3T1YT

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a human anti-codon stem loop (hasl) of transfer rna lysine 3 (trnalys3) bound to an mrna with an aag-codon in the a-site and paromomycin
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAVQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Human tRNA(Lys3)(UUU) Is Pre-Structured by Natural Modifications for Cognate and Wobble Codon Binding through Keto-Enol Tautomerism.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 34
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2011-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 3t1yT00
2VQET 4JI2T 4JI3T 4AQYT 4JI7T 4JI1T 3OTOT 1HR0T 4B3TT 2UXBT 4JI8T 1XMQT 4GKJT 4DV1T 2ZM6T 4KHPT 1IBKT 2HHHT 4DUZT 4DR1T 1XMOT 1N36T 2UUAT 1XNRT 1I94T 4LFCT 4DV2T 4LF5T 2F4VT 4DR5T 4DV7T 4DV6T 4DR7T 4JI5T 1IBLT 4JI4T 2E5LT 4JI6T 4LF9T 4B3MT 1N32T 1HNWT 4DUYT 3T1YT 4B3RT 4LFBT 4DR3T 4B3ST 4K0KT 4X64T 4X65T 2VQFT 4JV5T 4JYAT 2UUCT 1HNZT 4NXMT 4LF6T 1IBMT 4JI0T 5LMNT 1FJGT 1XNQT 4DV0T 4DR6T 4X62T 4YY3T 4LF8T 4DV3T 2UXDT 4GKKT 4DV5T 4OX9T 3T1HT 1J5ET 4LFAT 1HNXT 5LMUT 4NXNT 4LF4T 4LF7T 4DV4T 2UU9T 4X66T 4YHHT 5IWAT 1N34T 1N33T 4DR4T 4DR2T 2UUBT 5BR8T 2UXCT
chains in the Genus database with same CATH superfamily
3GN5A 1KF6A 3A8YC 3E0ZA 2VASA 5F5WA 2BG9A 3V5UA 2MBGA 3M65A 1HG2A 1XMQT 4ASKA 4IREA 4O4LE 2LM2A 4DUZT 2WMOA 1E7PA 4BAYB 1N36T 3ZCJA 2EHOD 5L3GB 4U2YA 1KK7A 5IYZE 2XPKA 3AECA 3KV5A 4TX5A 4TWDA 5L2LA 1GQEA 2FUPA 4HFCA 4TWFA 4AQFA 5ETWA 2YOEA 5LG3A 4B3MT 1HNWT 2CXFA 3QK6A 3PUGA 3G06A 2BVLA 3BQIA 4IE6A 2VL8A 2XSAA 2LKGA 4PJMA 4DBRA 3VU7H 4H9PC 5L3CB 2D5UA 1T7SA 4NXMT 5HXRA 2LE8A 5KXJA 4HWHA 3ZLIA 2JQQA 4E7SA 3HA4A 2L8KA 1J5ET 2KMFA 2KSRA 4LF4T 5LNKA 1S94A 5EK4A 1ZV4X 5AQTB 5M4YA 3KV6A 3MXZA 4DBQA 3ZCIA 1N34T 4QH5A 3JADA 1Z8UA 4ILUA 4DR4T 4K0KT 4U2ZA 2K5BB 2V26A 3HKDE 3N9QA 2WWUA 4JUYA 3RPUA 2BS2A 3R84B 2WU2A 3I9YA 3ZEFB 1HR0T 3NZQA 4JI8T 1UX4A 2W0GA 5JDLA 3T8OA 3JAFA 3SFEA 5JDFA 2DCFA 4PAGA 1KEYA 1YQ4A 4N78D 4ZOLE 4DV7T 2BS3A 4YTPA 3N5LA 4U74A 4UEMA 2RP4A 3VKHA 4X65T 3FB2A 5AQSB 5LCYA 2BBJA 1ZHCA 4YXDA 3F2EA 5JVDE 4X1IE 2BZBA 2XM2A 1NEKA 5HEJA 5ABFB 4YSXA 4TV9E 3LJCA 2NW8A 4A56A 4ZZCA 4O8SA 2C5IT 3CX7B 5AQPB 5EZYE 2W00A 4ZZBA 3AB3B 2W63A 4U7IA 5AQGB 1X9BA 2WP9A 3AEAA 3JC6C 2YDRA 3RQUA 3HL6A 4I4TE 5IWAT 3UU6A 3ZSSA 4MBQA 2VQET 3ZJ1A 4EZHA 3LDQB 4EIWA 1NWMX 2XQ3A 4I55E 2ES0A 4HFHA 2LEHA 5H6RB 5ABGA 2JQKA 2YK0A 3SWHA 2CBIA 5FKYA 1AJ3A 1BR0A 5HWXA 1XMOT 1OEDC 5JTGA 5IHYA 3UU5A 3UQ4A 3RIUA 4DIDB 4ZHQE 3E08A 4JI6T 5HEHA 4PK6A 4LF9T 3RIFA 3I1AA 3EDUA 2BKPA 2KLQA 4Z91A 4ZEYA 4KHZF 4EB6E 1HF8A 4JBWF 3B57A 4C91A 4L5GA 3P4RA 4U72A 3EI0A 1YXRA 2UXNB 2JQHA 4AISA 2LSKA 2V5CA 3RLFF 2I6HA 2UXDT 2DLRA 5JDQA 2FJBA 2XQ4A 2V6YB 3PUSA 4LFAT 2E9XA 5LHGB 4UF0B 2CLYC 3Q5XA 4FI5A 5EK2A 2IDOB 3OYZA 2UXXB 1I6ZA 4EV6A 3B13A 1ZOYA 2YKSA 2W4XA 3M3ZB 2VKOA 2OA5A 3N2GE 3CVRA 1MIVA 5JDHA 3MZKB 4H9RC 4L9IA 2HHHT 2NW9A 5HEOA 4LMKA 3ANWA 2HPLA 3AVRA 5JR9C 5L3BB 5FL1A 4WZXA 2X9HA 4LF5T 2WSSV 2KINB 4GK5E 3ZSTA 4ADZA 1M62A 3LK3B 3ZYMA 4NIQA 3ZT7A 4HN9A 3K8PC 2J62A 2W67A 3VR8A 1SUMB 2Q9QD 3ZKRA 4CN1A 3H3MA 4P09A 4CN4A 3KINB 2WDVA 5F3JA 4JYAT 1HS7A 4O4JE 1MMNA 1IBMT 4UV9B 3AAAB 4QWNB 2NW7A 4TUYE 1FMWA 2H7OA 2V7MA 2XQ8A 2ACZA 2CCQA 2IC9A 2WDQA 4PK5A 4G63A 2A72A 4UELA 3BQLA 5L3DB 4IDZA 4P0BA 2K3WA 3AE4A 3FHNA 4JI2T 2LM9A 1YQ3A 2D2SA 1IJ6A 1WCRA 3CX8B 3TLVA 5LBQB 2PBIA 4ERRA 4DR1T 2VURA 5ABFA 2FBWA 2XY8B 2F4VT 3S4UA 2E2AA 4A97A 4AIUA 5FXWA 4DR7T 2BS4A 3BQKA 3FBLA 4U3CA 4LFBT 2CLYB 4ILCA 1VCSA 3LFMA 2WZIA 3PU8A 3RIAA 1UUSA 1M7KA 3AAEB 2N9DA 3AXJB 2FJAA 3UFGA 3EHZA 4HTEA 2E9XD 2IC6A 5FVKA 3P50A 4HFBA 3I0OA 2CHNA 2NOXA 3AE9A 5JR9B 3RC8A 3MKDA 1U5PA 3MACA 4TWHA 4XAXB 3O4XE 2IMLA 2M6BA 3E22E 5EK3A 5DQVA 5LHIB 3UU4A 3UUBA 1W9RA 1US7B 3PUZF 1MMDA 2HN2A 4JI3T 3ZYLA 3RRWA 1WR0A 2Y6XA 3H3AA 3OTOT 3SRZA 1UX5A 2IIUA 2G0UA 1MNDA 3CWZB 5HXEA 4H9QC 1NAFA 3AA7B 1HCIA 3ONXA 4AQGA 1HTJF 4YSYA 2NP9A 5HXSA 2V6YA 4UVAB 4ZS2A 2VQFT 2D9DA 4Q25A 4ZS3A 2E5VA 2W61A 4ZI3D 1YW0A 3DTOA 4U31A 1W0BA 2C0SA 2Y8DA 3CK6A 3AE2A 3UUNA 3QC9A 5E0OA 2ZM2A 3RX6A 4F6RC 4LF8T 2DHRA 3AE8A 4WW0A 4TN7B 5LJMA 3RKGA 5CA1E 1OWAA 4OX9T 4WNKA 3P8CD 1EZ3A 2DL1A 3ZN1B 3ZT5A 5HXHA 2LLYA 2D0UA 4BA9A 3AEDA 5AQVB 1HX1B 3LSVA 3MK7C 4PFPA 2LHRA 5BR8T 3FZHB 4WYVA 4IL9A 3PJAA 2MAWA 5FY1A 2J1DG 2XAHB 4F8HA 2CM0A 4B6XA 4ANJA 2GK9A 2K48A 1WYCA 2XAGB 4PK4A 2ACXA 3QUJA 2CBJA 2LSYA 2W66A 4LFCT 4V1Av 2OLTA 3O1IA 4BJMA 3VRBA 3OPCA 4U7YA 4JI5T 2YDSA 2MPKA 5F8PA 1OEDA 1BR1A 2RA1A 3GA8A 3N9LA 4GOUA 2PJQA 1V9DA 2JPFA 2EHOB 1MMAA 1LVKA 3N9MA 3RRCA 1WLXA 5FP3A 2UUCT 3VKGA 4I43B 4XBFB 2WS3A 4DMVA 3ZC0A 1MNEA 2W2UA 2JQ9A 4AKIA 5LB7B 3H37A 2YU2A 4GKKT 4ZI2C 3L09A 4HKAA 3T1HT 5JDGA 2V6XA 1JNZA 3VR9A 2P9BA 3UUXB 1G73A 3UULA 2VK9A 1N33T 2BKOA 5AQKB 1D0ZA 3C4ZA 2UXCT 4MALA 1DU2A 5HCJA 3UFEA 2KZ7B 3L8RA 2IW5B 2QA7A 5J2UE 4GKJT 3N9NA 2K24A 2N1GA 5AFUL 3AA6B 2LSGA 4H63H 1MIWA 3N9OA 2BG9E 3U78A 5AQQB 4QHOA 2WDRA 1XZYA 4LMLA 1D1BA 1J5WA 3CQXC 2HN1A 2X66A 4DV6T 4GIWA 2V7LA 3PUAA 5KMGP 3ONJA 4QKNA 3UU3A 2D0TA 5JR9A 3CMLA 1YKHB 2NR4A 3IBPA 3WAJA 4ZXLA 3J9X1 5FXZA 3ZJ2A 4K0UA 1WYBA 3IEEA 1FJGT 3AEGA 4DR6T 3MA9A 2M6IA 4YY3T 3AE6A 3P4WA 3CX6B 1W0AA 2VWAA 4O2AE 3LK2B 2QGSA 5JRCA 2E8IA 3JC6D 3UU8A 2XASB 1KNPA 3I0QA 3LBXB 3Q2MA 4CXYA 2L3LA 3F31A 3HKCE 1Y01A 5ADXL 4YLHA 2WQYA 3AEFA 4O2BE 3NKZA 5LYJE 2WAUA 1H7CA 4OK0A 2JIWA 5JQGE 3GN5B 2Q9QC 2V5DA 4DV1T 1T72A 2KNDA 5JH7E 4GK0E 2BG9B 3U3IA 2LJLA 1MMGA 3FZFB 2CA5A 4FJOA 4IDNA 3OYXA 4Z90A 4KUMB 4DUYT 4DR3T 5JREA 5J0ZA 1R8IA 2V7IA 3I9WA 4ISTA 3SS1A 4EAHA 3OJAA 2DWKA 3NWIA 4CXXA 3ZMSB 1BR4A 4CN6A 4JI0T 3BK9A 4AI6A 1XNQT 4DV0T 2LRKA 3DJBA 2I59A 3KFWX 1D0XA 3RC3A 4AKLA 3AVSA 4GYSA 4EGWA 4HFVA 3ZN0B 4Z8XA 2X67A 4LF7T 5L4HA 1IZNB 3RIUC 2WZHA 3NVOA 3JCFA 2CWOA 3X1DA 4H9SE 5AQUB 2FJDA 4AQYT 2XQ5A 1VRBA 4JI7T 2XQ9A 5FXXA 3O1JA 3N2OA 2VVNA 5C2TA 3C4WA 3KVAA 5DABA 2ZM6T 4KHPT 4CQIA 2NWBA 3KV9A 2XAQB 4YT0A 5LGUB 4ZI7E 2JRKA 3SFDA 5CGMA 1IBLT 3HKEE 2VVSA 3V5SA 3RYCE 5AQRB 3CPZA 3EDVA 2KWHA 2A2FX 3O1HA 2PG8A 3VRAA 4ILAA 3FXDB 3RQWA 4IE0A 4UVBB 3Q9DA 5GONE 3W15B 3PE0A 4HWCA 3TLSA 2IAKA 4U33A 5LMNT 3CKDA 4X62T 2WMNA 3K3NA 2Q9QB 2BBHA 2FJEA 2WB5A 5IUXA 5CA0E 2XAJB 3ABVA 5FNVE 4AKHA 3PURA 2X0LB 1MIYA 5LXTE 3KBTA 2CXLA 2VB6A 1UCUA 5HAXA 5HYAA 2XTLA 1UK5A 1IAPA 3PTRB 2QRXA 2PFVA 5JDMA 3RH3A 3C4XA 3EABA 3SOLA 5L3FB 4OFZA 4HWIB 2ZM0A 2V1DB 1HFAA 2PTFA 4KI0F 5FY7A 2YINA 1E2AA 5LHHB 4JEUB 2EHOC 3UQ7A 4IDQA 2DI4A 3CIRA 2LHNA 1SE7A 4DR5T 4TNVA 2H88A 1D1CA 1QUUA 3AEEA 3PV0F 4HWDA 1OXZA 4HFEA 4EEDA 1WRDA 3CQCB 4AXPA 4CI3B 1N32T 2XQ6A 5AQIB 4YJ3E 4O4IE 3TLWA 1ZKEA 4HE8A 3PDYA 5AQOB 2A9UA 5FYMA 3RYFE 1HNZT 2J4GA 1CUNA 1YKEB 2XQ7A 3ESLA 1QLBA 4M1PA 1Z0PA 3KBUA 4DV3T 4UF0A 5CJ5A 4I0UA 5LBMA 1S35A 4BJNA 2IUBA 4X1KE 5LP6E 4HGAA 2XM1A 2MTQA 2B1EA 5JDNA 5C8YE 4H9OC 4QH4A 4E7ZA 2UUBT 2E9XB 3LK42 1W09A 1ZP0A 3PUWF 1U4QA 2VKDA 2LT3A 5AQNB 3UT5E 5ABEA 3A7MA 2N2NA 2VL0A 4GYRA 4WBNE 3AE5A 3C64A 4IL4A 2CPTA 1QSDA 3HI2A 1VCTA 3FXEB 4IT4A 2Z6EA 3A5XA 3NBXX 3ANWB 3FZKB 3P7IA 4HWFA 2YU1A 3ZMUB 3Q5EA 3AAIA 4JEHB 1BR2A 2QYWA 5FXVA 5HEUA 5KX5E 1D0YA 3TLTA 2BKNA 3PUVF 4NUUA 4EYYR 2C5KT 4YJ2E 4OHFA 5AQHB 5L47A 2LOSA 3AA1B 3IHRA 3TKLB 3RHWA 1FMVA 3AE3A 4H63V 4X5TA 4P0AA 2M67A 4DNDA 3N2KE 4KX6A 3KDSE 4DO0A 3UUMA 4L0RA 1KNZA 5ABHA 3QB5K 1CHUA 3OVUA 2UU9T 3DP7A 1KNRA 4EYUA 2H7VC 2ODVA 3FZLB 2BG9C 4QXCB 5L3EB 2SPCA 2H3RA 5LG4A 4CZZB 4DR2T 4YSZA 3NZPA 2XZEA 3QOFA 2YEVC 1X79A 2CWYA 5FMNA 2JJ9A 3RF1A 2XHEB 4H9NC 3PU3A 4JLEA 3KVBA 4AQFC 3ZT6A 2WU5A 3RGLA 4IGUA 1I94T 2LSJA 2CE7A 2BVMA 2Q9QA 2VKJA 2C5JA 5AQLB 1Y64B 2YDQA 2CHOA 3OBVE 4B3RT 5BMVE 3RYIE 4X64T 2ODUA 2YN6A 4ILBA 3NRYA 3ZMTB 4COFA 1E1HB 3AXJA 4IE5A 3N9PA 4YFSA 2I0MA 4AKRB 2CXDA 2AXDS 3L39A 1WR6A 5FY0A 4YTMA 2LRLA 2HH7A 2AE9A 4ZI2D 3ZMZB 4NXNT 2IHR1 5TAOA 4TZ4C 1UURA 3ZYKA 5LOVE 5DJQC 4YTNA 4UIGA 2B76A 2HPJA 2XAFB 3VHLA 4MHCA 2X9WA 3Q5DA 3PUXF 2XQAA 2Y48B 4IDPA 4PNIA 5AQJB 2WCAA 1LRZA 5HEGA 3F57A 2UXBT 1WFDA 1T98A 3JAEA 1IBKT 4EXTA 4IDOA 1IJ5A 5LJNA 2UUAT 3EAMA 1SHZC 3O9XA 5LA6E 3EUHA 2X51A 2X9YA 4CI1B 4TNWA 1FEWA 4HFIA 2X9XA 4IE4A 4B3ST 1YD8G 5A1LA 3PUQA 1OEDE 3PJAJ 1ZEEA 3R6NA 3C51A 2X68A 2QVAA 2J47A 3NRXA 4ISSA 1O3XA 2WBLA 4I50E 3OKQA 3L3PA 4PJLA 3K3OA 3UTKA 3FBZA 4HEAA 3GWHA 2R6GF 3IA3A 1LVFA 4LMJA 2WWVA 1HNXT 5AQFB 4OYJA 2OV9A 3ETUA 4YHHT 1HG5A 2LSIA 3QB5A 4IIJE 2JMHA 3B5MA 2WM9A 4KMCA 3ZC1A 4NUVA 2LOPA 4PJNA 3K3QC 4A98A 2KT9A 4HFDA 5HWYA 2ZLYA 2K9AA 1D1AA 3QNUA 4MLKA 5AQMB 1VOMA 1XDOA 4AKGA 1XDPA 2LKHA 4QX7B 3WI3A 3D0TA 2XJ7A 2VKHA 3C98B 4EOZB 3ZMVB 2XQYA 1XWMA 4QX8B 4C90A 2EHOA 4OYKA 2RPAA 4JI4T 4X20E 2E5LT 3IF8B 1HX8A 5H6QB 3AA0B 3ZPOA 1SA0E 4G2AA 4JV5T 4UXNB 5LGTB 1OEDB 4QXBB 3MJXA 2DNXA 3P4PA 3HKBE 1UGOA 1JNRA 2E9XC 3HR0A 3K1SA 5HXCA 4DV5T 4DVDA 3GMIA 3RYHE 3CQGB 4X66T 2KWIB 5CB4E 2CMRA 4EZ4A 2JMKA 2V8SV 3AE7A 1L0VA 3ETVA 1J1JA 5L4EA 2X0HA 1NENA 3J7Yq 5C3JA 2MOZA 4NPPA 4IHJE 2W62A 4O4HE 1G8XA 3WAKA 4JI1T 4B3TT 3P4SA 2WY2A 4CXWA 2BDEA 5HCMA 5KDMC 4UR9A 2DWGA 2A3DA 2NTXA 3TLUA 2V7KA 3PUYF 4DMWA 1XNRT 5J2TE 5CFBA 4DV2T 3LG7A 4QH1A 4X1YE 3KV4A 2CRBA 5LGNB 2V7JA 4QXHB 4A5XA 4PJJA 5FVLA 4PFOA 2KXPB 2L9QA 4KP3C 3T1YT 3RI5A 4IE7A 4YHJA 2XUEA 4UV8B 4ZI3C 4J2CA 2MYSA 3P4QA 4WBOA 5DQWA 4EEBA 5FL0A 3Q5WA 2X0YA 1KFYA 4LF6T 3ONLC 2ZMAA 4UVCB 3RKOA 4TV8E 5J1GA 3EVYA 1B7TA 3C50A 4KBMB 4CI2B 1T8BA 3LBXA 5LMUT 1FIOA 4XZCA 2H89A 2XSBA 2CEAA 4DV4T 4P1NA 3AE1A 4PW8A 2NTYA 3AEBA 3FZMB 1LKXA 2ZM8A 4MFRA 5JRCB
chains in the Genus database with same CATH topology
2VQET 4JI2T 4JI3T 4AQYT 4JI7T 4JI1T 3OTOT 1HR0T 4B3TT 2UXBT 4JI8T 1XMQT 4GKJT 4DV1T 2ZM6T 4KHPT 1IBKT 2HHHT 4DUZT 4DR1T 1XMOT 1N36T 2UUAT 1XNRT 1I94T 4LFCT 4DV2T 4LF5T 2F4VT 4DR5T 4DV7T 4DV6T 4DR7T 4JI5T 1IBLT 4JI4T 2E5LT 4JI6T 4LF9T 4B3MT 1N32T 1HNWT 4DUYT 3T1YT 4B3RT 4LFBT 4DR3T 4B3ST 4K0KT 4X64T 4X65T 2VQFT 4JV5T 4JYAT 2UUCT 1HNZT 4NXMT 4LF6T 1IBMT 4JI0T 5LMNT 1FJGT 1XNQT 4DV0T 4DR6T 4X62T 4YY3T 4LF8T 4DV3T 2UXDT 4GKKT 4DV5T 4OX9T 3T1HT 1J5ET 4LFAT 1HNXT 5LMUT 4NXNT 4LF4T 4LF7T 4DV4T 2UU9T 4X66T 4YHHT 5IWAT 1N34T 1N33T 4DR4T 4DR2T 2UUBT 5BR8T 2UXCT
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VQE T;  4JI2 T;  4JI3 T;  4AQY T;  4JI7 T;  4JI1 T;  3OTO T;  1HR0 T;  4B3T T;  2UXB T;  4JI8 T;  1XMQ T;  4GKJ T;  4DV1 T;  2ZM6 T;  4KHP T;  1IBK T;  2HHH T;  4DUZ T;  4DR1 T;  1XMO T;  1N36 T;  2UUA T;  1XNR T;  1I94 T;  4LFC T;  4DV2 T;  4LF5 T;  2F4V T;  4DR5 T;  4DV7 T;  4DV6 T;  4DR7 T;  4JI5 T;  1IBL T;  4JI4 T;  2E5L T;  4JI6 T;  4LF9 T;  4B3M T;  1N32 T;  1HNW T;  4DUY T;  3T1Y T;  4B3R T;  4LFB T;  4DR3 T;  4B3S T;  4K0K T;  4X64 T;  4X65 T;  2VQF T;  4JV5 T;  4JYA T;  2UUC T;  1HNZ T;  4NXM T;  4LF6 T;  1IBM T;  4JI0 T;  5LMN T;  1FJG T;  1XNQ T;  4DV0 T;  4DR6 T;  4X62 T;  4YY3 T;  4LF8 T;  4DV3 T;  2UXD T;  4GKK T;  4DV5 T;  4OX9 T;  3T1H T;  1J5E T;  4LFA T;  1HNX T;  5LMU T;  4NXN T;  4LF4 T;  4LF7 T;  4DV4 T;  2UU9 T;  4X66 T;  4YHH T;  5IWA T;  1N34 T;  1N33 T;  4DR4 T;  4DR2 T;  2UUB T;  5BR8 T;  2UXC T; 
#chains in the Genus database with same CATH topology
 3GN5 A;  1KF6 A;  3A8Y C;  3E0Z A;  2VAS A;  5F5W A;  2BG9 A;  3V5U A;  2MBG A;  3M65 A;  1HG2 A;  1XMQ T;  4ASK A;  4IRE A;  4O4L E;  2LM2 A;  4DUZ T;  2WMO A;  1E7P A;  4BAY B;  1N36 T;  3ZCJ A;  2EHO D;  5L3G B;  4U2Y A;  1KK7 A;  5IYZ E;  2XPK A;  3AEC A;  3KV5 A;  4TX5 A;  4TWD A;  5L2L A;  1GQE A;  2FUP A;  4HFC A;  4TWF A;  4AQF A;  5ETW A;  2YOE A;  5LG3 A;  4B3M T;  1HNW T;  2CXF A;  3QK6 A;  3PUG A;  3G06 A;  2BVL A;  3BQI A;  4IE6 A;  2VL8 A;  2XSA A;  2LKG A;  4PJM A;  4DBR A;  3VU7 H;  4H9P C;  5L3C B;  2D5U A;  1T7S A;  4NXM T;  5HXR A;  2LE8 A;  5KXJ A;  4HWH A;  3ZLI A;  2JQQ A;  4E7S A;  3HA4 A;  2L8K A;  1J5E T;  2KMF A;  2KSR A;  4LF4 T;  5LNK A;  1S94 A;  5EK4 A;  1ZV4 X;  5AQT B;  5M4Y A;  3KV6 A;  3MXZ A;  4DBQ A;  3ZCI A;  1N34 T;  4QH5 A;  3JAD A;  1Z8U A;  4ILU A;  4DR4 T;  4K0K T;  4U2Z A;  2K5B B;  2V26 A;  3HKD E;  3N9Q A;  2WWU A;  4JUY A;  3RPU A;  2BS2 A;  3R84 B;  2WU2 A;  3I9Y A;  3ZEF B;  1HR0 T;  3NZQ A;  4JI8 T;  1UX4 A;  2W0G A;  5JDL A;  3T8O A;  3JAF A;  3SFE A;  5JDF A;  2DCF A;  4PAG A;  1KEY A;  1YQ4 A;  4N78 D;  4ZOL E;  4DV7 T;  2BS3 A;  4YTP A;  3N5L A;  4U74 A;  4UEM A;  2RP4 A;  3VKH A;  4X65 T;  3FB2 A;  5AQS B;  5LCY A;  2BBJ A;  1ZHC A;  4YXD A;  3F2E A;  5JVD E;  4X1I E;  2BZB A;  2XM2 A;  1NEK A;  5HEJ A;  5ABF B;  4YSX A;  4TV9 E;  3LJC A;  2NW8 A;  4A56 A;  4ZZC A;  4O8S A;  2C5I T;  3CX7 B;  5AQP B;  5EZY E;  2W00 A;  4ZZB A;  3AB3 B;  2W63 A;  4U7I A;  5AQG B;  1X9B A;  2WP9 A;  3AEA A;  3JC6 C;  2YDR A;  3RQU A;  3HL6 A;  4I4T E;  5IWA T;  3UU6 A;  3ZSS A;  4MBQ A;  2VQE T;  3ZJ1 A;  4EZH A;  3LDQ B;  4EIW A;  1NWM X;  2XQ3 A;  4I55 E;  2ES0 A;  4HFH A;  2LEH A;  5H6R B;  5ABG A;  2JQK A;  2YK0 A;  3SWH A;  2CBI A;  5FKY A;  1AJ3 A;  1BR0 A;  5HWX A;  1XMO T;  1OED C;  5JTG A;  5IHY A;  3UU5 A;  3UQ4 A;  3RIU A;  4DID B;  4ZHQ E;  3E08 A;  4JI6 T;  5HEH A;  4PK6 A;  4LF9 T;  3RIF A;  3I1A A;  3EDU A;  2BKP A;  2KLQ A;  4Z91 A;  4ZEY A;  4KHZ F;  4EB6 E;  1HF8 A;  4JBW F;  3B57 A;  4C91 A;  4L5G A;  3P4R A;  4U72 A;  3EI0 A;  1YXR A;  2UXN B;  2JQH A;  4AIS A;  2LSK A;  2V5C A;  3RLF F;  2I6H A;  2UXD T;  2DLR A;  5JDQ A;  2FJB A;  2XQ4 A;  2V6Y B;  3PUS A;  4LFA T;  2E9X A;  5LHG B;  4UF0 B;  2CLY C;  3Q5X A;  4FI5 A;  5EK2 A;  2IDO B;  3OYZ A;  2UXX B;  1I6Z A;  4EV6 A;  3B13 A;  1ZOY A;  2YKS A;  2W4X A;  3M3Z B;  2VKO A;  2OA5 A;  3N2G E;  3CVR A;  1MIV A;  5JDH A;  3MZK B;  4H9R C;  4L9I A;  2HHH T;  2NW9 A;  5HEO A;  4LMK A;  3ANW A;  2HPL A;  3AVR A;  5JR9 C;  5L3B B;  5FL1 A;  4WZX A;  2X9H A;  4LF5 T;  2WSS V;  2KIN B;  4GK5 E;  3ZST A;  4ADZ A;  1M62 A;  3LK3 B;  3ZYM A;  4NIQ A;  3ZT7 A;  4HN9 A;  3K8P C;  2J62 A;  2W67 A;  3VR8 A;  1SUM B;  2Q9Q D;  3ZKR A;  4CN1 A;  3H3M A;  4P09 A;  4CN4 A;  3KIN B;  2WDV A;  5F3J A;  4JYA T;  1HS7 A;  4O4J E;  1MMN A;  1IBM T;  4UV9 B;  3AAA B;  4QWN B;  2NW7 A;  4TUY E;  1FMW A;  2H7O A;  2V7M A;  2XQ8 A;  2ACZ A;  2CCQ A;  2IC9 A;  2WDQ A;  4PK5 A;  4G63 A;  2A72 A;  4UEL A;  3BQL A;  5L3D B;  4IDZ A;  4P0B A;  2K3W A;  3AE4 A;  3FHN A;  4JI2 T;  2LM9 A;  1YQ3 A;  2D2S A;  1IJ6 A;  1WCR A;  3CX8 B;  3TLV A;  5LBQ B;  2PBI A;  4ERR A;  4DR1 T;  2VUR A;  5ABF A;  2FBW A;  2XY8 B;  2F4V T;  3S4U A;  2E2A A;  4A97 A;  4AIU A;  5FXW A;  4DR7 T;  2BS4 A;  3BQK A;  3FBL A;  4U3C A;  4LFB T;  2CLY B;  4ILC A;  1VCS A;  3LFM A;  2WZI A;  3PU8 A;  3RIA A;  1UUS A;  1M7K A;  3AAE B;  2N9D A;  3AXJ B;  2FJA A;  3UFG A;  3EHZ A;  4HTE A;  2E9X D;  2IC6 A;  5FVK A;  3P50 A;  4HFB A;  3I0O A;  2CHN A;  2NOX A;  3AE9 A;  5JR9 B;  3RC8 A;  3MKD A;  1U5P A;  3MAC A;  4TWH A;  4XAX B;  3O4X E;  2IML A;  2M6B A;  3E22 E;  5EK3 A;  5DQV A;  5LHI B;  3UU4 A;  3UUB A;  1W9R A;  1US7 B;  3PUZ F;  1MMD A;  2HN2 A;  4JI3 T;  3ZYL A;  3RRW A;  1WR0 A;  2Y6X A;  3H3A A;  3OTO T;  3SRZ A;  1UX5 A;  2IIU A;  2G0U A;  1MND A;  3CWZ B;  5HXE A;  4H9Q C;  1NAF A;  3AA7 B;  1HCI A;  3ONX A;  4AQG A;  1HTJ F;  4YSY A;  2NP9 A;  5HXS A;  2V6Y A;  4UVA B;  4ZS2 A;  2VQF T;  2D9D A;  4Q25 A;  4ZS3 A;  2E5V A;  2W61 A;  4ZI3 D;  1YW0 A;  3DTO A;  4U31 A;  1W0B A;  2C0S A;  2Y8D A;  3CK6 A;  3AE2 A;  3UUN A;  3QC9 A;  5E0O A;  2ZM2 A;  3RX6 A;  4F6R C;  4LF8 T;  2DHR A;  3AE8 A;  4WW0 A;  4TN7 B;  5LJM A;  3RKG A;  5CA1 E;  1OWA A;  4OX9 T;  4WNK A;  3P8C D;  1EZ3 A;  2DL1 A;  3ZN1 B;  3ZT5 A;  5HXH A;  2LLY A;  2D0U A;  4BA9 A;  3AED A;  5AQV B;  1HX1 B;  3LSV A;  3MK7 C;  4PFP A;  2LHR A;  5BR8 T;  3FZH B;  4WYV A;  4IL9 A;  3PJA A;  2MAW A;  5FY1 A;  2J1D G;  2XAH B;  4F8H A;  2CM0 A;  4B6X A;  4ANJ A;  2GK9 A;  2K48 A;  1WYC A;  2XAG B;  4PK4 A;  2ACX A;  3QUJ A;  2CBJ A;  2LSY A;  2W66 A;  4LFC T;  4V1A v;  2OLT A;  3O1I A;  4BJM A;  3VRB A;  3OPC A;  4U7Y A;  4JI5 T;  2YDS A;  2MPK A;  5F8P A;  1OED A;  1BR1 A;  2RA1 A;  3GA8 A;  3N9L A;  4GOU A;  2PJQ A;  1V9D A;  2JPF A;  2EHO B;  1MMA A;  1LVK A;  3N9M A;  3RRC A;  1WLX A;  5FP3 A;  2UUC T;  3VKG A;  4I43 B;  4XBF B;  2WS3 A;  4DMV A;  3ZC0 A;  1MNE A;  2W2U A;  2JQ9 A;  4AKI A;  5LB7 B;  3H37 A;  2YU2 A;  4GKK T;  4ZI2 C;  3L09 A;  4HKA A;  3T1H T;  5JDG A;  2V6X A;  1JNZ A;  3VR9 A;  2P9B A;  3UUX B;  1G73 A;  3UUL A;  2VK9 A;  1N33 T;  2BKO A;  5AQK B;  1D0Z A;  3C4Z A;  2UXC T;  4MAL A;  1DU2 A;  5HCJ A;  3UFE A;  2KZ7 B;  3L8R A;  2IW5 B;  2QA7 A;  5J2U E;  4GKJ T;  3N9N A;  2K24 A;  2N1G A;  5AFU L;  3AA6 B;  2LSG A;  4H63 H;  1MIW A;  3N9O A;  2BG9 E;  3U78 A;  5AQQ B;  4QHO A;  2WDR A;  1XZY A;  4LML A;  1D1B A;  1J5W A;  3CQX C;  2HN1 A;  2X66 A;  4DV6 T;  4GIW A;  2V7L A;  3PUA A;  5KMG P;  3ONJ A;  4QKN A;  3UU3 A;  2D0T A;  5JR9 A;  3CML A;  1YKH B;  2NR4 A;  3IBP A;  3WAJ A;  4ZXL A;  3J9X 1;  5FXZ A;  3ZJ2 A;  4K0U A;  1WYB A;  3IEE A;  1FJG T;  3AEG A;  4DR6 T;  3MA9 A;  2M6I A;  4YY3 T;  3AE6 A;  3P4W A;  3CX6 B;  1W0A A;  2VWA A;  4O2A E;  3LK2 B;  2QGS A;  5JRC A;  2E8I A;  3JC6 D;  3UU8 A;  2XAS B;  1KNP A;  3I0Q A;  3LBX B;  3Q2M A;  4CXY A;  2L3L A;  3F31 A;  3HKC E;  1Y01 A;  5ADX L;  4YLH A;  2WQY A;  3AEF A;  4O2B E;  3NKZ A;  5LYJ E;  2WAU A;  1H7C A;  4OK0 A;  2JIW A;  5JQG E;  3GN5 B;  2Q9Q C;  2V5D A;  4DV1 T;  1T72 A;  2KND A;  5JH7 E;  4GK0 E;  2BG9 B;  3U3I A;  2LJL A;  1MMG A;  3FZF B;  2CA5 A;  4FJO A;  4IDN A;  3OYX A;  4Z90 A;  4KUM B;  4DUY T;  4DR3 T;  5JRE A;  5J0Z A;  1R8I A;  2V7I A;  3I9W A;  4IST A;  3SS1 A;  4EAH A;  3OJA A;  2DWK A;  3NWI A;  4CXX A;  3ZMS B;  1BR4 A;  4CN6 A;  4JI0 T;  3BK9 A;  4AI6 A;  1XNQ T;  4DV0 T;  2LRK A;  3DJB A;  2I59 A;  3KFW X;  1D0X A;  3RC3 A;  4AKL A;  3AVS A;  4GYS A;  4EGW A;  4HFV A;  3ZN0 B;  4Z8X A;  2X67 A;  4LF7 T;  5L4H A;  1IZN B;  3RIU C;  2WZH A;  3NVO A;  3JCF A;  2CWO A;  3X1D A;  4H9S E;  5AQU B;  2FJD A;  4AQY T;  2XQ5 A;  1VRB A;  4JI7 T;  2XQ9 A;  5FXX A;  3O1J A;  3N2O A;  2VVN A;  5C2T A;  3C4W A;  3KVA A;  5DAB A;  2ZM6 T;  4KHP T;  4CQI A;  2NWB A;  3KV9 A;  2XAQ B;  4YT0 A;  5LGU B;  4ZI7 E;  2JRK A;  3SFD A;  5CGM A;  1IBL T;  3HKE E;  2VVS A;  3V5S A;  3RYC E;  5AQR B;  3CPZ A;  3EDV A;  2KWH A;  2A2F X;  3O1H A;  2PG8 A;  3VRA A;  4ILA A;  3FXD B;  3RQW A;  4IE0 A;  4UVB B;  3Q9D A;  5GON E;  3W15 B;  3PE0 A;  4HWC A;  3TLS A;  2IAK A;  4U33 A;  5LMN T;  3CKD A;  4X62 T;  2WMN A;  3K3N A;  2Q9Q B;  2BBH A;  2FJE A;  2WB5 A;  5IUX A;  5CA0 E;  2XAJ B;  3ABV A;  5FNV E;  4AKH A;  3PUR A;  2X0L B;  1MIY A;  5LXT E;  3KBT A;  2CXL A;  2VB6 A;  1UCU A;  5HAX A;  5HYA A;  2XTL A;  1UK5 A;  1IAP A;  3PTR B;  2QRX A;  2PFV A;  5JDM A;  3RH3 A;  3C4X A;  3EAB A;  3SOL A;  5L3F B;  4OFZ A;  4HWI B;  2ZM0 A;  2V1D B;  1HFA A;  2PTF A;  4KI0 F;  5FY7 A;  2YIN A;  1E2A A;  5LHH B;  4JEU B;  2EHO C;  3UQ7 A;  4IDQ A;  2DI4 A;  3CIR A;  2LHN A;  1SE7 A;  4DR5 T;  4TNV A;  2H88 A;  1D1C A;  1QUU A;  3AEE A;  3PV0 F;  4HWD A;  1OXZ A;  4HFE A;  4EED A;  1WRD A;  3CQC B;  4AXP A;  4CI3 B;  1N32 T;  2XQ6 A;  5AQI B;  4YJ3 E;  4O4I E;  3TLW A;  1ZKE A;  4HE8 A;  3PDY A;  5AQO B;  2A9U A;  5FYM A;  3RYF E;  1HNZ T;  2J4G A;  1CUN A;  1YKE B;  2XQ7 A;  3ESL A;  1QLB A;  4M1P A;  1Z0P A;  3KBU A;  4DV3 T;  4UF0 A;  5CJ5 A;  4I0U A;  5LBM A;  1S35 A;  4BJN A;  2IUB A;  4X1K E;  5LP6 E;  4HGA A;  2XM1 A;  2MTQ A;  2B1E A;  5JDN A;  5C8Y E;  4H9O C;  4QH4 A;  4E7Z A;  2UUB T;  2E9X B;  3LK4 2;  1W09 A;  1ZP0 A;  3PUW F;  1U4Q A;  2VKD A;  2LT3 A;  5AQN B;  3UT5 E;  5ABE A;  3A7M A;  2N2N A;  2VL0 A;  4GYR A;  4WBN E;  3AE5 A;  3C64 A;  4IL4 A;  2CPT A;  1QSD A;  3HI2 A;  1VCT A;  3FXE B;  4IT4 A;  2Z6E A;  3A5X A;  3NBX X;  3ANW B;  3FZK B;  3P7I A;  4HWF A;  2YU1 A;  3ZMU B;  3Q5E A;  3AAI A;  4JEH B;  1BR2 A;  2QYW A;  5FXV A;  5HEU A;  5KX5 E;  1D0Y A;  3TLT A;  2BKN A;  3PUV F;  4NUU A;  4EYY R;  2C5K T;  4YJ2 E;  4OHF A;  5AQH B;  5L47 A;  2LOS A;  3AA1 B;  3IHR A;  3TKL B;  3RHW A;  1FMV A;  3AE3 A;  4H63 V;  4X5T A;  4P0A A;  2M67 A;  4DND A;  3N2K E;  4KX6 A;  3KDS E;  4DO0 A;  3UUM A;  4L0R A;  1KNZ A;  5ABH A;  3QB5 K;  1CHU A;  3OVU A;  2UU9 T;  3DP7 A;  1KNR A;  4EYU A;  2H7V C;  2ODV A;  3FZL B;  2BG9 C;  4QXC B;  5L3E B;  2SPC A;  2H3R A;  5LG4 A;  4CZZ B;  4DR2 T;  4YSZ A;  3NZP A;  2XZE A;  3QOF A;  2YEV C;  1X79 A;  2CWY A;  5FMN A;  2JJ9 A;  3RF1 A;  2XHE B;  4H9N C;  3PU3 A;  4JLE A;  3KVB A;  4AQF C;  3ZT6 A;  2WU5 A;  3RGL A;  4IGU A;  1I94 T;  2LSJ A;  2CE7 A;  2BVM A;  2Q9Q A;  2VKJ A;  2C5J A;  5AQL B;  1Y64 B;  2YDQ A;  2CHO A;  3OBV E;  4B3R T;  5BMV E;  3RYI E;  4X64 T;  2ODU A;  2YN6 A;  4ILB A;  3NRY A;  3ZMT B;  4COF A;  1E1H B;  3AXJ A;  4IE5 A;  3N9P A;  4YFS A;  2I0M A;  4AKR B;  2CXD A;  2AXD S;  3L39 A;  1WR6 A;  5FY0 A;  4YTM A;  2LRL A;  2HH7 A;  2AE9 A;  4ZI2 D;  3ZMZ B;  4NXN T;  2IHR 1;  5TAO A;  4TZ4 C;  1UUR A;  3ZYK A;  5LOV E;  5DJQ C;  4YTN A;  4UIG A;  2B76 A;  2HPJ A;  2XAF B;  3VHL A;  4MHC A;  2X9W A;  3Q5D A;  3PUX F;  2XQA A;  2Y48 B;  4IDP A;  4PNI A;  5AQJ B;  2WCA A;  1LRZ A;  5HEG A;  3F57 A;  2UXB T;  1WFD A;  1T98 A;  3JAE A;  1IBK T;  4EXT A;  4IDO A;  1IJ5 A;  5LJN A;  2UUA T;  3EAM A;  1SHZ C;  3O9X A;  5LA6 E;  3EUH A;  2X51 A;  2X9Y A;  4CI1 B;  4TNW A;  1FEW A;  4HFI A;  2X9X A;  4IE4 A;  4B3S T;  1YD8 G;  5A1L A;  3PUQ A;  1OED E;  3PJA J;  1ZEE A;  3R6N A;  3C51 A;  2X68 A;  2QVA A;  2J47 A;  3NRX A;  4ISS A;  1O3X A;  2WBL A;  4I50 E;  3OKQ A;  3L3P A;  4PJL A;  3K3O A;  3UTK A;  3FBZ A;  4HEA A;  3GWH A;  2R6G F;  3IA3 A;  1LVF A;  4LMJ A;  2WWV A;  1HNX T;  5AQF B;  4OYJ A;  2OV9 A;  3ETU A;  4YHH T;  1HG5 A;  2LSI A;  3QB5 A;  4IIJ E;  2JMH A;  3B5M A;  2WM9 A;  4KMC A;  3ZC1 A;  4NUV A;  2LOP A;  4PJN A;  3K3Q C;  4A98 A;  2KT9 A;  4HFD A;  5HWY A;  2ZLY A;  2K9A A;  1D1A A;  3QNU A;  4MLK A;  5AQM B;  1VOM A;  1XDO A;  4AKG A;  1XDP A;  2LKH A;  4QX7 B;  3WI3 A;  3D0T A;  2XJ7 A;  2VKH A;  3C98 B;  4EOZ B;  3ZMV B;  2XQY A;  1XWM A;  4QX8 B;  4C90 A;  2EHO A;  4OYK A;  2RPA A;  4JI4 T;  4X20 E;  2E5L T;  3IF8 B;  1HX8 A;  5H6Q B;  3AA0 B;  3ZPO A;  1SA0 E;  4G2A A;  4JV5 T;  4UXN B;  5LGT B;  1OED B;  4QXB B;  3MJX A;  2DNX A;  3P4P A;  3HKB E;  1UGO A;  1JNR A;  2E9X C;  3HR0 A;  3K1S A;  5HXC A;  4DV5 T;  4DVD A;  3GMI A;  3RYH E;  3CQG B;  4X66 T;  2KWI B;  5CB4 E;  2CMR A;  4EZ4 A;  2JMK A;  2V8S V;  3AE7 A;  1L0V A;  3ETV A;  1J1J A;  5L4E A;  2X0H A;  1NEN A;  3J7Y q;  5C3J A;  2MOZ A;  4NPP A;  4IHJ E;  2W62 A;  4O4H E;  1G8X A;  3WAK A;  4JI1 T;  4B3T T;  3P4S A;  2WY2 A;  4CXW A;  2BDE A;  5HCM A;  5KDM C;  4UR9 A;  2DWG A;  2A3D A;  2NTX A;  3TLU A;  2V7K A;  3PUY F;  4DMW A;  1XNR T;  5J2T E;  5CFB A;  4DV2 T;  3LG7 A;  4QH1 A;  4X1Y E;  3KV4 A;  2CRB A;  5LGN B;  2V7J A;  4QXH B;  4A5X A;  4PJJ A;  5FVL A;  4PFO A;  2KXP B;  2L9Q A;  4KP3 C;  3T1Y T;  3RI5 A;  4IE7 A;  4YHJ A;  2XUE A;  4UV8 B;  4ZI3 C;  4J2C A;  2MYS A;  3P4Q A;  4WBO A;  5DQW A;  4EEB A;  5FL0 A;  3Q5W A;  2X0Y A;  1KFY A;  4LF6 T;  3ONL C;  2ZMA A;  4UVC B;  3RKO A;  4TV8 E;  5J1G A;  3EVY A;  1B7T A;  3C50 A;  4KBM B;  4CI2 B;  1T8B A;  3LBX A;  5LMU T;  1FIO A;  4XZC A;  2H89 A;  2XSB A;  2CEA A;  4DV4 T;  4P1N A;  3AE1 A;  4PW8 A;  2NTY A;  3AEB A;  3FZM B;  1LKX A;  2ZM8 A;  4MFR A;  5JRC B; 
#chains in the Genus database with same CATH homology
 2VQE T;  4JI2 T;  4JI3 T;  4AQY T;  4JI7 T;  4JI1 T;  3OTO T;  1HR0 T;  4B3T T;  2UXB T;  4JI8 T;  1XMQ T;  4GKJ T;  4DV1 T;  2ZM6 T;  4KHP T;  1IBK T;  2HHH T;  4DUZ T;  4DR1 T;  1XMO T;  1N36 T;  2UUA T;  1XNR T;  1I94 T;  4LFC T;  4DV2 T;  4LF5 T;  2F4V T;  4DR5 T;  4DV7 T;  4DV6 T;  4DR7 T;  4JI5 T;  1IBL T;  4JI4 T;  2E5L T;  4JI6 T;  4LF9 T;  4B3M T;  1N32 T;  1HNW T;  4DUY T;  3T1Y T;  4B3R T;  4LFB T;  4DR3 T;  4B3S T;  4K0K T;  4X64 T;  4X65 T;  2VQF T;  4JV5 T;  4JYA T;  2UUC T;  1HNZ T;  4NXM T;  4LF6 T;  1IBM T;  4JI0 T;  5LMN T;  1FJG T;  1XNQ T;  4DV0 T;  4DR6 T;  4X62 T;  4YY3 T;  4LF8 T;  4DV3 T;  2UXD T;  4GKK T;  4DV5 T;  4OX9 T;  3T1H T;  1J5E T;  4LFA T;  1HNX T;  5LMU T;  4NXN T;  4LF4 T;  4LF7 T;  4DV4 T;  2UU9 T;  4X66 T;  4YHH T;  5IWA T;  1N34 T;  1N33 T;  4DR4 T;  4DR2 T;  2UUB T;  5BR8 T;  2UXC T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...