3T1YT

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a human anti-codon stem loop (hasl) of transfer rna lysine 3 (trnalys3) bound to an mrna with an aag-codon in the a-site and paromomycin
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAVQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
publication title Human tRNA(Lys3)(UUU) Is Pre-Structured by Natural Modifications for Cognate and Wobble Codon Binding through Keto-Enol Tautomerism.
pubmed doi rcsb
total genus 34
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2011-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 3t1yT00
4DV2T 3T1HT 1IBMT 4LF7T 1HNZT 4OX9T 1XMQT 4AQYT 4LF6T 2HHHT 4LF4T 4DV4T 1XNRT 2UXBT 4JI6T 1HR0T 4JI4T 4DV1T 1HNXT 5LMNT 4NXMT 4JI7T 4LFAT 2ZM6T 4JI3T 4DR7T 4LFCT 1IBLT 1HNWT 4DR1T 1FJGT 2UU9T 1IBKT 4K0KT 4DR2T 2UUBT 4X64T 4JI1T 4LF8T 4DR5T 5LMUT 4JI8T 4JI0T 4X66T 4YHHT 2F4VT 2UUCT 4DUYT 2E5LT 4B3MT 4LFBT 1N32T 2VQFT 4JYAT 4JV5T 2UUAT 4KHPT 1J5ET 4JI5T 1N34T 1N36T 5IWAT 4DR6T 5BR8T 4YY3T 4DV7T 4DV6T 4X62T 3OTOT 1XNQT 4B3TT 1I94T 4DUZT 4X65T 4B3RT 4NXNT 4LF9T 4GKKT 4GKJT 4DV5T 4DR3T 3T1YT 2VQET 4DV3T 2UXCT 4DR4T 1XMOT 4B3ST 4LF5T 2UXDT 4DV0T 4JI2T 1N33T
chains in the Genus database with same CATH superfamily
4DV2T 1ZV4X 3LK3B 3F31A 2OA5A 2FBWA 3HKCE 5L3BB 3DP7A 1BR2A 3Q5XA 4YSXA 4ZHQE 4I0UA 3LK42 5ABFA 3AVRA 2VWAA 2X51A 4IT4A 3A5XA 3ZMTB 4O4IE 4AKLA 5KMGP 2LJLA 2CXLA 1UX5A 1W09A 3AE5A 5DJQC 5JRCB 3ANWB 4DR1T 2N2NA 3OJAA 4DBQA 3JAFA 4UF0B 5JREA 4EEBA 3O1HA 3KFWX 2LSJA 4IE4A 3U3IA 4A56A 4JYAT 4H9SE 1J1JA 5FL1A 4OYJA 2X0LB 5FXVA 1MMGA 3V5SA 3WAKA 3PUAA 4B3TT 4H63H 4N78D 4ZI3D 3N9NA 4EB6E 3HA4A 3E22E 2D2SA 4EOZB 4Q25A 4ERRA 3CX7B 1D1CA 5LG3A 2V6YB 3PU8A 4LF5T 4I50E 5DQWA 2JMKA 4C90A 3KBUA 3ZJ2A 3ZLIA 3RX6A 4LF7T 3B13A 3P4SA 5CJ5A 2KSRA 3P8CD 5JVDE 3VHLA 2FUPA 4PJJA 2JQHA 1WCRA 3HR0A 3H37A 4EEDA 3TLTA 2E2AA 1IAPA 2LE8A 4JI3T 4EXTA 4AIUA 2VVSA 1OEDC 2NR4A 2BKPA 4GIWA 4IE5A 3NRXA 5AQSB 4JUYA 1MNDA 4TUYE 1SUMB 3VU7H 1WFDA 1HX8A 2UUCT 4FJOA 2Q9QB 5L3CB 2LSYA 4CXWA 3ONLC 5FXZA 2G0UA 2C0SA 3ZT6A 4GYSA 2CBJA 2CE7A 1NEKA 2NTYA 5FYMA 2NW9A 4HEAA 5L47A 2XAJB 2D0TA 1KF6A 4QXCB 3RIAA 4DIDB 3VKGA 2X9XA 1X79A 1ZHCA 4U7IA 2WDQA 2H7OA 2IMLA 5FNVE 3EI0A 4DV3T 2V7KA 2UXCT 4EGWA 4X1KE 3KDSE 3S4UA 4TNVA 3MACA 5A1LA 4G63A 2XQ3A 2Y8DA 1U4QA 3LBXA 3O1JA 3KBTA 5LHGB 3RRCA 5JDNA 3OBVE 4JI6T 4I4TE 2IC9A 4DV1T 2KWHA 5HWYA 5C8YE 5LOVE 4JI7T 3R6NA 4TWHA 1WLXA 2Q9QD 2PFVA 4HFEA 1ZEEA 1HNWT 4PJLA 4UV8B 1XZYA 2H89A 3C98B 4ISTA 2JJ9A 1QLBA 1CHUA 4HTEA 3TLVA 4GOUA 4KI0F 4IDPA 2E5VA 3CX6B 4CI1B 5CA0E 5J0ZA 5HYAA 3AE8A 3C4ZA 4XBFB 4AXPA 2WU5A 3RLFF 1CUNA 5C2TA 4C91A 3PUQA 3AAAB 3HKDE 5FY7A 3UUBA 4X62T 4TV9E 1T98A 2VL0A 2VK9A 4O2BE 4GYRA 4IDOA 2WCAA 1SA0E 3JADA 2XASB 2LRKA 4CZZB 3RHWA 1LVKA 2K5BB 4QH4A 4Z8XA 3PJAA 2K24A 5JR9B 2XSAA 2XAQB 2HHHT 4MBQA 2BDEA 3E08A 2UXBT 1WR0A 5AQIB 1HR0T 3I9WA 2XY8B 2H3RA 3P4QA 3AE1A 1MMDA 4QWNB 3QC9A 4H9RC 4OHFA 1MMNA 5CA1E 2W66A 5AQMB 3RQWA 5BMVE 4K0KT 4IL9A 4A5XA 3ZMSB 1ZOYA 3RIUA 2P9BA 3DTOA 3KV9A 4QXBB 3UU6A 2WWVA 4DUYT 5JDHA 5IHYA 3ZMVB 2A72A 4O4LE 4PJNA 3W15B 2CXFA 5LP6E 3RIFA 2WZIA 5EZYE 5L3GB 3PUWF 5HXHA 2EHOB 5BR8T 2YU2A 3IEEA 4B3RT 3O9XA 4O2AE 3NZPA 4ZZCA 1UX4A 4KUMB 5F8PA 4GKJT 3ABVA 1I6ZA 2IUBA 2Y48B 2NTXA 3Q5DA 2JQ9A 3N2KE 4DBRA 4BAYB 3N9LA 5HCJA 5KX5E 1HX1B 1G8XA 4JI2T 3ZT7A 3AA0B 4QXHB 3ZSSA 2V7MA 4X5TA 3IF8B 2KINB 2RP4A 4ZI7E 3PU3A 4KHZF 3I9YA 2VL8A 2SPCA 3PUGA 2J1DG 3AA6B 3N9QA 4AQGA 5ADXL 2CMRA 4DMWA 2HH7A 2V8SV 4UV9B 5ETWA 2FJBA 1HG5A 2BBJA 3A8YC 4AISA 3VRBA 3QNUA 4U33A 2IHR1 4IREA 2LEHA 4IDZA 3ZYKA 1UK5A 1KNZA 1HF8A 3PURA 3K3OA 2EHOD 3LSVA 1E2AA 5AQOB 2MYSA 3Q5EA 4LMKA 3O4XE 1J5WA 4QHOA 2BG9A 4WBOA 1J5ET 2XQ5A 1YQ3A 3OKQA 4YTMA 4DV6T 3K3NA 4CN6A 3C4XA 3AEAA 1HS7A 2KXPB 3NZQA 1M62A 5HEJA 5LGTB 2KT9A 2NWBA 3QOFA 1OEDE 5JH7E 4U7YA 4KMCA 1SE7A 4WBNE 2XQ6A 2C5KT 2LKHA 5F3JA 2LHRA 2XQYA 5JTGA 2W67A 4KBMB 3CVRA 4TZ4C 2WBLA 1HNXT 5AQFB 5FVLA 4H9NC 1B7TA 3SFEA 2X0HA 4TWFA 2ZM6T 2WAUA 5FL0A 4XAXB 2KNDA 2LLYA 1FJGT 1VCSA 3KV6A 5LGUB 5AQQB 2GK9A 4YHHT 2YN6A 4ILUA 2CWYA 4O4HE 2LOPA 2A2FX 1YQ4A 2VQFT 4TX5A 3OVUA 5L3FB 3K3QC 2CEAA 3CWZB 2YDSA 2WMNA 3F2EA 4PK6A 5IWAT 4AKHA 3LDQB 3OTOT 5AQUB 4PFPA 4U31A 3C4WA 1IJ6A 2XPKA 3QB5A 4UIGA 4B6XA 3AXJB 4ISSA 4H9OC 4HFVA 2X68A 3RKGA 2L8KA 2VQET 4U72A 4YLHA 4GK0E 3N9MA 2XHEB 2A3DA 4U3CA 4WYVA 3UUXB 2QA7A 4ZOLE 3FZKB 3RC8A 4JI4T 2H7VC 2UXXB 2QYWA 4E7SA 3FBLA 2LKGA 2M6IA 3SWHA 3AAEB 4NUVA 2LHNA 2E9XA 5JDLA 2MBGA 4ZI2C 5HXSA 5HCMA 1G73A 1FMVA 2AXDS 2NP9A 4WZXA 1HCIA 4DR2T 1ZKEA 3ZT5A 4L0RA 2CA5A 3E0ZA 3PJAJ 4PK5A 1YKHB 2WDVA 4EZ4A 2YEVC 2VKJA 4U2YA 1N32T 2CXDA 3RIUC 4O8SA 3V5UA 3CQXC 2UXNB 2XSBA 3RC3A 1IJ5A 4JI5T 5LYJE 4EZHA 5AQGB 4IIJE 1I94T 1BR1A 4CI3B 3Q5WA 4GKKT 1D0YA 2W61A 3UULA 3RYHE 5HXEA 1KFYA 1DU2A 4EAHA 3HKEE 4YFSA 4DNDA 2MAWA 3NRYA 5L3DB 3AE7A 4WW0A 5KXJA 5H6QB 2W63A 3FZFB 4J2CA 1BR0A 2LSKA 2J4GA 1QSDA 2IAKA 2IIUA 3OYZA 2YDRA 5ABFB 3FZHB 2D0UA 1BR4A 3AE4A 4ZS2A 4DR7T 2ODUA 4NUUA 3N9OA 5E0OA 2DNXA 4TWDA 1LVFA 3IA3A 1D1BA 4BJMA 3C64A 3UU4A 5J1GA 2M6BA 1D0ZA 5L3EB 3FB2A 3RH3A 4X66T 2YDQA 2XQAA 4PNIA 1KK7A 4B3MT 3AE6A 3P4RA 4H63V 2ZMAA 1WYCA 3EHZA 5CGMA 1MIYA 4I55E 2DL1A 2ZM2A 1N36T 2N1GA 3I0OA 3U78A 4TV8E 4ZXLA 1W0BA 4AKRB 2K9AA 5AQJB 3KV4A 2IC6A 3GMIA 2WS3A 2DI4A 2CCQA 2BG9C 5LBMA 2MTQA 1S35A 3ZCJA 3LJCA 2PJQA 2YKSA 4DV5T 2QGSA 2WB5A 5LXTE 2W00A 1NWMX 2IW5B 3FXEB 5LA6E 2DWGA 4B3ST 1T8BA 4I43B 3AECA 3K8PC 4MALA 4DV0T 3DJBA 3CX8B 2X9HA 1XDPA 1KNPA 3C50A 5LNKA 3PUSA 5LB7B 4HFDA 3MK7C 3KVBA 2ACXA 5HXRA 4UVAB 1W0AA 3FXDB 3BQLA 2ODVA 4E7ZA 4HFIA 2AE9A 1LKXA 1S94A 1YD8G 3AA7B 5IYZE 1Z8UA 1FEWA 5JDFA 2HN2A 3L8RA 5FKYA 4P0AA 4TN7B 1QUUA 4HGAA 1AJ3A 3AAIA 2XTLA 4MHCA 5JDQA 3RKOA 4ILAA 1W9RA 2PTFA 3EABA 4YY3T 4AKGA 3AEDA 1U5PA 2BBHA 1HG2A 4M1PA 2A9UA 4IL4A 4DR3T 1SHZC 2ES0A 3JC6C 2W0GA 2XAHB 2XM1A 3HI2A 4QH5A 4H9PC 2DCFA 5FXXA 2KZ7B 2CHOA 3VKHA 3ZC1A 4ILBA 3VR9A 1O3XA 1MMAA 4YXDA 3ZKRA 4OX9T 5HAXA 1M7KA 4LF4T 3LBXB 4PK4A 2J47A 1XNRT 2M67A 1MIWA 3CQCB 5GONE 3SS1A 3ONJA 3I0QA 2LSIA 2XQ4A 3PUYF 4CXXA 5LMNT 4HFHA 3GA8A 3MKDA 4NXMT 4F8HA 2X0YA 3BQKA 3P7IA 5JRCA 3ANWA 4PW8A 2CBIA 1YXRA 2NOXA 2WZHA 3D0TA 3UTKA 4X1YE 3LG7A 4AQFA 4YJ3E 2V6XA 4HFBA 1D1AA 2E9XC 5FY1A 3ZMUB 3NBXX 2XQ8A 3N2OA 1HFAA 3MA9A 2V1DB 3ZYMA 2JQKA 3RGLA 3ONXA 4HFCA 2CLYC 3ZN0B 3I1AA 4XZCA 2L9QA 2FJEA 1OXZA 2V7IA 3EAMA 2I59A 5FMNA 2CM0A 3FBZA 3IHRA 3RI5A 1E1HB 2V6YA 3UT5E 3HKBE 5AQKB 5AQNB 3RYIE 1XMOT 4ANJA 4QX8B 2UXDT 5EK3A 1XWMA 4HWHA 2V5CA 4IE6A 1L0VA 5AQLB 3CKDA 2C5JA 5HEUA 3AE2A 2QVAA 3UFEA 4EIWA 3PV0F 2WY2A 2CPTA 4TNWA 3WI3A 2W62A 2B1EA 1R8IA 2KMFA 4LFAT 5AQTB 2PG8A 5KDMC 3M65A 4LFCT 4UELA 4JEHB 1FIOA 3P50A 1IBKT 4GK5E 4EYYR 1T7SA 5EK4A 4AI6A 4DMVA 4JI1T 3JAEA 2FJAA 3LK2B 4Z91A 2ZLYA 2Q9QA 3G06A 4P09A 4LFBT 2Y6XA 2D5UA 3CQGB 4YTPA 1N34T 2CWOA 4CQIA 3HL6A 4DV7T 3ZN1B 3TLUA 3KV5A 4YSYA 2XAGB 4H9QC 2QRXA 3T8OA 3EVYA 3ZPOA 3JCFA 3RRWA 5LGNB 3RYFE 2WQYA 3N5LA 2Z6EA 4ZI2D 2BVLA 2E8IA 3T1HT 2WDRA 4YHJA 3AEFA 3IBPA 3CPZA 1HNZT 5HEHA 2V26A 3EDVA 5JQGE 3KVAA 2JPFA 2YINA 3Q9DA 2OV9A 2LM9A 3SRZA 4OYKA 3RYCE 3AB3B 3PE0A 4KP3C 2VKDA 2BG9E 4ADZA 3EUHA 3PTRB 4HWCA 1JNZA 2K48A 2YOEA 3QB5K 4LF8T 3GN5A 2LRLA 5LMUT 5HEGA 4JI8T 2F4VT 1D0XA 3C51A 5CB4E 3ZJ1A 4MFRA 2E5LT 2BS4A 2UUAT 1MIVA 2DWKA 2CRBA 4YSZA 3N2GE 1H7CA 3PUZF 4A97A 2JMHA 2BG9B 2V7LA 3MXZA 5HEOA 3RPUA 3NVOA 3J9X1 3BQIA 3VR8A 2WP9A 3SFDA 4YT0A 5LCYA 5AQPB 2VB6A 1NENA 2DLRA 5LBQB 3F57A 4DR4T 1Y01A 3L39A 2WWUA 3UFGA 3TLSA 5JDGA 5JR9A 4ZS3A 4P0BA 4JLEA 1X9BA 4ZI3C 4X20E 4NIQA 2VASA 2ZM8A 4U2ZA 4QX7B 4HE8A 2XJ7A 2LT3A 5F5WA 2BVMA 1IBLT 4FI5A 3ZEFB 3UQ4A 2XQ7A 2UU9T 4PJMA 2UUBT 2MPKA 5FVKA 1WRDA 1Y64B 2WM9A 2BKNA 2BS3A 1EZ3A 2VURA 2WU2A 1WR6A 1HTJF 3MJXA 3M3ZB 4L9IA 4AQFC 3ZYLA 2ZM0A 5H6RB 3UUNA 1XDOA 4PAGA 5AQVB 2EHOA 2NW8A 3K1SA 2N9DA 2RA1A 3SOLA 2XAFB 4ZEYA 1IZNB 5FXWA 5LHHB 5L4EA 3T1YT 3AEBA 2OLTA 2HN1A 4UVCB 2L3LA 5AQHB 2VKOA 2X9WA 4IE7A 2K3WA 5DQVA 5IUXA 4Z90A 3X1DA 3B5MA 4KX6A 5CFBA 1XMQT 4AQYT 4LF6T 5ABEA 3PUXF 1VOMA 4QKNA 3AEGA 2XQ9A 2RPAA 3GN5B 5J2TE 3O1IA 2LOSA 4HWIB 2E9XB 5AQRB 2J62A 4HKAA 2H88A 4AKIA 1VRBA 1NAFA 1YKEB 4IDQA 1FMWA 2LSGA 3GWHA 4CN1A 2XM2A 2CLYB 5DABA 3TLWA 1UUSA 3JC6D 4JEUB 3ZC0A 5ABHA 4U74A 3FHNA 4L5GA 2Q9QC 2WMOA 4DR6T 3PDYA 4F6RC 4IGUA 3ETVA 4K0UA 1WYBA 1MNEA 3EDUA 3ETUA 3QUJA 3VRAA 3UQ7A 2VVNA 4X65T 3H3AA 4DUZT 3H3MA 4NXNT 4LF9T 4QH1A 5HWXA 2BS2A 5LG4A 2HPJA 3FZMB 3AA1B 2JIWA 4ZZBA 4OK0A 1N33T 2JQQA 1V9DA 5C3JA 3BK9A 2E9XD 4HN9A 3N9PA 5L2LA 2FJDA 5ABGA 1OEDA 1T72A 3UU8A 4CN4A 3ESLA 2BKOA 2V5DA 5FP3A 2C5IT 3P4WA 4P1NA 4A98A 5EK2A 2B76A 1KEYA 4DO0A 5J2UE 2D9DA 4JI0T 3AEEA 4DVDA 3FZLB 1UGOA 4ILCA 3UU5A 2R6GF 2I6HA 2X67A 2X9YA 5LJNA 3AE3A 2JRKA 3J7Yq 4EYUA 5FY0A 4UF0A 2XZEA 3AVSA 4WNKA 3AE9A 4BA9A 1ZP0A 4JBWF 2IDOB 5TAOA 3PUVF 3L3PA 2KLQA 4ASKA 3UU3A 5LHIB 3ZMZB 2I0MA 3AXJA 3OPCA 3KINB 3OYXA 4HWDA 3UUMA 2X66A 2LM2A 2W4XA 2XUEA 2NW7A 3NWIA 3TKLB 3ZSTA 1YW0A 4IHJE 4BJNA 3ZCIA 5LJMA 4YTNA 2YK0A 2YU1A 1IBMT 3RF1A 1UURA 1JNRA 3B57A 3CK6A 3L09A 1GQEA 4DV4T 4MLKA 5JR9C 4EV6A 1VCTA 3P4PA 4UEMA 4X1IE 4UVBB 2ACZA 5M4YA 4YJ2E 3A7MA 3LFMA 5JDMA 4G2AA 4V1Av 4X64T 2KWIB 3CIRA 4DR5T 3MZKB 5L4HA 4NPPA 5AFUL 4LMJA 2CHNA 2HPLA 4JV5T 2MOZA 4UXNB 3WAJA 1E7PA 4UR9A 1Z0PA 4KHPT 4CXYA 4IDNA 2PBIA 4PFOA 3NKZA 3R84B 3Q2MA 3RQUA 1XNQT 2BZBA 1UCUA 2WSSV 3QK6A 4CI2B 2EHOC 2DHRA 4OFZA 4LMLA 5HXCA 3CMLA 4O4JE 4COFA 1LRZA 1KNRA 2VKHA 1OEDB 2V7JA 2W2UA 4HWFA 1US7B 1OWAA 4IE0A
chains in the Genus database with same CATH topology
4DV2T 3T1HT 1IBMT 4LF7T 1HNZT 4OX9T 1XMQT 4AQYT 4LF6T 2HHHT 4LF4T 4DV4T 1XNRT 2UXBT 4JI6T 1HR0T 4JI4T 4DV1T 1HNXT 5LMNT 4NXMT 4JI7T 4LFAT 2ZM6T 4JI3T 4DR7T 4LFCT 1IBLT 1HNWT 4DR1T 1FJGT 2UU9T 1IBKT 4K0KT 4DR2T 2UUBT 4X64T 4JI1T 4LF8T 4DR5T 5LMUT 4JI8T 4JI0T 4X66T 4YHHT 2F4VT 2UUCT 4DUYT 2E5LT 4B3MT 4LFBT 1N32T 2VQFT 4JYAT 4JV5T 2UUAT 4KHPT 1J5ET 4JI5T 1N34T 1N36T 5IWAT 4DR6T 5BR8T 4YY3T 4DV7T 4DV6T 4X62T 3OTOT 1XNQT 4B3TT 1I94T 4DUZT 4X65T 4B3RT 4NXNT 4LF9T 4GKKT 4GKJT 4DV5T 4DR3T 3T1YT 2VQET 4DV3T 2UXCT 4DR4T 1XMOT 4B3ST 4LF5T 2UXDT 4DV0T 4JI2T 1N33T
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV2 T;  3T1H T;  1IBM T;  4LF7 T;  1HNZ T;  4OX9 T;  1XMQ T;  4AQY T;  4LF6 T;  2HHH T;  4LF4 T;  4DV4 T;  1XNR T;  2UXB T;  4JI6 T;  1HR0 T;  4JI4 T;  4DV1 T;  1HNX T;  5LMN T;  4NXM T;  4JI7 T;  4LFA T;  2ZM6 T;  4JI3 T;  4DR7 T;  4LFC T;  1IBL T;  1HNW T;  4DR1 T;  1FJG T;  2UU9 T;  1IBK T;  4K0K T;  4DR2 T;  2UUB T;  4X64 T;  4JI1 T;  4LF8 T;  4DR5 T;  5LMU T;  4JI8 T;  4JI0 T;  4X66 T;  4YHH T;  2F4V T;  2UUC T;  4DUY T;  2E5L T;  4B3M T;  4LFB T;  1N32 T;  2VQF T;  4JYA T;  4JV5 T;  2UUA T;  4KHP T;  1J5E T;  4JI5 T;  1N34 T;  1N36 T;  5IWA T;  4DR6 T;  5BR8 T;  4YY3 T;  4DV7 T;  4DV6 T;  4X62 T;  3OTO T;  1XNQ T;  4B3T T;  1I94 T;  4DUZ T;  4X65 T;  4B3R T;  4NXN T;  4LF9 T;  4GKK T;  4GKJ T;  4DV5 T;  4DR3 T;  3T1Y T;  2VQE T;  4DV3 T;  2UXC T;  4DR4 T;  1XMO T;  4B3S T;  4LF5 T;  2UXD T;  4DV0 T;  4JI2 T;  1N33 T; 
#chains in the Genus database with same CATH topology
 4DV2 T;  1ZV4 X;  3LK3 B;  3F31 A;  2OA5 A;  2FBW A;  3HKC E;  5L3B B;  3DP7 A;  1BR2 A;  3Q5X A;  4YSX A;  4ZHQ E;  4I0U A;  3LK4 2;  5ABF A;  3AVR A;  2VWA A;  2X51 A;  4IT4 A;  3A5X A;  3ZMT B;  4O4I E;  4AKL A;  5KMG P;  2LJL A;  2CXL A;  1UX5 A;  1W09 A;  3AE5 A;  5DJQ C;  5JRC B;  3ANW B;  4DR1 T;  2N2N A;  3OJA A;  4DBQ A;  3JAF A;  4UF0 B;  5JRE A;  4EEB A;  3O1H A;  3KFW X;  2LSJ A;  4IE4 A;  3U3I A;  4A56 A;  4JYA T;  4H9S E;  1J1J A;  5FL1 A;  4OYJ A;  2X0L B;  5FXV A;  1MMG A;  3V5S A;  3WAK A;  3PUA A;  4B3T T;  4H63 H;  4N78 D;  4ZI3 D;  3N9N A;  4EB6 E;  3HA4 A;  3E22 E;  2D2S A;  4EOZ B;  4Q25 A;  4ERR A;  3CX7 B;  1D1C A;  5LG3 A;  2V6Y B;  3PU8 A;  4LF5 T;  4I50 E;  5DQW A;  2JMK A;  4C90 A;  3KBU A;  3ZJ2 A;  3ZLI A;  3RX6 A;  4LF7 T;  3B13 A;  3P4S A;  5CJ5 A;  2KSR A;  3P8C D;  5JVD E;  3VHL A;  2FUP A;  4PJJ A;  2JQH A;  1WCR A;  3HR0 A;  3H37 A;  4EED A;  3TLT A;  2E2A A;  1IAP A;  2LE8 A;  4JI3 T;  4EXT A;  4AIU A;  2VVS A;  1OED C;  2NR4 A;  2BKP A;  4GIW A;  4IE5 A;  3NRX A;  5AQS B;  4JUY A;  1MND A;  4TUY E;  1SUM B;  3VU7 H;  1WFD A;  1HX8 A;  2UUC T;  4FJO A;  2Q9Q B;  5L3C B;  2LSY A;  4CXW A;  3ONL C;  5FXZ A;  2G0U A;  2C0S A;  3ZT6 A;  4GYS A;  2CBJ A;  2CE7 A;  1NEK A;  2NTY A;  5FYM A;  2NW9 A;  4HEA A;  5L47 A;  2XAJ B;  2D0T A;  1KF6 A;  4QXC B;  3RIA A;  4DID B;  3VKG A;  2X9X A;  1X79 A;  1ZHC A;  4U7I A;  2WDQ A;  2H7O A;  2IML A;  5FNV E;  3EI0 A;  4DV3 T;  2V7K A;  2UXC T;  4EGW A;  4X1K E;  3KDS E;  3S4U A;  4TNV A;  3MAC A;  5A1L A;  4G63 A;  2XQ3 A;  2Y8D A;  1U4Q A;  3LBX A;  3O1J A;  3KBT A;  5LHG B;  3RRC A;  5JDN A;  3OBV E;  4JI6 T;  4I4T E;  2IC9 A;  4DV1 T;  2KWH A;  5HWY A;  5C8Y E;  5LOV E;  4JI7 T;  3R6N A;  4TWH A;  1WLX A;  2Q9Q D;  2PFV A;  4HFE A;  1ZEE A;  1HNW T;  4PJL A;  4UV8 B;  1XZY A;  2H89 A;  3C98 B;  4IST A;  2JJ9 A;  1QLB A;  1CHU A;  4HTE A;  3TLV A;  4GOU A;  4KI0 F;  4IDP A;  2E5V A;  3CX6 B;  4CI1 B;  5CA0 E;  5J0Z A;  5HYA A;  3AE8 A;  3C4Z A;  4XBF B;  4AXP A;  2WU5 A;  3RLF F;  1CUN A;  5C2T A;  4C91 A;  3PUQ A;  3AAA B;  3HKD E;  5FY7 A;  3UUB A;  4X62 T;  4TV9 E;  1T98 A;  2VL0 A;  2VK9 A;  4O2B E;  4GYR A;  4IDO A;  2WCA A;  1SA0 E;  3JAD A;  2XAS B;  2LRK A;  4CZZ B;  3RHW A;  1LVK A;  2K5B B;  4QH4 A;  4Z8X A;  3PJA A;  2K24 A;  5JR9 B;  2XSA A;  2XAQ B;  2HHH T;  4MBQ A;  2BDE A;  3E08 A;  2UXB T;  1WR0 A;  5AQI B;  1HR0 T;  3I9W A;  2XY8 B;  2H3R A;  3P4Q A;  3AE1 A;  1MMD A;  4QWN B;  3QC9 A;  4H9R C;  4OHF A;  1MMN A;  5CA1 E;  2W66 A;  5AQM B;  3RQW A;  5BMV E;  4K0K T;  4IL9 A;  4A5X A;  3ZMS B;  1ZOY A;  3RIU A;  2P9B A;  3DTO A;  3KV9 A;  4QXB B;  3UU6 A;  2WWV A;  4DUY T;  5JDH A;  5IHY A;  3ZMV B;  2A72 A;  4O4L E;  4PJN A;  3W15 B;  2CXF A;  5LP6 E;  3RIF A;  2WZI A;  5EZY E;  5L3G B;  3PUW F;  5HXH A;  2EHO B;  5BR8 T;  2YU2 A;  3IEE A;  4B3R T;  3O9X A;  4O2A E;  3NZP A;  4ZZC A;  1UX4 A;  4KUM B;  5F8P A;  4GKJ T;  3ABV A;  1I6Z A;  2IUB A;  2Y48 B;  2NTX A;  3Q5D A;  2JQ9 A;  3N2K E;  4DBR A;  4BAY B;  3N9L A;  5HCJ A;  5KX5 E;  1HX1 B;  1G8X A;  4JI2 T;  3ZT7 A;  3AA0 B;  4QXH B;  3ZSS A;  2V7M A;  4X5T A;  3IF8 B;  2KIN B;  2RP4 A;  4ZI7 E;  3PU3 A;  4KHZ F;  3I9Y A;  2VL8 A;  2SPC A;  3PUG A;  2J1D G;  3AA6 B;  3N9Q A;  4AQG A;  5ADX L;  2CMR A;  4DMW A;  2HH7 A;  2V8S V;  4UV9 B;  5ETW A;  2FJB A;  1HG5 A;  2BBJ A;  3A8Y C;  4AIS A;  3VRB A;  3QNU A;  4U33 A;  2IHR 1;  4IRE A;  2LEH A;  4IDZ A;  3ZYK A;  1UK5 A;  1KNZ A;  1HF8 A;  3PUR A;  3K3O A;  2EHO D;  3LSV A;  1E2A A;  5AQO B;  2MYS A;  3Q5E A;  4LMK A;  3O4X E;  1J5W A;  4QHO A;  2BG9 A;  4WBO A;  1J5E T;  2XQ5 A;  1YQ3 A;  3OKQ A;  4YTM A;  4DV6 T;  3K3N A;  4CN6 A;  3C4X A;  3AEA A;  1HS7 A;  2KXP B;  3NZQ A;  1M62 A;  5HEJ A;  5LGT B;  2KT9 A;  2NWB A;  3QOF A;  1OED E;  5JH7 E;  4U7Y A;  4KMC A;  1SE7 A;  4WBN E;  2XQ6 A;  2C5K T;  2LKH A;  5F3J A;  2LHR A;  2XQY A;  5JTG A;  2W67 A;  4KBM B;  3CVR A;  4TZ4 C;  2WBL A;  1HNX T;  5AQF B;  5FVL A;  4H9N C;  1B7T A;  3SFE A;  2X0H A;  4TWF A;  2ZM6 T;  2WAU A;  5FL0 A;  4XAX B;  2KND A;  2LLY A;  1FJG T;  1VCS A;  3KV6 A;  5LGU B;  5AQQ B;  2GK9 A;  4YHH T;  2YN6 A;  4ILU A;  2CWY A;  4O4H E;  2LOP A;  2A2F X;  1YQ4 A;  2VQF T;  4TX5 A;  3OVU A;  5L3F B;  3K3Q C;  2CEA A;  3CWZ B;  2YDS A;  2WMN A;  3F2E A;  4PK6 A;  5IWA T;  4AKH A;  3LDQ B;  3OTO T;  5AQU B;  4PFP A;  4U31 A;  3C4W A;  1IJ6 A;  2XPK A;  3QB5 A;  4UIG A;  4B6X A;  3AXJ B;  4ISS A;  4H9O C;  4HFV A;  2X68 A;  3RKG A;  2L8K A;  2VQE T;  4U72 A;  4YLH A;  4GK0 E;  3N9M A;  2XHE B;  2A3D A;  4U3C A;  4WYV A;  3UUX B;  2QA7 A;  4ZOL E;  3FZK B;  3RC8 A;  4JI4 T;  2H7V C;  2UXX B;  2QYW A;  4E7S A;  3FBL A;  2LKG A;  2M6I A;  3SWH A;  3AAE B;  4NUV A;  2LHN A;  2E9X A;  5JDL A;  2MBG A;  4ZI2 C;  5HXS A;  5HCM A;  1G73 A;  1FMV A;  2AXD S;  2NP9 A;  4WZX A;  1HCI A;  4DR2 T;  1ZKE A;  3ZT5 A;  4L0R A;  2CA5 A;  3E0Z A;  3PJA J;  4PK5 A;  1YKH B;  2WDV A;  4EZ4 A;  2YEV C;  2VKJ A;  4U2Y A;  1N32 T;  2CXD A;  3RIU C;  4O8S A;  3V5U A;  3CQX C;  2UXN B;  2XSB A;  3RC3 A;  1IJ5 A;  4JI5 T;  5LYJ E;  4EZH A;  5AQG B;  4IIJ E;  1I94 T;  1BR1 A;  4CI3 B;  3Q5W A;  4GKK T;  1D0Y A;  2W61 A;  3UUL A;  3RYH E;  5HXE A;  1KFY A;  1DU2 A;  4EAH A;  3HKE E;  4YFS A;  4DND A;  2MAW A;  3NRY A;  5L3D B;  3AE7 A;  4WW0 A;  5KXJ A;  5H6Q B;  2W63 A;  3FZF B;  4J2C A;  1BR0 A;  2LSK A;  2J4G A;  1QSD A;  2IAK A;  2IIU A;  3OYZ A;  2YDR A;  5ABF B;  3FZH B;  2D0U A;  1BR4 A;  3AE4 A;  4ZS2 A;  4DR7 T;  2ODU A;  4NUU A;  3N9O A;  5E0O A;  2DNX A;  4TWD A;  1LVF A;  3IA3 A;  1D1B A;  4BJM A;  3C64 A;  3UU4 A;  5J1G A;  2M6B A;  1D0Z A;  5L3E B;  3FB2 A;  3RH3 A;  4X66 T;  2YDQ A;  2XQA A;  4PNI A;  1KK7 A;  4B3M T;  3AE6 A;  3P4R A;  4H63 V;  2ZMA A;  1WYC A;  3EHZ A;  5CGM A;  1MIY A;  4I55 E;  2DL1 A;  2ZM2 A;  1N36 T;  2N1G A;  3I0O A;  3U78 A;  4TV8 E;  4ZXL A;  1W0B A;  4AKR B;  2K9A A;  5AQJ B;  3KV4 A;  2IC6 A;  3GMI A;  2WS3 A;  2DI4 A;  2CCQ A;  2BG9 C;  5LBM A;  2MTQ A;  1S35 A;  3ZCJ A;  3LJC A;  2PJQ A;  2YKS A;  4DV5 T;  2QGS A;  2WB5 A;  5LXT E;  2W00 A;  1NWM X;  2IW5 B;  3FXE B;  5LA6 E;  2DWG A;  4B3S T;  1T8B A;  4I43 B;  3AEC A;  3K8P C;  4MAL A;  4DV0 T;  3DJB A;  3CX8 B;  2X9H A;  1XDP A;  1KNP A;  3C50 A;  5LNK A;  3PUS A;  5LB7 B;  4HFD A;  3MK7 C;  3KVB A;  2ACX A;  5HXR A;  4UVA B;  1W0A A;  3FXD B;  3BQL A;  2ODV A;  4E7Z A;  4HFI A;  2AE9 A;  1LKX A;  1S94 A;  1YD8 G;  3AA7 B;  5IYZ E;  1Z8U A;  1FEW A;  5JDF A;  2HN2 A;  3L8R A;  5FKY A;  4P0A A;  4TN7 B;  1QUU A;  4HGA A;  1AJ3 A;  3AAI A;  2XTL A;  4MHC A;  5JDQ A;  3RKO A;  4ILA A;  1W9R A;  2PTF A;  3EAB A;  4YY3 T;  4AKG A;  3AED A;  1U5P A;  2BBH A;  1HG2 A;  4M1P A;  2A9U A;  4IL4 A;  4DR3 T;  1SHZ C;  2ES0 A;  3JC6 C;  2W0G A;  2XAH B;  2XM1 A;  3HI2 A;  4QH5 A;  4H9P C;  2DCF A;  5FXX A;  2KZ7 B;  2CHO A;  3VKH A;  3ZC1 A;  4ILB A;  3VR9 A;  1O3X A;  1MMA A;  4YXD A;  3ZKR A;  4OX9 T;  5HAX A;  1M7K A;  4LF4 T;  3LBX B;  4PK4 A;  2J47 A;  1XNR T;  2M67 A;  1MIW A;  3CQC B;  5GON E;  3SS1 A;  3ONJ A;  3I0Q A;  2LSI A;  2XQ4 A;  3PUY F;  4CXX A;  5LMN T;  4HFH A;  3GA8 A;  3MKD A;  4NXM T;  4F8H A;  2X0Y A;  3BQK A;  3P7I A;  5JRC A;  3ANW A;  4PW8 A;  2CBI A;  1YXR A;  2NOX A;  2WZH A;  3D0T A;  3UTK A;  4X1Y E;  3LG7 A;  4AQF A;  4YJ3 E;  2V6X A;  4HFB A;  1D1A A;  2E9X C;  5FY1 A;  3ZMU B;  3NBX X;  2XQ8 A;  3N2O A;  1HFA A;  3MA9 A;  2V1D B;  3ZYM A;  2JQK A;  3RGL A;  3ONX A;  4HFC A;  2CLY C;  3ZN0 B;  3I1A A;  4XZC A;  2L9Q A;  2FJE A;  1OXZ A;  2V7I A;  3EAM A;  2I59 A;  5FMN A;  2CM0 A;  3FBZ A;  3IHR A;  3RI5 A;  1E1H B;  2V6Y A;  3UT5 E;  3HKB E;  5AQK B;  5AQN B;  3RYI E;  1XMO T;  4ANJ A;  4QX8 B;  2UXD T;  5EK3 A;  1XWM A;  4HWH A;  2V5C A;  4IE6 A;  1L0V A;  5AQL B;  3CKD A;  2C5J A;  5HEU A;  3AE2 A;  2QVA A;  3UFE A;  4EIW A;  3PV0 F;  2WY2 A;  2CPT A;  4TNW A;  3WI3 A;  2W62 A;  2B1E A;  1R8I A;  2KMF A;  4LFA T;  5AQT B;  2PG8 A;  5KDM C;  3M65 A;  4LFC T;  4UEL A;  4JEH B;  1FIO A;  3P50 A;  1IBK T;  4GK5 E;  4EYY R;  1T7S A;  5EK4 A;  4AI6 A;  4DMV A;  4JI1 T;  3JAE A;  2FJA A;  3LK2 B;  4Z91 A;  2ZLY A;  2Q9Q A;  3G06 A;  4P09 A;  4LFB T;  2Y6X A;  2D5U A;  3CQG B;  4YTP A;  1N34 T;  2CWO A;  4CQI A;  3HL6 A;  4DV7 T;  3ZN1 B;  3TLU A;  3KV5 A;  4YSY A;  2XAG B;  4H9Q C;  2QRX A;  3T8O A;  3EVY A;  3ZPO A;  3JCF A;  3RRW A;  5LGN B;  3RYF E;  2WQY A;  3N5L A;  2Z6E A;  4ZI2 D;  2BVL A;  2E8I A;  3T1H T;  2WDR A;  4YHJ A;  3AEF A;  3IBP A;  3CPZ A;  1HNZ T;  5HEH A;  2V26 A;  3EDV A;  5JQG E;  3KVA A;  2JPF A;  2YIN A;  3Q9D A;  2OV9 A;  2LM9 A;  3SRZ A;  4OYK A;  3RYC E;  3AB3 B;  3PE0 A;  4KP3 C;  2VKD A;  2BG9 E;  4ADZ A;  3EUH A;  3PTR B;  4HWC A;  1JNZ A;  2K48 A;  2YOE A;  3QB5 K;  4LF8 T;  3GN5 A;  2LRL A;  5LMU T;  5HEG A;  4JI8 T;  2F4V T;  1D0X A;  3C51 A;  5CB4 E;  3ZJ1 A;  4MFR A;  2E5L T;  2BS4 A;  2UUA T;  1MIV A;  2DWK A;  2CRB A;  4YSZ A;  3N2G E;  1H7C A;  3PUZ F;  4A97 A;  2JMH A;  2BG9 B;  2V7L A;  3MXZ A;  5HEO A;  3RPU A;  3NVO A;  3J9X 1;  3BQI A;  3VR8 A;  2WP9 A;  3SFD A;  4YT0 A;  5LCY A;  5AQP B;  2VB6 A;  1NEN A;  2DLR A;  5LBQ B;  3F57 A;  4DR4 T;  1Y01 A;  3L39 A;  2WWU A;  3UFG A;  3TLS A;  5JDG A;  5JR9 A;  4ZS3 A;  4P0B A;  4JLE A;  1X9B A;  4ZI3 C;  4X20 E;  4NIQ A;  2VAS A;  2ZM8 A;  4U2Z A;  4QX7 B;  4HE8 A;  2XJ7 A;  2LT3 A;  5F5W A;  2BVM A;  1IBL T;  4FI5 A;  3ZEF B;  3UQ4 A;  2XQ7 A;  2UU9 T;  4PJM A;  2UUB T;  2MPK A;  5FVK A;  1WRD A;  1Y64 B;  2WM9 A;  2BKN A;  2BS3 A;  1EZ3 A;  2VUR A;  2WU2 A;  1WR6 A;  1HTJ F;  3MJX A;  3M3Z B;  4L9I A;  4AQF C;  3ZYL A;  2ZM0 A;  5H6R B;  3UUN A;  1XDO A;  4PAG A;  5AQV B;  2EHO A;  2NW8 A;  3K1S A;  2N9D A;  2RA1 A;  3SOL A;  2XAF B;  4ZEY A;  1IZN B;  5FXW A;  5LHH B;  5L4E A;  3T1Y T;  3AEB A;  2OLT A;  2HN1 A;  4UVC B;  2L3L A;  5AQH B;  2VKO A;  2X9W A;  4IE7 A;  2K3W A;  5DQV A;  5IUX A;  4Z90 A;  3X1D A;  3B5M A;  4KX6 A;  5CFB A;  1XMQ T;  4AQY T;  4LF6 T;  5ABE A;  3PUX F;  1VOM A;  4QKN A;  3AEG A;  2XQ9 A;  2RPA A;  3GN5 B;  5J2T E;  3O1I A;  2LOS A;  4HWI B;  2E9X B;  5AQR B;  2J62 A;  4HKA A;  2H88 A;  4AKI A;  1VRB A;  1NAF A;  1YKE B;  4IDQ A;  1FMW A;  2LSG A;  3GWH A;  4CN1 A;  2XM2 A;  2CLY B;  5DAB A;  3TLW A;  1UUS A;  3JC6 D;  4JEU B;  3ZC0 A;  5ABH A;  4U74 A;  3FHN A;  4L5G A;  2Q9Q C;  2WMO A;  4DR6 T;  3PDY A;  4F6R C;  4IGU A;  3ETV A;  4K0U A;  1WYB A;  1MNE A;  3EDU A;  3ETU A;  3QUJ A;  3VRA A;  3UQ7 A;  2VVN A;  4X65 T;  3H3A A;  4DUZ T;  3H3M A;  4NXN T;  4LF9 T;  4QH1 A;  5HWX A;  2BS2 A;  5LG4 A;  2HPJ A;  3FZM B;  3AA1 B;  2JIW A;  4ZZB A;  4OK0 A;  1N33 T;  2JQQ A;  1V9D A;  5C3J A;  3BK9 A;  2E9X D;  4HN9 A;  3N9P A;  5L2L A;  2FJD A;  5ABG A;  1OED A;  1T72 A;  3UU8 A;  4CN4 A;  3ESL A;  2BKO A;  2V5D A;  5FP3 A;  2C5I T;  3P4W A;  4P1N A;  4A98 A;  5EK2 A;  2B76 A;  1KEY A;  4DO0 A;  5J2U E;  2D9D A;  4JI0 T;  3AEE A;  4DVD A;  3FZL B;  1UGO A;  4ILC A;  3UU5 A;  2R6G F;  2I6H A;  2X67 A;  2X9Y A;  5LJN A;  3AE3 A;  2JRK A;  3J7Y q;  4EYU A;  5FY0 A;  4UF0 A;  2XZE A;  3AVS A;  4WNK A;  3AE9 A;  4BA9 A;  1ZP0 A;  4JBW F;  2IDO B;  5TAO A;  3PUV F;  3L3P A;  2KLQ A;  4ASK A;  3UU3 A;  5LHI B;  3ZMZ B;  2I0M A;  3AXJ A;  3OPC A;  3KIN B;  3OYX A;  4HWD A;  3UUM A;  2X66 A;  2LM2 A;  2W4X A;  2XUE A;  2NW7 A;  3NWI A;  3TKL B;  3ZST A;  1YW0 A;  4IHJ E;  4BJN A;  3ZCI A;  5LJM A;  4YTN A;  2YK0 A;  2YU1 A;  1IBM T;  3RF1 A;  1UUR A;  1JNR A;  3B57 A;  3CK6 A;  3L09 A;  1GQE A;  4DV4 T;  4MLK A;  5JR9 C;  4EV6 A;  1VCT A;  3P4P A;  4UEM A;  4X1I E;  4UVB B;  2ACZ A;  5M4Y A;  4YJ2 E;  3A7M A;  3LFM A;  5JDM A;  4G2A A;  4V1A v;  4X64 T;  2KWI B;  3CIR A;  4DR5 T;  3MZK B;  5L4H A;  4NPP A;  5AFU L;  4LMJ A;  2CHN A;  2HPL A;  4JV5 T;  2MOZ A;  4UXN B;  3WAJ A;  1E7P A;  4UR9 A;  1Z0P A;  4KHP T;  4CXY A;  4IDN A;  2PBI A;  4PFO A;  3NKZ A;  3R84 B;  3Q2M A;  3RQU A;  1XNQ T;  2BZB A;  1UCU A;  2WSS V;  3QK6 A;  4CI2 B;  2EHO C;  2DHR A;  4OFZ A;  4LML A;  5HXC A;  3CML A;  4O4J E;  4COF A;  1LRZ A;  1KNR A;  2VKH A;  1OED B;  2V7J A;  2W2U A;  4HWF A;  1US7 B;  1OWA A;  4IE0 A; 
#chains in the Genus database with same CATH homology
 4DV2 T;  3T1H T;  1IBM T;  4LF7 T;  1HNZ T;  4OX9 T;  1XMQ T;  4AQY T;  4LF6 T;  2HHH T;  4LF4 T;  4DV4 T;  1XNR T;  2UXB T;  4JI6 T;  1HR0 T;  4JI4 T;  4DV1 T;  1HNX T;  5LMN T;  4NXM T;  4JI7 T;  4LFA T;  2ZM6 T;  4JI3 T;  4DR7 T;  4LFC T;  1IBL T;  1HNW T;  4DR1 T;  1FJG T;  2UU9 T;  1IBK T;  4K0K T;  4DR2 T;  2UUB T;  4X64 T;  4JI1 T;  4LF8 T;  4DR5 T;  5LMU T;  4JI8 T;  4JI0 T;  4X66 T;  4YHH T;  2F4V T;  2UUC T;  4DUY T;  2E5L T;  4B3M T;  4LFB T;  1N32 T;  2VQF T;  4JYA T;  4JV5 T;  2UUA T;  4KHP T;  1J5E T;  4JI5 T;  1N34 T;  1N36 T;  5IWA T;  4DR6 T;  5BR8 T;  4YY3 T;  4DV7 T;  4DV6 T;  4X62 T;  3OTO T;  1XNQ T;  4B3T T;  1I94 T;  4DUZ T;  4X65 T;  4B3R T;  4NXN T;  4LF9 T;  4GKK T;  4GKJ T;  4DV5 T;  4DR3 T;  3T1Y T;  2VQE T;  4DV3 T;  2UXC T;  4DR4 T;  1XMO T;  4B3S T;  4LF5 T;  2UXD T;  4DV0 T;  4JI2 T;  1N33 T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...