3T1YT

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a human anti-codon stem loop (hasl) of transfer rna lysine 3 (trnalys3) bound to an mrna with an aag-codon in the a-site and paromomycin
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAVQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Human tRNA(Lys3)(UUU) Is Pre-Structured by Natural Modifications for Cognate and Wobble Codon Binding through Keto-Enol Tautomerism.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 34
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2011-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 3t1yT00
4LF5T 2UUAT 2UXDT 1HNWT 4X65T 1FJGT 4DR1T 4X64T 3OTOT 4JI7T 4DV4T 4X66T 4DR6T 4JYAT 4NXMT 4JI6T 4DV2T 4GKJT 4DUZT 4DV7T 2E5LT 4B3RT 2ZM6T 1IBKT 4LF6T 1XNQT 4B3MT 2HHHT 4LF8T 5BR8T 1HNZT 4DUYT 1HNXT 4K0KT 4DR5T 1N33T 5LMUT 4JI5T 4LF7T 4DR7T 5LMNT 1IBMT 1XMQT 2UXBT 4B3TT 4JI0T 4JI4T 3T1YT 4LF4T 1XMOT 4GKKT 4OX9T 1HR0T 3T1HT 4JI3T 4DV5T 4JI1T 4B3ST 2UU9T 1I94T 4JI8T 4DV1T 4JI2T 4LF9T 1IBLT 4LFBT 1N32T 4YY3T 4NXNT 5IWAT 1J5ET 4JV5T 1XNRT 2F4VT 4DR4T 4X62T 4LFAT 4DR3T 2VQET 2UUBT 1N34T 2UXCT 4DR2T 4DV3T 1N36T 4YHHT 4DV6T 2UUCT 2VQFT 4AQYT 4LFCT 4DV0T 4KHPT
chains in the Genus database with same CATH superfamily
3CX7B 2NWBA 4G63A 4HKAA 3K1SA 5L4EA 1LVFA 3RHWA 4YT0A 2UXDT 4IIJE 5AQIB 1UUSA 1FMWA 3EUHA 4IL9A 5AQLB 4OFZA 4YSYA 5LXTE 3RI5A 1MIWA 3VRAA 4N78D 2WDVA 3AA7B 1QUUA 3AE5A 4P09A 4AKRB 3RIUA 4AQFC 1ZEEA 2ZMAA 1E1HB 5IUXA 3KV6A 5LA6E 4X1IE 1CUNA 3PU8A 5LHIB 3ZSTA 4CN1A 4KI0F 5A1LA 2MBGA 4KX6A 3CMLA 2V5CA 4AKGA 2JIWA 3C50A 4DR6T 2KWHA 1Y01A 2DHRA 3AEFA 3UT5E 5JDLA 3UQ7A 4JYAT 1W0BA 3ANWA 3CPZA 4DV2T 5DJQC 3UU4A 3AE6A 3A7MA 2WB5A 1HFAA 3EVYA 2KXPB 3FB2A 3LDQB 5FVLA 5HCJA 2J47A 3VR8A 3RH3A 2BG9A 3TLVA 1LKXA 5LCYA 1VCSA 2XQ3A 4DUZT 2E5LT 4MFRA 2AXDS 1W0AA 2I0MA 2VKJA 3EI0A 4I50E 4CI2B 2DL1A 5L3GB 5LHGB 2ZM6T 1KNRA 4EYYR 4NPPA 3CX6B 5JDMA 3CK6A 3MA9A 4Q25A 3NVOA 3RYCE 1HNZT 2XQ9A 4QX8B 3FZLB 1HNXT 2OV9A 2PBIA 3AAIA 4PW8A 4I55E 4EV6A 3ZMSB 3F31A 4Z8XA 3L39A 3EAMA 2NP9A 5FMNA 4WBNE 1ZV4X 2ES0A 4OHFA 5JR9C 3O1HA 5LOVE 5LG3A 1LRZA 1YD8G 5LMUT 2Q9QC 2J62A 2BS4A 3CQXC 4YHJA 4B6XA 2BVMA 5FXZA 5J2UE 3PUZF 5KXJA 3GN5A 4WW0A 3RKOA 2M67A 5JREA 3FZFB 3CX8B 4L0RA 3BQKA 3P4WA 4PK5A 5LMNT 1IBMT 2IHR1 4PFPA 3LSVA 2CXDA 3G06A 5DABA 3P4SA 4Z91A 5AQTB 3V5SA 2YU2A 2ZM2A 4TWFA 2GK9A 4DIDB 3ETVA 3ZT5A 5FL1A 2W0GA 4LF4T 1XMOT 4G2AA 3AAEB 3AA1B 2OLTA 1OEDB 1Y64B 4AIUA 5FVKA 1HR0T 3UU8A 3ZLIA 2BG9C 3HA4A 5CGMA 1CHUA 4H9NC 4X5TA 1KK7A 4UF0A 3R84B 2UU9T 3FZHB 4PK6A 2D9DA 4IE6A 5TAOA 1Z0PA 2P9BA 1HCIA 2WU2A 3ANWB 1KNZA 4C91A 3ZYMA 4WBOA 3ZMZB 2VKHA 5AQVB 2D0UA 2WBLA 4U2YA 4EXTA 3PUXF 2BG9B 2LOPA 4YSXA 4AXPA 2BVLA 5ABFB 5C8YE 1N32T 4U31A 4IDNA 4DNDA 1HG2A 3CWZB 2XQ6A 5KDMC 2WDRA 4JEHB 3H37A 4MHCA 5AQPB 2V7MA 5LNKA 4DMWA 3QOFA 4UVAB 5JR9A 3SWHA 3AE1A 2V6YB 4X62T 2AE9A 3M65A 5LYJE 3UU5A 4HGAA 3N2KE 2LM2A 3AE9A 2E9XC 3C64A 3HKEE 4JUYA 3KINB 4ZI3C 4IDZA 3GA8A 4DMVA 3QB5A 4H9OC 3RYIE 2CBIA 2E9XA 2VVNA 5CB4E 5CFBA 2BBHA 3N9OA 4A98A 4I4TE 2X0YA 1MMGA 3DTOA 5HEUA 3AEDA 5AQMB 2XAFB 5ADXL 3RIAA 2WQYA 3QB5K 1WCRA 4UF0B 2RP4A 4I0UA 4JBWF 2CLYB 2JMKA 2YINA 4LFCT 2E8IA 3AE2A 2LHNA 4PJMA 5E0OA 3O4XE 4ILUA 2HPJA 2MTQA 3QK6A 3CIRA 2DLRA 2WZHA 5H6QB 2BDEA 3H3MA 4XAXB 1SHZC 2HPLA 3KVAA 3PTRB 1QSDA 2UXXB 4U3CA 2N2NA 3FXDB 1KNPA 2H3RA 2M6BA 2XY8B 3LJCA 1OEDE 3IEEA 3AB3B 3P4PA 4NIQA 1MMAA 2MAWA 2NR4A 2WAUA 5GONE 5FY7A 3SS1A 5ABEA 4CQIA 2HN1A 4BAYB 4EZ4A 4FI5A 4HFHA 3T8OA 2OA5A 4ZZBA 5JH7E 5AQFB 2Q9QB 5KMGP 1FJGT 3B5MA 4YTPA 4OK0A 4U74A 3K3NA 3H3AA 4HFEA 5JR9B 3KDSE 1WFDA 2QYWA 2X67A 4UVBB 1D0XA 4ILBA 4X64T 4UVCB 4YXDA 3HKDE 3IF8B 4DV4T 1FMVA 1WRDA 5EK4A 3VR9A 3WAKA 4TWDA 2D2SA 4X66T 3HKBE 4IDPA 2LLYA 4TV8E 4O2AE 1UGOA 1YKHB 3BK9A 3N9PA 4HEAA 3SRZA 4O4IE 2LSKA 3K3QC 4ILAA 3SFDA 4GKJT 3O9XA 5LJNA 3JAFA 4YJ3E 5AQJB 2XSBA 4MALA 4TV9E 1J5WA 4UXNB 3QC9A 4TWHA 3UU6A 4UV8B 2LKGA 3VRBA 2VASA 4L5GA 3ZN1B 2LKHA 3AA0B 4IGUA 1MIYA 4GOUA 4HWFA 5ABHA 2BS2A 5AQUB 2WY2A 5FXVA 5HWXA 3P8CD 2LE8A 4HFCA 2VURA 4CZZB 5AQQB 4B3MT 4CXYA 2CLYC 2X9WA 2YU1A 3Q5WA 1WLXA 1UX5A 3O1IA 4IDOA 5AQRB 4LF8T 5LGUB 1MNEA 2X9HA 1D1CA 5BR8T 2CRBA 3PUAA 2MYSA 3UUXB 4KP3C 3UULA 2CMRA 2BKNA 4O4HE 1HTJF 5FYMA 5CJ5A 2YK0A 4DBRA 3VKGA 5EZYE 2EHOD 2Y6XA 2QRXA 5FXWA 2KMFA 3E22E 4HWHA 2KINB 2XAGB 4L9IA 2BKPA 3NRYA 3PU3A 1BR2A 3WI3A 4EEBA 1IJ5A 5AQHB 3UTKA 4EB6E 5BMVE 3K3OA 1WYBA 4WYVA 5HXEA 1DU2A 3ONLC 5CA1E 4ZI2C 2VB6A 4ZI7E 1FEWA 3B57A 4QH5A 3FZKB 4TNVA 1ZP0A 4CI1B 5LHHB 2WMOA 1NEKA 2XTLA 4IDQA 4OX9T 2ZM8A 4EYUA 4YTNA 3U3IA 4IT4A 5HXSA 4U7YA 5ETWA 4JI1T 4UELA 2Y8DA 4B3ST 1UK5A 1I94T 2VL0A 1IJ6A 3OPCA 3X1DA 4JI8T 4CI3B 3BQIA 5L3FB 2CXLA 1BR4A 2KWIB 3MACA 4HE8A 5FXXA 4I43B 5HAXA 3U78A 1OXZA 5L47A 2MPKA 2XSAA 3AEBA 5JDGA 2XQ8A 3KV5A 3JCFA 1HS7A 4IREA 1MNDA 4YJ2E 2DWKA 4LFBT 4YY3T 1OEDC 5JDHA 3E0ZA 3AEAA 4ZS2A 4AKHA 3VHLA 4YFSA 4JV5T 4HTEA 2A2FX 4E7ZA 3QNUA 2YOEA 1US7B 3NWIA 2DWGA 2IC6A 5FY1A 3TLWA 4CN6A 4ZHQE 2VQET 3ETUA 4V1Av 2VWAA 2UUBT 2IDOB 3AE8A 2UXCT 2BBJA 3AA6B 1N36T 1SA0E 2QVAA 3IA3A 4YHHT 4DV6T 2I59A 1XDPA 2PG8A 3N9QA 2KSRA 3W15B 4H9SE 2UUCT 2CWOA 2ZM0A 3P4QA 1SUMB 4TN7B 4TX5A 3LK2B 4YLHA 2A3DA 5JVDE 3VU7H 4ERRA 1HX1B 3ONXA 2V26A 4IE0A 2V5DA 3ZEFB 3N2OA 4ZI2D 1D1AA 5LJMA 4XZCA 4H9QC 3ZCJA 3PDYA 1WYCA 3EHZA 3MZKB 1O3XA 2YEVC 2HN2A 2NW9A 4C90A 5J0ZA 2FJAA 2VK9A 3CVRA 5EK3A 5FKYA 2G0UA 2V7JA 3C98B 2J1DG 1GQEA 1G73A 2H88A 2CE7A 4ZXLA 2WWVA 5L3DB 3ZC0A 1VRBA 3NBXX 3KV9A 4QXBB 5HYAA 4U72A 3LBXB 1D0ZA 3QUJA 4O4LE 3ZMVB 3Q2MA 4DR1T 4KHPT 2EHOC 3L8RA 5HXHA 5H6RB 2M6IA 1UCUA 3OKQA 4IE4A 1HG5A 5IYZE 2JPFA 2B1EA 2LEHA 3OTOT 2EHOA 4B3RT 3RQUA 4IE7A 2WSSV 3NZPA 3ZT6A 4XBFB 3RLFF 2CA5A 5FNVE 4AI6A 2CCQA 2Z6EA 2WP9A 2JQ9A 2LM9A 2WU5A 4WNKA 3MJXA 4NXMT 3AE4A 5C3JA 2XAQB 4JI6T 2YDRA 3A8YC 2ACZA 2IAKA 2IMLA 2XUEA 3AEEA 5F8PA 2V7LA 2D0TA 4ZI3D 5LG4A 3IHRA 2X0LB 2NTXA 2ACXA 4PK4A 5FL0A 4O2BE 4BJMA 3I1AA 3MKDA 3Q5XA 2YN6A 3RYFE 2J4GA 3PUWF 3S4UA 2H89A 2LSGA 2ODUA 4AQGA 3KVBA 5HXRA 3AXJB 1MMNA 2LSJA 3K8PC 3PUVF 3N9MA 4KHZF 4KUMB 3RKGA 1IBKT 4Z90A 5AQGB 4QXHB 4HFVA 5HXCA 1XNQT 2HHHT 5FY0A 4ZOLE 4PAGA 2JRKA 3I0QA 4DUYT 3ONJA 2E5VA 3KFWX 4U7IA 2BG9E 1KEYA 4UV9B 4K0KT 1M62A 3CQGB 1J1JA 3HKCE 5HCMA 1KF6A 3F2EA 1I6ZA 3C4WA 2X51A 3UU3A 4X1KE 4ISTA 4M1PA 2DI4A 2EHOB 3HL6A 3KV4A 4HFDA 4K0UA 2WCAA 2XHEB 3LFMA 4U2ZA 5HEGA 2I6HA 4AKLA 2N9DA 2W2UA 2CPTA 4LF7T 2E2AA 3P7IA 4J2CA 3AAAB 4ZS3A 2DNXA 4CN4A 2V6YA 3B13A 4HFBA 5JDQA 2UXBT 2A9UA 3ZSSA 1ZKEA 4B3TT 5JDNA 3PURA 4ADZA 4DR3T 4GKKT 4WZXA 4DVDA 2K5BB 3T1YT 2C0SA 1JNZA 2RA1A 3EDVA 5DQWA 1W9RA 2DCFA 5LGNB 3J7Yq 2XJ7A 3ESLA 1W09A 5M4YA 2XQ7A 3T1HT 3RGLA 2D5UA 3TLSA 3TLUA 1LVKA 5AFUL 2V7KA 4DV5T 2W66A 3N9NA 2PJQA 2W00A 3A5XA 4HWDA 4MBQA 1U5PA 4NUUA 5C2TA 3N2GE 4H9PC 3AXJA 3ZMUB 4YTMA 2XQAA 2L8KA 4H63V 4PJLA 5DQVA 5ABGA 3ZT7A 1T8BA 5HEJA 4DV1T 1SE7A 1YQ3A 1ZHCA 1B7TA 3PV0F 4JI2T 3RYHE 4EEDA 3I0OA 4LF9T 3GWHA 2V6XA 3OYZA 4MLKA 3MK7C 4PFOA 1IBLT 4EOZB 5AQSB 3IBPA 3UUMA 4UIGA 5L3EB 3C4ZA 4NXNT 3N9LA 5JTGA 1XDOA 2CM0A 2IC9A 2RPAA 3GMIA 2LOSA 3KBTA 3OVUA 4QKNA 5IWAT 1J5ET 5AQKB 1M7KA 2FJDA 2K3WA 2ZLYA 2K24A 5LBMA 1WR6A 2KNDA 2NTYA 3GN5B 5AQOB 3NZQA 5F3JA 2IIUA 3PUYF 2Q9QD 3RIFA 3ZN0B 2V1DB 3FZMB 3JC6D 4TUYE 2K48A 3DP7A 4BJNA 2SPCA 1HF8A 3HR0A 3AVSA 4H9RC 3UFGA 4EZHA 2CEAA 4DV3T 4TZ4C 2X9YA 2JQHA 3CKDA 4DR4T 2FBWA 4NUVA 4QX7B 3ZPOA 2WMNA 4F8HA 2H7OA 1V9DA 3PE0A 3R6NA 3C51A 2V8SV 3E08A 3EDUA 2NW7A 4PNIA 2X68A 3BQLA 2IUBA 4AISA 2FJBA 3LK42 2XQ5A 1L0VA 3V5UA 1BR0A 1KFYA 2QA7A 2W62A 2FUPA 3OYXA 4QH1A 1YKEB 3RPUA 2LJLA 4GIWA 3ZKRA 1WR0A 3ABVA 4F6RC 3P4RA 4AKIA 4DV0T 1T7SA 4X1YE 4DO0A 2JQKA 3ZMTB 4LF5T 2UUAT 5ABFA 2Y48B 2BKOA 1VOMA 4ILCA 4GK0E 2VKOA 3D0TA 4DBQA 2NOXA 3EABA 3CQCB 3MXZA 4IHJE 5L3BB 5HEOA 1HNWT 4X65T 4CXWA 2ODVA 3P50A 2WZIA 5JRCA 1YW0A 2YKSA 3ZCIA 1UX4A 2X9XA 2MOZA 2LT3A 3VKHA 1IAPA 5J2TE 3RF1A 4JI7T 1D0YA 1E2AA 3UQ4A 3LBXA 2LSYA 4QXCB 3AECA 3ZJ2A 1XWMA 3JADA 2E9XB 3RRWA 2E9XD 2JQQA 3J9X1 1ZOYA 2V7IA 3RRCA 2YDSA 3FHNA 1S94A 3PJAA 3PUGA 4KBMB 2W61A 5F5WA 3F57A 2QGSA 2L3LA 3Q9DA 3RIUC 4DV7T 3I9YA 2LRKA 5LGTB 2XAHB 2X66A 4P1NA 4QHOA 4X20E 3SFEA 3TLTA 2YDQA 1NAFA 5LBQB 5LB7B 2JMHA 2VVSA 2JJ9A 4CXXA 2WDQA 1HX8A 4H63H 1H7CA 2BZBA 2BS3A 3Q5DA 4OYJA 4LF6T 2C5KT 3JAEA 5J1GA 4P0BA 4YSZA 2K9AA 4LMJA 4OYKA 3RC3A 3RX6A 2Q9QA 2XM2A 3ZYLA 2WM9A 4ISSA 3NRXA 2KZ7B 4U33A 3SOLA 4P0AA 1E7PA 3PUSA 4GYSA 1T72A 5FP3A 5JDFA 3I9WA 3JC6C 2H7VC 3L3PA 4DR5T 1N33T 2XASB 3L09A 3LG7A 3HI2A 3RQWA 1BR1A 1JNRA 1X9BA 2UXNB 1MMDA 3LK3B 1G8XA 3AVRA 4JI5T 4ANJA 4E7SA 2W4XA 5L2LA 4DR7T 2R6GF 2WWUA 2CXFA 1NENA 4GYRA 1OEDA 1XZYA 5JRCB 1XMQT 3PUQA 2N1GA 2NW8A 2KT9A 3UFEA 2W67A 3FBLA 4JI0T 1AJ3A 4JI4T 1S35A 5AQNB 2X0HA 5KX5E 3AE7A 1VCTA 4FJOA 4HWCA 5L3CB 4JI3T 4ASKA 2CWYA 2CHOA 4O4JE 4QWNB 1D1BA 5CA0E 2B76A 4A97A 3M3ZB 2LRLA 5HWYA 1IZNB 1MIVA 1U4QA 2HH7A 2L9QA 2VL8A 4EIWA 1QLBA 1EZ3A 4ZEYA 5EK2A 5IHYA 3O1JA 2LSIA 4HN9A 2CHNA 3AE3A 4HWIB 4AQFA 2VKDA 3NKZA 3Q5EA 4PJJA 2C5IT 3PJAJ 4A56A 5LP6E 4EAHA 2W63A 2WS3A 3WAJA 2IW5B 3UUBA 4TNWA 5JQGE 2C5JA 2XM1A 4JLEA 1YQ4A 2CBJA 3FXEB 4KMCA 4A5XA 2XAJB 4UR9A 1XNRT 4BA9A 1NWMX 3DJBA 3AEGA 2XZEA 2F4VT 3FBZA 4IE5A 4IL4A 2XQ4A 4PJNA 3TKLB 4UEMA 3ZYKA 4LFAT 2A72A 2KLQA 4HFIA 2PFVA 3C4XA 1T98A 2FJEA 4JEUB 5L4HA 1R8IA 2LHRA 1N34T 2PTFA 4DR2T 3RC8A 3OJAA 1OWAA 3OBVE 4COFA 2XPKA 1UURA 4GK5E 3UUNA 1YXRA 2XQYA 3N5LA 4ZZCA 2VQFT 3KBUA 4LMLA 4AQYT 4QH4A 1Z8UA 4O8SA 3ZJ1A 3ZC1A 4EGWA 1X79A 1FIOA 4LMKA 5HEHA
chains in the Genus database with same CATH topology
4LF5T 2UUAT 2UXDT 1HNWT 4X65T 1FJGT 4DR1T 4X64T 3OTOT 4JI7T 4DV4T 4X66T 4DR6T 4JYAT 4NXMT 4JI6T 4DV2T 4GKJT 4DUZT 4DV7T 2E5LT 4B3RT 2ZM6T 1IBKT 4LF6T 1XNQT 4B3MT 2HHHT 4LF8T 5BR8T 1HNZT 4DUYT 1HNXT 4K0KT 4DR5T 1N33T 5LMUT 4JI5T 4LF7T 4DR7T 5LMNT 1IBMT 1XMQT 2UXBT 4B3TT 4JI0T 4JI4T 3T1YT 4LF4T 1XMOT 4GKKT 4OX9T 1HR0T 3T1HT 4JI3T 4DV5T 4JI1T 4B3ST 2UU9T 1I94T 4JI8T 4DV1T 4JI2T 4LF9T 1IBLT 4LFBT 1N32T 4YY3T 4NXNT 5IWAT 1J5ET 4JV5T 1XNRT 2F4VT 4DR4T 4X62T 4LFAT 4DR3T 2VQET 2UUBT 1N34T 2UXCT 4DR2T 4DV3T 1N36T 4YHHT 4DV6T 2UUCT 2VQFT 4AQYT 4LFCT 4DV0T 4KHPT
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LF5 T;  2UUA T;  2UXD T;  1HNW T;  4X65 T;  1FJG T;  4DR1 T;  4X64 T;  3OTO T;  4JI7 T;  4DV4 T;  4X66 T;  4DR6 T;  4JYA T;  4NXM T;  4JI6 T;  4DV2 T;  4GKJ T;  4DUZ T;  4DV7 T;  2E5L T;  4B3R T;  2ZM6 T;  1IBK T;  4LF6 T;  1XNQ T;  4B3M T;  2HHH T;  4LF8 T;  5BR8 T;  1HNZ T;  4DUY T;  1HNX T;  4K0K T;  4DR5 T;  1N33 T;  5LMU T;  4JI5 T;  4LF7 T;  4DR7 T;  5LMN T;  1IBM T;  1XMQ T;  2UXB T;  4B3T T;  4JI0 T;  4JI4 T;  3T1Y T;  4LF4 T;  1XMO T;  4GKK T;  4OX9 T;  1HR0 T;  3T1H T;  4JI3 T;  4DV5 T;  4JI1 T;  4B3S T;  2UU9 T;  1I94 T;  4JI8 T;  4DV1 T;  4JI2 T;  4LF9 T;  1IBL T;  4LFB T;  1N32 T;  4YY3 T;  4NXN T;  5IWA T;  1J5E T;  4JV5 T;  1XNR T;  2F4V T;  4DR4 T;  4X62 T;  4LFA T;  4DR3 T;  2VQE T;  2UUB T;  1N34 T;  2UXC T;  4DR2 T;  4DV3 T;  1N36 T;  4YHH T;  4DV6 T;  2UUC T;  2VQF T;  4AQY T;  4LFC T;  4DV0 T;  4KHP T; 
#chains in the Genus database with same CATH topology
 3CX7 B;  2NWB A;  4G63 A;  4HKA A;  3K1S A;  5L4E A;  1LVF A;  3RHW A;  4YT0 A;  2UXD T;  4IIJ E;  5AQI B;  1UUS A;  1FMW A;  3EUH A;  4IL9 A;  5AQL B;  4OFZ A;  4YSY A;  5LXT E;  3RI5 A;  1MIW A;  3VRA A;  4N78 D;  2WDV A;  3AA7 B;  1QUU A;  3AE5 A;  4P09 A;  4AKR B;  3RIU A;  4AQF C;  1ZEE A;  2ZMA A;  1E1H B;  5IUX A;  3KV6 A;  5LA6 E;  4X1I E;  1CUN A;  3PU8 A;  5LHI B;  3ZST A;  4CN1 A;  4KI0 F;  5A1L A;  2MBG A;  4KX6 A;  3CML A;  2V5C A;  4AKG A;  2JIW A;  3C50 A;  4DR6 T;  2KWH A;  1Y01 A;  2DHR A;  3AEF A;  3UT5 E;  5JDL A;  3UQ7 A;  4JYA T;  1W0B A;  3ANW A;  3CPZ A;  4DV2 T;  5DJQ C;  3UU4 A;  3AE6 A;  3A7M A;  2WB5 A;  1HFA A;  3EVY A;  2KXP B;  3FB2 A;  3LDQ B;  5FVL A;  5HCJ A;  2J47 A;  3VR8 A;  3RH3 A;  2BG9 A;  3TLV A;  1LKX A;  5LCY A;  1VCS A;  2XQ3 A;  4DUZ T;  2E5L T;  4MFR A;  2AXD S;  1W0A A;  2I0M A;  2VKJ A;  3EI0 A;  4I50 E;  4CI2 B;  2DL1 A;  5L3G B;  5LHG B;  2ZM6 T;  1KNR A;  4EYY R;  4NPP A;  3CX6 B;  5JDM A;  3CK6 A;  3MA9 A;  4Q25 A;  3NVO A;  3RYC E;  1HNZ T;  2XQ9 A;  4QX8 B;  3FZL B;  1HNX T;  2OV9 A;  2PBI A;  3AAI A;  4PW8 A;  4I55 E;  4EV6 A;  3ZMS B;  3F31 A;  4Z8X A;  3L39 A;  3EAM A;  2NP9 A;  5FMN A;  4WBN E;  1ZV4 X;  2ES0 A;  4OHF A;  5JR9 C;  3O1H A;  5LOV E;  5LG3 A;  1LRZ A;  1YD8 G;  5LMU T;  2Q9Q C;  2J62 A;  2BS4 A;  3CQX C;  4YHJ A;  4B6X A;  2BVM A;  5FXZ A;  5J2U E;  3PUZ F;  5KXJ A;  3GN5 A;  4WW0 A;  3RKO A;  2M67 A;  5JRE A;  3FZF B;  3CX8 B;  4L0R A;  3BQK A;  3P4W A;  4PK5 A;  5LMN T;  1IBM T;  2IHR 1;  4PFP A;  3LSV A;  2CXD A;  3G06 A;  5DAB A;  3P4S A;  4Z91 A;  5AQT B;  3V5S A;  2YU2 A;  2ZM2 A;  4TWF A;  2GK9 A;  4DID B;  3ETV A;  3ZT5 A;  5FL1 A;  2W0G A;  4LF4 T;  1XMO T;  4G2A A;  3AAE B;  3AA1 B;  2OLT A;  1OED B;  1Y64 B;  4AIU A;  5FVK A;  1HR0 T;  3UU8 A;  3ZLI A;  2BG9 C;  3HA4 A;  5CGM A;  1CHU A;  4H9N C;  4X5T A;  1KK7 A;  4UF0 A;  3R84 B;  2UU9 T;  3FZH B;  4PK6 A;  2D9D A;  4IE6 A;  5TAO A;  1Z0P A;  2P9B A;  1HCI A;  2WU2 A;  3ANW B;  1KNZ A;  4C91 A;  3ZYM A;  4WBO A;  3ZMZ B;  2VKH A;  5AQV B;  2D0U A;  2WBL A;  4U2Y A;  4EXT A;  3PUX F;  2BG9 B;  2LOP A;  4YSX A;  4AXP A;  2BVL A;  5ABF B;  5C8Y E;  1N32 T;  4U31 A;  4IDN A;  4DND A;  1HG2 A;  3CWZ B;  2XQ6 A;  5KDM C;  2WDR A;  4JEH B;  3H37 A;  4MHC A;  5AQP B;  2V7M A;  5LNK A;  4DMW A;  3QOF A;  4UVA B;  5JR9 A;  3SWH A;  3AE1 A;  2V6Y B;  4X62 T;  2AE9 A;  3M65 A;  5LYJ E;  3UU5 A;  4HGA A;  3N2K E;  2LM2 A;  3AE9 A;  2E9X C;  3C64 A;  3HKE E;  4JUY A;  3KIN B;  4ZI3 C;  4IDZ A;  3GA8 A;  4DMV A;  3QB5 A;  4H9O C;  3RYI E;  2CBI A;  2E9X A;  2VVN A;  5CB4 E;  5CFB A;  2BBH A;  3N9O A;  4A98 A;  4I4T E;  2X0Y A;  1MMG A;  3DTO A;  5HEU A;  3AED A;  5AQM B;  2XAF B;  5ADX L;  3RIA A;  2WQY A;  3QB5 K;  1WCR A;  4UF0 B;  2RP4 A;  4I0U A;  4JBW F;  2CLY B;  2JMK A;  2YIN A;  4LFC T;  2E8I A;  3AE2 A;  2LHN A;  4PJM A;  5E0O A;  3O4X E;  4ILU A;  2HPJ A;  2MTQ A;  3QK6 A;  3CIR A;  2DLR A;  2WZH A;  5H6Q B;  2BDE A;  3H3M A;  4XAX B;  1SHZ C;  2HPL A;  3KVA A;  3PTR B;  1QSD A;  2UXX B;  4U3C A;  2N2N A;  3FXD B;  1KNP A;  2H3R A;  2M6B A;  2XY8 B;  3LJC A;  1OED E;  3IEE A;  3AB3 B;  3P4P A;  4NIQ A;  1MMA A;  2MAW A;  2NR4 A;  2WAU A;  5GON E;  5FY7 A;  3SS1 A;  5ABE A;  4CQI A;  2HN1 A;  4BAY B;  4EZ4 A;  4FI5 A;  4HFH A;  3T8O A;  2OA5 A;  4ZZB A;  5JH7 E;  5AQF B;  2Q9Q B;  5KMG P;  1FJG T;  3B5M A;  4YTP A;  4OK0 A;  4U74 A;  3K3N A;  3H3A A;  4HFE A;  5JR9 B;  3KDS E;  1WFD A;  2QYW A;  2X67 A;  4UVB B;  1D0X A;  4ILB A;  4X64 T;  4UVC B;  4YXD A;  3HKD E;  3IF8 B;  4DV4 T;  1FMV A;  1WRD A;  5EK4 A;  3VR9 A;  3WAK A;  4TWD A;  2D2S A;  4X66 T;  3HKB E;  4IDP A;  2LLY A;  4TV8 E;  4O2A E;  1UGO A;  1YKH B;  3BK9 A;  3N9P A;  4HEA A;  3SRZ A;  4O4I E;  2LSK A;  3K3Q C;  4ILA A;  3SFD A;  4GKJ T;  3O9X A;  5LJN A;  3JAF A;  4YJ3 E;  5AQJ B;  2XSB A;  4MAL A;  4TV9 E;  1J5W A;  4UXN B;  3QC9 A;  4TWH A;  3UU6 A;  4UV8 B;  2LKG A;  3VRB A;  2VAS A;  4L5G A;  3ZN1 B;  2LKH A;  3AA0 B;  4IGU A;  1MIY A;  4GOU A;  4HWF A;  5ABH A;  2BS2 A;  5AQU B;  2WY2 A;  5FXV A;  5HWX A;  3P8C D;  2LE8 A;  4HFC A;  2VUR A;  4CZZ B;  5AQQ B;  4B3M T;  4CXY A;  2CLY C;  2X9W A;  2YU1 A;  3Q5W A;  1WLX A;  1UX5 A;  3O1I A;  4IDO A;  5AQR B;  4LF8 T;  5LGU B;  1MNE A;  2X9H A;  1D1C A;  5BR8 T;  2CRB A;  3PUA A;  2MYS A;  3UUX B;  4KP3 C;  3UUL A;  2CMR A;  2BKN A;  4O4H E;  1HTJ F;  5FYM A;  5CJ5 A;  2YK0 A;  4DBR A;  3VKG A;  5EZY E;  2EHO D;  2Y6X A;  2QRX A;  5FXW A;  2KMF A;  3E22 E;  4HWH A;  2KIN B;  2XAG B;  4L9I A;  2BKP A;  3NRY A;  3PU3 A;  1BR2 A;  3WI3 A;  4EEB A;  1IJ5 A;  5AQH B;  3UTK A;  4EB6 E;  5BMV E;  3K3O A;  1WYB A;  4WYV A;  5HXE A;  1DU2 A;  3ONL C;  5CA1 E;  4ZI2 C;  2VB6 A;  4ZI7 E;  1FEW A;  3B57 A;  4QH5 A;  3FZK B;  4TNV A;  1ZP0 A;  4CI1 B;  5LHH B;  2WMO A;  1NEK A;  2XTL A;  4IDQ A;  4OX9 T;  2ZM8 A;  4EYU A;  4YTN A;  3U3I A;  4IT4 A;  5HXS A;  4U7Y A;  5ETW A;  4JI1 T;  4UEL A;  2Y8D A;  4B3S T;  1UK5 A;  1I94 T;  2VL0 A;  1IJ6 A;  3OPC A;  3X1D A;  4JI8 T;  4CI3 B;  3BQI A;  5L3F B;  2CXL A;  1BR4 A;  2KWI B;  3MAC A;  4HE8 A;  5FXX A;  4I43 B;  5HAX A;  3U78 A;  1OXZ A;  5L47 A;  2MPK A;  2XSA A;  3AEB A;  5JDG A;  2XQ8 A;  3KV5 A;  3JCF A;  1HS7 A;  4IRE A;  1MND A;  4YJ2 E;  2DWK A;  4LFB T;  4YY3 T;  1OED C;  5JDH A;  3E0Z A;  3AEA A;  4ZS2 A;  4AKH A;  3VHL A;  4YFS A;  4JV5 T;  4HTE A;  2A2F X;  4E7Z A;  3QNU A;  2YOE A;  1US7 B;  3NWI A;  2DWG A;  2IC6 A;  5FY1 A;  3TLW A;  4CN6 A;  4ZHQ E;  2VQE T;  3ETU A;  4V1A v;  2VWA A;  2UUB T;  2IDO B;  3AE8 A;  2UXC T;  2BBJ A;  3AA6 B;  1N36 T;  1SA0 E;  2QVA A;  3IA3 A;  4YHH T;  4DV6 T;  2I59 A;  1XDP A;  2PG8 A;  3N9Q A;  2KSR A;  3W15 B;  4H9S E;  2UUC T;  2CWO A;  2ZM0 A;  3P4Q A;  1SUM B;  4TN7 B;  4TX5 A;  3LK2 B;  4YLH A;  2A3D A;  5JVD E;  3VU7 H;  4ERR A;  1HX1 B;  3ONX A;  2V26 A;  4IE0 A;  2V5D A;  3ZEF B;  3N2O A;  4ZI2 D;  1D1A A;  5LJM A;  4XZC A;  4H9Q C;  3ZCJ A;  3PDY A;  1WYC A;  3EHZ A;  3MZK B;  1O3X A;  2YEV C;  2HN2 A;  2NW9 A;  4C90 A;  5J0Z A;  2FJA A;  2VK9 A;  3CVR A;  5EK3 A;  5FKY A;  2G0U A;  2V7J A;  3C98 B;  2J1D G;  1GQE A;  1G73 A;  2H88 A;  2CE7 A;  4ZXL A;  2WWV A;  5L3D B;  3ZC0 A;  1VRB A;  3NBX X;  3KV9 A;  4QXB B;  5HYA A;  4U72 A;  3LBX B;  1D0Z A;  3QUJ A;  4O4L E;  3ZMV B;  3Q2M A;  4DR1 T;  4KHP T;  2EHO C;  3L8R A;  5HXH A;  5H6R B;  2M6I A;  1UCU A;  3OKQ A;  4IE4 A;  1HG5 A;  5IYZ E;  2JPF A;  2B1E A;  2LEH A;  3OTO T;  2EHO A;  4B3R T;  3RQU A;  4IE7 A;  2WSS V;  3NZP A;  3ZT6 A;  4XBF B;  3RLF F;  2CA5 A;  5FNV E;  4AI6 A;  2CCQ A;  2Z6E A;  2WP9 A;  2JQ9 A;  2LM9 A;  2WU5 A;  4WNK A;  3MJX A;  4NXM T;  3AE4 A;  5C3J A;  2XAQ B;  4JI6 T;  2YDR A;  3A8Y C;  2ACZ A;  2IAK A;  2IML A;  2XUE A;  3AEE A;  5F8P A;  2V7L A;  2D0T A;  4ZI3 D;  5LG4 A;  3IHR A;  2X0L B;  2NTX A;  2ACX A;  4PK4 A;  5FL0 A;  4O2B E;  4BJM A;  3I1A A;  3MKD A;  3Q5X A;  2YN6 A;  3RYF E;  2J4G A;  3PUW F;  3S4U A;  2H89 A;  2LSG A;  2ODU A;  4AQG A;  3KVB A;  5HXR A;  3AXJ B;  1MMN A;  2LSJ A;  3K8P C;  3PUV F;  3N9M A;  4KHZ F;  4KUM B;  3RKG A;  1IBK T;  4Z90 A;  5AQG B;  4QXH B;  4HFV A;  5HXC A;  1XNQ T;  2HHH T;  5FY0 A;  4ZOL E;  4PAG A;  2JRK A;  3I0Q A;  4DUY T;  3ONJ A;  2E5V A;  3KFW X;  4U7I A;  2BG9 E;  1KEY A;  4UV9 B;  4K0K T;  1M62 A;  3CQG B;  1J1J A;  3HKC E;  5HCM A;  1KF6 A;  3F2E A;  1I6Z A;  3C4W A;  2X51 A;  3UU3 A;  4X1K E;  4IST A;  4M1P A;  2DI4 A;  2EHO B;  3HL6 A;  3KV4 A;  4HFD A;  4K0U A;  2WCA A;  2XHE B;  3LFM A;  4U2Z A;  5HEG A;  2I6H A;  4AKL A;  2N9D A;  2W2U A;  2CPT A;  4LF7 T;  2E2A A;  3P7I A;  4J2C A;  3AAA B;  4ZS3 A;  2DNX A;  4CN4 A;  2V6Y A;  3B13 A;  4HFB A;  5JDQ A;  2UXB T;  2A9U A;  3ZSS A;  1ZKE A;  4B3T T;  5JDN A;  3PUR A;  4ADZ A;  4DR3 T;  4GKK T;  4WZX A;  4DVD A;  2K5B B;  3T1Y T;  2C0S A;  1JNZ A;  2RA1 A;  3EDV A;  5DQW A;  1W9R A;  2DCF A;  5LGN B;  3J7Y q;  2XJ7 A;  3ESL A;  1W09 A;  5M4Y A;  2XQ7 A;  3T1H T;  3RGL A;  2D5U A;  3TLS A;  3TLU A;  1LVK A;  5AFU L;  2V7K A;  4DV5 T;  2W66 A;  3N9N A;  2PJQ A;  2W00 A;  3A5X A;  4HWD A;  4MBQ A;  1U5P A;  4NUU A;  5C2T A;  3N2G E;  4H9P C;  3AXJ A;  3ZMU B;  4YTM A;  2XQA A;  2L8K A;  4H63 V;  4PJL A;  5DQV A;  5ABG A;  3ZT7 A;  1T8B A;  5HEJ A;  4DV1 T;  1SE7 A;  1YQ3 A;  1ZHC A;  1B7T A;  3PV0 F;  4JI2 T;  3RYH E;  4EED A;  3I0O A;  4LF9 T;  3GWH A;  2V6X A;  3OYZ A;  4MLK A;  3MK7 C;  4PFO A;  1IBL T;  4EOZ B;  5AQS B;  3IBP A;  3UUM A;  4UIG A;  5L3E B;  3C4Z A;  4NXN T;  3N9L A;  5JTG A;  1XDO A;  2CM0 A;  2IC9 A;  2RPA A;  3GMI A;  2LOS A;  3KBT A;  3OVU A;  4QKN A;  5IWA T;  1J5E T;  5AQK B;  1M7K A;  2FJD A;  2K3W A;  2ZLY A;  2K24 A;  5LBM A;  1WR6 A;  2KND A;  2NTY A;  3GN5 B;  5AQO B;  3NZQ A;  5F3J A;  2IIU A;  3PUY F;  2Q9Q D;  3RIF A;  3ZN0 B;  2V1D B;  3FZM B;  3JC6 D;  4TUY E;  2K48 A;  3DP7 A;  4BJN A;  2SPC A;  1HF8 A;  3HR0 A;  3AVS A;  4H9R C;  3UFG A;  4EZH A;  2CEA A;  4DV3 T;  4TZ4 C;  2X9Y A;  2JQH A;  3CKD A;  4DR4 T;  2FBW A;  4NUV A;  4QX7 B;  3ZPO A;  2WMN A;  4F8H A;  2H7O A;  1V9D A;  3PE0 A;  3R6N A;  3C51 A;  2V8S V;  3E08 A;  3EDU A;  2NW7 A;  4PNI A;  2X68 A;  3BQL A;  2IUB A;  4AIS A;  2FJB A;  3LK4 2;  2XQ5 A;  1L0V A;  3V5U A;  1BR0 A;  1KFY A;  2QA7 A;  2W62 A;  2FUP A;  3OYX A;  4QH1 A;  1YKE B;  3RPU A;  2LJL A;  4GIW A;  3ZKR A;  1WR0 A;  3ABV A;  4F6R C;  3P4R A;  4AKI A;  4DV0 T;  1T7S A;  4X1Y E;  4DO0 A;  2JQK A;  3ZMT B;  4LF5 T;  2UUA T;  5ABF A;  2Y48 B;  2BKO A;  1VOM A;  4ILC A;  4GK0 E;  2VKO A;  3D0T A;  4DBQ A;  2NOX A;  3EAB A;  3CQC B;  3MXZ A;  4IHJ E;  5L3B B;  5HEO A;  1HNW T;  4X65 T;  4CXW A;  2ODV A;  3P50 A;  2WZI A;  5JRC A;  1YW0 A;  2YKS A;  3ZCI A;  1UX4 A;  2X9X A;  2MOZ A;  2LT3 A;  3VKH A;  1IAP A;  5J2T E;  3RF1 A;  4JI7 T;  1D0Y A;  1E2A A;  3UQ4 A;  3LBX A;  2LSY A;  4QXC B;  3AEC A;  3ZJ2 A;  1XWM A;  3JAD A;  2E9X B;  3RRW A;  2E9X D;  2JQQ A;  3J9X 1;  1ZOY A;  2V7I A;  3RRC A;  2YDS A;  3FHN A;  1S94 A;  3PJA A;  3PUG A;  4KBM B;  2W61 A;  5F5W A;  3F57 A;  2QGS A;  2L3L A;  3Q9D A;  3RIU C;  4DV7 T;  3I9Y A;  2LRK A;  5LGT B;  2XAH B;  2X66 A;  4P1N A;  4QHO A;  4X20 E;  3SFE A;  3TLT A;  2YDQ A;  1NAF A;  5LBQ B;  5LB7 B;  2JMH A;  2VVS A;  2JJ9 A;  4CXX A;  2WDQ A;  1HX8 A;  4H63 H;  1H7C A;  2BZB A;  2BS3 A;  3Q5D A;  4OYJ A;  4LF6 T;  2C5K T;  3JAE A;  5J1G A;  4P0B A;  4YSZ A;  2K9A A;  4LMJ A;  4OYK A;  3RC3 A;  3RX6 A;  2Q9Q A;  2XM2 A;  3ZYL A;  2WM9 A;  4ISS A;  3NRX A;  2KZ7 B;  4U33 A;  3SOL A;  4P0A A;  1E7P A;  3PUS A;  4GYS A;  1T72 A;  5FP3 A;  5JDF A;  3I9W A;  3JC6 C;  2H7V C;  3L3P A;  4DR5 T;  1N33 T;  2XAS B;  3L09 A;  3LG7 A;  3HI2 A;  3RQW A;  1BR1 A;  1JNR A;  1X9B A;  2UXN B;  1MMD A;  3LK3 B;  1G8X A;  3AVR A;  4JI5 T;  4ANJ A;  4E7S A;  2W4X A;  5L2L A;  4DR7 T;  2R6G F;  2WWU A;  2CXF A;  1NEN A;  4GYR A;  1OED A;  1XZY A;  5JRC B;  1XMQ T;  3PUQ A;  2N1G A;  2NW8 A;  2KT9 A;  3UFE A;  2W67 A;  3FBL A;  4JI0 T;  1AJ3 A;  4JI4 T;  1S35 A;  5AQN B;  2X0H A;  5KX5 E;  3AE7 A;  1VCT A;  4FJO A;  4HWC A;  5L3C B;  4JI3 T;  4ASK A;  2CWY A;  2CHO A;  4O4J E;  4QWN B;  1D1B A;  5CA0 E;  2B76 A;  4A97 A;  3M3Z B;  2LRL A;  5HWY A;  1IZN B;  1MIV A;  1U4Q A;  2HH7 A;  2L9Q A;  2VL8 A;  4EIW A;  1QLB A;  1EZ3 A;  4ZEY A;  5EK2 A;  5IHY A;  3O1J A;  2LSI A;  4HN9 A;  2CHN A;  3AE3 A;  4HWI B;  4AQF A;  2VKD A;  3NKZ A;  3Q5E A;  4PJJ A;  2C5I T;  3PJA J;  4A56 A;  5LP6 E;  4EAH A;  2W63 A;  2WS3 A;  3WAJ A;  2IW5 B;  3UUB A;  4TNW A;  5JQG E;  2C5J A;  2XM1 A;  4JLE A;  1YQ4 A;  2CBJ A;  3FXE B;  4KMC A;  4A5X A;  2XAJ B;  4UR9 A;  1XNR T;  4BA9 A;  1NWM X;  3DJB A;  3AEG A;  2XZE A;  2F4V T;  3FBZ A;  4IE5 A;  4IL4 A;  2XQ4 A;  4PJN A;  3TKL B;  4UEM A;  3ZYK A;  4LFA T;  2A72 A;  2KLQ A;  4HFI A;  2PFV A;  3C4X A;  1T98 A;  2FJE A;  4JEU B;  5L4H A;  1R8I A;  2LHR A;  1N34 T;  2PTF A;  4DR2 T;  3RC8 A;  3OJA A;  1OWA A;  3OBV E;  4COF A;  2XPK A;  1UUR A;  4GK5 E;  3UUN A;  1YXR A;  2XQY A;  3N5L A;  4ZZC A;  2VQF T;  3KBU A;  4LML A;  4AQY T;  4QH4 A;  1Z8U A;  4O8S A;  3ZJ1 A;  3ZC1 A;  4EGW A;  1X79 A;  1FIO A;  4LMK A;  5HEH A; 
#chains in the Genus database with same CATH homology
 4LF5 T;  2UUA T;  2UXD T;  1HNW T;  4X65 T;  1FJG T;  4DR1 T;  4X64 T;  3OTO T;  4JI7 T;  4DV4 T;  4X66 T;  4DR6 T;  4JYA T;  4NXM T;  4JI6 T;  4DV2 T;  4GKJ T;  4DUZ T;  4DV7 T;  2E5L T;  4B3R T;  2ZM6 T;  1IBK T;  4LF6 T;  1XNQ T;  4B3M T;  2HHH T;  4LF8 T;  5BR8 T;  1HNZ T;  4DUY T;  1HNX T;  4K0K T;  4DR5 T;  1N33 T;  5LMU T;  4JI5 T;  4LF7 T;  4DR7 T;  5LMN T;  1IBM T;  1XMQ T;  2UXB T;  4B3T T;  4JI0 T;  4JI4 T;  3T1Y T;  4LF4 T;  1XMO T;  4GKK T;  4OX9 T;  1HR0 T;  3T1H T;  4JI3 T;  4DV5 T;  4JI1 T;  4B3S T;  2UU9 T;  1I94 T;  4JI8 T;  4DV1 T;  4JI2 T;  4LF9 T;  1IBL T;  4LFB T;  1N32 T;  4YY3 T;  4NXN T;  5IWA T;  1J5E T;  4JV5 T;  1XNR T;  2F4V T;  4DR4 T;  4X62 T;  4LFA T;  4DR3 T;  2VQE T;  2UUB T;  1N34 T;  2UXC T;  4DR2 T;  4DV3 T;  1N36 T;  4YHH T;  4DV6 T;  2UUC T;  2VQF T;  4AQY T;  4LFC T;  4DV0 T;  4KHP T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...