3T1YT

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a human anti-codon stem loop (hasl) of transfer rna lysine 3 (trnalys3) bound to an mrna with an aag-codon in the a-site and paromomycin
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAVQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Human tRNA(Lys3)(UUU) Is Pre-Structured by Natural Modifications for Cognate and Wobble Codon Binding through Keto-Enol Tautomerism.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 34
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2011-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 3t1yT00
4JI0T 1XNRT 4JV5T 1IBLT 1HNZT 4DR1T 1N34T 2HHHT 4B3TT 4JI7T 1N33T 5LMUT 1J5ET 4LF6T 4DR5T 4LFAT 1XMOT 4JI1T 2UUAT 1HR0T 5LMNT 2UUCT 2VQFT 2F4VT 4K0KT 4GKJT 1FJGT 2UXCT 4LF7T 4DV1T 4DUYT 4NXMT 4DV6T 4AQYT 4DR4T 5BR8T 4B3MT 4DV7T 2UXDT 2E5LT 4LF5T 4LF4T 4X64T 4NXNT 2UXBT 4DV2T 4X65T 3OTOT 4X66T 4DV0T 2UU9T 1HNXT 4LFCT 4OX9T 4X62T 1IBMT 4B3ST 4B3RT 4DV5T 4DR6T 3T1YT 1N32T 1N36T 4GKKT 2ZM6T 5IWAT 1XNQT 2UUBT 4DUZT 4YY3T 4LF9T 1HNWT 4JI2T 4KHPT 4DV3T 1IBKT 4JYAT 4LF8T 4DV4T 4DR7T 1XMQT 4JI4T 4YHHT 4JI6T 4JI8T 4JI5T 4DR2T 1I94T 3T1HT 4DR3T 2VQET 4JI3T 4LFBT
chains in the Genus database with same CATH superfamily
2VWAA 4Q25A 3WI3A 1BR2A 2E2AA 2PTFA 2V7IA 3K3OA 2ES0A 4IREA 2LE8A 2MTQA 3SFDA 2G0UA 4MBQA 4YXDA 5IUXA 4PFPA 1IBLT 4KMCA 5EK3A 2WU2A 3LDQB 5J0ZA 4LMJA 3PV0F 1FEWA 2LEHA 2WBLA 4AKRB 4X5TA 2VL0A 5H6QB 4ZEYA 3TLSA 4G63A 3RYHE 1YXRA 4QX8B 4AQFC 1BR1A 1IJ5A 3PUZF 5LMUT 2LM9A 3NRXA 2BBJA 2V1DB 2V26A 4HWHA 3UFGA 3EDUA 4JLEA 1T8BA 2I0MA 5AQJB 2A72A 2HN1A 4ZS2A 3X1DA 2CLYB 4HFCA 2BKNA 4PK4A 5FXVA 3BK9A 3NWIA 2WDRA 2W61A 3ANWA 3O1IA 2J1DG 3MA9A 5AQMB 2W4XA 3H3AA 4ZI2D 1XMOT 2BS2A 4GIWA 4UEMA 3RLFF 4IDZA 5JDMA 2MPKA 4WBOA 4MLKA 4X20E 2XQ3A 3VR9A 4AIUA 5FNVE 3L09A 4IDOA 5LBMA 1WYCA 1CHUA 3PUSA 4YJ3E 2WP9A 2WWVA 3RQWA 5J2TE 5LXTE 4HWCA 2HN2A 2WU5A 4O2AE 2XTLA 3AEBA 3CKDA 5LMNT 2VQFT 4YJ2E 2YINA 2NP9A 3VKHA 5JDHA 1BR0A 3I0QA 3E22E 2DWGA 3AA7B 3KVBA 2CEAA 2LJLA 3PUVF 2F4VT 4GK5E 2Q9QA 5JR9C 4LF7T 4Z91A 1D1CA 4BJMA 2V7MA 4DV1T 5HCJA 1W0BA 2XQ8A 3L3PA 4HE8A 3PUAA 5AQVB 2XPKA 2AXDS 3M65A 4M1PA 2NW9A 3RKGA 3U3IA 2N9DA 5A1LA 4QWNB 4DV6T 1U5PA 3CPZA 3CX6B 5LNKA 1SE7A 3N9OA 2UXDT 3AAIA 5AQTB 2D2SA 4H63H 4DBQA 5JRCA 2X9HA 3N9PA 2WS3A 1N34T 1YKEB 4X64T 5AQGB 3ZN0B 4IE4A 2LOSA 1UCUA 3UUBA 4DMVA 4IL4A 3I0OA 2B1EA 4ADZA 4A56A 5JRCB 2X0LB 1YD8G 5F5WA 2W00A 3CQCB 1QUUA 3F2EA 1MMDA 1NENA 3AVSA 1NAFA 4ZI3D 4LFCT 4OX9T 2LSKA 2C5KT 2Q9QC 2Y48B 5JR9A 1NEKA 3MACA 1MMAA 3AE8A 2KT9A 1AJ3A 4HFDA 4MFRA 5L3FB 3C51A 2W0GA 3E0ZA 1EZ3A 4DR6T 1MIWA 2IUBA 5JDNA 3I1AA 1XWMA 3N9MA 4O2BE 1VCSA 5JTGA 5AQQB 3QUJA 1N36T 1LVFA 4WYVA 2VURA 4IDQA 2CBIA 2XJ7A 5JDFA 4EYYR 3CVRA 2V7KA 3BQLA 4AISA 5TAOA 4KUMB 4ZZBA 4DUZT 2UXXB 2QYWA 2UUBT 4YY3T 3BQKA 4U7IA 2IC6A 5HXRA 4JI2T 3UQ4A 3B13A 1FMWA 1ZHCA 3JADA 4YT0A 3B57A 1VCTA 4V1Av 4EB6E 2A3DA 1OEDE 2WAUA 3RRWA 4ZI7E 1LKXA 1W09A 4IE0A 4EIWA 1IJ6A 2KWIB 4FI5A 4JUYA 3UULA 2QA7A 5KXJA 4AI6A 2XM1A 4PW8A 4J2CA 3P4SA 3AA6B 2X68A 4AKIA 1KNZA 2KNDA 2IIUA 1I6ZA 1SUMB 1LRZA 1UK5A 2ACXA 2OA5A 1HG2A 2KINB 4HEAA 5DABA 4JI8T 2KXPB 3PUWF 1X9BA 3LSVA 3N9QA 4K0UA 4HFIA 4JI5T 3MJXA 1IZNB 4NXMT 4H9RC 4HGAA 2A2FX 5JDQA 3LBXA 4YTNA 3A5XA 4XBFB 4X1IE 2XAHB 1MNDA 1HF8A 3GA8A 4ILAA 5CGMA 1YQ4A 5EK2A 2I59A 4JI3T 1X79A 3EUHA 3CX7B 3EVYA 4OK0A 4U33A 4YHJA 1UX5A 4UVAB 1D1AA 1T7SA 4ILBA 2WZIA 3CK6A 2QGSA 4PK6A 4IE5A 3ZN1B 4ASKA 5HXEA 3PUXF 2YU1A 4IT4A 4B6XA 2LT3A 2WQYA 2JQHA 1D0ZA 5LG3A 2BKOA 4ISSA 5AQUB 1V9DA 2J47A 4H9OC 5M4YA 3E08A 3FZFB 2HHHT 1BR4A 4COFA 3IA3A 4ZOLE 3ABVA 2ZMAA 1N33T 2VVSA 4U7YA 3UUNA 1IAPA 5LCYA 2V8SV 4YSZA 3RPUA 3C50A 5JDGA 2ZM0A 1JNZA 5DQWA 4LF6T 2WZHA 4IE6A 5AQOB 4O4IE 2W62A 3NZQA 4H9QC 4EV6A 5AQHB 3PTRB 3HI2A 4QKNA 4DR5T 5FMNA 2IHR1 5KX5E 2M67A 1QSDA 3R6NA 2ZM2A 3AEDA 3NVOA 4Z8XA 2JPFA 5JDLA 4UVBB 4WNKA 5FYMA 4EEBA 2KLQA 4DBRA 3DTOA 3NBXX 3KDSE 3KVAA 4B3MT 2V5CA 1WRDA 3CMLA 4MHCA 4AQFA 1S35A 5HEGA 2J4GA 3UU6A 3SFEA 2BG9C 3UU3A 2XAGB 3FZHB 4HFVA 1FJGT 2UXCT 2DLRA 2NTXA 4GKJT 3O1JA 5AQIB 4CN4A 3HKEE 2B76A 4QH1A 3ZT7A 3IEEA 3H37A 2C5JA 1YW0A 5F3JA 2EHOA 3LJCA 5L3CB 1VRBA 2DHRA 4XAXB 5LGTB 4TWDA 2CWYA 4DR4T 4X1KE 3RIUC 5C3JA 5BR8T 4TN7B 4TV9E 3TLTA 2XQYA 4U2ZA 4ZHQE 4C90A 2EHOC 4H9PC 2E5LT 4P09A 4P0AA 3P7IA 5FL0A 4NUUA 2PG8A 2XHEB 2CCQA 2H7VC 2X51A 3AE5A 2CMRA 4KBMB 2OLTA 4GYRA 4UF0A 3NZPA 5H6RB 3KINB 3OTOT 1US7B 3IBPA 5EZYE 2Y6XA 4Z90A 3ETVA 2NOXA 4AQGA 3UU4A 3RIAA 2BZBA 4H9SE 3AE9A 5LB7B 2UU9T 4H63V 1FMVA 3CIRA 1IBMT 4U3CA 4QXBB 3TLVA 1WYBA 2ODVA 4CQIA 4B3ST 1UGOA 4I55E 1OEDA 4UIGA 4HFEA 4UR9A 1KFYA 1N32T 1D0XA 3Q5XA 1KF6A 1T72A 4KX6A 4OYKA 5ETWA 3OBVE 3BQIA 3SRZA 4CZZB 2FUPA 4U2YA 4AKLA 3PDYA 4UELA 2DWKA 2KZ7B 3TLUA 5CA1E 5CJ5A 3IHRA 3AXJA 3AE1A 2XQAA 4UV8B 3ZMVB 2BVLA 3VKGA 3FZMB 3PUQA 3RH3A 1HCIA 1E1HB 5J1GA 3QOFA 3ZT5A 4LF9T 3N9LA 1HX8A 5ABHA 2HH7A 5LP6E 4OYJA 4EZHA 3C98B 3W15B 2D0UA 2Q9QB 5HEHA 3LK3B 1WLXA 3HKCE 3GN5B 4WBNE 4DV4T 3P8CD 4ZI3C 2WMOA 3OYZA 3UT5E 3N2KE 3OKQA 2YK0A 3RHWA 5L3GB 1XMQT 3WAJA 1OXZA 4HKAA 3PJAA 5AQLB 2CE7A 2N1GA 2XAFB 3Q2MA 4IGUA 4DIDB 4DVDA 3EABA 4JI6T 3ZSSA 2JIWA 2BDEA 3QC9A 5C2TA 2HPLA 5J2UE 1WCRA 4PFOA 4QX7B 4DR2T 2K9AA 3P4PA 5FXXA 3IF8B 5JVDE 3VRBA 3D0TA 3V5UA 4ZI2C 3RKOA 4JBWF 2CHNA 3AVRA 5L4HA 3N2GE 1LVKA 1QLBA 1E7PA 3KBUA 2XM2A 3N2OA 3PU8A 4LMLA 3FHNA 4NUVA 2XSAA 3SOLA 3TKLB 3ZC1A 4YTPA 3JAFA 4YSXA 2LRKA 2WB5A 3ZMTB 1E2AA 1G73A 3ONXA 1OWAA 1KNRA 3ZEFB 3Q5DA 4YLHA 1HNZT 2XQ4A 1YQ3A 4DR1T 3QB5A 2QVAA 4EGWA 5HEUA 4CI2B 3N5LA 2VKJA 3GN5A 3L8RA 1MMNA 4U72A 3RX6A 3T8OA 3UFEA 1ZV4X 1D0YA 4A98A 1HS7A 2YKSA 2VB6A 1D1BA 3KV4A 3LK42 3GMIA 3PUYF 4QXHB 2LOPA 4CI1B 5HXHA 2CA5A 1L0VA 4CXXA 4GYSA 5HEOA 3LFMA 2DI4A 3KV9A 1HTJF 2W63A 3AAAB 4I50E 4JEUB 5AQRB 3U78A 4JI1T 4LFAT 4EXTA 3HR0A 2FJAA 3ZJ1A 2BS3A 4L0RA 2IW5B 5L2LA 3EHZA 2JMHA 5HWXA 3C4ZA 3JC6C 2ZM8A 5ABFA 5HEJA 3JCFA 3MXZA 3FXDB 3RYCE 3A8YC 5L3EB 1HR0T 2LSIA 4IDPA 1HFAA 3ZCJA 2UUCT 2XQ9A 2XZEA 3ONLC 3DP7A 3MKDA 4QH4A 1XDOA 5L47A 1UX4A 3P50A 2YDQA 1YKHB 2X9WA 5AQSB 3P4QA 5LHGB 5HWYA 2K48A 2UXNB 4F8HA 4C91A 5FY7A 2LSJA 2OV9A 1VOMA 1W0AA 2DL1A 3CX8B 4DUYT 3C4XA 1R8IA 4IIJE 2K3WA 2LSYA 2XQ5A 1ZKEA 2XASB 3H3MA 3N9NA 3OYXA 5BMVE 5CFBA 4AQYT 2CXDA 2CM0A 4DV7T 2BG9E 3AXJB 5JREA 4CN6A 2VL8A 5ABFB 2JJ9A 2V7LA 3KV6A 3L39A 4FJOA 5CB4E 4NXNT 3CQXC 3OJAA 5LGNB 3Q5EA 2CPTA 3HA4A 5HCMA 1WFDA 3MZKB 3AEGA 1J5WA 2BG9A 2LKHA 3ZJ2A 5LYJE 2WY2A 4X65T 4X66T 3AA1B 4TUYE 4NIQA 2IDOB 3FZKB 3I9WA 3ZYMA 4DV0T 1HNXT 2YOEA 1Y01A 2L3LA 2IMLA 1MNEA 1WR6A 5LHHB 5LJMA 3AEFA 3O1HA 3C4WA 3RYIE 1KNPA 2WSSV 3T1YT 2E8IA 1SA0E 1UURA 2BKPA 2EHOB 2XUEA 4GOUA 5DQVA 4TV8E 3AE2A 4YTMA 2XAJB 3RGLA 4O4HE 5JH7E 2WDVA 2LM2A 3ESLA 1G8XA 4TWFA 4CN1A 3WAKA 2I6HA 2X9XA 5E0OA 3FXEB 1M62A 5IWAT 1XNQT 3O4XE 5JQGE 3AE4A 1KEYA 2D0TA 2DCFA 3HKDE 1KK7A 4EAHA 4CXYA 3J7Yq 1HNWT 2XY8B 2WM9A 2BVMA 3FBLA 2N2NA 1MIYA 5L4EA 3UUXB 3VHLA 4UXNB 2M6IA 5LJNA 1IBKT 3AE7A 2RA1A 3AEAA 3PURA 4HTEA 4EEDA 4AKGA 2NW7A 3OPCA 5LA6E 3MK7C 4ZS3A 3ZKRA 5JR9B 3RC8A 5IYZE 5AQFB 4H9NC 4DNDA 3OVUA 3ZT6A 4A97A 1XZYA 1ZOYA 3LK2B 4TZ4C 4UV9B 2NTYA 4YHHT 1H7CA 5FXZA 2X0HA 4TWHA 2MAWA 5CA0E 1GQEA 2E9XB 4KP3C 5F8PA 5LG4A 4JEHB 4LMKA 2H7OA 2M6BA 4TX5A 3RRCA 3ZMUB 4A5XA 3HL6A 3PE0A 3VU7H 4E7ZA 5LHIB 1T98A 5C8YE 2VASA 2CRBA 2WWUA 4O8SA 2VQET 3NRYA 4TNVA 2E9XA 2LHRA 4WZXA 3ZMSB 1SHZC 2IAKA 3PUGA 2W66A 2X67A 4PJLA 2V6YA 5AFUL 4JI0T 1XNRT 1ZEEA 2SPCA 3O9XA 1Z0PA 2BS4A 3F31A 4JV5T 5FP3A 1DU2A 1OEDB 5FL1A 3SS1A 2UXBT 1OEDC 3NKZA 1ZP0A 3DJBA 3LBXB 2E5VA 4HWIB 5ABGA 2X66A 4DV2T 3ZC0A 3UU8A 2K24A 2K5BB 4O4JE 3SWHA 5HAXA 2FJDA 2H88A 4E7SA 2EHOD 2R6GF 5IHYA 4B3TT 1B7TA 2VVNA 3GWHA 4JI7T 2AE9A 2VKOA 1MMGA 4UF0B 3UUMA 5DJQC 3K8PC 4IE7A 4HWFA 5ADXL 1JNRA 2NR4A 4PJMA 4ANJA 4I43B 1J5ET 2Z6EA 2RP4A 2YDRA 3CQGB 4GKKT 2LHNA 3B5MA 4YSYA 2E9XC 5HYAA 2V5DA 4GK0E 3ZSTA 3F57A 2UUAT 2H3RA 4OFZA 1CUNA 2C0SA 2CBJA 2V6XA 4ILCA 3K1SA 4CI3B 4XZCA 3RIFA 3AE6A 3ZCIA 2XQ7A 3EDVA 4CXWA 5HXSA 2C5IT 3KBTA 3I9YA 3J9X1 3FB2A 3M3ZB 3VRAA 4PAGA 2WCAA 2A9UA 1M7KA 3ETUA 4P0BA 5AQNB 2ZLYA 4K0KT 2ACZA 4OHFA 2CXLA 1MIVA 5AQPB 3UQ7A 2LSGA 3C64A 4YFSA 5FVKA 3AB3B 2D5UA 4DMWA 3EI0A 4HN9A 2NWBA 2V6YB 1UUSA 3K3QC 2W67A 4L5GA 5LBQB 3RYFE 2NW8A 3ZLIA 1FIOA 2JQKA 3VR8A 5LGUB 3ANWB 4AKHA 3RF1A 2YN6A 2CHOA 2YDSA 4TNWA 2E9XD 2XAQB 3CWZB 4IL9A 4ZXLA 2JQQA 4O4LE 4QXCB 3S4UA 3FZLB 3TLWA 1W9RA 4KHZF 4LF4T 3QK6A 2H89A 3RIUA 2D9DA 3QB5K 2DNXA 3AA0B 4BAYB 4BJNA 2L8KA 2P9BA 3Q9DA 1NWMX 3QNUA 2FJEA 4IHJE 4PJNA 1Y64B 2W2UA 4QHOA 5ABEA 3RI5A 3PJAJ 3AECA 1HX1B 4EOZB 2PBIA 2WDQA 2CLYC 2XSBA 3HKBE 4X62T 3P4RA 5AQKB 2LKGA 2KSRA 2VK9A 1S94A 2JRKA 2IC9A 2RPAA 3KFWX 2JMKA 3A7MA 2FBWA 4HFBA 3R84B 3ZPOA 1WR0A 2XQ6A 3JAEA 4HFHA 4DV5T 4B3RT 2PJQA 2X9YA 1U4QA 3JC6D 2J62A 4IDNA 4U74A 4ZZCA 2VKDA 4L9IA 3AAEB 2ODUA 5FY0A 2MOZA 3RQUA 3UU5A 4I0UA 5GONE 3UTKA 2GK9A 4PJJA 2YEVC 4WW0A 2ZM6T 5FKYA 3V5SA 3K3NA 4ISTA 4UVCB 4BA9A 3ZYKA 1Z8UA 5FVLA 1J1JA 4EZ4A 2KWHA 3FBZA 3Q5WA 5LOVE 4P1NA 4AXPA 1HG5A 4EYUA 4X1YE 2MBGA 2HPJA 4PNIA 2BG9B 4ILUA 2LRLA 4KHPT 2V7JA 1XDPA 3AEEA 4DV3T 4QH5A 4DO0A 4JYAT 3EAMA 5KMGP 4LF8T 2LLYA 3AE3A 5EK4A 4DR7T 4ERRA 2Q9QD 4N78D 2JQ9A 4NPPA 5HXCA 1O3XA 2FJBA 4LF5T 3RC3A 2QRXA 4I4TE 2WMNA 5L3DB 4JI4T 3ONJA 3P4WA 4U31A 4MALA 3KV5A 4F6RC 5FY1A 2BBHA 5FXWA 5KDMC 3ZMZB 2YU2A 1I94T 3ZYLA 4HWDA 2MYSA 3LG7A 4PK5A 2PFVA 3G06A 2L9QA 3T1HT 2CXFA 4DR3T 2Y8DA 3PU3A 4KI0F 2VKHA 4LFBT 5L3BB 2KMFA 2X0YA 4G2AA 2CWOA
chains in the Genus database with same CATH topology
4JI0T 1XNRT 4JV5T 1IBLT 1HNZT 4DR1T 1N34T 2HHHT 4B3TT 4JI7T 1N33T 5LMUT 1J5ET 4LF6T 4DR5T 4LFAT 1XMOT 4JI1T 2UUAT 1HR0T 5LMNT 2UUCT 2VQFT 2F4VT 4K0KT 4GKJT 1FJGT 2UXCT 4LF7T 4DV1T 4DUYT 4NXMT 4DV6T 4AQYT 4DR4T 5BR8T 4B3MT 4DV7T 2UXDT 2E5LT 4LF5T 4LF4T 4X64T 4NXNT 2UXBT 4DV2T 4X65T 3OTOT 4X66T 4DV0T 2UU9T 1HNXT 4LFCT 4OX9T 4X62T 1IBMT 4B3ST 4B3RT 4DV5T 4DR6T 3T1YT 1N32T 1N36T 4GKKT 2ZM6T 5IWAT 1XNQT 2UUBT 4DUZT 4YY3T 4LF9T 1HNWT 4JI2T 4KHPT 4DV3T 1IBKT 4JYAT 4LF8T 4DV4T 4DR7T 1XMQT 4JI4T 4YHHT 4JI6T 4JI8T 4JI5T 4DR2T 1I94T 3T1HT 4DR3T 2VQET 4JI3T 4LFBT
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI0 T;  1XNR T;  4JV5 T;  1IBL T;  1HNZ T;  4DR1 T;  1N34 T;  2HHH T;  4B3T T;  4JI7 T;  1N33 T;  5LMU T;  1J5E T;  4LF6 T;  4DR5 T;  4LFA T;  1XMO T;  4JI1 T;  2UUA T;  1HR0 T;  5LMN T;  2UUC T;  2VQF T;  2F4V T;  4K0K T;  4GKJ T;  1FJG T;  2UXC T;  4LF7 T;  4DV1 T;  4DUY T;  4NXM T;  4DV6 T;  4AQY T;  4DR4 T;  5BR8 T;  4B3M T;  4DV7 T;  2UXD T;  2E5L T;  4LF5 T;  4LF4 T;  4X64 T;  4NXN T;  2UXB T;  4DV2 T;  4X65 T;  3OTO T;  4X66 T;  4DV0 T;  2UU9 T;  1HNX T;  4LFC T;  4OX9 T;  4X62 T;  1IBM T;  4B3S T;  4B3R T;  4DV5 T;  4DR6 T;  3T1Y T;  1N32 T;  1N36 T;  4GKK T;  2ZM6 T;  5IWA T;  1XNQ T;  2UUB T;  4DUZ T;  4YY3 T;  4LF9 T;  1HNW T;  4JI2 T;  4KHP T;  4DV3 T;  1IBK T;  4JYA T;  4LF8 T;  4DV4 T;  4DR7 T;  1XMQ T;  4JI4 T;  4YHH T;  4JI6 T;  4JI8 T;  4JI5 T;  4DR2 T;  1I94 T;  3T1H T;  4DR3 T;  2VQE T;  4JI3 T;  4LFB T; 
#chains in the Genus database with same CATH topology
 2VWA A;  4Q25 A;  3WI3 A;  1BR2 A;  2E2A A;  2PTF A;  2V7I A;  3K3O A;  2ES0 A;  4IRE A;  2LE8 A;  2MTQ A;  3SFD A;  2G0U A;  4MBQ A;  4YXD A;  5IUX A;  4PFP A;  1IBL T;  4KMC A;  5EK3 A;  2WU2 A;  3LDQ B;  5J0Z A;  4LMJ A;  3PV0 F;  1FEW A;  2LEH A;  2WBL A;  4AKR B;  4X5T A;  2VL0 A;  5H6Q B;  4ZEY A;  3TLS A;  4G63 A;  3RYH E;  1YXR A;  4QX8 B;  4AQF C;  1BR1 A;  1IJ5 A;  3PUZ F;  5LMU T;  2LM9 A;  3NRX A;  2BBJ A;  2V1D B;  2V26 A;  4HWH A;  3UFG A;  3EDU A;  4JLE A;  1T8B A;  2I0M A;  5AQJ B;  2A72 A;  2HN1 A;  4ZS2 A;  3X1D A;  2CLY B;  4HFC A;  2BKN A;  4PK4 A;  5FXV A;  3BK9 A;  3NWI A;  2WDR A;  2W61 A;  3ANW A;  3O1I A;  2J1D G;  3MA9 A;  5AQM B;  2W4X A;  3H3A A;  4ZI2 D;  1XMO T;  2BS2 A;  4GIW A;  4UEM A;  3RLF F;  4IDZ A;  5JDM A;  2MPK A;  4WBO A;  4MLK A;  4X20 E;  2XQ3 A;  3VR9 A;  4AIU A;  5FNV E;  3L09 A;  4IDO A;  5LBM A;  1WYC A;  1CHU A;  3PUS A;  4YJ3 E;  2WP9 A;  2WWV A;  3RQW A;  5J2T E;  5LXT E;  4HWC A;  2HN2 A;  2WU5 A;  4O2A E;  2XTL A;  3AEB A;  3CKD A;  5LMN T;  2VQF T;  4YJ2 E;  2YIN A;  2NP9 A;  3VKH A;  5JDH A;  1BR0 A;  3I0Q A;  3E22 E;  2DWG A;  3AA7 B;  3KVB A;  2CEA A;  2LJL A;  3PUV F;  2F4V T;  4GK5 E;  2Q9Q A;  5JR9 C;  4LF7 T;  4Z91 A;  1D1C A;  4BJM A;  2V7M A;  4DV1 T;  5HCJ A;  1W0B A;  2XQ8 A;  3L3P A;  4HE8 A;  3PUA A;  5AQV B;  2XPK A;  2AXD S;  3M65 A;  4M1P A;  2NW9 A;  3RKG A;  3U3I A;  2N9D A;  5A1L A;  4QWN B;  4DV6 T;  1U5P A;  3CPZ A;  3CX6 B;  5LNK A;  1SE7 A;  3N9O A;  2UXD T;  3AAI A;  5AQT B;  2D2S A;  4H63 H;  4DBQ A;  5JRC A;  2X9H A;  3N9P A;  2WS3 A;  1N34 T;  1YKE B;  4X64 T;  5AQG B;  3ZN0 B;  4IE4 A;  2LOS A;  1UCU A;  3UUB A;  4DMV A;  4IL4 A;  3I0O A;  2B1E A;  4ADZ A;  4A56 A;  5JRC B;  2X0L B;  1YD8 G;  5F5W A;  2W00 A;  3CQC B;  1QUU A;  3F2E A;  1MMD A;  1NEN A;  3AVS A;  1NAF A;  4ZI3 D;  4LFC T;  4OX9 T;  2LSK A;  2C5K T;  2Q9Q C;  2Y48 B;  5JR9 A;  1NEK A;  3MAC A;  1MMA A;  3AE8 A;  2KT9 A;  1AJ3 A;  4HFD A;  4MFR A;  5L3F B;  3C51 A;  2W0G A;  3E0Z A;  1EZ3 A;  4DR6 T;  1MIW A;  2IUB A;  5JDN A;  3I1A A;  1XWM A;  3N9M A;  4O2B E;  1VCS A;  5JTG A;  5AQQ B;  3QUJ A;  1N36 T;  1LVF A;  4WYV A;  2VUR A;  4IDQ A;  2CBI A;  2XJ7 A;  5JDF A;  4EYY R;  3CVR A;  2V7K A;  3BQL A;  4AIS A;  5TAO A;  4KUM B;  4ZZB A;  4DUZ T;  2UXX B;  2QYW A;  2UUB T;  4YY3 T;  3BQK A;  4U7I A;  2IC6 A;  5HXR A;  4JI2 T;  3UQ4 A;  3B13 A;  1FMW A;  1ZHC A;  3JAD A;  4YT0 A;  3B57 A;  1VCT A;  4V1A v;  4EB6 E;  2A3D A;  1OED E;  2WAU A;  3RRW A;  4ZI7 E;  1LKX A;  1W09 A;  4IE0 A;  4EIW A;  1IJ6 A;  2KWI B;  4FI5 A;  4JUY A;  3UUL A;  2QA7 A;  5KXJ A;  4AI6 A;  2XM1 A;  4PW8 A;  4J2C A;  3P4S A;  3AA6 B;  2X68 A;  4AKI A;  1KNZ A;  2KND A;  2IIU A;  1I6Z A;  1SUM B;  1LRZ A;  1UK5 A;  2ACX A;  2OA5 A;  1HG2 A;  2KIN B;  4HEA A;  5DAB A;  4JI8 T;  2KXP B;  3PUW F;  1X9B A;  3LSV A;  3N9Q A;  4K0U A;  4HFI A;  4JI5 T;  3MJX A;  1IZN B;  4NXM T;  4H9R C;  4HGA A;  2A2F X;  5JDQ A;  3LBX A;  4YTN A;  3A5X A;  4XBF B;  4X1I E;  2XAH B;  1MND A;  1HF8 A;  3GA8 A;  4ILA A;  5CGM A;  1YQ4 A;  5EK2 A;  2I59 A;  4JI3 T;  1X79 A;  3EUH A;  3CX7 B;  3EVY A;  4OK0 A;  4U33 A;  4YHJ A;  1UX5 A;  4UVA B;  1D1A A;  1T7S A;  4ILB A;  2WZI A;  3CK6 A;  2QGS A;  4PK6 A;  4IE5 A;  3ZN1 B;  4ASK A;  5HXE A;  3PUX F;  2YU1 A;  4IT4 A;  4B6X A;  2LT3 A;  2WQY A;  2JQH A;  1D0Z A;  5LG3 A;  2BKO A;  4ISS A;  5AQU B;  1V9D A;  2J47 A;  4H9O C;  5M4Y A;  3E08 A;  3FZF B;  2HHH T;  1BR4 A;  4COF A;  3IA3 A;  4ZOL E;  3ABV A;  2ZMA A;  1N33 T;  2VVS A;  4U7Y A;  3UUN A;  1IAP A;  5LCY A;  2V8S V;  4YSZ A;  3RPU A;  3C50 A;  5JDG A;  2ZM0 A;  1JNZ A;  5DQW A;  4LF6 T;  2WZH A;  4IE6 A;  5AQO B;  4O4I E;  2W62 A;  3NZQ A;  4H9Q C;  4EV6 A;  5AQH B;  3PTR B;  3HI2 A;  4QKN A;  4DR5 T;  5FMN A;  2IHR 1;  5KX5 E;  2M67 A;  1QSD A;  3R6N A;  2ZM2 A;  3AED A;  3NVO A;  4Z8X A;  2JPF A;  5JDL A;  4UVB B;  4WNK A;  5FYM A;  4EEB A;  2KLQ A;  4DBR A;  3DTO A;  3NBX X;  3KDS E;  3KVA A;  4B3M T;  2V5C A;  1WRD A;  3CML A;  4MHC A;  4AQF A;  1S35 A;  5HEG A;  2J4G A;  3UU6 A;  3SFE A;  2BG9 C;  3UU3 A;  2XAG B;  3FZH B;  4HFV A;  1FJG T;  2UXC T;  2DLR A;  2NTX A;  4GKJ T;  3O1J A;  5AQI B;  4CN4 A;  3HKE E;  2B76 A;  4QH1 A;  3ZT7 A;  3IEE A;  3H37 A;  2C5J A;  1YW0 A;  5F3J A;  2EHO A;  3LJC A;  5L3C B;  1VRB A;  2DHR A;  4XAX B;  5LGT B;  4TWD A;  2CWY A;  4DR4 T;  4X1K E;  3RIU C;  5C3J A;  5BR8 T;  4TN7 B;  4TV9 E;  3TLT A;  2XQY A;  4U2Z A;  4ZHQ E;  4C90 A;  2EHO C;  4H9P C;  2E5L T;  4P09 A;  4P0A A;  3P7I A;  5FL0 A;  4NUU A;  2PG8 A;  2XHE B;  2CCQ A;  2H7V C;  2X51 A;  3AE5 A;  2CMR A;  4KBM B;  2OLT A;  4GYR A;  4UF0 A;  3NZP A;  5H6R B;  3KIN B;  3OTO T;  1US7 B;  3IBP A;  5EZY E;  2Y6X A;  4Z90 A;  3ETV A;  2NOX A;  4AQG A;  3UU4 A;  3RIA A;  2BZB A;  4H9S E;  3AE9 A;  5LB7 B;  2UU9 T;  4H63 V;  1FMV A;  3CIR A;  1IBM T;  4U3C A;  4QXB B;  3TLV A;  1WYB A;  2ODV A;  4CQI A;  4B3S T;  1UGO A;  4I55 E;  1OED A;  4UIG A;  4HFE A;  4UR9 A;  1KFY A;  1N32 T;  1D0X A;  3Q5X A;  1KF6 A;  1T72 A;  4KX6 A;  4OYK A;  5ETW A;  3OBV E;  3BQI A;  3SRZ A;  4CZZ B;  2FUP A;  4U2Y A;  4AKL A;  3PDY A;  4UEL A;  2DWK A;  2KZ7 B;  3TLU A;  5CA1 E;  5CJ5 A;  3IHR A;  3AXJ A;  3AE1 A;  2XQA A;  4UV8 B;  3ZMV B;  2BVL A;  3VKG A;  3FZM B;  3PUQ A;  3RH3 A;  1HCI A;  1E1H B;  5J1G A;  3QOF A;  3ZT5 A;  4LF9 T;  3N9L A;  1HX8 A;  5ABH A;  2HH7 A;  5LP6 E;  4OYJ A;  4EZH A;  3C98 B;  3W15 B;  2D0U A;  2Q9Q B;  5HEH A;  3LK3 B;  1WLX A;  3HKC E;  3GN5 B;  4WBN E;  4DV4 T;  3P8C D;  4ZI3 C;  2WMO A;  3OYZ A;  3UT5 E;  3N2K E;  3OKQ A;  2YK0 A;  3RHW A;  5L3G B;  1XMQ T;  3WAJ A;  1OXZ A;  4HKA A;  3PJA A;  5AQL B;  2CE7 A;  2N1G A;  2XAF B;  3Q2M A;  4IGU A;  4DID B;  4DVD A;  3EAB A;  4JI6 T;  3ZSS A;  2JIW A;  2BDE A;  3QC9 A;  5C2T A;  2HPL A;  5J2U E;  1WCR A;  4PFO A;  4QX7 B;  4DR2 T;  2K9A A;  3P4P A;  5FXX A;  3IF8 B;  5JVD E;  3VRB A;  3D0T A;  3V5U A;  4ZI2 C;  3RKO A;  4JBW F;  2CHN A;  3AVR A;  5L4H A;  3N2G E;  1LVK A;  1QLB A;  1E7P A;  3KBU A;  2XM2 A;  3N2O A;  3PU8 A;  4LML A;  3FHN A;  4NUV A;  2XSA A;  3SOL A;  3TKL B;  3ZC1 A;  4YTP A;  3JAF A;  4YSX A;  2LRK A;  2WB5 A;  3ZMT B;  1E2A A;  1G73 A;  3ONX A;  1OWA A;  1KNR A;  3ZEF B;  3Q5D A;  4YLH A;  1HNZ T;  2XQ4 A;  1YQ3 A;  4DR1 T;  3QB5 A;  2QVA A;  4EGW A;  5HEU A;  4CI2 B;  3N5L A;  2VKJ A;  3GN5 A;  3L8R A;  1MMN A;  4U72 A;  3RX6 A;  3T8O A;  3UFE A;  1ZV4 X;  1D0Y A;  4A98 A;  1HS7 A;  2YKS A;  2VB6 A;  1D1B A;  3KV4 A;  3LK4 2;  3GMI A;  3PUY F;  4QXH B;  2LOP A;  4CI1 B;  5HXH A;  2CA5 A;  1L0V A;  4CXX A;  4GYS A;  5HEO A;  3LFM A;  2DI4 A;  3KV9 A;  1HTJ F;  2W63 A;  3AAA B;  4I50 E;  4JEU B;  5AQR B;  3U78 A;  4JI1 T;  4LFA T;  4EXT A;  3HR0 A;  2FJA A;  3ZJ1 A;  2BS3 A;  4L0R A;  2IW5 B;  5L2L A;  3EHZ A;  2JMH A;  5HWX A;  3C4Z A;  3JC6 C;  2ZM8 A;  5ABF A;  5HEJ A;  3JCF A;  3MXZ A;  3FXD B;  3RYC E;  3A8Y C;  5L3E B;  1HR0 T;  2LSI A;  4IDP A;  1HFA A;  3ZCJ A;  2UUC T;  2XQ9 A;  2XZE A;  3ONL C;  3DP7 A;  3MKD A;  4QH4 A;  1XDO A;  5L47 A;  1UX4 A;  3P50 A;  2YDQ A;  1YKH B;  2X9W A;  5AQS B;  3P4Q A;  5LHG B;  5HWY A;  2K48 A;  2UXN B;  4F8H A;  4C91 A;  5FY7 A;  2LSJ A;  2OV9 A;  1VOM A;  1W0A A;  2DL1 A;  3CX8 B;  4DUY T;  3C4X A;  1R8I A;  4IIJ E;  2K3W A;  2LSY A;  2XQ5 A;  1ZKE A;  2XAS B;  3H3M A;  3N9N A;  3OYX A;  5BMV E;  5CFB A;  4AQY T;  2CXD A;  2CM0 A;  4DV7 T;  2BG9 E;  3AXJ B;  5JRE A;  4CN6 A;  2VL8 A;  5ABF B;  2JJ9 A;  2V7L A;  3KV6 A;  3L39 A;  4FJO A;  5CB4 E;  4NXN T;  3CQX C;  3OJA A;  5LGN B;  3Q5E A;  2CPT A;  3HA4 A;  5HCM A;  1WFD A;  3MZK B;  3AEG A;  1J5W A;  2BG9 A;  2LKH A;  3ZJ2 A;  5LYJ E;  2WY2 A;  4X65 T;  4X66 T;  3AA1 B;  4TUY E;  4NIQ A;  2IDO B;  3FZK B;  3I9W A;  3ZYM A;  4DV0 T;  1HNX T;  2YOE A;  1Y01 A;  2L3L A;  2IML A;  1MNE A;  1WR6 A;  5LHH B;  5LJM A;  3AEF A;  3O1H A;  3C4W A;  3RYI E;  1KNP A;  2WSS V;  3T1Y T;  2E8I A;  1SA0 E;  1UUR A;  2BKP A;  2EHO B;  2XUE A;  4GOU A;  5DQV A;  4TV8 E;  3AE2 A;  4YTM A;  2XAJ B;  3RGL A;  4O4H E;  5JH7 E;  2WDV A;  2LM2 A;  3ESL A;  1G8X A;  4TWF A;  4CN1 A;  3WAK A;  2I6H A;  2X9X A;  5E0O A;  3FXE B;  1M62 A;  5IWA T;  1XNQ T;  3O4X E;  5JQG E;  3AE4 A;  1KEY A;  2D0T A;  2DCF A;  3HKD E;  1KK7 A;  4EAH A;  4CXY A;  3J7Y q;  1HNW T;  2XY8 B;  2WM9 A;  2BVM A;  3FBL A;  2N2N A;  1MIY A;  5L4E A;  3UUX B;  3VHL A;  4UXN B;  2M6I A;  5LJN A;  1IBK T;  3AE7 A;  2RA1 A;  3AEA A;  3PUR A;  4HTE A;  4EED A;  4AKG A;  2NW7 A;  3OPC A;  5LA6 E;  3MK7 C;  4ZS3 A;  3ZKR A;  5JR9 B;  3RC8 A;  5IYZ E;  5AQF B;  4H9N C;  4DND A;  3OVU A;  3ZT6 A;  4A97 A;  1XZY A;  1ZOY A;  3LK2 B;  4TZ4 C;  4UV9 B;  2NTY A;  4YHH T;  1H7C A;  5FXZ A;  2X0H A;  4TWH A;  2MAW A;  5CA0 E;  1GQE A;  2E9X B;  4KP3 C;  5F8P A;  5LG4 A;  4JEH B;  4LMK A;  2H7O A;  2M6B A;  4TX5 A;  3RRC A;  3ZMU B;  4A5X A;  3HL6 A;  3PE0 A;  3VU7 H;  4E7Z A;  5LHI B;  1T98 A;  5C8Y E;  2VAS A;  2CRB A;  2WWU A;  4O8S A;  2VQE T;  3NRY A;  4TNV A;  2E9X A;  2LHR A;  4WZX A;  3ZMS B;  1SHZ C;  2IAK A;  3PUG A;  2W66 A;  2X67 A;  4PJL A;  2V6Y A;  5AFU L;  4JI0 T;  1XNR T;  1ZEE A;  2SPC A;  3O9X A;  1Z0P A;  2BS4 A;  3F31 A;  4JV5 T;  5FP3 A;  1DU2 A;  1OED B;  5FL1 A;  3SS1 A;  2UXB T;  1OED C;  3NKZ A;  1ZP0 A;  3DJB A;  3LBX B;  2E5V A;  4HWI B;  5ABG A;  2X66 A;  4DV2 T;  3ZC0 A;  3UU8 A;  2K24 A;  2K5B B;  4O4J E;  3SWH A;  5HAX A;  2FJD A;  2H88 A;  4E7S A;  2EHO D;  2R6G F;  5IHY A;  4B3T T;  1B7T A;  2VVN A;  3GWH A;  4JI7 T;  2AE9 A;  2VKO A;  1MMG A;  4UF0 B;  3UUM A;  5DJQ C;  3K8P C;  4IE7 A;  4HWF A;  5ADX L;  1JNR A;  2NR4 A;  4PJM A;  4ANJ A;  4I43 B;  1J5E T;  2Z6E A;  2RP4 A;  2YDR A;  3CQG B;  4GKK T;  2LHN A;  3B5M A;  4YSY A;  2E9X C;  5HYA A;  2V5D A;  4GK0 E;  3ZST A;  3F57 A;  2UUA T;  2H3R A;  4OFZ A;  1CUN A;  2C0S A;  2CBJ A;  2V6X A;  4ILC A;  3K1S A;  4CI3 B;  4XZC A;  3RIF A;  3AE6 A;  3ZCI A;  2XQ7 A;  3EDV A;  4CXW A;  5HXS A;  2C5I T;  3KBT A;  3I9Y A;  3J9X 1;  3FB2 A;  3M3Z B;  3VRA A;  4PAG A;  2WCA A;  2A9U A;  1M7K A;  3ETU A;  4P0B A;  5AQN B;  2ZLY A;  4K0K T;  2ACZ A;  4OHF A;  2CXL A;  1MIV A;  5AQP B;  3UQ7 A;  2LSG A;  3C64 A;  4YFS A;  5FVK A;  3AB3 B;  2D5U A;  4DMW A;  3EI0 A;  4HN9 A;  2NWB A;  2V6Y B;  1UUS A;  3K3Q C;  2W67 A;  4L5G A;  5LBQ B;  3RYF E;  2NW8 A;  3ZLI A;  1FIO A;  2JQK A;  3VR8 A;  5LGU B;  3ANW B;  4AKH A;  3RF1 A;  2YN6 A;  2CHO A;  2YDS A;  4TNW A;  2E9X D;  2XAQ B;  3CWZ B;  4IL9 A;  4ZXL A;  2JQQ A;  4O4L E;  4QXC B;  3S4U A;  3FZL B;  3TLW A;  1W9R A;  4KHZ F;  4LF4 T;  3QK6 A;  2H89 A;  3RIU A;  2D9D A;  3QB5 K;  2DNX A;  3AA0 B;  4BAY B;  4BJN A;  2L8K A;  2P9B A;  3Q9D A;  1NWM X;  3QNU A;  2FJE A;  4IHJ E;  4PJN A;  1Y64 B;  2W2U A;  4QHO A;  5ABE A;  3RI5 A;  3PJA J;  3AEC A;  1HX1 B;  4EOZ B;  2PBI A;  2WDQ A;  2CLY C;  2XSB A;  3HKB E;  4X62 T;  3P4R A;  5AQK B;  2LKG A;  2KSR A;  2VK9 A;  1S94 A;  2JRK A;  2IC9 A;  2RPA A;  3KFW X;  2JMK A;  3A7M A;  2FBW A;  4HFB A;  3R84 B;  3ZPO A;  1WR0 A;  2XQ6 A;  3JAE A;  4HFH A;  4DV5 T;  4B3R T;  2PJQ A;  2X9Y A;  1U4Q A;  3JC6 D;  2J62 A;  4IDN A;  4U74 A;  4ZZC A;  2VKD A;  4L9I A;  3AAE B;  2ODU A;  5FY0 A;  2MOZ A;  3RQU A;  3UU5 A;  4I0U A;  5GON E;  3UTK A;  2GK9 A;  4PJJ A;  2YEV C;  4WW0 A;  2ZM6 T;  5FKY A;  3V5S A;  3K3N A;  4IST A;  4UVC B;  4BA9 A;  3ZYK A;  1Z8U A;  5FVL A;  1J1J A;  4EZ4 A;  2KWH A;  3FBZ A;  3Q5W A;  5LOV E;  4P1N A;  4AXP A;  1HG5 A;  4EYU A;  4X1Y E;  2MBG A;  2HPJ A;  4PNI A;  2BG9 B;  4ILU A;  2LRL A;  4KHP T;  2V7J A;  1XDP A;  3AEE A;  4DV3 T;  4QH5 A;  4DO0 A;  4JYA T;  3EAM A;  5KMG P;  4LF8 T;  2LLY A;  3AE3 A;  5EK4 A;  4DR7 T;  4ERR A;  2Q9Q D;  4N78 D;  2JQ9 A;  4NPP A;  5HXC A;  1O3X A;  2FJB A;  4LF5 T;  3RC3 A;  2QRX A;  4I4T E;  2WMN A;  5L3D B;  4JI4 T;  3ONJ A;  3P4W A;  4U31 A;  4MAL A;  3KV5 A;  4F6R C;  5FY1 A;  2BBH A;  5FXW A;  5KDM C;  3ZMZ B;  2YU2 A;  1I94 T;  3ZYL A;  4HWD A;  2MYS A;  3LG7 A;  4PK5 A;  2PFV A;  3G06 A;  2L9Q A;  3T1H T;  2CXF A;  4DR3 T;  2Y8D A;  3PU3 A;  4KI0 F;  2VKH A;  4LFB T;  5L3B B;  2KMF A;  2X0Y A;  4G2A A;  2CWO A; 
#chains in the Genus database with same CATH homology
 4JI0 T;  1XNR T;  4JV5 T;  1IBL T;  1HNZ T;  4DR1 T;  1N34 T;  2HHH T;  4B3T T;  4JI7 T;  1N33 T;  5LMU T;  1J5E T;  4LF6 T;  4DR5 T;  4LFA T;  1XMO T;  4JI1 T;  2UUA T;  1HR0 T;  5LMN T;  2UUC T;  2VQF T;  2F4V T;  4K0K T;  4GKJ T;  1FJG T;  2UXC T;  4LF7 T;  4DV1 T;  4DUY T;  4NXM T;  4DV6 T;  4AQY T;  4DR4 T;  5BR8 T;  4B3M T;  4DV7 T;  2UXD T;  2E5L T;  4LF5 T;  4LF4 T;  4X64 T;  4NXN T;  2UXB T;  4DV2 T;  4X65 T;  3OTO T;  4X66 T;  4DV0 T;  2UU9 T;  1HNX T;  4LFC T;  4OX9 T;  4X62 T;  1IBM T;  4B3S T;  4B3R T;  4DV5 T;  4DR6 T;  3T1Y T;  1N32 T;  1N36 T;  4GKK T;  2ZM6 T;  5IWA T;  1XNQ T;  2UUB T;  4DUZ T;  4YY3 T;  4LF9 T;  1HNW T;  4JI2 T;  4KHP T;  4DV3 T;  1IBK T;  4JYA T;  4LF8 T;  4DV4 T;  4DR7 T;  1XMQ T;  4JI4 T;  4YHH T;  4JI6 T;  4JI8 T;  4JI5 T;  4DR2 T;  1I94 T;  3T1H T;  4DR3 T;  2VQE T;  4JI3 T;  4LFB T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...