4GK5 E;  4IE6 A;  4NXM T;  2XY8 B;  2WBL A;  4CZZ B;  2YN6 A;  1XNR T;  2XAF B;  4TWF A;  5JR9 C;  1E7P A;  2QRX A;  3FXD B;  2E2A A;  4ZS3 A;  3ZJ2 A;  2AXD S;  3EI0 A;  5HXR A;  2DNX A;  2VAS A;  3TLT A;  2W00 A;  3A8Y C;  3MZK B;  4PNI A;  2X9W A;  1WYB A;  4DV1 T;  4ZI2 D;  3I0O A;  5FKY A;  4ILB A;  3LJC A;  1W0A A;  4TX5 A;  5FY1 A;  5LXT E;  4I50 E;  4XBF B;  2N2N A;  3QNU A;  5KX5 E;  1T98 A;  5AFU L;  4DID B;  1XZY A;  1JNZ A;  3AEB A;  3FXE B;  5FXW A;  4MHC A;  3BQI A;  2DL1 A;  2K5B B;  3O1J A;  2YDS A;  5AQN B;  2QGS A;  3P7I A;  3OTO T;  3O4X E;  2FJE A;  3RPU A;  2YEV C;  1MIV A;  2ZLY A;  4WW0 A;  3E22 E;  3A7M A;  3CIR A;  4ILU A;  2LHN A;  3LG7 A;  2FUP A;  3ZT6 A;  1N33 T;  4UV9 B;  5HXS A;  2RP4 A;  3KVB A;  4HFI A;  2NWB A;  3NZQ A;  4EAH A;  3LK4 2;  5C3J A;  2WDV A;  2JIW A;  2LM2 A;  3OYX A;  5JR9 B;  4LF4 T;  2UXC T;  4U31 A;  5L3D B;  4QKN A;  2LKG A;  5LMU T;  5IHY A;  3N2G E;  4Q25 A;  5FL1 A;  4ZZB A;  4HWF A;  3PTR B;  4COF A;  4IRE A;  2LSG A;  5JTG A;  2V7K A;  1T72 A;  3QUJ A;  1FEW A;  3CWZ B;  4PK5 A;  5JDL A;  1J5W A;  4JYA T;  2HPL A;  2V7M A;  3ZKR A;  4KHZ F;  2A72 A;  4KMC A;  4JEH B;  2YDQ A;  2XUE A;  5LNK A;  5L4E A;  2D0U A;  3ZT7 A;  2JPF A;  1ZV4 X;  4JI8 T;  1G73 A;  3PUA A;  3U3I A;  5JRC A;  1D1C A;  4TV9 E;  2WY2 A;  2BKN A;  1YQ4 A;  4HKA A;  4H9Q C;  2BVL A;  3RIF A;  1BR0 A;  3C98 B;  1VCS A;  5LGN B;  1J5E T;  5FXZ A;  3ZN0 B;  3SOL A;  3KVA A;  3N9M A;  4U7Y A;  4HWC A;  2KIN B;  2D2S A;  1Y01 A;  1CHU A;  4OYJ A;  3NKZ A;  3CKD A;  4DR2 T;  5FYM A;  4JLE A;  1T8B A;  4JI1 T;  5AQK B;  2BG9 C;  3ZCJ A;  2IDO B;  1IAP A;  2A2F X;  2XM2 A;  2H7O A;  3EAM A;  3AE7 A;  2FBW A;  4O4J E;  3R6N A;  2F4V T;  5AQJ B;  2CM0 A;  2X9H A;  5LG3 A;  3X1D A;  5LJM A;  4TNW A;  4UEM A;  3KFW X;  4EZH A;  2XQ8 A;  2V5D A;  3AA1 B;  4X20 E;  4HFC A;  3UU5 A;  1HG5 A;  3I1A A;  4HGA A;  3UT5 E;  1MIW A;  2EHO D;  2V7I A;  2YKS A;  2SPC A;  4KP3 C;  4HWH A;  4CQI A;  4X64 T;  2VQE T;  4LF7 T;  3RX6 A;  2PG8 A;  4YJ2 E;  3AEA A;  3VHL A;  4K0K T;  2KXP B;  1MMD A;  4DV0 T;  2EHO B;  1UCU A;  1FMV A;  3UQ7 A;  4HWD A;  4U72 A;  5TAO A;  2UU9 T;  3AEF A;  3PDY A;  2V5C A;  1KFY A;  3JC6 C;  5AQI B;  4UVB B;  2BG9 B;  2WAU A;  1O3X A;  1XNQ T;  1XDO A;  5A1L A;  1HCI A;  5EK2 A;  3HKD E;  4ZEY A;  4CXY A;  2WB5 A;  3Q5E A;  3JAE A;  1HF8 A;  2DWK A;  4UV8 B;  4QWN B;  3MAC A;  2LSK A;  4O2A E;  3AXJ B;  5CJ5 A;  2MOZ A;  1YW0 A;  2E9X C;  4AQY T;  2VKH A;  4EZ4 A;  2OV9 A;  2W62 A;  3D0T A;  3GN5 B;  2MBG A;  3FZH B;  4O8S A;  4OX9 T;  2JJ9 A;  3RYF E;  3I9W A;  1WYC A;  4DO0 A;  3KV6 A;  5F3J A;  3CX7 B;  3SFE A;  3ZMT B;  2WSS V;  4TWH A;  2M67 A;  3LBX B;  2XSA A;  3M3Z B;  1M7K A;  2CBI A;  5JRE A;  3FZL B;  5HWX A;  3RRW A;  3RYI E;  4GKK T;  2Y6X A;  2V1D B;  2KZ7 B;  4TNV A;  2XHE B;  2CMR A;  4YHJ A;  1W0B A;  1G8X A;  1NEK A;  2LOS A;  4KUM B;  2E9X B;  4AKI A;  4P0B A;  3ZPO A;  2X9X A;  2VQF T;  3UUB A;  4MBQ A;  2CEA A;  2ACX A;  3NWI A;  3AE4 A;  4F6R C;  5AQV B;  3BQL A;  3ZC1 A;  3ZYM A;  3T8O A;  4CXX A;  3ABV A;  2XJ7 A;  2X68 A;  4LF6 T;  4DV3 T;  3RIU A;  3F57 A;  5E0O A;  5C2T A;  2Q9Q C;  2J4G A;  4QH5 A;  4TV8 E;  1M62 A;  5FXX A;  1MMA A;  5F8P A;  2BS4 A;  3P50 A;  5J2T E;  4AQG A;  3E0Z A;  1KK7 A;  4GYS A;  3HL6 A;  3AE3 A;  3IBP A;  5HAX A;  1X79 A;  1HTJ F;  2HN1 A;  2NW9 A;  3AE5 A;  2WMN A;  2WCA A;  3PUQ A;  4WNK A;  3N9Q A;  1E1H B;  4X1I E;  3AED A;  2YOE A;  4P1N A;  3VR9 A;  1KNP A;  3RGL A;  4GKJ T;  5HXE A;  2DLR A;  4IDQ A;  4OHF A;  3ONJ A;  1HFA A;  1OED C;  2UXB T;  2YIN A;  3GMI A;  4O4H E;  5L3C B;  5HEH A;  2XAQ B;  3E08 A;  3H37 A;  2WQY A;  4YSZ A;  4UIG A;  4AQF C;  4HTE A;  2JQ9 A;  3KV9 A;  2DI4 A;  4PJN A;  3UFE A;  2BG9 E;  3CX6 B;  2YU2 A;  3SS1 A;  3RF1 A;  4O2B E;  5HXH A;  4WBO A;  2WZI A;  1SHZ C;  2XAG B;  4DV5 T;  4IL9 A;  3DP7 A;  5J1G A;  2Q9Q B;  5AQQ B;  2H88 A;  2ZM0 A;  4HFB A;  1HNZ T;  4L5G A;  5AQP B;  3UUX B;  3DJB A;  5FVK A;  3ZLI A;  3FZM B;  5DQV A;  3AE9 A;  2XQ7 A;  5FY0 A;  4ZZC A;  2E8I A;  3BQK A;  3PU8 A;  4LML A;  4UEL A;  3AVS A;  4H9N C;  4L9I A;  2PTF A;  2BKO A;  2IIU A;  2CLY C;  1V9D A;  3ZMZ B;  3RLF F;  1HS7 A;  3T1Y T;  1AJ3 A;  4DUZ T;  3A5X A;  4H9P C;  4H9S E;  2VL8 A;  1SA0 E;  3KBU A;  2VVN A;  3VRB A;  4CI1 B;  3VKG A;  3QC9 A;  1OED B;  1W09 A;  2WZH A;  2DHR A;  3FBZ A;  4JI6 T;  1N32 T;  1WR0 A;  4DUY T;  3WAK A;  3KBT A;  5JVD E;  3WI3 A;  2DCF A;  2XAJ B;  3O1H A;  3I0Q A;  5FNV E;  4ZI3 C;  1IBM T;  3H3M A;  5AQU B;  5EZY E;  4P0A A;  3L8R A;  2WS3 A;  3GWH A;  3AE1 A;  4EB6 E;  2WMO A;  2EHO A;  3J7Y q;  5DJQ C;  2V6Y B;  5ABF A;  4PW8 A;  4G63 A;  5FL0 A;  4JI4 T;  4H63 H;  2IW5 B;  2J47 A;  2CA5 A;  4AKG A;  3KV5 A;  3ZN1 B;  4LMJ A;  2W0G A;  2VKO A;  2W63 A;  4P09 A;  1YXR A;  1MNE A;  4BJN A;  1SE7 A;  2CLY B;  1IBL T;  3S4U A;  4EXT A;  3N9O A;  4CI2 B;  5IWA T;  3JCF A;  2IUB A;  3ANW A;  2W2U A;  4U3C A;  2CWY A;  2V8S V;  3GN5 A;  1UUR A;  3C50 A;  5JDG A;  3N9N A;  4LF9 T;  2UXN B;  2JMK A;  2NOX A;  2X0Y A;  4LF8 T;  1CUN A;  4NXN T;  4HFE A;  2BKP A;  4CN6 A;  4DV2 T;  1YD8 G;  5AQS B;  4UF0 B;  2A9U A;  3RC8 A;  1XWM A;  2A3D A;  4OFZ A;  2JMH A;  1ZOY A;  4PAG A;  4ILA A;  1S94 A;  4JI0 T;  5ETW A;  2VKD A;  4NUV A;  5KXJ A;  1MND A;  3LBX A;  4B3M T;  2ACZ A;  1Z0P A;  2XZE A;  4I4T E;  5HEO A;  1UX5 A;  3RIA A;  3L3P A;  5H6R B;  1N34 T;  2ZMA A;  4UXN B;  2LOP A;  3AE2 A;  2KWI B;  5HXC A;  3UUL A;  4DR4 T;  3F31 A;  3UU3 A;  4LF5 T;  1R8I A;  4NPP A;  5HEG A;  4DR7 T;  2AE9 A;  2ZM2 A;  4QXB B;  4EOZ B;  4X1K E;  2OA5 A;  3AE6 A;  3MXZ A;  3HKC E;  2CHO A;  1UGO A;  3PUS A;  3ZEF B;  3EVY A;  3ZMV B;  4U74 A;  1MIY A;  2Y48 B;  3C4Z A;  3UTK A;  1N36 T;  2FJD A;  2J62 A;  5AQH B;  2XM1 A;  5JDQ A;  2J1D G;  3MA9 A;  4Z90 A;  5EK3 A;  5FVL A;  3EDU A;  4QH4 A;  5HEU A;  5ABG A;  4IST A;  2W61 A;  5AQO B;  5ABH A;  3N9L A;  5JDF A;  1H7C A;  3PUZ F;  4O4L E;  3L09 A;  2KSR A;  2LSY A;  2VL0 A;  2HHH T;  3CQX C;  4DMW A;  5FP3 A;  2W66 A;  2YDR A;  1U5P A;  4BA9 A;  3J9X 1;  2BVM A;  5LGT B;  1E2A A;  3TLS A;  2XAH B;  3ZC0 A;  3AA7 B;  4EYU A;  3RQU A;  5AQG B;  2LE8 A;  3NRY A;  4KX6 A;  4Z8X A;  4QX8 B;  2D9D A;  4ZXL A;  3AE8 A;  3K3O A;  4IL4 A;  4YFS A;  2C5J A;  3HKB E;  4X62 T;  4TN7 B;  1VCT A;  3QB5 K;  4DBQ A;  2XQA A;  4HN9 A; 
#chains in the Genus database with same CATH homology
 3F57 A;  5JR9 C;  5E0O A;  3FXD B;  4PK6 A;  1BR4 A;  2Q9Q C;  5KMG P;  2K9A A;  4ZS3 A;  3ZJ2 A;  2PFV A;  4TV8 E;  5FXX A;  3MKD A;  4XAX B;  2IC6 A;  1MMA A;  5HXR A;  5F8P A;  2DNX A;  2VAS A;  4QX7 B;  5H6Q B;  3W15 B;  1YKH B;  2W00 A;  2X67 A;  3CPZ A;  4AQG A;  3MZK B;  5J2T E;  3O1I A;  2WM9 A;  3E0Z A;  4PNI A;  1KK7 A;  2X9W A;  4GYS A;  4X1Y E;  1WYB A;  4XZC A;  2ES0 A;  3HI2 A;  3HL6 A;  4PJM A;  2KT9 A;  3AA0 B;  2E9X A;  3IBP A;  5HAX A;  3I0O A;  4ZI2 D;  1X79 A;  1HTJ F;  5LG4 A;  3H3A A;  3LJC A;  2NW9 A;  5LHG B;  4TX5 A;  5FY1 A;  4ANJ A;  1U4Q A;  3CVR A;  5LXT E;  2WMN A;  4I50 E;  4XBF B;  2N2N A;  3AB3 B;  3PUQ A;  4WNK A;  3N9Q A;  3HA4 A;  5KX5 E;  5EK2 A;  2EHO C;  1E1H B;  5FXV A;  3OJA A;  4X1I E;  1T98 A;  3LFM A;  5AFU L;  4V1A v;  3JC6 D;  3FXE B;  5FXW A;  4MHC A;  3BQI A;  5HXE A;  2K5B B;  3O1J A;  3OYZ A;  2DLR A;  4DBR A;  4OHF A;  2QGS A;  5LGU B;  1HFA A;  3P7I A;  1MMN A;  2MTQ A;  3ESL A;  1ZHC A;  5L3F B;  3O4X E;  3RPU A;  2YEV C;  2YIN A;  3GMI A;  4IIJ E;  1MIV A;  2ZLY A;  4O4H E;  2KND A;  4WW0 A;  3FB2 A;  5L3C B;  3V5S A;  2XAQ B;  4DMV A;  3E22 E;  3E08 A;  4PFP A;  4ILU A;  2LHN A;  3H37 A;  3LG7 A;  4KBM B;  4UIG A;  4AQF C;  4HTE A;  2V7L A;  4UV9 B;  3KV9 A;  5HXS A;  2DI4 A;  4PJN A;  3RC3 A;  4HEA A;  3UFE A;  2E9X D;  2IAK A;  4WBN E;  5LHI B;  4IHJ E;  4AI6 A;  2RP4 A;  3CX6 B;  2YU2 A;  3SS1 A;  3KVB A;  2L8K A;  2NWB A;  3NZQ A;  2V7J A;  4UVC B;  4O2B E;  3C4X A;  4EAH A;  3LK4 2;  5C8Y E;  1BR2 A;  5HXH A;  4WBO A;  5JRC B;  1EZ3 A;  1SHZ C;  2XAG B;  3OYX A;  3ZMS B;  5JR9 B;  4GIW A;  3DP7 A;  5J1G A;  5L3D B;  4QKN A;  3KDS E;  2Q9Q B;  2NP9 A;  2ZM0 A;  5IHY A;  3N2G E;  3PU3 A;  3GA8 A;  1IJ6 A;  2LJL A;  3FHN A;  4L5G A;  3SWH A;  4PJL A;  3UUX B;  3UUM A;  3DJB A;  3PTR B;  3ZLI A;  2LSG A;  5DQV A;  5JQG E;  1HG2 A;  2N1G A;  2V7K A;  3QUJ A;  1US7 B;  1FEW A;  5FY0 A;  3CWZ B;  2E8I A;  4PK5 A;  2NW7 A;  5JDL A;  1QUU A;  3BQK A;  5HYA A;  3PU8 A;  1BR1 A;  4UEL A;  2ODU A;  3AVS A;  2HPL A;  4H9N C;  2V7M A;  4L9I A;  2LHR A;  2A72 A;  4KMC A;  2CLY C;  3QK6 A;  1V9D A;  4JEH B;  3ZMZ B;  3TKL B;  3ZYK A;  2XUE A;  1WR6 A;  5LNK A;  1HS7 A;  1MMG A;  2D0U A;  3PUG A;  2JPF A;  1ZV4 X;  1AJ3 A;  1G73 A;  3A5X A;  2D5U A;  4H9P C;  2YU1 A;  3PUA A;  4H9S E;  2VL8 A;  3N9P A;  1SA0 E;  3KBU A;  3KIN B;  3U3I A;  5JRC A;  1D1C A;  4TV9 E;  2KLQ A;  5JR9 A;  4CI1 B;  3QC9 A;  3VKG A;  4HKA A;  2Q9Q A;  2B1E A;  4H9Q C;  2DHR A;  3FBZ A;  4PJJ A;  4IE5 A;  3ONX A;  3WAK A;  2BVL A;  3KBT A;  4QXC B;  5JVD E;  1BR0 A;  2X51 A;  3KV4 A;  3WI3 A;  3NRX A;  3C98 B;  5L3E B;  2DCF A;  4UVA B;  3R84 B;  4IDZ A;  2XAJ B;  1LVF A;  4E7S A;  1VOM A;  3O1H A;  3CQC B;  5LGN B;  3I0Q A;  5FNV E;  4ZI3 C;  4OYK A;  5FXZ A;  3BK9 A;  3F2E A;  3ZN0 B;  5EZY E;  3NBX X;  3SOL A;  4P0A A;  2L3L A;  2UXX B;  4OK0 A;  3ANW B;  2WWU A;  3AAE B;  3KVA A;  4ISS A;  3N9M A;  5LCY A;  4JEU B;  5BMV E;  3GWH A;  2Z6E A;  3RYC E;  2KIN B;  1QSD A;  2D2S A;  3C64 A;  2G0U A;  4EB6 E;  2WMO A;  2EHO A;  4OYJ A;  4BJM A;  3J7Y q;  3P8C D;  2H3R A;  3CKD A;  5FYM A;  2H7V C;  5DJQ C;  4UF0 A;  2C0S A;  4PW8 A;  4G63 A;  4GYR A;  4JLE A;  2LT3 A;  3C4W A;  5JDH A;  4H63 H;  5HWY A;  2PBI A;  3ETV A;  2C5K T;  2IW5 B;  2NW8 A;  4H63 V;  2CA5 A;  4PFO A;  3ZCJ A;  4AKG A;  3KV5 A;  4FI5 A;  1IAP A;  4H9O C;  3ZN1 B;  2W0G A;  3Q2M A;  2VKO A;  3M65 A;  2Q9Q D;  3IF8 B;  3VU7 H;  4AKR B;  2A2F X;  2W63 A;  4L0R A;  3IEE A;  4P09 A;  4AKL A;  3MK7 C;  5JH7 E;  1MNE A;  1ZKE A;  4O4I E;  1VRB A;  2H7O A;  1UX4 A;  4ZI7 E;  2CE7 A;  2DWG A;  3R6N A;  4O4J E;  4AQF A;  4BJN A;  1D0X A;  5LJN A;  4JUY A;  1FMW A;  3PE0 A;  3Q9D A;  2CLY B;  3ZYL A;  2CM0 A;  1OWA A;  2X9H A;  5LJM A;  5CA0 E;  3S4U A;  2C5I T;  4MFR A;  4B6X A;  3N9O A;  4UEM A;  4CI2 B;  4EXT A;  3KFW X;  3ANW A;  5J2U E;  2N9D A;  4EZH A;  2LSJ A;  5LA6 E;  3AA1 B;  2V26 A;  4X20 E;  1HG5 A;  3I1A A;  3CQG B;  4HGA A;  2CWY A;  3UT5 E;  1MIW A;  2EHO D;  2L9Q A;  3WAJ A;  2V7I A;  2D0T A;  2BZB A;  2SPC A;  3GN5 A;  2JQQ A;  3C50 A;  4KP3 C;  4PK4 A;  4CQI A;  5JDG A;  3N9N A;  3RX6 A;  2XTL A;  2KMF A;  2PG8 A;  2K48 A;  4QXH B;  3Q5X A;  2UXN B;  4YJ2 E;  2JMK A;  4ZI2 C;  2NOX A;  4IGU A;  5L2L A;  3IHR A;  4I43 B;  1CUN A;  2CXL A;  3VKH A;  1NAF A;  5FMN A;  3VHL A;  1B7T A;  2ODV A;  4IE7 A;  2KXP B;  1Y64 B;  5JDM A;  1MMD A;  3MJX A;  2NTY A;  4I55 E;  1YD8 G;  4ADZ A;  4AKH A;  2EHO B;  5LP6 E;  1UCU A;  5GON E;  1FMV A;  4ZS2 A;  3PUR A;  4MAL A;  4UF0 B;  5LBM A;  2CXD A;  3CML A;  4M1P A;  4U72 A;  5TAO A;  4ASK A;  3RC8 A;  2A3D A;  4OFZ A;  2JMH A;  3PDY A;  1ZEE A;  4C90 A;  4PAG A;  1S94 A;  3JC6 C;  3LK2 B;  3OBV E;  4HFV A;  5ETW A;  3FBL A;  2VKD A;  4NUV A;  2X66 A;  2CXF A;  4UVB B;  1MND A;  3LBX A;  3AVR A;  1Z0P A;  2MYS A;  4ERR A;  5M4Y A;  3EDV A;  2WAU A;  3AAA B;  1FIO A;  2X9Y A;  3C51 A;  4I4T E;  1O3X A;  3U78 A;  1D0Z A;  1UX5 A;  4E7Z A;  3RYH E;  2JRK A;  5A1L A;  2CCQ A;  1HCI A;  3L3P A;  3HKD E;  3LK3 B;  3N2O A;  4FJO A;  4C91 A;  2BDE A;  3AA6 B;  4HE8 A;  5H6R B;  4CXY A;  2RA1 A;  1YKE B;  1HF8 A;  2ZMA A;  2DWK A;  3K3N A;  4UXN B;  5L3B B;  3V5U A;  4DVD A;  2LOP A;  3Q5W A;  4UV8 B;  2GK9 A;  4QWN B;  3MAC A;  1LRZ A;  2K24 A;  2KWI B;  2LSK A;  4EYY R;  1LVK A;  5HXC A;  4O2A E;  2X0L B;  3UUL A;  4CXW A;  2MOZ A;  3O9X A;  1OXZ A;  3ZJ1 A;  1YW0 A;  2E9X C;  3DTO A;  3B57 A;  3F31 A;  5LHH B;  5LBQ B;  5FY7 A;  3ETU A;  4QHO A;  4TZ4 C;  2ZM2 A;  2ZM8 A;  2VKH A;  5CB4 E;  4QXB B;  4EOZ B;  5LOV E;  4EZ4 A;  4X1K E;  2W62 A;  4YLH A;  3K8P C;  2OA5 A;  5L3G B;  5JDN A;  3D0T A;  1D1B A;  2KWH A;  3GN5 B;  3MXZ A;  4MLK A;  3HKC E;  4EIW A;  2YK0 A;  3PUS A;  3ZEF B;  3EVY A;  2PJQ A;  4U74 A;  3ZCI A;  3RH3 A;  3ZMV B;  1MIY A;  2Y48 B;  2MBG A;  4O8S A;  3C4Z A;  5DAB A;  1D0Y A;  1HX8 A;  2JJ9 A;  3UTK A;  2LM9 A;  5CA1 E;  3RYF E;  4GOU A;  3I9W A;  3K3Q C;  3EUH A;  1WYC A;  5JDQ A;  4DO0 A;  2J1D G;  3KV6 A;  3MA9 A;  4J2C A;  4NUU A;  2LEH A;  4IE4 A;  5F3J A;  5EK3 A;  3CX7 B;  3ZMT B;  3EDU A;  5EK4 A;  2WSS V;  4IST A;  4G2A A;  1LKX A;  2W61 A;  3UUN A;  4H9R C;  4YJ3 E;  2M67 A;  4GK0 E;  3RRC A;  2VB6 A;  3N9L A;  5JDF A;  3LBX B;  1D1A A;  3N2K E;  2HPJ A;  4BAY B;  1H7C A;  2XAS B;  4ZI3 D;  4N78 D;  4O4L E;  3L09 A;  3HR0 A;  4DND A;  5JRE A;  5HWX A;  2LSY A;  3ZMU B;  3OKQ A;  1IZN B;  2I59 A;  3RRW A;  5DQW A;  3RYI E;  1IJ5 A;  5LYJ E;  2Y6X A;  3CX8 B;  2V1D B;  3I9Y A;  2NTX A;  3SRZ A;  2Y8D A;  4A56 A;  2KZ7 B;  4IE0 A;  2P9B A;  3CQX C;  2XHE B;  4AXP A;  4DMW A;  3NZP A;  2CMR A;  5FP3 A;  4YHJ A;  1U5P A;  4BA9 A;  3J9X 1;  1G8X A;  1NWM X;  2BVM A;  4ZOL E;  4TUY E;  5LGT B;  3RKO A;  2XAH B;  2QA7 A;  2LOS A;  4KUM B;  2E9X B;  3ZC0 A;  1WRD A;  2VKJ A;  3AA7 B;  4P0B A;  4EYU A;  4AKI A;  3B13 A;  3ZPO A;  2LE8 A;  3N5L A;  2X9X A;  3AAI A;  4MBQ A;  3NRY A;  2CEA A;  4Z8X A;  1S35 A;  2CWO A;  4QX8 B;  2ACX A;  5KDM C;  1KNZ A;  1WLX A;  2HH7 A;  3K3O A;  5ADX L;  2IC9 A;  2XQY A;  4GK5 E;  4IE6 A;  4YFS A;  4F6R C;  2C5J A;  2VWA A;  2WBL A;  3BQL A;  4CZZ B;  3HKB E;  3ZC1 A;  3ZYM A;  4ZHQ E;  3T8O A;  4TN7 B;  2LSI A;  4K0U A;  2XAF B;  3HKE E;  2VK9 A;  4CI3 B;  4CXX A;  4DBQ A;  5IYZ E;  2X68 A;  4HN9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...