3T1YT

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a human anti-codon stem loop (hasl) of transfer rna lysine 3 (trnalys3) bound to an mrna with an aag-codon in the a-site and paromomycin
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAVQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Human tRNA(Lys3)(UUU) Is Pre-Structured by Natural Modifications for Cognate and Wobble Codon Binding through Keto-Enol Tautomerism.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 34
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2011-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 3t1yT00
4LFAT 4DR4T 2UU9T 4B3ST 1HR0T 5IWAT 4DR2T 1HNZT 2UUAT 4DR1T 1IBKT 4X66T 2E5LT 4LF7T 4OX9T 4B3MT 4X62T 3OTOT 4DV5T 1XNRT 4DV6T 4LF6T 1N33T 4LFBT 2UXBT 1I94T 4X65T 4DR6T 4YY3T 4X64T 1N36T 2VQFT 4DV4T 1J5ET 4DV0T 4YHHT 4JYAT 4DUYT 4LFCT 4B3TT 4LF4T 4DV3T 4LF9T 4NXNT 4LF8T 4K0KT 4AQYT 4KHPT 2UXDT 2F4VT 4LF5T 4GKJT 2HHHT 1N34T 4DV1T 1XMQT 1HNXT 1IBLT 4DR3T 3T1YT 2ZM6T 1XMOT 4DUZT 4JI7T 5LMUT 4GKKT 1HNWT 4DV2T 4JI0T 4DR5T 1N32T 4JI5T 2UUBT 4NXMT 2VQET 5BR8T 4JI6T 4JI2T 2UUCT 5LMNT 1IBMT 3T1HT 2UXCT 4JI8T 4JV5T 4JI4T 4JI1T 4DV7T 4B3RT 4JI3T 1XNQT 1FJGT 4DR7T
chains in the Genus database with same CATH superfamily
4MFRA 5LXTE 4UEMA 4HTEA 4BJNA 2DCFA 2I6HA 2Z6EA 1HNZT 3Q5WA 5JDGA 4X66T 5AQJB 2XQYA 5L2LA 2JIWA 1HG2A 3ZMTB 4DV5T 2FUPA 2YKSA 3KV4A 1N33T 3HKCE 2HPLA 4AKRB 5CA0E 4U31A 2KZ7B 1IJ5A 1MMGA 3IA3A 4PNIA 2WZHA 2YINA 5AQGB 4WW0A 5LHHB 3AVRA 5AFUL 1FMWA 2CHOA 3J9X1 2X9WA 2YU1A 2IMLA 2J4GA 5HAXA 2KMFA 3PUVF 4AI6A 4L5GA 2C5IT 3O1JA 4YT0A 2LM9A 2HHHT 2WB5A 1KNPA 4UVAB 1E1HB 3QB5A 3UQ4A 4ILBA 2MAWA 1E2AA 2PG8A 1VCTA 3C98B 2BBHA 1OEDA 1W0BA 2CXDA 1YW0A 1YQ3A 3FZKB 2VURA 3FZLB 4B3RT 2LSGA 4O2BE 1FJGT 5JRCA 3ETUA 3RIFA 2UU9T 1E7PA 3PUZF 4QXCB 3RH3A 1T8BA 4U7IA 3N9LA 1NEKA 3BQLA 4GOUA 2KLQA 4UR9A 2V6YA 5JDFA 5L3BB 2CWOA 3PDYA 2WDVA 2DWGA 2IUBA 4OX9T 3EUHA 3PUSA 2BKPA 1KEYA 1VCSA 3F57A 2XHEB 2CWYA 3UT5E 3LJCA 4QH5A 1MMDA 4C91A 4EEDA 4IDNA 2LHRA 5AQSB 2DWKA 2WZIA 1MMAA 4ZI7E 2X51A 5ABGA 2A72A 3PUYF 2RA1A 1UGOA 2W4XA 4MLKA 4X1YE 3ZKRA 5F3JA 4UV9B 5AQKB 5HCJA 2MBGA 2XQ7A 3FZHB 4ZI3D 4HKAA 3UU3A 3RRWA 1ZEEA 2XAJB 3PJAA 4WNKA 4JI1T 4EB6E 1KK7A 5EK4A 4IDZA 1V9DA 3QB5K 3UULA 2FJEA 1LVKA 5EZYE 5ABFB 2QA7A 2UUAT 2LKHA 1ZHCA 2N1GA 3KBUA 3RI5A 3PJAJ 3JAEA 2H3RA 2L9QA 5ETWA 4IREA 3QC9A 3RIUC 4DIDB 4IDPA 1XDPA 2XAQB 1M62A 4QX7B 2JQ9A 3K3OA 3S4UA 3H3AA 1FEWA 2CMRA 4B3TT 3QNUA 4DV3T 4G2AA 1L0VA 2EHOD 4J2CA 3E08A 2WDRA 3ZSTA 5HXCA 3C64A 1HNXT 2HN2A 4K0UA 3T1YT 5CA1E 1WR0A 4PK6A 3TLUA 5FXXA 1D0ZA 4DV2T 5HYAA 4BA9A 5JDMA 1BR0A 5L4HA 3ETVA 1MMNA 4MBQA 4YLHA 4YHJA 3L3PA 2UXCT 3JAFA 2PJQA 3AA6B 3SS1A 3RHWA 4HE8A 4TN7B 3ZMZB 4IDOA 1JNRA 2DL1A 3UU5A 3ZYMA 4H9NC 3FXEB 5J2TE 3P50A 1XDOA 2NTXA 4Z90A 4BJMA 5IWAT 1NENA 2CCQA 3K3QC 2CM0A 4DR1T 4KUMB 3KFWX 3Q5EA 4IT4A 3W15B 3AE3A 1LRZA 5JR9C 2WWVA 2EHOA 1XNRT 2LT3A 2K9AA 3Q9DA 1S94A 4X64T 4PAGA 2XTLA 1J5ET 4HWDA 1WCRA 3ZMSB 4DUYT 1R8IA 3ZMVB 4TX5A 1VRBA 2YN6A 5GONE 5ABFA 4EZHA 4GYSA 1IJ6A 1BR4A 2ZM2A 1N34T 3AAIA 4WBNE 3EDUA 4N78D 3N9NA 4JI7T 3VKGA 5EK3A 2NTYA 2D0UA 5L4EA 2IIUA 2OV9A 3I0OA 3VHLA 2V7MA 3NRXA 4Z8XA 3KINB 2X0HA 3AE5A 1G8XA 4NUVA 5HXRA 2ODUA 5E0OA 2BKNA 4L0RA 3Q5XA 3U3IA 3P4WA 4B3ST 4H9QC 4O4HE 2AXDS 4OYJA 2KSRA 2CPTA 3AAAB 5FP3A 5LYJE 2H89A 2MPKA 2X68A 3N9MA 2BG9B 2JJ9A 4UF0B 4HWIB 5DQWA 1Z8UA 3ONLC 2VKDA 2V8SV 3BQIA 4LF6T 4P1NA 4A5XA 2WAUA 3OPCA 2WS3A 4C90A 2XQ6A 3ZJ1A 3CKDA 3E22E 4KBMB 4KMCA 2BKOA 1WYCA 3I1AA 4YTPA 4JUYA 1QUUA 1QLBA 4LF4T 2E8IA 2FJAA 4IE6A 1XZYA 4HN9A 5AQQB 4GKJT 2BZBA 4X1IE 2C0SA 2I59A 3IEEA 4IDQA 4YXDA 4HEAA 2A9UA 3N5LA 2UUBT 3ZJ2A 3L8RA 1UX4A 2BS2A 1SE7A 3FBZA 5FY0A 5LNKA 4PFPA 2E9XB 4JI4T 5ADXL 3L39A 2WCAA 3CX7B 4U2YA 3MK7C 5M4YA 2XAGB 3RYFE 4E7ZA 3EI0A 5LGNB 2MTQA 1ZP0A 2DNXA 1VOMA 4LMJA 4HFCA 2CBJA 5HEHA 4CN6A 2V1DB 2WU2A 1I94T 3BK9A 5KMGP 4O2AE 3IF8B 2XSAA 2LLYA 2V7IA 4JYAT 3P4RA 4X20E 4TNVA 5HXHA 2NW7A 5ABHA 5KXJA 4LF8T 5FL0A 5FXZA 3AAEB 2PBIA 3SFDA 2A2FX 4H9SE 4IE4A 2FJDA 1HG5A 2BG9A 2JQKA 4UF0A 3EAMA 3B5MA 3RYHE 1D1CA 2D9DA 3Q5DA 3AEFA 4PJJA 3KVAA 2FJBA 4TUYE 1B7TA 3UUNA 5FNVE 1WYBA 2VVSA 4FJOA 3AEEA 3P8CD 2R6GF 4JI2T 2UUCT 1IBMT 4HWFA 1X79A 4V1Av 3MJXA 2LSJA 3UU8A 3PUGA 1OEDE 3ZT7A 1W0AA 3CIRA 5LG3A 2M67A 1T72A 2W00A 2XY8B 4DR4T 3EDVA 5C3JA 4HGAA 5AQTB 1CHUA 4O4LE 4EIWA 2CRBA 2JRKA 2L3LA 3LBXB 3VKHA 2VVNA 2WDQA 4ZS2A 4CI2B 5LP6E 2KT9A 5AQLB 5LCYA 3ZEFB 5JH7E 2XQ9A 1ZKEA 4I4TE 2BS4A 3EABA 2MYSA 1J1JA 4OFZA 2RPAA 3WAJA 3B13A 2YK0A 2G0UA 1EZ3A 1UCUA 3PU8A 3K3NA 2WSSV 1LVFA 5FXWA 1KNRA 2W67A 1AJ3A 3RLFF 2LEHA 4H9RC 2UXDT 3NZPA 5JVDE 5JR9B 1NAFA 4HFHA 1XMQT 4XAXB 2YDRA 4DUZT 4AKHA 4DVDA 3ZC1A 3I9WA 1HNWT 2X66A 1OEDC 4YSXA 4YTMA 2VKHA 5LA6E 3FZFB 2CA5A 5LBMA 2LJLA 2BVLA 2WQYA 3EHZA 3BQKA 2Q9QB 5DQVA 5JQGE 5LG4A 3PUQA 1WRDA 3CQGB 4ILCA 2VKJA 2IDOB 4ANJA 2E5VA 2CE7A 4BAYB 1XWMA 5H6QB 3N9PA 3A8YC 1X9BA 2VKOA 3SFEA 2C5JA 4X62T 5AQHB 2K3WA 2N2NA 2V7LA 2CLYC 2JQQA 2K5BB 1YXRA 1WLXA 1H7CA 1HTJF 2K24A 3ZYKA 1T7SA 5HWYA 5KX5E 2VQFT 3P7IA 5FKYA 3SOLA 2IC9A 5DABA 3RX6A 2X0YA 3UUXB 4U3CA 1US7B 4LF5T 4Q25A 2LSKA 4IIJE 3ANWB 3MZKB 3QK6A 3EVYA 4CXWA 2VK9A 4I55E 4U74A 4DV1T 1IZNB 2RP4A 5BMVE 2JMKA 4HWHA 1CUNA 3PUAA 1Y01A 2V5CA 3TKLB 3VR9A 3ONXA 2X9HA 5LGTB 3HKDE 5L3EB 3JCFA 1N32T 2Y6XA 3ZYLA 4NXMT 3N2KE 2W0GA 4EEBA 3AE7A 3A7MA 2SPCA 5JDHA 3AE2A 4MHCA 3AE4A 4DV7T 4EXTA 4JI3T 5LBQB 3CPZA 4LFAT 3CWZB 3UFEA 1S35A 3TLVA 4YFSA 2QYWA 4JEUB 4EGWA 5JDQA 3PTRB 5EK2A 4QWNB 3A5XA 3L09A 5CJ5A 4H63H 5HEOA 4OK0A 3JC6D 2X9XA 2WY2A 4UIGA 5LJNA 3O9XA 2NR4A 1D1AA 4DV0T 5HWXA 2K48A 3RGLA 2LM2A 2W61A 3K8PC 5HXEA 4K0KT 1SHZC 3ZCIA 4AQYT 4MALA 4ZI3C 3GN5B 4U2ZA 4HFBA 3LDQB 2NW9A 4EYUA 4AIUA 5LHIB 3R6NA 3RC3A 3N9QA 2M6BA 3PUXF 4PK5A 2JQHA 1FMVA 4AXPA 3H37A 5FY7A 2ZM0A 4JI6T 2XSBA 3WI3A 2CXFA 3RQUA 2WMOA 4DBRA 4AQFA 3MACA 2YU2A 1IAPA 1HCIA 3TLSA 5C2TA 2PTFA 3RQWA 3UU4A 3CX6B 4QXHB 4A56A 3KV5A 2I0MA 3N9OA 4LMKA 2NP9A 2UXNB 2EHOC 3FXDB 4DMVA 1MIVA 4KHZF 3K1SA 4ZZBA 1I6ZA 5TAOA 3RRCA 5FMNA 2MOZA 3MA9A 3ZT6A 3WAKA 4GK0E 3PUWF 2V26A 3FZMB 4UELA 3OYZA 3RKGA 4X5TA 2H7VC 4GYRA 5L47A 4IE0A 3JADA 3JC6C 4CN4A 1UUSA 4UXNB 4ADZA 3QUJA 3ESLA 4HFVA 4ZI2D 5JDLA 3AE9A 4O4IE 3ZPOA 3LSVA 3ZMUB 5LHGB 3P4SA 4XZCA 2XASB 2FBWA 4JV5T 3DJBA 3I9YA 3RKOA 2VASA 1KF6A 3RPUA 5HEUA 2Y8DA 4ISTA 3H3MA 4ZHQE 4NPPA 4EV6A 2KINB 2H7OA 3KV9A 2VB6A 4JEHB 2J47A 1KNZA 3NBXX 4UVBB 4ZEYA 3KV6A 5LB7B 2VL0A 3OTOT 3PV0F 5JREA 3LK2B 3PE0A 3FBLA 5F5WA 2C5KT 5L3CB 4YY3T 5JRCB 4CXXA 2VL8A 4EAHA 4TNWA 2PFVA 2WM9A 2YEVC 4NXNT 4TV9E 4HWCA 2LSIA 1OWAA 2V6YB 3V5UA 1DU2A 5AQOB 3C4XA 2VWAA 1IBLT 4IL4A 3RYIE 3ZCJA 2BG9E 2IC6A 2ZLYA 1U5PA 4DR5T 1QSDA 2XM1A 4P0BA 1D0XA 2CBIA 2LOSA 2XQ4A 2E9XD 4PK4A 2JPFA 4JI8T 1UK5A 2IAKA 3LFMA 1XNQT 4O8SA 3O4XE 4QXBB 4U33A 2DHRA 3AEDA 3RF1A 4KP3C 1J5WA 4ZI2C 2N9DA 3P4QA 1HFAA 1W09A 4YJ3E 4DV6T 4GK5E 2YDSA 3C51A 4DR6T 2GK9A 4X1KE 1HX1B 4HFIA 1JNZA 2DI4A 4P0AA 4WZXA 3RYCE 1YKEB 4LFCT 3VU7H 1Z0PA 1MIWA 2E2AA 1YQ4A 2WBLA 3KDSE 4LF9T 2BVMA 4TWDA 4H63V 1MNEA 2F4VT 4XBFB 4CXYA 2BG9C 3GMIA 3AE6A 4ILUA 3G06A 2E9XA 4WBOA 3D0TA 3ONJA 3RC8A 2BDEA 5JDNA 5CGMA 2D2SA 4IL9A 4JI0T 1YD8G 4DNDA 5L3GB 1T98A 1D0YA 4CI3B 4NIQA 3ZC0A 1FIOA 2VQET 4KX6A 2XQ3A 1NWMX 1M7KA 3LK3B 4PJMA 2YDQA 2NW8A 3VR8A 2LKGA 3CK6A 2BBJA 3NWIA 1WFDA 4U7YA 4QHOA 5AQUB 4DR7T 2WWUA 4KI0F 2ACZA 5CFBA 4ZXLA 5LGUB 4EOZB 5LJMA 5FVLA 2XPKA 3QOFA 3NZQA 2CXLA 3R84B 3U78A 1WR6A 3AEGA 3OJAA 3AA1B 2JMHA 4AKIA 4LFBT 3PU3A 2E9XC 3RIUA 2A3DA 2LRKA 4ZZCA 4JLEA 3N2GE 3NRYA 4DV4T 3OYXA 1U4QA 3DP7A 4I0UA 5FXVA 3LG7A 2XJ7A 2W62A 3AE1A 4PJNA 1MIYA 4AISA 5L3FB 4TWHA 4M1PA 2H88A 3UTKA 2LE8A 5AQPB 2EHOB 4DO0A 3VRBA 4HFEA 5HEGA 2WMNA 3N2OA 2ZM6T 3AVSA 2LRLA 3FHNA 4OYKA 4QX8B 2L8KA 3LBXA 4JI5T 3FB2A 5CB4E 4ASKA 3CVRA 3AXJB 3CX8B 2CHNA 1OXZA 4QH4A 3NVOA 2QRXA 2Q9QD 4F8HA 3VRAA 2IW5B 2V5DA 4QH1A 4DBQA 3TLTA 2KXPB 4ISSA 1HF8A 4OHFA 5ABEA 4CN1A 2OLTA 3M65A 3MXZA 4Z91A 3C50A 5HXSA 5JR9A 2XAHB 4LF7T 3J7Yq 2X0LB 4EZ4A 2XUEA 4UV8B 2X67A 3TLWA 3M3ZB 4O4JE 3V5SA 4YHHT 2NWBA 4CZZB 5AQFB 2ES0A 2J1DG 2YOEA 2M6IA 2P9BA 5C8YE 4KHPT 3IHRA 4IE5A 5FY1A 3O1HA 4E7SA 4DR3T 2ACXA 2W66A 4TV8E 2QVAA 2ZM8A 5AQNB 1XMOT 2Q9QA 2AE9A 4YTNA 4L9IA 4ZOLE 5LMUT 3LK42 2D5UA 5AQIB 4A98A 4HFDA 5FVKA 4GIWA 4QKNA 2KWIB 1UURA 5A1LA 4YSZA 2XZEA 4WYVA 4NUUA 5LMNT 4H9OC 3T8OA 3T1HT 3O1IA 4CI1B 4ERRA 4LMLA 2UXXB 3HKEE 1BR2A 1HR0T 2WP9A 4B6XA 5JTGA 5HCMA 2HN1A 1IBKT 4JBWF 2E5LT 3ANWA 2ZMAA 1O3XA 3CQXC 3AXJA 1YKHB 1G73A 2HPJA 2DLRA 3HI2A 2W2UA 5FL1A 2XQ8A 3AEBA 2Q9QC 3HL6A 4A97A 3UFGA 3ZN1B 3NKZA 3C4ZA 5J0ZA 3AA0B 3MKDA 3AEAA 3OBVE 1ZV4X 2WU5A 4F6RC 2KWHA 4I50E 4IE7A 2LHNA 4P09A 3KBTA 3P4PA 3SRZA 5IHYA 4IGUA 2V6XA 2KNDA 3PURA 4DMWA 2V7KA 1HX8A 3F2EA 3OVUA 4AQGA 3Q2MA 3CMLA 1KFYA 4GKKT 3RIAA 2OA5A 5FYMA 1BR1A 3ZN0B 3CQCB 2Y48B 2CEAA 3B57A 3OKQA 2B1EA 4YJ2E 4PFOA 2X9YA 3UUMA 2V7JA 4AQFC 3UUBA 3E0ZA 2QGSA 2B76A 1MNDA 4COFA 3ZSSA 4H9PC 3SWHA 3AE8A 4FI5A 3HA4A 3ABVA 5HEJA 4EYYR 2BS3A 4DR2T 3HKBE 2HH7A 4G63A 1Y64B 4AKLA 5DJQC 3AB3B 3ZLIA 3IBPA 5KDMC 4TWFA 3GN5A 1W9RA 4ILAA 4B3MT 5L3DB 5J1GA 2IHR1 2UXBT 1SUMB 2XQAA 4X65T 3UQ7A 2LOPA 3DTOA 2W63A 1N36T 4UVCB 3ZT5A 4PJLA 4ZS3A 1OEDB 3C4WA 2NOXA 2XM2A 4YSYA 1D1BA 4IHJE 2XQ5A 1HS7A 3UU6A 4I43B 4AKGA 2LSYA 3GA8A 5LOVE 4PW8A 5IUXA 3HR0A 2D0TA 3AA7B 3GWHA 2XAFB 1LKXA 5H6RB 1ZOYA 3F31A 4CQIA 1GQEA 1UX5A 5BR8T 5AQMB 2CLYB 5IYZE 1SA0E 5F8PA 4TZ4C 2J62A 5AQRB 5J2UE 2ODVA 3AECA 3X1DA 5AQVB 3I0QA 4U72A 3KVBA
chains in the Genus database with same CATH topology
4LFAT 4DR4T 2UU9T 4B3ST 1HR0T 5IWAT 4DR2T 1HNZT 2UUAT 4DR1T 1IBKT 4X66T 2E5LT 4LF7T 4OX9T 4B3MT 4X62T 3OTOT 4DV5T 1XNRT 4DV6T 4LF6T 1N33T 4LFBT 2UXBT 1I94T 4X65T 4DR6T 4YY3T 4X64T 1N36T 2VQFT 4DV4T 1J5ET 4DV0T 4YHHT 4JYAT 4DUYT 4LFCT 4B3TT 4LF4T 4DV3T 4LF9T 4NXNT 4LF8T 4K0KT 4AQYT 4KHPT 2UXDT 2F4VT 4LF5T 4GKJT 2HHHT 1N34T 4DV1T 1XMQT 1HNXT 1IBLT 4DR3T 3T1YT 2ZM6T 1XMOT 4DUZT 4JI7T 5LMUT 4GKKT 1HNWT 4DV2T 4JI0T 4DR5T 1N32T 4JI5T 2UUBT 4NXMT 2VQET 5BR8T 4JI6T 4JI2T 2UUCT 5LMNT 1IBMT 3T1HT 2UXCT 4JI8T 4JV5T 4JI4T 4JI1T 4DV7T 4B3RT 4JI3T 1XNQT 1FJGT 4DR7T
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LFA T;  4DR4 T;  2UU9 T;  4B3S T;  1HR0 T;  5IWA T;  4DR2 T;  1HNZ T;  2UUA T;  4DR1 T;  1IBK T;  4X66 T;  2E5L T;  4LF7 T;  4OX9 T;  4B3M T;  4X62 T;  3OTO T;  4DV5 T;  1XNR T;  4DV6 T;  4LF6 T;  1N33 T;  4LFB T;  2UXB T;  1I94 T;  4X65 T;  4DR6 T;  4YY3 T;  4X64 T;  1N36 T;  2VQF T;  4DV4 T;  1J5E T;  4DV0 T;  4YHH T;  4JYA T;  4DUY T;  4LFC T;  4B3T T;  4LF4 T;  4DV3 T;  4LF9 T;  4NXN T;  4LF8 T;  4K0K T;  4AQY T;  4KHP T;  2UXD T;  2F4V T;  4LF5 T;  4GKJ T;  2HHH T;  1N34 T;  4DV1 T;  1XMQ T;  1HNX T;  1IBL T;  4DR3 T;  3T1Y T;  2ZM6 T;  1XMO T;  4DUZ T;  4JI7 T;  5LMU T;  4GKK T;  1HNW T;  4DV2 T;  4JI0 T;  4DR5 T;  1N32 T;  4JI5 T;  2UUB T;  4NXM T;  2VQE T;  5BR8 T;  4JI6 T;  4JI2 T;  2UUC T;  5LMN T;  1IBM T;  3T1H T;  2UXC T;  4JI8 T;  4JV5 T;  4JI4 T;  4JI1 T;  4DV7 T;  4B3R T;  4JI3 T;  1XNQ T;  1FJG T;  4DR7 T; 
#chains in the Genus database with same CATH topology
 4MFR A;  5LXT E;  4UEM A;  4HTE A;  4BJN A;  2DCF A;  2I6H A;  2Z6E A;  1HNZ T;  3Q5W A;  5JDG A;  4X66 T;  5AQJ B;  2XQY A;  5L2L A;  2JIW A;  1HG2 A;  3ZMT B;  4DV5 T;  2FUP A;  2YKS A;  3KV4 A;  1N33 T;  3HKC E;  2HPL A;  4AKR B;  5CA0 E;  4U31 A;  2KZ7 B;  1IJ5 A;  1MMG A;  3IA3 A;  4PNI A;  2WZH A;  2YIN A;  5AQG B;  4WW0 A;  5LHH B;  3AVR A;  5AFU L;  1FMW A;  2CHO A;  3J9X 1;  2X9W A;  2YU1 A;  2IML A;  2J4G A;  5HAX A;  2KMF A;  3PUV F;  4AI6 A;  4L5G A;  2C5I T;  3O1J A;  4YT0 A;  2LM9 A;  2HHH T;  2WB5 A;  1KNP A;  4UVA B;  1E1H B;  3QB5 A;  3UQ4 A;  4ILB A;  2MAW A;  1E2A A;  2PG8 A;  1VCT A;  3C98 B;  2BBH A;  1OED A;  1W0B A;  2CXD A;  1YW0 A;  1YQ3 A;  3FZK B;  2VUR A;  3FZL B;  4B3R T;  2LSG A;  4O2B E;  1FJG T;  5JRC A;  3ETU A;  3RIF A;  2UU9 T;  1E7P A;  3PUZ F;  4QXC B;  3RH3 A;  1T8B A;  4U7I A;  3N9L A;  1NEK A;  3BQL A;  4GOU A;  2KLQ A;  4UR9 A;  2V6Y A;  5JDF A;  5L3B B;  2CWO A;  3PDY A;  2WDV A;  2DWG A;  2IUB A;  4OX9 T;  3EUH A;  3PUS A;  2BKP A;  1KEY A;  1VCS A;  3F57 A;  2XHE B;  2CWY A;  3UT5 E;  3LJC A;  4QH5 A;  1MMD A;  4C91 A;  4EED A;  4IDN A;  2LHR A;  5AQS B;  2DWK A;  2WZI A;  1MMA A;  4ZI7 E;  2X51 A;  5ABG A;  2A72 A;  3PUY F;  2RA1 A;  1UGO A;  2W4X A;  4MLK A;  4X1Y E;  3ZKR A;  5F3J A;  4UV9 B;  5AQK B;  5HCJ A;  2MBG A;  2XQ7 A;  3FZH B;  4ZI3 D;  4HKA A;  3UU3 A;  3RRW A;  1ZEE A;  2XAJ B;  3PJA A;  4WNK A;  4JI1 T;  4EB6 E;  1KK7 A;  5EK4 A;  4IDZ A;  1V9D A;  3QB5 K;  3UUL A;  2FJE A;  1LVK A;  5EZY E;  5ABF B;  2QA7 A;  2UUA T;  2LKH A;  1ZHC A;  2N1G A;  3KBU A;  3RI5 A;  3PJA J;  3JAE A;  2H3R A;  2L9Q A;  5ETW A;  4IRE A;  3QC9 A;  3RIU C;  4DID B;  4IDP A;  1XDP A;  2XAQ B;  1M62 A;  4QX7 B;  2JQ9 A;  3K3O A;  3S4U A;  3H3A A;  1FEW A;  2CMR A;  4B3T T;  3QNU A;  4DV3 T;  4G2A A;  1L0V A;  2EHO D;  4J2C A;  3E08 A;  2WDR A;  3ZST A;  5HXC A;  3C64 A;  1HNX T;  2HN2 A;  4K0U A;  3T1Y T;  5CA1 E;  1WR0 A;  4PK6 A;  3TLU A;  5FXX A;  1D0Z A;  4DV2 T;  5HYA A;  4BA9 A;  5JDM A;  1BR0 A;  5L4H A;  3ETV A;  1MMN A;  4MBQ A;  4YLH A;  4YHJ A;  3L3P A;  2UXC T;  3JAF A;  2PJQ A;  3AA6 B;  3SS1 A;  3RHW A;  4HE8 A;  4TN7 B;  3ZMZ B;  4IDO A;  1JNR A;  2DL1 A;  3UU5 A;  3ZYM A;  4H9N C;  3FXE B;  5J2T E;  3P50 A;  1XDO A;  2NTX A;  4Z90 A;  4BJM A;  5IWA T;  1NEN A;  2CCQ A;  3K3Q C;  2CM0 A;  4DR1 T;  4KUM B;  3KFW X;  3Q5E A;  4IT4 A;  3W15 B;  3AE3 A;  1LRZ A;  5JR9 C;  2WWV A;  2EHO A;  1XNR T;  2LT3 A;  2K9A A;  3Q9D A;  1S94 A;  4X64 T;  4PAG A;  2XTL A;  1J5E T;  4HWD A;  1WCR A;  3ZMS B;  4DUY T;  1R8I A;  3ZMV B;  4TX5 A;  1VRB A;  2YN6 A;  5GON E;  5ABF A;  4EZH A;  4GYS A;  1IJ6 A;  1BR4 A;  2ZM2 A;  1N34 T;  3AAI A;  4WBN E;  3EDU A;  4N78 D;  3N9N A;  4JI7 T;  3VKG A;  5EK3 A;  2NTY A;  2D0U A;  5L4E A;  2IIU A;  2OV9 A;  3I0O A;  3VHL A;  2V7M A;  3NRX A;  4Z8X A;  3KIN B;  2X0H A;  3AE5 A;  1G8X A;  4NUV A;  5HXR A;  2ODU A;  5E0O A;  2BKN A;  4L0R A;  3Q5X A;  3U3I A;  3P4W A;  4B3S T;  4H9Q C;  4O4H E;  2AXD S;  4OYJ A;  2KSR A;  2CPT A;  3AAA B;  5FP3 A;  5LYJ E;  2H89 A;  2MPK A;  2X68 A;  3N9M A;  2BG9 B;  2JJ9 A;  4UF0 B;  4HWI B;  5DQW A;  1Z8U A;  3ONL C;  2VKD A;  2V8S V;  3BQI A;  4LF6 T;  4P1N A;  4A5X A;  2WAU A;  3OPC A;  2WS3 A;  4C90 A;  2XQ6 A;  3ZJ1 A;  3CKD A;  3E22 E;  4KBM B;  4KMC A;  2BKO A;  1WYC A;  3I1A A;  4YTP A;  4JUY A;  1QUU A;  1QLB A;  4LF4 T;  2E8I A;  2FJA A;  4IE6 A;  1XZY A;  4HN9 A;  5AQQ B;  4GKJ T;  2BZB A;  4X1I E;  2C0S A;  2I59 A;  3IEE A;  4IDQ A;  4YXD A;  4HEA A;  2A9U A;  3N5L A;  2UUB T;  3ZJ2 A;  3L8R A;  1UX4 A;  2BS2 A;  1SE7 A;  3FBZ A;  5FY0 A;  5LNK A;  4PFP A;  2E9X B;  4JI4 T;  5ADX L;  3L39 A;  2WCA A;  3CX7 B;  4U2Y A;  3MK7 C;  5M4Y A;  2XAG B;  3RYF E;  4E7Z A;  3EI0 A;  5LGN B;  2MTQ A;  1ZP0 A;  2DNX A;  1VOM A;  4LMJ A;  4HFC A;  2CBJ A;  5HEH A;  4CN6 A;  2V1D B;  2WU2 A;  1I94 T;  3BK9 A;  5KMG P;  4O2A E;  3IF8 B;  2XSA A;  2LLY A;  2V7I A;  4JYA T;  3P4R A;  4X20 E;  4TNV A;  5HXH A;  2NW7 A;  5ABH A;  5KXJ A;  4LF8 T;  5FL0 A;  5FXZ A;  3AAE B;  2PBI A;  3SFD A;  2A2F X;  4H9S E;  4IE4 A;  2FJD A;  1HG5 A;  2BG9 A;  2JQK A;  4UF0 A;  3EAM A;  3B5M A;  3RYH E;  1D1C A;  2D9D A;  3Q5D A;  3AEF A;  4PJJ A;  3KVA A;  2FJB A;  4TUY E;  1B7T A;  3UUN A;  5FNV E;  1WYB A;  2VVS A;  4FJO A;  3AEE A;  3P8C D;  2R6G F;  4JI2 T;  2UUC T;  1IBM T;  4HWF A;  1X79 A;  4V1A v;  3MJX A;  2LSJ A;  3UU8 A;  3PUG A;  1OED E;  3ZT7 A;  1W0A A;  3CIR A;  5LG3 A;  2M67 A;  1T72 A;  2W00 A;  2XY8 B;  4DR4 T;  3EDV A;  5C3J A;  4HGA A;  5AQT B;  1CHU A;  4O4L E;  4EIW A;  2CRB A;  2JRK A;  2L3L A;  3LBX B;  3VKH A;  2VVN A;  2WDQ A;  4ZS2 A;  4CI2 B;  5LP6 E;  2KT9 A;  5AQL B;  5LCY A;  3ZEF B;  5JH7 E;  2XQ9 A;  1ZKE A;  4I4T E;  2BS4 A;  3EAB A;  2MYS A;  1J1J A;  4OFZ A;  2RPA A;  3WAJ A;  3B13 A;  2YK0 A;  2G0U A;  1EZ3 A;  1UCU A;  3PU8 A;  3K3N A;  2WSS V;  1LVF A;  5FXW A;  1KNR A;  2W67 A;  1AJ3 A;  3RLF F;  2LEH A;  4H9R C;  2UXD T;  3NZP A;  5JVD E;  5JR9 B;  1NAF A;  4HFH A;  1XMQ T;  4XAX B;  2YDR A;  4DUZ T;  4AKH A;  4DVD A;  3ZC1 A;  3I9W A;  1HNW T;  2X66 A;  1OED C;  4YSX A;  4YTM A;  2VKH A;  5LA6 E;  3FZF B;  2CA5 A;  5LBM A;  2LJL A;  2BVL A;  2WQY A;  3EHZ A;  3BQK A;  2Q9Q B;  5DQV A;  5JQG E;  5LG4 A;  3PUQ A;  1WRD A;  3CQG B;  4ILC A;  2VKJ A;  2IDO B;  4ANJ A;  2E5V A;  2CE7 A;  4BAY B;  1XWM A;  5H6Q B;  3N9P A;  3A8Y C;  1X9B A;  2VKO A;  3SFE A;  2C5J A;  4X62 T;  5AQH B;  2K3W A;  2N2N A;  2V7L A;  2CLY C;  2JQQ A;  2K5B B;  1YXR A;  1WLX A;  1H7C A;  1HTJ F;  2K24 A;  3ZYK A;  1T7S A;  5HWY A;  5KX5 E;  2VQF T;  3P7I A;  5FKY A;  3SOL A;  2IC9 A;  5DAB A;  3RX6 A;  2X0Y A;  3UUX B;  4U3C A;  1US7 B;  4LF5 T;  4Q25 A;  2LSK A;  4IIJ E;  3ANW B;  3MZK B;  3QK6 A;  3EVY A;  4CXW A;  2VK9 A;  4I55 E;  4U74 A;  4DV1 T;  1IZN B;  2RP4 A;  5BMV E;  2JMK A;  4HWH A;  1CUN A;  3PUA A;  1Y01 A;  2V5C A;  3TKL B;  3VR9 A;  3ONX A;  2X9H A;  5LGT B;  3HKD E;  5L3E B;  3JCF A;  1N32 T;  2Y6X A;  3ZYL A;  4NXM T;  3N2K E;  2W0G A;  4EEB A;  3AE7 A;  3A7M A;  2SPC A;  5JDH A;  3AE2 A;  4MHC A;  3AE4 A;  4DV7 T;  4EXT A;  4JI3 T;  5LBQ B;  3CPZ A;  4LFA T;  3CWZ B;  3UFE A;  1S35 A;  3TLV A;  4YFS A;  2QYW A;  4JEU B;  4EGW A;  5JDQ A;  3PTR B;  5EK2 A;  4QWN B;  3A5X A;  3L09 A;  5CJ5 A;  4H63 H;  5HEO A;  4OK0 A;  3JC6 D;  2X9X A;  2WY2 A;  4UIG A;  5LJN A;  3O9X A;  2NR4 A;  1D1A A;  4DV0 T;  5HWX A;  2K48 A;  3RGL A;  2LM2 A;  2W61 A;  3K8P C;  5HXE A;  4K0K T;  1SHZ C;  3ZCI A;  4AQY T;  4MAL A;  4ZI3 C;  3GN5 B;  4U2Z A;  4HFB A;  3LDQ B;  2NW9 A;  4EYU A;  4AIU A;  5LHI B;  3R6N A;  3RC3 A;  3N9Q A;  2M6B A;  3PUX F;  4PK5 A;  2JQH A;  1FMV A;  4AXP A;  3H37 A;  5FY7 A;  2ZM0 A;  4JI6 T;  2XSB A;  3WI3 A;  2CXF A;  3RQU A;  2WMO A;  4DBR A;  4AQF A;  3MAC A;  2YU2 A;  1IAP A;  1HCI A;  3TLS A;  5C2T A;  2PTF A;  3RQW A;  3UU4 A;  3CX6 B;  4QXH B;  4A56 A;  3KV5 A;  2I0M A;  3N9O A;  4LMK A;  2NP9 A;  2UXN B;  2EHO C;  3FXD B;  4DMV A;  1MIV A;  4KHZ F;  3K1S A;  4ZZB A;  1I6Z A;  5TAO A;  3RRC A;  5FMN A;  2MOZ A;  3MA9 A;  3ZT6 A;  3WAK A;  4GK0 E;  3PUW F;  2V26 A;  3FZM B;  4UEL A;  3OYZ A;  3RKG A;  4X5T A;  2H7V C;  4GYR A;  5L47 A;  4IE0 A;  3JAD A;  3JC6 C;  4CN4 A;  1UUS A;  4UXN B;  4ADZ A;  3QUJ A;  3ESL A;  4HFV A;  4ZI2 D;  5JDL A;  3AE9 A;  4O4I E;  3ZPO A;  3LSV A;  3ZMU B;  5LHG B;  3P4S A;  4XZC A;  2XAS B;  2FBW A;  4JV5 T;  3DJB A;  3I9Y A;  3RKO A;  2VAS A;  1KF6 A;  3RPU A;  5HEU A;  2Y8D A;  4IST A;  3H3M A;  4ZHQ E;  4NPP A;  4EV6 A;  2KIN B;  2H7O A;  3KV9 A;  2VB6 A;  4JEH B;  2J47 A;  1KNZ A;  3NBX X;  4UVB B;  4ZEY A;  3KV6 A;  5LB7 B;  2VL0 A;  3OTO T;  3PV0 F;  5JRE A;  3LK2 B;  3PE0 A;  3FBL A;  5F5W A;  2C5K T;  5L3C B;  4YY3 T;  5JRC B;  4CXX A;  2VL8 A;  4EAH A;  4TNW A;  2PFV A;  2WM9 A;  2YEV C;  4NXN T;  4TV9 E;  4HWC A;  2LSI A;  1OWA A;  2V6Y B;  3V5U A;  1DU2 A;  5AQO B;  3C4X A;  2VWA A;  1IBL T;  4IL4 A;  3RYI E;  3ZCJ A;  2BG9 E;  2IC6 A;  2ZLY A;  1U5P A;  4DR5 T;  1QSD A;  2XM1 A;  4P0B A;  1D0X A;  2CBI A;  2LOS A;  2XQ4 A;  2E9X D;  4PK4 A;  2JPF A;  4JI8 T;  1UK5 A;  2IAK A;  3LFM A;  1XNQ T;  4O8S A;  3O4X E;  4QXB B;  4U33 A;  2DHR A;  3AED A;  3RF1 A;  4KP3 C;  1J5W A;  4ZI2 C;  2N9D A;  3P4Q A;  1HFA A;  1W09 A;  4YJ3 E;  4DV6 T;  4GK5 E;  2YDS A;  3C51 A;  4DR6 T;  2GK9 A;  4X1K E;  1HX1 B;  4HFI A;  1JNZ A;  2DI4 A;  4P0A A;  4WZX A;  3RYC E;  1YKE B;  4LFC T;  3VU7 H;  1Z0P A;  1MIW A;  2E2A A;  1YQ4 A;  2WBL A;  3KDS E;  4LF9 T;  2BVM A;  4TWD A;  4H63 V;  1MNE A;  2F4V T;  4XBF B;  4CXY A;  2BG9 C;  3GMI A;  3AE6 A;  4ILU A;  3G06 A;  2E9X A;  4WBO A;  3D0T A;  3ONJ A;  3RC8 A;  2BDE A;  5JDN A;  5CGM A;  2D2S A;  4IL9 A;  4JI0 T;  1YD8 G;  4DND A;  5L3G B;  1T98 A;  1D0Y A;  4CI3 B;  4NIQ A;  3ZC0 A;  1FIO A;  2VQE T;  4KX6 A;  2XQ3 A;  1NWM X;  1M7K A;  3LK3 B;  4PJM A;  2YDQ A;  2NW8 A;  3VR8 A;  2LKG A;  3CK6 A;  2BBJ A;  3NWI A;  1WFD A;  4U7Y A;  4QHO A;  5AQU B;  4DR7 T;  2WWU A;  4KI0 F;  2ACZ A;  5CFB A;  4ZXL A;  5LGU B;  4EOZ B;  5LJM A;  5FVL A;  2XPK A;  3QOF A;  3NZQ A;  2CXL A;  3R84 B;  3U78 A;  1WR6 A;  3AEG A;  3OJA A;  3AA1 B;  2JMH A;  4AKI A;  4LFB T;  3PU3 A;  2E9X C;  3RIU A;  2A3D A;  2LRK A;  4ZZC A;  4JLE A;  3N2G E;  3NRY A;  4DV4 T;  3OYX A;  1U4Q A;  3DP7 A;  4I0U A;  5FXV A;  3LG7 A;  2XJ7 A;  2W62 A;  3AE1 A;  4PJN A;  1MIY A;  4AIS A;  5L3F B;  4TWH A;  4M1P A;  2H88 A;  3UTK A;  2LE8 A;  5AQP B;  2EHO B;  4DO0 A;  3VRB A;  4HFE A;  5HEG A;  2WMN A;  3N2O A;  2ZM6 T;  3AVS A;  2LRL A;  3FHN A;  4OYK A;  4QX8 B;  2L8K A;  3LBX A;  4JI5 T;  3FB2 A;  5CB4 E;  4ASK A;  3CVR A;  3AXJ B;  3CX8 B;  2CHN A;  1OXZ A;  4QH4 A;  3NVO A;  2QRX A;  2Q9Q D;  4F8H A;  3VRA A;  2IW5 B;  2V5D A;  4QH1 A;  4DBQ A;  3TLT A;  2KXP B;  4ISS A;  1HF8 A;  4OHF A;  5ABE A;  4CN1 A;  2OLT A;  3M65 A;  3MXZ A;  4Z91 A;  3C50 A;  5HXS A;  5JR9 A;  2XAH B;  4LF7 T;  3J7Y q;  2X0L B;  4EZ4 A;  2XUE A;  4UV8 B;  2X67 A;  3TLW A;  3M3Z B;  4O4J E;  3V5S A;  4YHH T;  2NWB A;  4CZZ B;  5AQF B;  2ES0 A;  2J1D G;  2YOE A;  2M6I A;  2P9B A;  5C8Y E;  4KHP T;  3IHR A;  4IE5 A;  5FY1 A;  3O1H A;  4E7S A;  4DR3 T;  2ACX A;  2W66 A;  4TV8 E;  2QVA A;  2ZM8 A;  5AQN B;  1XMO T;  2Q9Q A;  2AE9 A;  4YTN A;  4L9I A;  4ZOL E;  5LMU T;  3LK4 2;  2D5U A;  5AQI B;  4A98 A;  4HFD A;  5FVK A;  4GIW A;  4QKN A;  2KWI B;  1UUR A;  5A1L A;  4YSZ A;  2XZE A;  4WYV A;  4NUU A;  5LMN T;  4H9O C;  3T8O A;  3T1H T;  3O1I A;  4CI1 B;  4ERR A;  4LML A;  2UXX B;  3HKE E;  1BR2 A;  1HR0 T;  2WP9 A;  4B6X A;  5JTG A;  5HCM A;  2HN1 A;  1IBK T;  4JBW F;  2E5L T;  3ANW A;  2ZMA A;  1O3X A;  3CQX C;  3AXJ A;  1YKH B;  1G73 A;  2HPJ A;  2DLR A;  3HI2 A;  2W2U A;  5FL1 A;  2XQ8 A;  3AEB A;  2Q9Q C;  3HL6 A;  4A97 A;  3UFG A;  3ZN1 B;  3NKZ A;  3C4Z A;  5J0Z A;  3AA0 B;  3MKD A;  3AEA A;  3OBV E;  1ZV4 X;  2WU5 A;  4F6R C;  2KWH A;  4I50 E;  4IE7 A;  2LHN A;  4P09 A;  3KBT A;  3P4P A;  3SRZ A;  5IHY A;  4IGU A;  2V6X A;  2KND A;  3PUR A;  4DMW A;  2V7K A;  1HX8 A;  3F2E A;  3OVU A;  4AQG A;  3Q2M A;  3CML A;  1KFY A;  4GKK T;  3RIA A;  2OA5 A;  5FYM A;  1BR1 A;  3ZN0 B;  3CQC B;  2Y48 B;  2CEA A;  3B57 A;  3OKQ A;  2B1E A;  4YJ2 E;  4PFO A;  2X9Y A;  3UUM A;  2V7J A;  4AQF C;  3UUB A;  3E0Z A;  2QGS A;  2B76 A;  1MND A;  4COF A;  3ZSS A;  4H9P C;  3SWH A;  3AE8 A;  4FI5 A;  3HA4 A;  3ABV A;  5HEJ A;  4EYY R;  2BS3 A;  4DR2 T;  3HKB E;  2HH7 A;  4G63 A;  1Y64 B;  4AKL A;  5DJQ C;  3AB3 B;  3ZLI A;  3IBP A;  5KDM C;  4TWF A;  3GN5 A;  1W9R A;  4ILA A;  4B3M T;  5L3D B;  5J1G A;  2IHR 1;  2UXB T;  1SUM B;  2XQA A;  4X65 T;  3UQ7 A;  2LOP A;  3DTO A;  2W63 A;  1N36 T;  4UVC B;  3ZT5 A;  4PJL A;  4ZS3 A;  1OED B;  3C4W A;  2NOX A;  2XM2 A;  4YSY A;  1D1B A;  4IHJ E;  2XQ5 A;  1HS7 A;  3UU6 A;  4I43 B;  4AKG A;  2LSY A;  3GA8 A;  5LOV E;  4PW8 A;  5IUX A;  3HR0 A;  2D0T A;  3AA7 B;  3GWH A;  2XAF B;  1LKX A;  5H6R B;  1ZOY A;  3F31 A;  4CQI A;  1GQE A;  1UX5 A;  5BR8 T;  5AQM B;  2CLY B;  5IYZ E;  1SA0 E;  5F8P A;  4TZ4 C;  2J62 A;  5AQR B;  5J2U E;  2ODV A;  3AEC A;  3X1D A;  5AQV B;  3I0Q A;  4U72 A;  3KVB A; 
#chains in the Genus database with same CATH homology
 4LFA T;  4DR4 T;  2UU9 T;  4B3S T;  1HR0 T;  5IWA T;  4DR2 T;  1HNZ T;  2UUA T;  4DR1 T;  1IBK T;  4X66 T;  2E5L T;  4LF7 T;  4OX9 T;  4B3M T;  4X62 T;  3OTO T;  4DV5 T;  1XNR T;  4DV6 T;  4LF6 T;  1N33 T;  4LFB T;  2UXB T;  1I94 T;  4X65 T;  4DR6 T;  4YY3 T;  4X64 T;  1N36 T;  2VQF T;  4DV4 T;  1J5E T;  4DV0 T;  4YHH T;  4JYA T;  4DUY T;  4LFC T;  4B3T T;  4LF4 T;  4DV3 T;  4LF9 T;  4NXN T;  4LF8 T;  4K0K T;  4AQY T;  4KHP T;  2UXD T;  2F4V T;  4LF5 T;  4GKJ T;  2HHH T;  1N34 T;  4DV1 T;  1XMQ T;  1HNX T;  1IBL T;  4DR3 T;  3T1Y T;  2ZM6 T;  1XMO T;  4DUZ T;  4JI7 T;  5LMU T;  4GKK T;  1HNW T;  4DV2 T;  4JI0 T;  4DR5 T;  1N32 T;  4JI5 T;  2UUB T;  4NXM T;  2VQE T;  5BR8 T;  4JI6 T;  4JI2 T;  2UUC T;  5LMN T;  1IBM T;  3T1H T;  2UXC T;  4JI8 T;  4JV5 T;  4JI4 T;  4JI1 T;  4DV7 T;  4B3R T;  4JI3 T;  1XNQ T;  1FJG T;  4DR7 T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...