3T1YT

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a human anti-codon stem loop (hasl) of transfer rna lysine 3 (trnalys3) bound to an mrna with an aag-codon in the a-site and paromomycin
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
99
structure length
99
Chain Sequence
b'RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAVQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Human tRNA(Lys3)(UUU) Is Pre-Structured by Natural Modifications for Cognate and Wobble Codon Binding through Keto-Enol Tautomerism.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 34
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2011-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 3t1yT00
3T1YT 4GKJT 2UUBT 1N36T 4LFBT 1XNRT 2VQET 1N34T 4YHHT 4DV2T 1HNXT 4DR6T 4DV7T 4JI4T 4DV4T 4LFAT 4JV5T 4YY3T 2HHHT 1XNQT 4X62T 4DV6T 4DV3T 4X65T 4NXMT 4KHPT 4LF6T 4JI8T 4DR3T 4DV1T 1IBLT 4DR2T 3T1HT 4DR7T 4DR4T 2UU9T 1XMOT 4GKKT 4B3TT 4B3MT 4JI0T 4OX9T 4LF9T 1XMQT 1HNZT 2UXCT 2UXDT 4JI2T 4JYAT 4X64T 3OTOT 2UUAT 4LF4T 4LF7T 4LFCT 4JI6T 1N32T 4JI3T 4K0KT 1IBMT 5BR8T 4DV5T 4JI1T 4DUYT 1N33T 4B3RT 4DR5T 5LMNT 1HNWT 4B3ST 4NXNT 4JI7T 2ZM6T 4AQYT 4JI5T 5IWAT 2VQFT 4DUZT 4DV0T 4X66T 2UUCT 1I94T 4LF8T 4LF5T 5LMUT 2F4VT 4DR1T 2UXBT 1J5ET 2E5LT 1HR0T 1IBKT 1FJGT
chains in the Genus database with same CATH superfamily
5JDNA 3KVAA 2I0MA 5HWXA 3EDVA 4YLHA 1J1JA 1N36T 2KWIB 3QK6A 3AEAA 3ZSSA 1HNXT 5JR9B 3VHLA 3AXJA 2W0GA 5L3GB 2XQYA 5BMVE 2W63A 2LM9A 3K8PC 4H63H 1ZV4X 4OHFA 2WMNA 3GMIA 3T1HT 1OEDE 4ASKA 1YQ3A 1XMOT 3SWHA 2IUBA 4ZS3A 1MNEA 3ETUA 3TLSA 3P4SA 1Y64B 5LGUB 2V26A 3C4ZA 3M3ZB 3AA6B 2YDQA 3RLFF 4IE5A 1WLXA 1KNPA 4ILAA 2XQ5A 4OFZA 4DVDA 4HFCA 5GONE 1VCTA 3IF8B 4DUZT 1KK7A 2GK9A 3FB2A 1NAFA 2I6HA 2JMKA 2IAKA 3GWHA 3UFGA 4ERRA 4AQFA 3I0OA 2YOEA 3P50A 2DWGA 5JRCB 4TNVA 2EHOD 1I6ZA 1BR0A 3HKDE 5AQLB 3TKLB 1XZYA 4X1YE 1YKEB 3CK6A 5L2LA 4U2ZA 3AEEA 3RYHE 4UEMA 2CRBA 2PTFA 4O4IE 3ZC1A 2XSAA 2ZM8A 2CXDA 3AEFA 4X65T 4H9RC 3ONJA 5JDFA 2LM2A 3WAKA 3UU6A 5JDMA 1IBLT 1HX8A 2V6YB 2UU9T 4EAHA 1BR4A 4G63A 3AA7B 2JJ9A 3FZFB 1MIYA 3HR0A 4P0BA 2NTYA 2X68A 3AA0B 2VKJA 4QH5A 3ZN1B 5HEUA 3O1JA 4L9IA 4GK0E 3UT5E 1ZP0A 4E7ZA 2DHRA 2NTXA 5AQOB 3IA3A 2V7IA 5L4EA 4EB6E 2BS3A 2LHNA 2VQFT 4CN6A 1L0VA 4HFIA 4H9PC 2NW8A 4FI5A 3BQIA 1J5WA 4MLKA 3KV6A 5CGMA 5FY0A 4WYVA 1D0XA 3RIAA 4ZXLA 3K3OA 3AAIA 1ZHCA 2WCAA 4A98A 4ANJA 1NENA 4FJOA 3X1DA 2E8IA 3U3IA 4H9SE 3CX8B 1N34T 2WBLA 1HS7A 2BG9B 1KEYA 2CWYA 2M6BA 2HHHT 4NXMT 3LBXA 1H7CA 2XM2A 4X5TA 3LFMA 1LRZA 3HKEE 2KNDA 4LF6T 3HA4A 3PURA 4DV1T 2XAGB 1V9DA 3CIRA 5L3DB 2X9YA 3ZT7A 1EZ3A 5M4YA 4O4JE 1MMGA 4WW0A 3P4QA 4H9QC 2NW7A 1HX1B 4GK5E 3RPUA 2JPFA 1T98A 3CX7B 5LYJE 4JI3T 4P1NA 1Z0PA 3EABA 4EYUA 3MZKB 3P4PA 2RP4A 4MBQA 4JEUB 2J1DG 4MFRA 4EGWA 3N9NA 1WYBA 2XQ6A 4JI7T 2V5CA 4IE6A 5JDQA 3Q5DA 3O1IA 3ZMUB 1OWAA 3A8YC 2JMHA 4NPPA 2BBHA 3B57A 3CQGB 5AQGB 5LMUT 2M6IA 2C5KT 5AQQB 3PV0F 4Z91A 2VURA 4NUVA 1VOMA 4HFHA 3CX6B 1WYCA 5HYAA 4U72A 2KINB 1CUNA 2X9XA 3UUBA 1D0ZA 2Y8DA 2ACXA 3RGLA 4DV7T 3N2GE 3LK3B 2VKDA 3PDYA 4CQIA 4YY3T 4X62T 4XBFB 1MMDA 4UR9A 5LJNA 5LOVE 1FMVA 4DIDB 2XQ9A 4A97A 1BR2A 2RA1A 4IE0A 3OJAA 4JI2T 3EUHA 2LSKA 4IL4A 4UIGA 1ZKEA 5JR9A 3ONLC 4AKLA 2KZ7B 5CB4E 1OEDC 5LBMA 3PUWF 2CXLA 2EHOC 1KF6A 1U4QA 5AQJB 5HXEA 5LG3A 1JNRA 5FKYA 2YU2A 1MMAA 3FZLB 5DQVA 4BA9A 5IWAT 4DV0T 3KV5A 3FBLA 5HWYA 2W2UA 2FJAA 5C8YE 3F31A 3RC8A 4OYKA 3S4UA 3BQKA 3V5SA 3AE4A 5ABFB 3HL6A 2E5LT 2XQ3A 4KMCA 2WSSV 2VVNA 4F8HA 5EZYE 3I9YA 3T1YT 4LMKA 1G73A 4YHHT 3AECA 2MOZA 3NZPA 2XZEA 3EVYA 3HI2A 4X1IE 3FXDB 5KDMC 4LFAT 3PUAA 2BS4A 3CKDA 4UXNB 4BJNA 2CLYB 2JQHA 1WRDA 3Q5EA 2X67A 3PJAA 3PUSA 4M1PA 3AEGA 4U7YA 3L39A 3RHWA 4CXYA 5HXHA 5JRCA 4B3MT 4KHZF 3ZPOA 3DP7A 1X9BA 5L3EB 2MYSA 3NBXX 3ESLA 2OV9A 3PU3A 4O4LE 2G0UA 2ODVA 2YDSA 2RPAA 3SOLA 3OTOT 2N9DA 4TZ4C 2VASA 4WNKA 3UQ4A 3RI5A 2QVAA 2L8KA 2V6YA 2VKHA 2PBIA 5CJ5A 3AE1A 2DL1A 3K1SA 4XZCA 4Z8XA 5F8PA 5FL0A 2WWUA 2BS2A 3L8RA 5A1LA 4EZHA 3R6NA 2LKHA 3NZQA 3P8CD 2WY2A 5CFBA 3UUMA 5AQTB 2CBJA 3NRXA 2YKSA 1J5ET 2XQ8A 4QH1A 5LB7B 2YK0A 1XWMA 5EK2A 2JQQA 4HFEA 2V7KA 3C98B 3KVBA 1UX4A 3AVSA 5J0ZA 4LMLA 2E2AA 4PFPA 3ETVA 1ZEEA 5FXXA 2CE7A 4WBNE 3N9QA 1YD8G 4LMJA 1QSDA 1SE7A 3AE5A 2XTLA 4ZZCA 1ZOYA 5DJQC 3E0ZA 3Q9DA 4IDZA 5AQSB 4U33A 4QH4A 2BG9A 2EHOB 3TLVA 4JYAT 4ILBA 3ZMVB 2V7LA 4DV5T 2IMLA 1OXZA 2LLYA 4Z90A 4BAYB 4I43B 3NRYA 3PUGA 3ZJ2A 2Q9QD 4Q25A 1D1CA 4AKGA 2ZM6T 1W9RA 4PNIA 4TWFA 4X66T 4I50E 3JAFA 2J4GA 4GIWA 2BKNA 5TAOA 3BQLA 1T8BA 5ETWA 1KNRA 1UURA 3V5UA 2K48A 3ZCIA 2XAJB 2BZBA 3JC6D 3BK9A 1FJGT 2DI4A 4HGAA 1FMWA 5J1GA 2X51A 3AB3B 4PAGA 2WB5A 3AE2A 3RKGA 2LKGA 4N78D 3OVUA 2HH7A 2H88A 3W15B 4ZI3D 1MNDA 2JIWA 4YTPA 4KHPT 2XJ7A 1GQEA 5EK3A 4COFA 4OX9T 4LF9T 3FZMB 2CPTA 2DWKA 2UXCT 3UUXB 2MPKA 3OPCA 3FZKB 3RIFA 3E08A 5F5WA 4IGUA 4ZZBA 5HAXA 3ZJ1A 1HTJF 4CXXA 2PG8A 4PJNA 4ILCA 4TV9E 4NXNT 5LCYA 5FVLA 3VRBA 1XDPA 2QYWA 2WU2A 5FXVA 3K3NA 3ZYLA 5FXZA 4LF5T 1Z8UA 2JQKA 3QC9A 4IDOA 4KP3C 4X1KE 4JUYA 2MBGA 4CI3B 2D5UA 3SFDA 2E9XD 5JDHA 3VKHA 4YTNA 4QX7B 3LJCA 3AEDA 1W0AA 4EEBA 3OBVE 2ODUA 2CA5A 5ABFA 4DR3T 3N5LA 5AQKB 4DR7T 4KUMB 3RIUC 4ZS2A 3ZC0A 2XQ4A 2IC6A 4X64T 2BKPA 2DNXA 4J2CA 2Y48B 1E7PA 2DLRA 4U31A 4QWNB 3RQWA 2VB6A 4PK6A 4CN4A 2KWHA 3FZHB 3P4WA 4HWFA 2CWOA 2WDQA 2BG9E 2W66A 2C5JA 5DQWA 3NWIA 4OYJA 3LG7A 4TNWA 4GYRA 3G06A 3C51A 4DR1T 5LGTB 3FBZA 3AE8A 2X9WA 2LE8A 5H6RB 4JBWF 5HEJA 5LHGB 2BVMA 3HKBE 3QB5A 3IBPA 5LNKA 2WQYA 2OA5A 1WFDA 1NWMX 3O4XE 4JV5T 3LK2B 2IW5B 5AQUB 3FXEB 2Q9QC 4YJ2E 4MALA 4ADZA 4UVBB 2LSYA 4GYSA 3CWZB 3AE9A 2W4XA 5JVDE 2E5VA 5L47A 4UV9B 4G2AA 2IDOB 3SFEA 5LXTE 1UK5A 2K3WA 2VKOA 5HEGA 3ANWB 4K0KT 3UU4A 3RH3A 3MXZA 2YDRA 3JC6C 3N9OA 4YSZA 4DUYT 2LHRA 4DR5T 5LMNT 2W61A 1SUMB 3UTKA 3J9X1 1O3XA 3QNUA 2H7VC 4O2AE 4AKIA 5HEHA 4AKRB 4ZI3C 4TUYE 2Y6XA 2EHOA 2W62A 1T7SA 5L3BB 5ABGA 3N9LA 2KT9A 2FUPA 4WZXA 2LRKA 2XQ7A 4TV8E 4ZI2D 4L0RA 4KI0F 2V1DB 2IHR1 4L5GA 4JEHB 3B5MA 4PJMA 5JR9C 4I4TE 3UU5A 2CCQA 3LSVA 4IIJE 4UVCB 3AEBA 3PUVF 1YKHB 5JTGA 1QLBA 4O8SA 2CHNA 1LVKA 3UULA 2CXFA 2PFVA 4QHOA 2VK9A 3KFWX 3AE7A 4CI1B 2XM1A 4DV6T 3ZKRA 5J2UE 3GN5B 4YXDA 3UQ7A 3KBUA 1HG2A 1JNZA 3JCFA 4PJLA 2A72A 1MIWA 2X0LB 2ZLYA 2D0UA 3N9PA 3UU3A 3ZT5A 3EDUA 3DTOA 4ISSA 1KNZA 4XAXB 2AE9A 2ES0A 2PJQA 1IJ5A 3CQCB 3TLUA 4LF7T 4TX5A 4P0AA 1N32T 1WR0A 3AA1B 5LGNB 2IC9A 4ZEYA 2E9XC 3RQUA 3QB5K 4AKHA 3WAJA 2UUCT 1CHUA 2WAUA 5AQRB 4AXPA 2K24A 3R84B 5KXJA 4EYYR 3RF1A 2A3DA 4U2YA 5LHHB 3O9XA 3T8OA 3ZLIA 3OYXA 5AQPB 5CA0E 2HN1A 3ZMTB 3IHRA 1U5PA 2XASB 5L3FB 2NW9A 3D0TA 3ZN0B 5L4HA 3DJBA 2CHOA 2Q9QB 4DV2T 4HE8A 4V1Av 3F57A 2K9AA 2XUEA 3MKDA 4JI4T 5LP6E 1XNQT 3C4WA 2KMFA 5DABA 4DR2T 1IJ6A 3H3MA 3MACA 2VWAA 5ABEA 1BR1A 1VRBA 3M65A 2YINA 2IIUA 3CMLA 1YW0A 4EEDA 1NEKA 4TWHA 4HFDA 4TWDA 1MMNA 4UV8B 5L3CB 2ZMAA 2ZM0A 2LJLA 1IBMT 2QRXA 3JADA 2KSRA 5IYZE 2HN2A 2X0YA 3RYCE 4YT0A 2WM9A 4B3ST 1DU2A 1OEDB 3ZYMA 4DBRA 3ZMSB 2D2SA 4IREA 2LOPA 3ZT6A 1SA0E 3GA8A 2YEVC 4H9NC 5LG4A 4YSXA 5JREA 4DNDA 2WP9A 2V7JA 4EV6A 4ZHQE 2F4VT 4O4HE 3ABVA 2JRKA 2R6GF 1WR6A 1HR0T 4PJJA 2A9UA 2VL8A 3JAEA 2BG9C 3TLWA 4H63V 1AJ3A 2QA7A 3EAMA 2ACZA 5FY7A 1XNRT 3PTRB 4EOZB 4HEAA 5HXSA 4EIWA 3KDSE 2C0SA 4P09A 3RYFE 1IZNB 3L09A 5CA1E 4CZZB 1S94A 2N2NA 3I9WA 4GKKT 2J62A 5F3JA 2NWBA 4UF0B 3UU8A 2H7OA 2C5IT 4ZI2C 2UUAT 4LF4T 2E9XB 2WWVA 4E7SA 3MK7C 4JI6T 3KV4A 3B13A 5BR8T 3E22E 3L3PA 3PUYF 2WMOA 4B3RT 4AQFC 5FP3A 4JLEA 3ONXA 3H37A 2UXNB 2NP9A 5C2TA 1I94T 4YTMA 2A2FX 5FYMA 4CN1A 5IHYA 2YU1A 3ANWA 3C64A 5H6QB 3RX6A 4CXWA 4K0UA 4IDNA 1IBKT 5AQNB 1KFYA 3NKZA 2KLQA 2UUBT 4PK5A 4DMWA 3EHZA 2XAQB 2MTQA 1E2AA 2LSGA 2BKOA 4DR6T 4PFOA 2HPJA 5E0OA 5FNVE 4DV4T 4C91A 3I1AA 4EXTA 4DV3T 4WBOA 5FL1A 3AE6A 3VRAA 2B76A 3KINB 5FY1A 3ZEFB 1FEWA 4JI0T 1UCUA 4DMVA 5ADXL 4AISA 2B1EA 3C4XA 3ZMZB 1W0BA 5AQMB 1E1HB 1HF8A 5JDGA 2CMRA 2WZHA 2XQAA 4QXCB 4JI1T 1HG5A 3GN5A 4TN7B 2VVSA 3LK42 1N33T 3RIUA 1HNWT 3J7Yq 5ABHA 5EK4A 4JI5T 2W00A 4A5XA 5AFUL 3CVRA 1D0YA 2N1GA 1Y01A 3AE3A 3AXJB 2X9HA 3PUXF 3U78A 2P9BA 5LHIB 1LKXA 3PU8A 4I55E 4HWHA 3VKGA 4C90A 2UXBT 4B6XA 2JQ9A 2X0HA 3QOFA 4PK4A 1YXRA 2QGSA 3KBTA 2CLYC 1D1BA 2VQET 2H89A 2CBIA 4NIQA 2XAHB 2XPKA 5JDLA 4CI2B 3RYIE 2LSJA 4BJMA 4YJ3E 1S35A 5AQVB 1R8IA 4UVAB 3RC3A 4DO0A 4JI8T 5HCMA 1FIOA 4UELA 3KV9A 3Q5XA 4AQGA 2NOXA 2CM0A 1WCRA 4KX6A 5AQIB 1X79A 2SPCA 1HNZT 3AAAB 5LBQB 1UGOA 2Q9QA 1US7B 3FHNA 4U3CA 5HXCA 1HFAA 4EZ4A 4O2BE 4IE4A 4LFCT 3H3AA 2X66A 2AXDS 3OYZA 3Q5WA 2XAFB 3AAEB 4DBQA 4H9OC 3PE0A 3Q2MA 4F6RC 2OLTA 4HWCA 2V7MA 4ZI7E 1M62A 4ILUA 1T72A 1W09A 2WZIA 4AIUA 4IHJE 4QXHB 4U74A 5KX5E 2BDEA 2HPLA 3SS1A 3SRZA 3UFEA 2V6XA 2BBJA 5FVKA 1OEDA 2LEHA 4GOUA 4IDQA 1SHZC 4LFBT 3IEEA 4YHJA 4AI6A 3UUNA 3CPZA 4YSYA 2DCFA 3PUQA 2BVLA 2Z6EA 3ZCJA 3NVOA 3EI0A 3O1HA 2WS3A 5HXRA 1UX5A 4B3TT 4ISTA 4HWIB 2XY8B 3C50A 3OKQA 2LSIA 2LRLA 3VR8A 2V8SV 4QX8B 3QUJA 5HCJA 4HWDA 2D0TA 3MJXA 5HEOA 3I0QA 2H3RA 4I0UA 2FJEA 2CEAA 4MHCA 2WDVA 5LA6E 3ZYKA 3N2KE 4IE7A 4HN9A 3P7IA 5JQGE 4HFVA 2W67A 4UF0A 2WDRA 3LDQB 4HKAA 2L3LA 4IL9A 2E9XA 3K3QC 4IDPA 1IAPA 3ZSTA 3LBXB 1LVFA 2ZM2A 4KBMB 4HFBA 4GKJT 4ZOLE 1MIVA 3TLTA 4A56A 5JH7E 2FBWA 3N9MA 2J47A 1D1AA 3A5XA 2NR4A 2I59A 3WI3A 3AVRA 5IUXA 4IT4A 2KXPB 4YFSA 5AQFB 1M7KA 4PW8A 3VR9A 3F2EA 1QUUA 3RRWA 4NUUA 2M67A 4DR4T 3MA9A 5FMNA 3VU7H 2V5DA 5LJMA 1XMQT 2UXDT 4U7IA 2LT3A 2K5BB 4QKNA 2XHEB 3PUZF 5AQHB 3HKCE 2FJBA 4OK0A 1UUSA 3RKOA 3P4RA 2YN6A 4QXBB 5J2TE 2FJDA 4AQYT 1YQ4A 3PJAJ 1HCIA 1G8XA 5C3JA 1XDOA 4LF8T 2XSBA 2D9DA 3CQXC 4X20E 5FXWA 2L9QA 2WU5A 2UXXB 1VCSA 2LOSA 1B7TA 3A7MA 2VL0A 3N2OA 5KMGP 3RRCA 4HTEA 2MAWA
chains in the Genus database with same CATH topology
3T1YT 4GKJT 2UUBT 1N36T 4LFBT 1XNRT 2VQET 1N34T 4YHHT 4DV2T 1HNXT 4DR6T 4DV7T 4JI4T 4DV4T 4LFAT 4JV5T 4YY3T 2HHHT 1XNQT 4X62T 4DV6T 4DV3T 4X65T 4NXMT 4KHPT 4LF6T 4JI8T 4DR3T 4DV1T 1IBLT 4DR2T 3T1HT 4DR7T 4DR4T 2UU9T 1XMOT 4GKKT 4B3TT 4B3MT 4JI0T 4OX9T 4LF9T 1XMQT 1HNZT 2UXCT 2UXDT 4JI2T 4JYAT 4X64T 3OTOT 2UUAT 4LF4T 4LF7T 4LFCT 4JI6T 1N32T 4JI3T 4K0KT 1IBMT 5BR8T 4DV5T 4JI1T 4DUYT 1N33T 4B3RT 4DR5T 5LMNT 1HNWT 4B3ST 4NXNT 4JI7T 2ZM6T 4AQYT 4JI5T 5IWAT 2VQFT 4DUZT 4DV0T 4X66T 2UUCT 1I94T 4LF8T 4LF5T 5LMUT 2F4VT 4DR1T 2UXBT 1J5ET 2E5LT 1HR0T 1IBKT 1FJGT
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T1Y T;  4GKJ T;  2UUB T;  1N36 T;  4LFB T;  1XNR T;  2VQE T;  1N34 T;  4YHH T;  4DV2 T;  1HNX T;  4DR6 T;  4DV7 T;  4JI4 T;  4DV4 T;  4LFA T;  4JV5 T;  4YY3 T;  2HHH T;  1XNQ T;  4X62 T;  4DV6 T;  4DV3 T;  4X65 T;  4NXM T;  4KHP T;  4LF6 T;  4JI8 T;  4DR3 T;  4DV1 T;  1IBL T;  4DR2 T;  3T1H T;  4DR7 T;  4DR4 T;  2UU9 T;  1XMO T;  4GKK T;  4B3T T;  4B3M T;  4JI0 T;  4OX9 T;  4LF9 T;  1XMQ T;  1HNZ T;  2UXC T;  2UXD T;  4JI2 T;  4JYA T;  4X64 T;  3OTO T;  2UUA T;  4LF4 T;  4LF7 T;  4LFC T;  4JI6 T;  1N32 T;  4JI3 T;  4K0K T;  1IBM T;  5BR8 T;  4DV5 T;  4JI1 T;  4DUY T;  1N33 T;  4B3R T;  4DR5 T;  5LMN T;  1HNW T;  4B3S T;  4NXN T;  4JI7 T;  2ZM6 T;  4AQY T;  4JI5 T;  5IWA T;  2VQF T;  4DUZ T;  4DV0 T;  4X66 T;  2UUC T;  1I94 T;  4LF8 T;  4LF5 T;  5LMU T;  2F4V T;  4DR1 T;  2UXB T;  1J5E T;  2E5L T;  1HR0 T;  1IBK T;  1FJG T; 
#chains in the Genus database with same CATH topology
 5JDN A;  3KVA A;  2I0M A;  5HWX A;  3EDV A;  4YLH A;  1J1J A;  1N36 T;  2KWI B;  3QK6 A;  3AEA A;  3ZSS A;  1HNX T;  5JR9 B;  3VHL A;  3AXJ A;  2W0G A;  5L3G B;  2XQY A;  5BMV E;  2W63 A;  2LM9 A;  3K8P C;  4H63 H;  1ZV4 X;  4OHF A;  2WMN A;  3GMI A;  3T1H T;  1OED E;  4ASK A;  1YQ3 A;  1XMO T;  3SWH A;  2IUB A;  4ZS3 A;  1MNE A;  3ETU A;  3TLS A;  3P4S A;  1Y64 B;  5LGU B;  2V26 A;  3C4Z A;  3M3Z B;  3AA6 B;  2YDQ A;  3RLF F;  4IE5 A;  1WLX A;  1KNP A;  4ILA A;  2XQ5 A;  4OFZ A;  4DVD A;  4HFC A;  5GON E;  1VCT A;  3IF8 B;  4DUZ T;  1KK7 A;  2GK9 A;  3FB2 A;  1NAF A;  2I6H A;  2JMK A;  2IAK A;  3GWH A;  3UFG A;  4ERR A;  4AQF A;  3I0O A;  2YOE A;  3P50 A;  2DWG A;  5JRC B;  4TNV A;  2EHO D;  1I6Z A;  1BR0 A;  3HKD E;  5AQL B;  3TKL B;  1XZY A;  4X1Y E;  1YKE B;  3CK6 A;  5L2L A;  4U2Z A;  3AEE A;  3RYH E;  4UEM A;  2CRB A;  2PTF A;  4O4I E;  3ZC1 A;  2XSA A;  2ZM8 A;  2CXD A;  3AEF A;  4X65 T;  4H9R C;  3ONJ A;  5JDF A;  2LM2 A;  3WAK A;  3UU6 A;  5JDM A;  1IBL T;  1HX8 A;  2V6Y B;  2UU9 T;  4EAH A;  1BR4 A;  4G63 A;  3AA7 B;  2JJ9 A;  3FZF B;  1MIY A;  3HR0 A;  4P0B A;  2NTY A;  2X68 A;  3AA0 B;  2VKJ A;  4QH5 A;  3ZN1 B;  5HEU A;  3O1J A;  4L9I A;  4GK0 E;  3UT5 E;  1ZP0 A;  4E7Z A;  2DHR A;  2NTX A;  5AQO B;  3IA3 A;  2V7I A;  5L4E A;  4EB6 E;  2BS3 A;  2LHN A;  2VQF T;  4CN6 A;  1L0V A;  4HFI A;  4H9P C;  2NW8 A;  4FI5 A;  3BQI A;  1J5W A;  4MLK A;  3KV6 A;  5CGM A;  5FY0 A;  4WYV A;  1D0X A;  3RIA A;  4ZXL A;  3K3O A;  3AAI A;  1ZHC A;  2WCA A;  4A98 A;  4ANJ A;  1NEN A;  4FJO A;  3X1D A;  2E8I A;  3U3I A;  4H9S E;  3CX8 B;  1N34 T;  2WBL A;  1HS7 A;  2BG9 B;  1KEY A;  2CWY A;  2M6B A;  2HHH T;  4NXM T;  3LBX A;  1H7C A;  2XM2 A;  4X5T A;  3LFM A;  1LRZ A;  3HKE E;  2KND A;  4LF6 T;  3HA4 A;  3PUR A;  4DV1 T;  2XAG B;  1V9D A;  3CIR A;  5L3D B;  2X9Y A;  3ZT7 A;  1EZ3 A;  5M4Y A;  4O4J E;  1MMG A;  4WW0 A;  3P4Q A;  4H9Q C;  2NW7 A;  1HX1 B;  4GK5 E;  3RPU A;  2JPF A;  1T98 A;  3CX7 B;  5LYJ E;  4JI3 T;  4P1N A;  1Z0P A;  3EAB A;  4EYU A;  3MZK B;  3P4P A;  2RP4 A;  4MBQ A;  4JEU B;  2J1D G;  4MFR A;  4EGW A;  3N9N A;  1WYB A;  2XQ6 A;  4JI7 T;  2V5C A;  4IE6 A;  5JDQ A;  3Q5D A;  3O1I A;  3ZMU B;  1OWA A;  3A8Y C;  2JMH A;  4NPP A;  2BBH A;  3B57 A;  3CQG B;  5AQG B;  5LMU T;  2M6I A;  2C5K T;  5AQQ B;  3PV0 F;  4Z91 A;  2VUR A;  4NUV A;  1VOM A;  4HFH A;  3CX6 B;  1WYC A;  5HYA A;  4U72 A;  2KIN B;  1CUN A;  2X9X A;  3UUB A;  1D0Z A;  2Y8D A;  2ACX A;  3RGL A;  4DV7 T;  3N2G E;  3LK3 B;  2VKD A;  3PDY A;  4CQI A;  4YY3 T;  4X62 T;  4XBF B;  1MMD A;  4UR9 A;  5LJN A;  5LOV E;  1FMV A;  4DID B;  2XQ9 A;  4A97 A;  1BR2 A;  2RA1 A;  4IE0 A;  3OJA A;  4JI2 T;  3EUH A;  2LSK A;  4IL4 A;  4UIG A;  1ZKE A;  5JR9 A;  3ONL C;  4AKL A;  2KZ7 B;  5CB4 E;  1OED C;  5LBM A;  3PUW F;  2CXL A;  2EHO C;  1KF6 A;  1U4Q A;  5AQJ B;  5HXE A;  5LG3 A;  1JNR A;  5FKY A;  2YU2 A;  1MMA A;  3FZL B;  5DQV A;  4BA9 A;  5IWA T;  4DV0 T;  3KV5 A;  3FBL A;  5HWY A;  2W2U A;  2FJA A;  5C8Y E;  3F31 A;  3RC8 A;  4OYK A;  3S4U A;  3BQK A;  3V5S A;  3AE4 A;  5ABF B;  3HL6 A;  2E5L T;  2XQ3 A;  4KMC A;  2WSS V;  2VVN A;  4F8H A;  5EZY E;  3I9Y A;  3T1Y T;  4LMK A;  1G73 A;  4YHH T;  3AEC A;  2MOZ A;  3NZP A;  2XZE A;  3EVY A;  3HI2 A;  4X1I E;  3FXD B;  5KDM C;  4LFA T;  3PUA A;  2BS4 A;  3CKD A;  4UXN B;  4BJN A;  2CLY B;  2JQH A;  1WRD A;  3Q5E A;  2X67 A;  3PJA A;  3PUS A;  4M1P A;  3AEG A;  4U7Y A;  3L39 A;  3RHW A;  4CXY A;  5HXH A;  5JRC A;  4B3M T;  4KHZ F;  3ZPO A;  3DP7 A;  1X9B A;  5L3E B;  2MYS A;  3NBX X;  3ESL A;  2OV9 A;  3PU3 A;  4O4L E;  2G0U A;  2ODV A;  2YDS A;  2RPA A;  3SOL A;  3OTO T;  2N9D A;  4TZ4 C;  2VAS A;  4WNK A;  3UQ4 A;  3RI5 A;  2QVA A;  2L8K A;  2V6Y A;  2VKH A;  2PBI A;  5CJ5 A;  3AE1 A;  2DL1 A;  3K1S A;  4XZC A;  4Z8X A;  5F8P A;  5FL0 A;  2WWU A;  2BS2 A;  3L8R A;  5A1L A;  4EZH A;  3R6N A;  2LKH A;  3NZQ A;  3P8C D;  2WY2 A;  5CFB A;  3UUM A;  5AQT B;  2CBJ A;  3NRX A;  2YKS A;  1J5E T;  2XQ8 A;  4QH1 A;  5LB7 B;  2YK0 A;  1XWM A;  5EK2 A;  2JQQ A;  4HFE A;  2V7K A;  3C98 B;  3KVB A;  1UX4 A;  3AVS A;  5J0Z A;  4LML A;  2E2A A;  4PFP A;  3ETV A;  1ZEE A;  5FXX A;  2CE7 A;  4WBN E;  3N9Q A;  1YD8 G;  4LMJ A;  1QSD A;  1SE7 A;  3AE5 A;  2XTL A;  4ZZC A;  1ZOY A;  5DJQ C;  3E0Z A;  3Q9D A;  4IDZ A;  5AQS B;  4U33 A;  4QH4 A;  2BG9 A;  2EHO B;  3TLV A;  4JYA T;  4ILB A;  3ZMV B;  2V7L A;  4DV5 T;  2IML A;  1OXZ A;  2LLY A;  4Z90 A;  4BAY B;  4I43 B;  3NRY A;  3PUG A;  3ZJ2 A;  2Q9Q D;  4Q25 A;  1D1C A;  4AKG A;  2ZM6 T;  1W9R A;  4PNI A;  4TWF A;  4X66 T;  4I50 E;  3JAF A;  2J4G A;  4GIW A;  2BKN A;  5TAO A;  3BQL A;  1T8B A;  5ETW A;  1KNR A;  1UUR A;  3V5U A;  2K48 A;  3ZCI A;  2XAJ B;  2BZB A;  3JC6 D;  3BK9 A;  1FJG T;  2DI4 A;  4HGA A;  1FMW A;  5J1G A;  2X51 A;  3AB3 B;  4PAG A;  2WB5 A;  3AE2 A;  3RKG A;  2LKG A;  4N78 D;  3OVU A;  2HH7 A;  2H88 A;  3W15 B;  4ZI3 D;  1MND A;  2JIW A;  4YTP A;  4KHP T;  2XJ7 A;  1GQE A;  5EK3 A;  4COF A;  4OX9 T;  4LF9 T;  3FZM B;  2CPT A;  2DWK A;  2UXC T;  3UUX B;  2MPK A;  3OPC A;  3FZK B;  3RIF A;  3E08 A;  5F5W A;  4IGU A;  4ZZB A;  5HAX A;  3ZJ1 A;  1HTJ F;  4CXX A;  2PG8 A;  4PJN A;  4ILC A;  4TV9 E;  4NXN T;  5LCY A;  5FVL A;  3VRB A;  1XDP A;  2QYW A;  2WU2 A;  5FXV A;  3K3N A;  3ZYL A;  5FXZ A;  4LF5 T;  1Z8U A;  2JQK A;  3QC9 A;  4IDO A;  4KP3 C;  4X1K E;  4JUY A;  2MBG A;  4CI3 B;  2D5U A;  3SFD A;  2E9X D;  5JDH A;  3VKH A;  4YTN A;  4QX7 B;  3LJC A;  3AED A;  1W0A A;  4EEB A;  3OBV E;  2ODU A;  2CA5 A;  5ABF A;  4DR3 T;  3N5L A;  5AQK B;  4DR7 T;  4KUM B;  3RIU C;  4ZS2 A;  3ZC0 A;  2XQ4 A;  2IC6 A;  4X64 T;  2BKP A;  2DNX A;  4J2C A;  2Y48 B;  1E7P A;  2DLR A;  4U31 A;  4QWN B;  3RQW A;  2VB6 A;  4PK6 A;  4CN4 A;  2KWH A;  3FZH B;  3P4W A;  4HWF A;  2CWO A;  2WDQ A;  2BG9 E;  2W66 A;  2C5J A;  5DQW A;  3NWI A;  4OYJ A;  3LG7 A;  4TNW A;  4GYR A;  3G06 A;  3C51 A;  4DR1 T;  5LGT B;  3FBZ A;  3AE8 A;  2X9W A;  2LE8 A;  5H6R B;  4JBW F;  5HEJ A;  5LHG B;  2BVM A;  3HKB E;  3QB5 A;  3IBP A;  5LNK A;  2WQY A;  2OA5 A;  1WFD A;  1NWM X;  3O4X E;  4JV5 T;  3LK2 B;  2IW5 B;  5AQU B;  3FXE B;  2Q9Q C;  4YJ2 E;  4MAL A;  4ADZ A;  4UVB B;  2LSY A;  4GYS A;  3CWZ B;  3AE9 A;  2W4X A;  5JVD E;  2E5V A;  5L47 A;  4UV9 B;  4G2A A;  2IDO B;  3SFE A;  5LXT E;  1UK5 A;  2K3W A;  2VKO A;  5HEG A;  3ANW B;  4K0K T;  3UU4 A;  3RH3 A;  3MXZ A;  2YDR A;  3JC6 C;  3N9O A;  4YSZ A;  4DUY T;  2LHR A;  4DR5 T;  5LMN T;  2W61 A;  1SUM B;  3UTK A;  3J9X 1;  1O3X A;  3QNU A;  2H7V C;  4O2A E;  4AKI A;  5HEH A;  4AKR B;  4ZI3 C;  4TUY E;  2Y6X A;  2EHO A;  2W62 A;  1T7S A;  5L3B B;  5ABG A;  3N9L A;  2KT9 A;  2FUP A;  4WZX A;  2LRK A;  2XQ7 A;  4TV8 E;  4ZI2 D;  4L0R A;  4KI0 F;  2V1D B;  2IHR 1;  4L5G A;  4JEH B;  3B5M A;  4PJM A;  5JR9 C;  4I4T E;  3UU5 A;  2CCQ A;  3LSV A;  4IIJ E;  4UVC B;  3AEB A;  3PUV F;  1YKH B;  5JTG A;  1QLB A;  4O8S A;  2CHN A;  1LVK A;  3UUL A;  2CXF A;  2PFV A;  4QHO A;  2VK9 A;  3KFW X;  3AE7 A;  4CI1 B;  2XM1 A;  4DV6 T;  3ZKR A;  5J2U E;  3GN5 B;  4YXD A;  3UQ7 A;  3KBU A;  1HG2 A;  1JNZ A;  3JCF A;  4PJL A;  2A72 A;  1MIW A;  2X0L B;  2ZLY A;  2D0U A;  3N9P A;  3UU3 A;  3ZT5 A;  3EDU A;  3DTO A;  4ISS A;  1KNZ A;  4XAX B;  2AE9 A;  2ES0 A;  2PJQ A;  1IJ5 A;  3CQC B;  3TLU A;  4LF7 T;  4TX5 A;  4P0A A;  1N32 T;  1WR0 A;  3AA1 B;  5LGN B;  2IC9 A;  4ZEY A;  2E9X C;  3RQU A;  3QB5 K;  4AKH A;  3WAJ A;  2UUC T;  1CHU A;  2WAU A;  5AQR B;  4AXP A;  2K24 A;  3R84 B;  5KXJ A;  4EYY R;  3RF1 A;  2A3D A;  4U2Y A;  5LHH B;  3O9X A;  3T8O A;  3ZLI A;  3OYX A;  5AQP B;  5CA0 E;  2HN1 A;  3ZMT B;  3IHR A;  1U5P A;  2XAS B;  5L3F B;  2NW9 A;  3D0T A;  3ZN0 B;  5L4H A;  3DJB A;  2CHO A;  2Q9Q B;  4DV2 T;  4HE8 A;  4V1A v;  3F57 A;  2K9A A;  2XUE A;  3MKD A;  4JI4 T;  5LP6 E;  1XNQ T;  3C4W A;  2KMF A;  5DAB A;  4DR2 T;  1IJ6 A;  3H3M A;  3MAC A;  2VWA A;  5ABE A;  1BR1 A;  1VRB A;  3M65 A;  2YIN A;  2IIU A;  3CML A;  1YW0 A;  4EED A;  1NEK A;  4TWH A;  4HFD A;  4TWD A;  1MMN A;  4UV8 B;  5L3C B;  2ZMA A;  2ZM0 A;  2LJL A;  1IBM T;  2QRX A;  3JAD A;  2KSR A;  5IYZ E;  2HN2 A;  2X0Y A;  3RYC E;  4YT0 A;  2WM9 A;  4B3S T;  1DU2 A;  1OED B;  3ZYM A;  4DBR A;  3ZMS B;  2D2S A;  4IRE A;  2LOP A;  3ZT6 A;  1SA0 E;  3GA8 A;  2YEV C;  4H9N C;  5LG4 A;  4YSX A;  5JRE A;  4DND A;  2WP9 A;  2V7J A;  4EV6 A;  4ZHQ E;  2F4V T;  4O4H E;  3ABV A;  2JRK A;  2R6G F;  1WR6 A;  1HR0 T;  4PJJ A;  2A9U A;  2VL8 A;  3JAE A;  2BG9 C;  3TLW A;  4H63 V;  1AJ3 A;  2QA7 A;  3EAM A;  2ACZ A;  5FY7 A;  1XNR T;  3PTR B;  4EOZ B;  4HEA A;  5HXS A;  4EIW A;  3KDS E;  2C0S A;  4P09 A;  3RYF E;  1IZN B;  3L09 A;  5CA1 E;  4CZZ B;  1S94 A;  2N2N A;  3I9W A;  4GKK T;  2J62 A;  5F3J A;  2NWB A;  4UF0 B;  3UU8 A;  2H7O A;  2C5I T;  4ZI2 C;  2UUA T;  4LF4 T;  2E9X B;  2WWV A;  4E7S A;  3MK7 C;  4JI6 T;  3KV4 A;  3B13 A;  5BR8 T;  3E22 E;  3L3P A;  3PUY F;  2WMO A;  4B3R T;  4AQF C;  5FP3 A;  4JLE A;  3ONX A;  3H37 A;  2UXN B;  2NP9 A;  5C2T A;  1I94 T;  4YTM A;  2A2F X;  5FYM A;  4CN1 A;  5IHY A;  2YU1 A;  3ANW A;  3C64 A;  5H6Q B;  3RX6 A;  4CXW A;  4K0U A;  4IDN A;  1IBK T;  5AQN B;  1KFY A;  3NKZ A;  2KLQ A;  2UUB T;  4PK5 A;  4DMW A;  3EHZ A;  2XAQ B;  2MTQ A;  1E2A A;  2LSG A;  2BKO A;  4DR6 T;  4PFO A;  2HPJ A;  5E0O A;  5FNV E;  4DV4 T;  4C91 A;  3I1A A;  4EXT A;  4DV3 T;  4WBO A;  5FL1 A;  3AE6 A;  3VRA A;  2B76 A;  3KIN B;  5FY1 A;  3ZEF B;  1FEW A;  4JI0 T;  1UCU A;  4DMV A;  5ADX L;  4AIS A;  2B1E A;  3C4X A;  3ZMZ B;  1W0B A;  5AQM B;  1E1H B;  1HF8 A;  5JDG A;  2CMR A;  2WZH A;  2XQA A;  4QXC B;  4JI1 T;  1HG5 A;  3GN5 A;  4TN7 B;  2VVS A;  3LK4 2;  1N33 T;  3RIU A;  1HNW T;  3J7Y q;  5ABH A;  5EK4 A;  4JI5 T;  2W00 A;  4A5X A;  5AFU L;  3CVR A;  1D0Y A;  2N1G A;  1Y01 A;  3AE3 A;  3AXJ B;  2X9H A;  3PUX F;  3U78 A;  2P9B A;  5LHI B;  1LKX A;  3PU8 A;  4I55 E;  4HWH A;  3VKG A;  4C90 A;  2UXB T;  4B6X A;  2JQ9 A;  2X0H A;  3QOF A;  4PK4 A;  1YXR A;  2QGS A;  3KBT A;  2CLY C;  1D1B A;  2VQE T;  2H89 A;  2CBI A;  4NIQ A;  2XAH B;  2XPK A;  5JDL A;  4CI2 B;  3RYI E;  2LSJ A;  4BJM A;  4YJ3 E;  1S35 A;  5AQV B;  1R8I A;  4UVA B;  3RC3 A;  4DO0 A;  4JI8 T;  5HCM A;  1FIO A;  4UEL A;  3KV9 A;  3Q5X A;  4AQG A;  2NOX A;  2CM0 A;  1WCR A;  4KX6 A;  5AQI B;  1X79 A;  2SPC A;  1HNZ T;  3AAA B;  5LBQ B;  1UGO A;  2Q9Q A;  1US7 B;  3FHN A;  4U3C A;  5HXC A;  1HFA A;  4EZ4 A;  4O2B E;  4IE4 A;  4LFC T;  3H3A A;  2X66 A;  2AXD S;  3OYZ A;  3Q5W A;  2XAF B;  3AAE B;  4DBQ A;  4H9O C;  3PE0 A;  3Q2M A;  4F6R C;  2OLT A;  4HWC A;  2V7M A;  4ZI7 E;  1M62 A;  4ILU A;  1T72 A;  1W09 A;  2WZI A;  4AIU A;  4IHJ E;  4QXH B;  4U74 A;  5KX5 E;  2BDE A;  2HPL A;  3SS1 A;  3SRZ A;  3UFE A;  2V6X A;  2BBJ A;  5FVK A;  1OED A;  2LEH A;  4GOU A;  4IDQ A;  1SHZ C;  4LFB T;  3IEE A;  4YHJ A;  4AI6 A;  3UUN A;  3CPZ A;  4YSY A;  2DCF A;  3PUQ A;  2BVL A;  2Z6E A;  3ZCJ A;  3NVO A;  3EI0 A;  3O1H A;  2WS3 A;  5HXR A;  1UX5 A;  4B3T T;  4IST A;  4HWI B;  2XY8 B;  3C50 A;  3OKQ A;  2LSI A;  2LRL A;  3VR8 A;  2V8S V;  4QX8 B;  3QUJ A;  5HCJ A;  4HWD A;  2D0T A;  3MJX A;  5HEO A;  3I0Q A;  2H3R A;  4I0U A;  2FJE A;  2CEA A;  4MHC A;  2WDV A;  5LA6 E;  3ZYK A;  3N2K E;  4IE7 A;  4HN9 A;  3P7I A;  5JQG E;  4HFV A;  2W67 A;  4UF0 A;  2WDR A;  3LDQ B;  4HKA A;  2L3L A;  4IL9 A;  2E9X A;  3K3Q C;  4IDP A;  1IAP A;  3ZST A;  3LBX B;  1LVF A;  2ZM2 A;  4KBM B;  4HFB A;  4GKJ T;  4ZOL E;  1MIV A;  3TLT A;  4A56 A;  5JH7 E;  2FBW A;  3N9M A;  2J47 A;  1D1A A;  3A5X A;  2NR4 A;  2I59 A;  3WI3 A;  3AVR A;  5IUX A;  4IT4 A;  2KXP B;  4YFS A;  5AQF B;  1M7K A;  4PW8 A;  3VR9 A;  3F2E A;  1QUU A;  3RRW A;  4NUU A;  2M67 A;  4DR4 T;  3MA9 A;  5FMN A;  3VU7 H;  2V5D A;  5LJM A;  1XMQ T;  2UXD T;  4U7I A;  2LT3 A;  2K5B B;  4QKN A;  2XHE B;  3PUZ F;  5AQH B;  3HKC E;  2FJB A;  4OK0 A;  1UUS A;  3RKO A;  3P4R A;  2YN6 A;  4QXB B;  5J2T E;  2FJD A;  4AQY T;  1YQ4 A;  3PJA J;  1HCI A;  1G8X A;  5C3J A;  1XDO A;  4LF8 T;  2XSB A;  2D9D A;  3CQX C;  4X20 E;  5FXW A;  2L9Q A;  2WU5 A;  2UXX B;  1VCS A;  2LOS A;  1B7T A;  3A7M A;  2VL0 A;  3N2O A;  5KMG P;  3RRC A;  4HTE A;  2MAW A; 
#chains in the Genus database with same CATH homology
 3T1Y T;  4GKJ T;  2UUB T;  1N36 T;  4LFB T;  1XNR T;  2VQE T;  1N34 T;  4YHH T;  4DV2 T;  1HNX T;  4DR6 T;  4DV7 T;  4JI4 T;  4DV4 T;  4LFA T;  4JV5 T;  4YY3 T;  2HHH T;  1XNQ T;  4X62 T;  4DV6 T;  4DV3 T;  4X65 T;  4NXM T;  4KHP T;  4LF6 T;  4JI8 T;  4DR3 T;  4DV1 T;  1IBL T;  4DR2 T;  3T1H T;  4DR7 T;  4DR4 T;  2UU9 T;  1XMO T;  4GKK T;  4B3T T;  4B3M T;  4JI0 T;  4OX9 T;  4LF9 T;  1XMQ T;  1HNZ T;  2UXC T;  2UXD T;  4JI2 T;  4JYA T;  4X64 T;  3OTO T;  2UUA T;  4LF4 T;  4LF7 T;  4LFC T;  4JI6 T;  1N32 T;  4JI3 T;  4K0K T;  1IBM T;  5BR8 T;  4DV5 T;  4JI1 T;  4DUY T;  1N33 T;  4B3R T;  4DR5 T;  5LMN T;  1HNW T;  4B3S T;  4NXN T;  4JI7 T;  2ZM6 T;  4AQY T;  4JI5 T;  5IWA T;  2VQF T;  4DUZ T;  4DV0 T;  4X66 T;  2UUC T;  1I94 T;  4LF8 T;  4LF5 T;  5LMU T;  2F4V T;  4DR1 T;  2UXB T;  1J5E T;  2E5L T;  1HR0 T;  1IBK T;  1FJG T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...