3T1YT

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a human anti-codon stem loop (hasl) of transfer rna lysine 3 (trnalys3) bound to an mrna with an aag-codon in the a-site and paromomycin
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
99
structure length
99
Chain Sequence
b'RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAVQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
molecule tags Ribosome/antibiotic
publication title Human tRNA(Lys3)(UUU) Is Pre-Structured by Natural Modifications for Cognate and Wobble Codon Binding through Keto-Enol Tautomerism.
pubmed doi rcsb
total genus 34
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2011-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 3t1yT00
4K0KT 4AQYT 1XMOT 4DR3T 3T1YT 4JV5T 4X65T 4NXNT 4B3TT 2UXCT 4JI8T 4LF4T 1IBKT 5BR8T 4LF7T 4DR4T 4LF6T 4OX9T 4DR6T 4JI0T 4DV1T 4LF5T 4YHHT 1XNQT 4LFCT 4JI7T 4DV0T 4DUYT 4DV7T 4DUZT 2UUBT 4DR1T 1N36T 1I94T 2E5LT 4DV5T 1N33T 1HNWT 2HHHT 1HNZT 4JYAT 4B3RT 2F4VT 4DR2T 1J5ET 1XNRT 4DV4T 4NXMT 4YY3T 4DV3T 5IWAT 4LF9T 4LFAT 2VQFT 4LFBT 4GKJT 4B3MT 5LMNT 1XMQT 4JI1T 3T1HT 1HNXT 1FJGT 1IBMT 2UUCT 1N34T 4JI5T 2UXBT 4LF8T 2UUAT 4DR7T 1HR0T 4JI3T 2UU9T 2ZM6T 4DR5T 1N32T 4DV6T 4JI4T 4JI6T 4DV2T 4KHPT 4X62T 4X66T 4GKKT 3OTOT 1IBLT 4JI2T 2UXDT 5LMUT 2VQET 4X64T 4B3ST
chains in the Genus database with same CATH superfamily
2V7KA 4YT0A 2VL8A 2ACXA 4HFDA 5LP6E 3ABVA 1KEYA 2WQYA 5L3GB 2BG9B 2FJBA 4PFOA 2DLRA 4HFEA 3LK3B 4HWDA 4OHFA 1M7KA 4U2ZA 2WWVA 4ZI7E 3T1YT 3ZPOA 5BMVE 4V1Av 3K8PC 4O2AE 1OEDC 4HFCA 4UEMA 3RIUC 1BR0A 4IIJE 4KBMB 1NAFA 2CE7A 1J1JA 1D1AA 1WYCA 1QSDA 1CHUA 3CKDA 3ONXA 5FKYA 3IBPA 4HWIB 5JDFA 3RIAA 2PG8A 3LG7A 3PJAA 4UXNB 4GK0E 2X9HA 4NUUA 5L3FB 2YN6A 3C4ZA 4CI1B 3LFMA 2VKHA 3TLVA 4AKIA 2ZMAA 1BR4A 3UULA 2WDQA 1YW0A 3I9YA 2JQKA 4H9OC 2XJ7A 2YINA 3ANWB 3FXDB 3OYXA 4HKAA 5HCMA 4AKGA 5BR8T 1MNEA 3QK6A 3BK9A 3PUWF 2E9XC 2KWHA 2LSYA 2ODVA 3ESLA 4MHCA 3OVUA 2BKOA 4N78D 3G06A 2CPTA 2ACZA 2BVMA 1ZP0A 2HH7A 2WDRA 5LHIB 4OX9T 3RC8A 3AA7B 3RPUA 3O1HA 3AAIA 4DBQA 5LJNA 5M4YA 2XAHB 4CXWA 5J2TE 3AA6B 4PJNA 5ABFB 2AE9A 1X79A 2X0HA 2LSJA 5HXCA 3AXJB 4COFA 4YHHT 4QWNB 3KV4A 1UUSA 2BKPA 4EAHA 5LYJE 1XNQT 2XQ8A 5J2UE 3MKDA 4LFCT 2IW5B 1E2AA 3FBZA 4CN1A 2FBWA 4X1IE 3KBUA 3C98B 4UELA 4DUYT 2LSIA 1YKHB 4EEBA 3N9OA 5L2LA 3ONLC 2BS2A 4L5GA 2UUBT 5CA1E 4ZI3C 1WLXA 3AEGA 1W09A 3C50A 2J62A 4UV8B 3TLSA 3UT5E 4IDZA 3EI0A 1I94T 1I6ZA 3AE1A 3RYIE 3UFGA 3ETVA 1VOMA 2CHNA 3AE9A 3SOLA 3RQWA 4ERRA 4ASKA 2W62A 2JMHA 3H3MA 3ZYLA 3F57A 3K3OA 4ZS3A 2WSSV 2L9QA 1YQ3A 2MYSA 5AQNB 4EGWA 5JDHA 4DR2T 2Z6EA 2KNDA 4AQFC 4H9NC 2YK0A 4YY3T 3CMLA 5AQVB 4TWHA 2CEAA 4LFAT 2E2AA 1T7SA 3RIUA 3RYHE 2VQFT 4LFBT 4MFRA 5F8PA 2Q9QC 2VVSA 4M1PA 5FY7A 5IUXA 5HAXA 2WMOA 5JDGA 2JPFA 4Q25A 1XMQT 4PK6A 2K9AA 5L3BB 4HFBA 3FHNA 3BQKA 5FXZA 3PE0A 3H37A 4H63H 3J9X1 3PDYA 3O9XA 1UX4A 3DTOA 4HWCA 3F31A 4AIUA 2NTYA 2ZM8A 4I4TE 1JNRA 3EDVA 1FJGT 4JBWF 4AKRB 2PFVA 4QX8B 4WNKA 1QUUA 1YQ4A 4CZZB 2X9YA 4BAYB 3RX6A 3JADA 1O3XA 3AE5A 1HX1B 3K3NA 3BQIA 3CWZB 2W66A 3KV6A 1FMWA 5EK4A 4IDQA 5HCJA 4DMVA 5LG4A 1LVFA 4TV9E 2CXLA 3IEEA 5LA6E 4P0AA 3W15B 2UU9T 1FMVA 3Q2MA 4K0UA 2ZM6T 2CMRA 2M6BA 2V6YA 2ZLYA 4PJJA 2ES0A 2JMKA 2K24A 2WY2A 2YU1A 4HGAA 4TNWA 3TLTA 4CN4A 2V7IA 2VB6A 2X68A 3P4WA 4YTPA 4DV6T 2WZHA 2B76A 1ZKEA 1OEDA 2VKDA 3CQGB 1XDOA 4QXBB 4EIWA 5JDNA 4KMCA 5JRCB 4IGUA 1VCSA 2CCQA 2CXFA 2ZM0A 2HPJA 3B57A 3AVRA 3CIRA 3IA3A 5DQWA 3RQUA 4X66T 4AXPA 3U3IA 5AQFB 4ANJA 3KVAA 3RGLA 3L09A 3QC9A 2XSBA 4HFVA 4O4IE 2L8KA 3ZCIA 2X9WA 4B3ST 5LXTE 3QNUA 3RHWA 2W61A 5AFUL 2LRKA 4FJOA 3N9PA 1Y01A 2D2SA 2CLYB 3GWHA 1V9DA 2NOXA 3I1AA 3N2KE 5JTGA 4LMKA 1E1HB 5AQLB 5L47A 1XMOT 5LCYA 2BG9E 4P0BA 4WW0A 4DNDA 4H9QC 4IE6A 4OYKA 5FL0A 2NW7A 2UUAT 4X65T 2NTXA 3QB5A 4MALA 5JDQA 5ETWA 4QXCB 4NXNT 2BBHA 2PBIA 2CBJA 2WU2A 3N9LA 1XZYA 2XQ3A 2XQAA 3H3AA 3R84B 5JRCA 1WR6A 2QGSA 3ZMZB 4EOZB 3ZJ1A 2H88A 2LRLA 2XQ7A 3QUJA 1MIVA 1XWMA 3FZKB 3ZT5A 2IAKA 5FY0A 5EK3A 1MMAA 3SWHA 5J0ZA 3EUHA 2JQ9A 3ZT7A 1DU2A 2BVLA 3N9MA 4DR6T 4TUYE 1QLBA 3UUXB 2XSAA 4HWHA 2JQHA 3ZSTA 4H9RC 4WBNE 4QXHB 3FZFB 4EYUA 2BDEA 2VVNA 4JEUB 2IHR1 3ZMUB 2WMNA 2X66A 2XQYA 3GN5B 2E8IA 3I9WA 2JIWA 3N9QA 3AE3A 2K48A 1HG2A 4GK5E 4QH1A 4ZEYA 4ZI2C 1UK5A 4DV1T 4YLHA 2J47A 3ZMTB 3Q5WA 3I0QA 4TZ4C 2CWOA 1KNZA 2X0YA 2WZIA 2DL1A 2N1GA 4JI7T 2B1EA 4WZXA 2QYWA 5FXVA 4I0UA 4UR9A 3UTKA 4BJMA 2CA5A 1LRZA 2KINB 5FY1A 4DUZT 2G0UA 2Q9QB 3PUYF 3AVSA 3HKDE 5AQOB 2LLYA 4UF0A 2C5KT 2H3RA 3NRXA 4U31A 1OEDB 1FIOA 2K5BB 3IHRA 2WP9A 3FXEB 2NR4A 3PV0F 3NZQA 4G2AA 4MBQA 3WAKA 2D0TA 5JREA 1HS7A 4B3RT 1HCIA 2XM1A 3PJAJ 2W00A 3PTRB 4X20E 4ZS2A 5AQSB 2J4GA 5H6QB 3Q5EA 4YFSA 4QKNA 2XTLA 2FJEA 4J2CA 5EZYE 1J5ET 4O4HE 5F5WA 3M65A 1W0BA 3EHZA 2KT9A 1W0AA 3AEAA 1JNZA 2X9XA 1IZNB 4U7IA 2MPKA 2A2FX 4NPPA 2EHOD 4ZI2D 4IDNA 3EVYA 4GKJT 2V1DB 5LMNT 3ANWA 3LBXA 3OBVE 3WI3A 2WBLA 2V26A 2MOZA 3P50A 2BG9A 4BA9A 2YDQA 4JV5T 4X1KE 4A5XA 4U74A 4EV6A 3EABA 3P4QA 3UU8A 5EK2A 4UVBB 3ZN0B 3QOFA 1B7TA 3HR0A 3AA0B 2XAFB 4WYVA 3I0OA 3JC6C 3U78A 4AQGA 3T1HT 2VL0A 2HPLA 1D0ZA 2CXDA 5FP3A 2Y6XA 3ONJA 4CI2B 2RA1A 2LT3A 1UX5A 2LHNA 3P7IA 3RYFE 2QA7A 4NUVA 4A56A 5FNVE 4DIDB 3DJBA 2YOEA 5ADXL 1IAPA 3E08A 3KVBA 4DR1T 3N5LA 5AQRB 3AEEA 3ZKRA 4UF0B 5HWXA 2JJ9A 4EZ4A 5GONE 5KX5E 1HR0T 4JI3T 4I50E 1ZHCA 5LHGB 4B3TT 3AE2A 4QHOA 3JAFA 1MMNA 2NW8A 1SUMB 1G8XA 4DR5T 1N32T 1UURA 5AQUB 3RH3A 3T8OA 4YTNA 3C4XA 3VHLA 1KNPA 1MNDA 4QX7B 2EHOC 3ZEFB 4HN9A 3VR9A 4DV2T 2DI4A 2AXDS 3MA9A 3AXJA 4O2BE 4EEDA 1LVKA 2V7LA 3L39A 5AQKB 3AAEB 5IYZE 1KNRA 5ABFA 3PUGA 2V6YB 1SHZC 4LMJA 2ZM2A 4EXTA 2KMFA 5CA0E 4KHZF 2VQET 2LSGA 2D9DA 1X9BA 2ODUA 3N9NA 3PURA 5ABGA 3E0ZA 4K0KT 4QH5A 1LKXA 5LJMA 4AQYT 1KF6A 2XQ5A 3VRBA 4DR3T 5FVLA 3ZCJA 1XDPA 2PJQA 2W63A 2XUEA 3EDUA 3RRWA 3ZMSB 5L4EA 3ZC0A 4GYRA 4PNIA 3MK7C 3DP7A 3AE4A 3PU3A 1L0VA 4EB6E 3OYZA 4ZOLE 5AQGB 3N2OA 5JR9A 5LNKA 4JUYA 3UUMA 3BQLA 3NKZA 3JAEA 1G73A 4TX5A 2BKNA 3ZT6A 5HEJA 2KSRA 1WCRA 5LG3A 3P8CD 4ISSA 4U7YA 3OKQA 4U3CA 3TKLB 4L9IA 2X67A 5KXJA 1IBKT 2YU2A 2HN2A 4PK4A 2C5IT 2KLQA 3AB3B 3CQCB 4X5TA 4ZI3D 4DR4T 4H9PC 1J5WA 4CI3B 4TNVA 1U5PA 4ILCA 2I0MA 2A3DA 4PJLA 5JQGE 3C4WA 3C51A 3PUZF 4UVCB 2W0GA 3CQXC 1D1CA 2I59A 2Y48B 3KV9A 4GIWA 4QH4A 4UIGA 4H63V 5FYMA 3HL6A 4TN7B 2NW9A 3ZN1B 3LSVA 5JR9C 4NIQA 4LF5T 3CK6A 4HWFA 4JEHB 4PFPA 1ZOYA 4DBRA 2BS3A 2XASB 5A1LA 3LDQB 1OXZA 4TV8E 1SE7A 4XAXB 1D1BA 4ZZBA 2V6XA 3ZYMA 3K3QC 3SFDA 4YSZA 4ZHQE 2UXXB 5L3EB 4DV0T 3MZKB 5LHHB 3UUBA 1NWMX 1D0YA 3KBTA 2LKHA 4PJMA 5LGTB 4C91A 2YDSA 1OEDE 3M3ZB 2UXNB 5J1GA 5HYAA 3ETUA 2JQQA 3PUQA 1FEWA 4ZXLA 4G63A 5AQHB 3VRAA 4YJ2E 4H9SE 2H7OA 3NRYA 5DQVA 2N9DA 5AQJB 2XHEB 3RF1A 4DMWA 4YXDA 2YDRA 1AJ3A 2VK9A 3AE8A 3FZHB 5JR9B 4F8HA 1YKEB 1US7B 2RPAA 1HNZT 5TAOA 3MJXA 3HKEE 2XAQB 2WU5A 5FL1A 1VCTA 3AA1B 2C5JA 4PW8A 4TWDA 1D0XA 3FZLB 3SFEA 3AAAB 4DV3T 3P4RA 3RYCE 3V5SA 1WYBA 2QVAA 3NVOA 3PUVF 2CLYC 4B3MT 3RC3A 3LJCA 2XPKA 4IREA 1UCUA 2LM9A 5AQPB 3A5XA 3VU7H 4IL9A 2SPCA 4L0RA 4C90A 1BR1A 3ZLIA 1T72A 2OA5A 4OK0A 3P4PA 4JLEA 4PK5A 1E7PA 3PU8A 1YXRA 4UVAB 2IC9A 3UU5A 4AISA 4AI6A 2L3LA 3KV5A 3FBLA 5HWYA 1HFAA 2E9XA 2EHOB 3UQ7A 4E7ZA 4YSXA 2WS3A 3KDSE 1IBMT 4DVDA 2XAGB 2FUPA 2IUBA 2H89A 1N34T 1NEKA 1Z0PA 2D0UA 2R6GF 4LF8T 4LF7T 1IJ6A 4ILBA 5LB7B 3A7MA 3VR8A 2M67A 4Z91A 4CXXA 2X51A 4AKHA 1M62A 4XBFB 2PTFA 4U33A 2BZBA 5JH7E 1KK7A 4XZCA 3RKOA 3NWIA 5AQMB 1NENA 3UQ4A 2LOPA 2VKJA 3Q5DA 4IE0A 5L3DB 4ILUA 1Y64B 3CX8B 3FZMB 5LBMA 2KXPB 3CVRA 2WCAA 5L4HA 1GQEA 5LBQB 4KHPT 3N2GE 3PUSA 5HEOA 2Q9QD 4A97A 1KFYA 2C0SA 5HEUA 4YJ3E 4CQIA 3TLUA 4GKKT 2W2UA 4HFIA 2XAJB 5HXRA 5C3JA 2UXDT 1T98A 3OPCA 2WB5A 2A72A 3LK42 3RKGA 4X64T 3HA4A 3ZMVB 4IE4A 3KFWX 2HN1A 3NZPA 5ABEA 2D5UA 2LSKA 3CX7B 5HEGA 1MMDA 5IHYA 2W67A 4KP3C 5L3CB 2WAUA 2V7JA 2RP4A 3MXZA 3LBXB 4TWFA 2CWYA 3AEBA 3PUXF 5F3JA 5FVKA 4KUMB 1S35A 2E9XB 1MMGA 4IT4A 1HF8A 4BJNA 1IJ5A 4OFZA 4ADZA 1HTJF 3AEFA 1EZ3A 4MLKA 2DCFA 4JI8T 4LF4T 2UXCT 4HTEA 2YEVC 2FJDA 5H6RB 3A8YC 1OWAA 4O4JE 2A9UA 3Q9DA 4P1NA 3O1JA 2CHOA 4F6RC 3UU3A 4IE5A 2XQ6A 3RIFA 4LF6T 2OLTA 3GA8A 3UFEA 4E7SA 2VASA 5HXSA 4JI0T 3NBXX 3KINB 3HKCE 2V7MA 1ZV4X 4X1YE 5ABHA 1T8BA 5CGMA 3ZSSA 5KMGP 3O4XE 2CRBA 1BR2A 1W9RA 2LOSA 4IL4A 4ILAA 5FXXA 1R8IA 2XQ4A 3ZJ2A 3AECA 2M6IA 2LM2A 1VRBA 4GOUA 3CPZA 3CX6B 4O8SA 2N2NA 1WRDA 4Z8XA 3F2EA 3K1SA 4EZHA 5C8YE 4A98A 4DV7T 2WWUA 3S4UA 2DHRA 5CFBA 2JRKA 2V8SV 3VKGA 2IIUA 2LEHA 3VKHA 3D0TA 4AQFA 3RLFF 2K3WA 1N36T 2IMLA 2LJLA 4AKLA 1SA0E 3E22E 4ISTA 3RI5A 4DV5T 2E5LT 3JCFA 1N33T 1HNWT 1U4QA 3LK2B 3IF8B 2HHHT 2XQ9A 3GMIA 2QRXA 5DJQC 2V5CA 5E0OA 4EYYR 4JYAT 3UUNA 4WBOA 2X0LB 5JDMA 2W4XA 5FXWA 2F4VT 4DO0A 2WDVA 1XNRT 4DV4T 2VURA 3UU6A 4NXMT 2NWBA 4FI5A 5AQTB 5IWAT 4LF9T 4HEAA 4IDPA 5CB4E 4YHJA 4KI0F 2MAWA 2LE8A 1ZEEA 3OJAA 4IE7A 3Q5XA 1WR0A 2LHRA 5HXEA 2BBJA 3L8RA 2MBGA 1UGOA 1S94A 2IC6A 4JI1T 2J1DG 3B5MA 4GYSA 4IDOA 4KX6A 5DABA 4I43B 3HKBE 4Z90A 4YTMA 5C2TA 2KZ7B 2OV9A 4HE8A 4O4LE 5HEHA 5HXHA 2DWKA 4CXYA 5LGUB 2FJAA 1HNXT 2V5DA 3TLWA 3V5UA 3X1DA 2XM2A 3ZYKA 5AQIB 3P4SA 3PUAA 4I55E 3FB2A 3O1IA 5AQQB 2E5VA 5JVDE 2LKGA 3WAJA 2UUCT 4JI5T 5CJ5A 1HX8A 5LOVE 2UXBT 3RRCA 4OYJA 1YD8G 2WM9A 2XZEA 2VKOA 4DR7T 3SS1A 2IDOB 2MTQA 4ZZCA 2I6HA 3AE6A 5JDLA 4HFHA 2CBIA 3UU4A 2Q9QA 1HG5A 1Z8UA 4U2YA 3ZC1A 2DWGA 3J7Yq 3GN5A 3R6NA 2EHOA 3B13A 2BG9C 3QB5K 2NP9A 3SRZA 4JI4T 1WFDA 2YKSA 4JI6T 3MACA 4P09A 1H7CA 2P9BA 4IHJE 4YSYA 3AE7A 4X62T 5KDMC 5LGNB 2CM0A 2VWAA 4LMLA 3C64A 4PAGA 4B6XA 3OTOT 1IBLT 4JI2T 3AEDA 4UV9B 4U72A 1MIWA 2DNXA 2Y8DA 4CN6A 1CUNA 5LMUT 5FMNA 2KWIB 2GK9A 2BS4A 2XY8B 3L3PA 1MIYA 3JC6D 3EAMA 2E9XD 2H7VC 3HI2A
chains in the Genus database with same CATH topology
4K0KT 4AQYT 1XMOT 4DR3T 3T1YT 4JV5T 4X65T 4NXNT 4B3TT 2UXCT 4JI8T 4LF4T 1IBKT 5BR8T 4LF7T 4DR4T 4LF6T 4OX9T 4DR6T 4JI0T 4DV1T 4LF5T 4YHHT 1XNQT 4LFCT 4JI7T 4DV0T 4DUYT 4DV7T 4DUZT 2UUBT 4DR1T 1N36T 1I94T 2E5LT 4DV5T 1N33T 1HNWT 2HHHT 1HNZT 4JYAT 4B3RT 2F4VT 4DR2T 1J5ET 1XNRT 4DV4T 4NXMT 4YY3T 4DV3T 5IWAT 4LF9T 4LFAT 2VQFT 4LFBT 4GKJT 4B3MT 5LMNT 1XMQT 4JI1T 3T1HT 1HNXT 1FJGT 1IBMT 2UUCT 1N34T 4JI5T 2UXBT 4LF8T 2UUAT 4DR7T 1HR0T 4JI3T 2UU9T 2ZM6T 4DR5T 1N32T 4DV6T 4JI4T 4JI6T 4DV2T 4KHPT 4X62T 4X66T 4GKKT 3OTOT 1IBLT 4JI2T 2UXDT 5LMUT 2VQET 4X64T 4B3ST
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4K0K T;  4AQY T;  1XMO T;  4DR3 T;  3T1Y T;  4JV5 T;  4X65 T;  4NXN T;  4B3T T;  2UXC T;  4JI8 T;  4LF4 T;  1IBK T;  5BR8 T;  4LF7 T;  4DR4 T;  4LF6 T;  4OX9 T;  4DR6 T;  4JI0 T;  4DV1 T;  4LF5 T;  4YHH T;  1XNQ T;  4LFC T;  4JI7 T;  4DV0 T;  4DUY T;  4DV7 T;  4DUZ T;  2UUB T;  4DR1 T;  1N36 T;  1I94 T;  2E5L T;  4DV5 T;  1N33 T;  1HNW T;  2HHH T;  1HNZ T;  4JYA T;  4B3R T;  2F4V T;  4DR2 T;  1J5E T;  1XNR T;  4DV4 T;  4NXM T;  4YY3 T;  4DV3 T;  5IWA T;  4LF9 T;  4LFA T;  2VQF T;  4LFB T;  4GKJ T;  4B3M T;  5LMN T;  1XMQ T;  4JI1 T;  3T1H T;  1HNX T;  1FJG T;  1IBM T;  2UUC T;  1N34 T;  4JI5 T;  2UXB T;  4LF8 T;  2UUA T;  4DR7 T;  1HR0 T;  4JI3 T;  2UU9 T;  2ZM6 T;  4DR5 T;  1N32 T;  4DV6 T;  4JI4 T;  4JI6 T;  4DV2 T;  4KHP T;  4X62 T;  4X66 T;  4GKK T;  3OTO T;  1IBL T;  4JI2 T;  2UXD T;  5LMU T;  2VQE T;  4X64 T;  4B3S T; 
#chains in the Genus database with same CATH topology
 2V7K A;  4YT0 A;  2VL8 A;  2ACX A;  4HFD A;  5LP6 E;  3ABV A;  1KEY A;  2WQY A;  5L3G B;  2BG9 B;  2FJB A;  4PFO A;  2DLR A;  4HFE A;  3LK3 B;  4HWD A;  4OHF A;  1M7K A;  4U2Z A;  2WWV A;  4ZI7 E;  3T1Y T;  3ZPO A;  5BMV E;  4V1A v;  3K8P C;  4O2A E;  1OED C;  4HFC A;  4UEM A;  3RIU C;  1BR0 A;  4IIJ E;  4KBM B;  1NAF A;  2CE7 A;  1J1J A;  1D1A A;  1WYC A;  1QSD A;  1CHU A;  3CKD A;  3ONX A;  5FKY A;  3IBP A;  4HWI B;  5JDF A;  3RIA A;  2PG8 A;  3LG7 A;  3PJA A;  4UXN B;  4GK0 E;  2X9H A;  4NUU A;  5L3F B;  2YN6 A;  3C4Z A;  4CI1 B;  3LFM A;  2VKH A;  3TLV A;  4AKI A;  2ZMA A;  1BR4 A;  3UUL A;  2WDQ A;  1YW0 A;  3I9Y A;  2JQK A;  4H9O C;  2XJ7 A;  2YIN A;  3ANW B;  3FXD B;  3OYX A;  4HKA A;  5HCM A;  4AKG A;  5BR8 T;  1MNE A;  3QK6 A;  3BK9 A;  3PUW F;  2E9X C;  2KWH A;  2LSY A;  2ODV A;  3ESL A;  4MHC A;  3OVU A;  2BKO A;  4N78 D;  3G06 A;  2CPT A;  2ACZ A;  2BVM A;  1ZP0 A;  2HH7 A;  2WDR A;  5LHI B;  4OX9 T;  3RC8 A;  3AA7 B;  3RPU A;  3O1H A;  3AAI A;  4DBQ A;  5LJN A;  5M4Y A;  2XAH B;  4CXW A;  5J2T E;  3AA6 B;  4PJN A;  5ABF B;  2AE9 A;  1X79 A;  2X0H A;  2LSJ A;  5HXC A;  3AXJ B;  4COF A;  4YHH T;  4QWN B;  3KV4 A;  1UUS A;  2BKP A;  4EAH A;  5LYJ E;  1XNQ T;  2XQ8 A;  5J2U E;  3MKD A;  4LFC T;  2IW5 B;  1E2A A;  3FBZ A;  4CN1 A;  2FBW A;  4X1I E;  3KBU A;  3C98 B;  4UEL A;  4DUY T;  2LSI A;  1YKH B;  4EEB A;  3N9O A;  5L2L A;  3ONL C;  2BS2 A;  4L5G A;  2UUB T;  5CA1 E;  4ZI3 C;  1WLX A;  3AEG A;  1W09 A;  3C50 A;  2J62 A;  4UV8 B;  3TLS A;  3UT5 E;  4IDZ A;  3EI0 A;  1I94 T;  1I6Z A;  3AE1 A;  3RYI E;  3UFG A;  3ETV A;  1VOM A;  2CHN A;  3AE9 A;  3SOL A;  3RQW A;  4ERR A;  4ASK A;  2W62 A;  2JMH A;  3H3M A;  3ZYL A;  3F57 A;  3K3O A;  4ZS3 A;  2WSS V;  2L9Q A;  1YQ3 A;  2MYS A;  5AQN B;  4EGW A;  5JDH A;  4DR2 T;  2Z6E A;  2KND A;  4AQF C;  4H9N C;  2YK0 A;  4YY3 T;  3CML A;  5AQV B;  4TWH A;  2CEA A;  4LFA T;  2E2A A;  1T7S A;  3RIU A;  3RYH E;  2VQF T;  4LFB T;  4MFR A;  5F8P A;  2Q9Q C;  2VVS A;  4M1P A;  5FY7 A;  5IUX A;  5HAX A;  2WMO A;  5JDG A;  2JPF A;  4Q25 A;  1XMQ T;  4PK6 A;  2K9A A;  5L3B B;  4HFB A;  3FHN A;  3BQK A;  5FXZ A;  3PE0 A;  3H37 A;  4H63 H;  3J9X 1;  3PDY A;  3O9X A;  1UX4 A;  3DTO A;  4HWC A;  3F31 A;  4AIU A;  2NTY A;  2ZM8 A;  4I4T E;  1JNR A;  3EDV A;  1FJG T;  4JBW F;  4AKR B;  2PFV A;  4QX8 B;  4WNK A;  1QUU A;  1YQ4 A;  4CZZ B;  2X9Y A;  4BAY B;  3RX6 A;  3JAD A;  1O3X A;  3AE5 A;  1HX1 B;  3K3N A;  3BQI A;  3CWZ B;  2W66 A;  3KV6 A;  1FMW A;  5EK4 A;  4IDQ A;  5HCJ A;  4DMV A;  5LG4 A;  1LVF A;  4TV9 E;  2CXL A;  3IEE A;  5LA6 E;  4P0A A;  3W15 B;  2UU9 T;  1FMV A;  3Q2M A;  4K0U A;  2ZM6 T;  2CMR A;  2M6B A;  2V6Y A;  2ZLY A;  4PJJ A;  2ES0 A;  2JMK A;  2K24 A;  2WY2 A;  2YU1 A;  4HGA A;  4TNW A;  3TLT A;  4CN4 A;  2V7I A;  2VB6 A;  2X68 A;  3P4W A;  4YTP A;  4DV6 T;  2WZH A;  2B76 A;  1ZKE A;  1OED A;  2VKD A;  3CQG B;  1XDO A;  4QXB B;  4EIW A;  5JDN A;  4KMC A;  5JRC B;  4IGU A;  1VCS A;  2CCQ A;  2CXF A;  2ZM0 A;  2HPJ A;  3B57 A;  3AVR A;  3CIR A;  3IA3 A;  5DQW A;  3RQU A;  4X66 T;  4AXP A;  3U3I A;  5AQF B;  4ANJ A;  3KVA A;  3RGL A;  3L09 A;  3QC9 A;  2XSB A;  4HFV A;  4O4I E;  2L8K A;  3ZCI A;  2X9W A;  4B3S T;  5LXT E;  3QNU A;  3RHW A;  2W61 A;  5AFU L;  2LRK A;  4FJO A;  3N9P A;  1Y01 A;  2D2S A;  2CLY B;  3GWH A;  1V9D A;  2NOX A;  3I1A A;  3N2K E;  5JTG A;  4LMK A;  1E1H B;  5AQL B;  5L47 A;  1XMO T;  5LCY A;  2BG9 E;  4P0B A;  4WW0 A;  4DND A;  4H9Q C;  4IE6 A;  4OYK A;  5FL0 A;  2NW7 A;  2UUA T;  4X65 T;  2NTX A;  3QB5 A;  4MAL A;  5JDQ A;  5ETW A;  4QXC B;  4NXN T;  2BBH A;  2PBI A;  2CBJ A;  2WU2 A;  3N9L A;  1XZY A;  2XQ3 A;  2XQA A;  3H3A A;  3R84 B;  5JRC A;  1WR6 A;  2QGS A;  3ZMZ B;  4EOZ B;  3ZJ1 A;  2H88 A;  2LRL A;  2XQ7 A;  3QUJ A;  1MIV A;  1XWM A;  3FZK B;  3ZT5 A;  2IAK A;  5FY0 A;  5EK3 A;  1MMA A;  3SWH A;  5J0Z A;  3EUH A;  2JQ9 A;  3ZT7 A;  1DU2 A;  2BVL A;  3N9M A;  4DR6 T;  4TUY E;  1QLB A;  3UUX B;  2XSA A;  4HWH A;  2JQH A;  3ZST A;  4H9R C;  4WBN E;  4QXH B;  3FZF B;  4EYU A;  2BDE A;  2VVN A;  4JEU B;  2IHR 1;  3ZMU B;  2WMN A;  2X66 A;  2XQY A;  3GN5 B;  2E8I A;  3I9W A;  2JIW A;  3N9Q A;  3AE3 A;  2K48 A;  1HG2 A;  4GK5 E;  4QH1 A;  4ZEY A;  4ZI2 C;  1UK5 A;  4DV1 T;  4YLH A;  2J47 A;  3ZMT B;  3Q5W A;  3I0Q A;  4TZ4 C;  2CWO A;  1KNZ A;  2X0Y A;  2WZI A;  2DL1 A;  2N1G A;  4JI7 T;  2B1E A;  4WZX A;  2QYW A;  5FXV A;  4I0U A;  4UR9 A;  3UTK A;  4BJM A;  2CA5 A;  1LRZ A;  2KIN B;  5FY1 A;  4DUZ T;  2G0U A;  2Q9Q B;  3PUY F;  3AVS A;  3HKD E;  5AQO B;  2LLY A;  4UF0 A;  2C5K T;  2H3R A;  3NRX A;  4U31 A;  1OED B;  1FIO A;  2K5B B;  3IHR A;  2WP9 A;  3FXE B;  2NR4 A;  3PV0 F;  3NZQ A;  4G2A A;  4MBQ A;  3WAK A;  2D0T A;  5JRE A;  1HS7 A;  4B3R T;  1HCI A;  2XM1 A;  3PJA J;  2W00 A;  3PTR B;  4X20 E;  4ZS2 A;  5AQS B;  2J4G A;  5H6Q B;  3Q5E A;  4YFS A;  4QKN A;  2XTL A;  2FJE A;  4J2C A;  5EZY E;  1J5E T;  4O4H E;  5F5W A;  3M65 A;  1W0B A;  3EHZ A;  2KT9 A;  1W0A A;  3AEA A;  1JNZ A;  2X9X A;  1IZN B;  4U7I A;  2MPK A;  2A2F X;  4NPP A;  2EHO D;  4ZI2 D;  4IDN A;  3EVY A;  4GKJ T;  2V1D B;  5LMN T;  3ANW A;  3LBX A;  3OBV E;  3WI3 A;  2WBL A;  2V26 A;  2MOZ A;  3P50 A;  2BG9 A;  4BA9 A;  2YDQ A;  4JV5 T;  4X1K E;  4A5X A;  4U74 A;  4EV6 A;  3EAB A;  3P4Q A;  3UU8 A;  5EK2 A;  4UVB B;  3ZN0 B;  3QOF A;  1B7T A;  3HR0 A;  3AA0 B;  2XAF B;  4WYV A;  3I0O A;  3JC6 C;  3U78 A;  4AQG A;  3T1H T;  2VL0 A;  2HPL A;  1D0Z A;  2CXD A;  5FP3 A;  2Y6X A;  3ONJ A;  4CI2 B;  2RA1 A;  2LT3 A;  1UX5 A;  2LHN A;  3P7I A;  3RYF E;  2QA7 A;  4NUV A;  4A56 A;  5FNV E;  4DID B;  3DJB A;  2YOE A;  5ADX L;  1IAP A;  3E08 A;  3KVB A;  4DR1 T;  3N5L A;  5AQR B;  3AEE A;  3ZKR A;  4UF0 B;  5HWX A;  2JJ9 A;  4EZ4 A;  5GON E;  5KX5 E;  1HR0 T;  4JI3 T;  4I50 E;  1ZHC A;  5LHG B;  4B3T T;  3AE2 A;  4QHO A;  3JAF A;  1MMN A;  2NW8 A;  1SUM B;  1G8X A;  4DR5 T;  1N32 T;  1UUR A;  5AQU B;  3RH3 A;  3T8O A;  4YTN A;  3C4X A;  3VHL A;  1KNP A;  1MND A;  4QX7 B;  2EHO C;  3ZEF B;  4HN9 A;  3VR9 A;  4DV2 T;  2DI4 A;  2AXD S;  3MA9 A;  3AXJ A;  4O2B E;  4EED A;  1LVK A;  2V7L A;  3L39 A;  5AQK B;  3AAE B;  5IYZ E;  1KNR A;  5ABF A;  3PUG A;  2V6Y B;  1SHZ C;  4LMJ A;  2ZM2 A;  4EXT A;  2KMF A;  5CA0 E;  4KHZ F;  2VQE T;  2LSG A;  2D9D A;  1X9B A;  2ODU A;  3N9N A;  3PUR A;  5ABG A;  3E0Z A;  4K0K T;  4QH5 A;  1LKX A;  5LJM A;  4AQY T;  1KF6 A;  2XQ5 A;  3VRB A;  4DR3 T;  5FVL A;  3ZCJ A;  1XDP A;  2PJQ A;  2W63 A;  2XUE A;  3EDU A;  3RRW A;  3ZMS B;  5L4E A;  3ZC0 A;  4GYR A;  4PNI A;  3MK7 C;  3DP7 A;  3AE4 A;  3PU3 A;  1L0V A;  4EB6 E;  3OYZ A;  4ZOL E;  5AQG B;  3N2O A;  5JR9 A;  5LNK A;  4JUY A;  3UUM A;  3BQL A;  3NKZ A;  3JAE A;  1G73 A;  4TX5 A;  2BKN A;  3ZT6 A;  5HEJ A;  2KSR A;  1WCR A;  5LG3 A;  3P8C D;  4ISS A;  4U7Y A;  3OKQ A;  4U3C A;  3TKL B;  4L9I A;  2X67 A;  5KXJ A;  1IBK T;  2YU2 A;  2HN2 A;  4PK4 A;  2C5I T;  2KLQ A;  3AB3 B;  3CQC B;  4X5T A;  4ZI3 D;  4DR4 T;  4H9P C;  1J5W A;  4CI3 B;  4TNV A;  1U5P A;  4ILC A;  2I0M A;  2A3D A;  4PJL A;  5JQG E;  3C4W A;  3C51 A;  3PUZ F;  4UVC B;  2W0G A;  3CQX C;  1D1C A;  2I59 A;  2Y48 B;  3KV9 A;  4GIW A;  4QH4 A;  4UIG A;  4H63 V;  5FYM A;  3HL6 A;  4TN7 B;  2NW9 A;  3ZN1 B;  3LSV A;  5JR9 C;  4NIQ A;  4LF5 T;  3CK6 A;  4HWF A;  4JEH B;  4PFP A;  1ZOY A;  4DBR A;  2BS3 A;  2XAS B;  5A1L A;  3LDQ B;  1OXZ A;  4TV8 E;  1SE7 A;  4XAX B;  1D1B A;  4ZZB A;  2V6X A;  3ZYM A;  3K3Q C;  3SFD A;  4YSZ A;  4ZHQ E;  2UXX B;  5L3E B;  4DV0 T;  3MZK B;  5LHH B;  3UUB A;  1NWM X;  1D0Y A;  3KBT A;  2LKH A;  4PJM A;  5LGT B;  4C91 A;  2YDS A;  1OED E;  3M3Z B;  2UXN B;  5J1G A;  5HYA A;  3ETU A;  2JQQ A;  3PUQ A;  1FEW A;  4ZXL A;  4G63 A;  5AQH B;  3VRA A;  4YJ2 E;  4H9S E;  2H7O A;  3NRY A;  5DQV A;  2N9D A;  5AQJ B;  2XHE B;  3RF1 A;  4DMW A;  4YXD A;  2YDR A;  1AJ3 A;  2VK9 A;  3AE8 A;  3FZH B;  5JR9 B;  4F8H A;  1YKE B;  1US7 B;  2RPA A;  1HNZ T;  5TAO A;  3MJX A;  3HKE E;  2XAQ B;  2WU5 A;  5FL1 A;  1VCT A;  3AA1 B;  2C5J A;  4PW8 A;  4TWD A;  1D0X A;  3FZL B;  3SFE A;  3AAA B;  4DV3 T;  3P4R A;  3RYC E;  3V5S A;  1WYB A;  2QVA A;  3NVO A;  3PUV F;  2CLY C;  4B3M T;  3RC3 A;  3LJC A;  2XPK A;  4IRE A;  1UCU A;  2LM9 A;  5AQP B;  3A5X A;  3VU7 H;  4IL9 A;  2SPC A;  4L0R A;  4C90 A;  1BR1 A;  3ZLI A;  1T72 A;  2OA5 A;  4OK0 A;  3P4P A;  4JLE A;  4PK5 A;  1E7P A;  3PU8 A;  1YXR A;  4UVA B;  2IC9 A;  3UU5 A;  4AIS A;  4AI6 A;  2L3L A;  3KV5 A;  3FBL A;  5HWY A;  1HFA A;  2E9X A;  2EHO B;  3UQ7 A;  4E7Z A;  4YSX A;  2WS3 A;  3KDS E;  1IBM T;  4DVD A;  2XAG B;  2FUP A;  2IUB A;  2H89 A;  1N34 T;  1NEK A;  1Z0P A;  2D0U A;  2R6G F;  4LF8 T;  4LF7 T;  1IJ6 A;  4ILB A;  5LB7 B;  3A7M A;  3VR8 A;  2M67 A;  4Z91 A;  4CXX A;  2X51 A;  4AKH A;  1M62 A;  4XBF B;  2PTF A;  4U33 A;  2BZB A;  5JH7 E;  1KK7 A;  4XZC A;  3RKO A;  3NWI A;  5AQM B;  1NEN A;  3UQ4 A;  2LOP A;  2VKJ A;  3Q5D A;  4IE0 A;  5L3D B;  4ILU A;  1Y64 B;  3CX8 B;  3FZM B;  5LBM A;  2KXP B;  3CVR A;  2WCA A;  5L4H A;  1GQE A;  5LBQ B;  4KHP T;  3N2G E;  3PUS A;  5HEO A;  2Q9Q D;  4A97 A;  1KFY A;  2C0S A;  5HEU A;  4YJ3 E;  4CQI A;  3TLU A;  4GKK T;  2W2U A;  4HFI A;  2XAJ B;  5HXR A;  5C3J A;  2UXD T;  1T98 A;  3OPC A;  2WB5 A;  2A72 A;  3LK4 2;  3RKG A;  4X64 T;  3HA4 A;  3ZMV B;  4IE4 A;  3KFW X;  2HN1 A;  3NZP A;  5ABE A;  2D5U A;  2LSK A;  3CX7 B;  5HEG A;  1MMD A;  5IHY A;  2W67 A;  4KP3 C;  5L3C B;  2WAU A;  2V7J A;  2RP4 A;  3MXZ A;  3LBX B;  4TWF A;  2CWY A;  3AEB A;  3PUX F;  5F3J A;  5FVK A;  4KUM B;  1S35 A;  2E9X B;  1MMG A;  4IT4 A;  1HF8 A;  4BJN A;  1IJ5 A;  4OFZ A;  4ADZ A;  1HTJ F;  3AEF A;  1EZ3 A;  4MLK A;  2DCF A;  4JI8 T;  4LF4 T;  2UXC T;  4HTE A;  2YEV C;  2FJD A;  5H6R B;  3A8Y C;  1OWA A;  4O4J E;  2A9U A;  3Q9D A;  4P1N A;  3O1J A;  2CHO A;  4F6R C;  3UU3 A;  4IE5 A;  2XQ6 A;  3RIF A;  4LF6 T;  2OLT A;  3GA8 A;  3UFE A;  4E7S A;  2VAS A;  5HXS A;  4JI0 T;  3NBX X;  3KIN B;  3HKC E;  2V7M A;  1ZV4 X;  4X1Y E;  5ABH A;  1T8B A;  5CGM A;  3ZSS A;  5KMG P;  3O4X E;  2CRB A;  1BR2 A;  1W9R A;  2LOS A;  4IL4 A;  4ILA A;  5FXX A;  1R8I A;  2XQ4 A;  3ZJ2 A;  3AEC A;  2M6I A;  2LM2 A;  1VRB A;  4GOU A;  3CPZ A;  3CX6 B;  4O8S A;  2N2N A;  1WRD A;  4Z8X A;  3F2E A;  3K1S A;  4EZH A;  5C8Y E;  4A98 A;  4DV7 T;  2WWU A;  3S4U A;  2DHR A;  5CFB A;  2JRK A;  2V8S V;  3VKG A;  2IIU A;  2LEH A;  3VKH A;  3D0T A;  4AQF A;  3RLF F;  2K3W A;  1N36 T;  2IML A;  2LJL A;  4AKL A;  1SA0 E;  3E22 E;  4IST A;  3RI5 A;  4DV5 T;  2E5L T;  3JCF A;  1N33 T;  1HNW T;  1U4Q A;  3LK2 B;  3IF8 B;  2HHH T;  2XQ9 A;  3GMI A;  2QRX A;  5DJQ C;  2V5C A;  5E0O A;  4EYY R;  4JYA T;  3UUN A;  4WBO A;  2X0L B;  5JDM A;  2W4X A;  5FXW A;  2F4V T;  4DO0 A;  2WDV A;  1XNR T;  4DV4 T;  2VUR A;  3UU6 A;  4NXM T;  2NWB A;  4FI5 A;  5AQT B;  5IWA T;  4LF9 T;  4HEA A;  4IDP A;  5CB4 E;  4YHJ A;  4KI0 F;  2MAW A;  2LE8 A;  1ZEE A;  3OJA A;  4IE7 A;  3Q5X A;  1WR0 A;  2LHR A;  5HXE A;  2BBJ A;  3L8R A;  2MBG A;  1UGO A;  1S94 A;  2IC6 A;  4JI1 T;  2J1D G;  3B5M A;  4GYS A;  4IDO A;  4KX6 A;  5DAB A;  4I43 B;  3HKB E;  4Z90 A;  4YTM A;  5C2T A;  2KZ7 B;  2OV9 A;  4HE8 A;  4O4L E;  5HEH A;  5HXH A;  2DWK A;  4CXY A;  5LGU B;  2FJA A;  1HNX T;  2V5D A;  3TLW A;  3V5U A;  3X1D A;  2XM2 A;  3ZYK A;  5AQI B;  3P4S A;  3PUA A;  4I55 E;  3FB2 A;  3O1I A;  5AQQ B;  2E5V A;  5JVD E;  2LKG A;  3WAJ A;  2UUC T;  4JI5 T;  5CJ5 A;  1HX8 A;  5LOV E;  2UXB T;  3RRC A;  4OYJ A;  1YD8 G;  2WM9 A;  2XZE A;  2VKO A;  4DR7 T;  3SS1 A;  2IDO B;  2MTQ A;  4ZZC A;  2I6H A;  3AE6 A;  5JDL A;  4HFH A;  2CBI A;  3UU4 A;  2Q9Q A;  1HG5 A;  1Z8U A;  4U2Y A;  3ZC1 A;  2DWG A;  3J7Y q;  3GN5 A;  3R6N A;  2EHO A;  3B13 A;  2BG9 C;  3QB5 K;  2NP9 A;  3SRZ A;  4JI4 T;  1WFD A;  2YKS A;  4JI6 T;  3MAC A;  4P09 A;  1H7C A;  2P9B A;  4IHJ E;  4YSY A;  3AE7 A;  4X62 T;  5KDM C;  5LGN B;  2CM0 A;  2VWA A;  4LML A;  3C64 A;  4PAG A;  4B6X A;  3OTO T;  1IBL T;  4JI2 T;  3AED A;  4UV9 B;  4U72 A;  1MIW A;  2DNX A;  2Y8D A;  4CN6 A;  1CUN A;  5LMU T;  5FMN A;  2KWI B;  2GK9 A;  2BS4 A;  2XY8 B;  3L3P A;  1MIY A;  3JC6 D;  3EAM A;  2E9X D;  2H7V C;  3HI2 A; 
#chains in the Genus database with same CATH homology
 4K0K T;  4AQY T;  1XMO T;  4DR3 T;  3T1Y T;  4JV5 T;  4X65 T;  4NXN T;  4B3T T;  2UXC T;  4JI8 T;  4LF4 T;  1IBK T;  5BR8 T;  4LF7 T;  4DR4 T;  4LF6 T;  4OX9 T;  4DR6 T;  4JI0 T;  4DV1 T;  4LF5 T;  4YHH T;  1XNQ T;  4LFC T;  4JI7 T;  4DV0 T;  4DUY T;  4DV7 T;  4DUZ T;  2UUB T;  4DR1 T;  1N36 T;  1I94 T;  2E5L T;  4DV5 T;  1N33 T;  1HNW T;  2HHH T;  1HNZ T;  4JYA T;  4B3R T;  2F4V T;  4DR2 T;  1J5E T;  1XNR T;  4DV4 T;  4NXM T;  4YY3 T;  4DV3 T;  5IWA T;  4LF9 T;  4LFA T;  2VQF T;  4LFB T;  4GKJ T;  4B3M T;  5LMN T;  1XMQ T;  4JI1 T;  3T1H T;  1HNX T;  1FJG T;  1IBM T;  2UUC T;  1N34 T;  4JI5 T;  2UXB T;  4LF8 T;  2UUA T;  4DR7 T;  1HR0 T;  4JI3 T;  2UU9 T;  2ZM6 T;  4DR5 T;  1N32 T;  4DV6 T;  4JI4 T;  4JI6 T;  4DV2 T;  4KHP T;  4X62 T;  4X66 T;  4GKK T;  3OTO T;  1IBL T;  4JI2 T;  2UXD T;  5LMU T;  2VQE T;  4X64 T;  4B3S T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...