2L8KA

Nmr structure of the arterivirus nonstructural protein 7 alpha (nsp7 alpha)
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
123
structure length
123
Chain Sequence
GLTATLAALTDDDFQFLSDVLDCRAVRSAMNLRAALTSFQVAQYRNILNASLQVDRDAARSRRLMAKLADFAVEQEVTAGDRVVVIDGLDRMAHFKDDLVLVPLTTKVVGGSRCTICDVVKEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords Non-structural protein 7
publication title Structure and Genetic Analysis of the Arterivirus Nonstructural Protein 7{alpha}.
pubmed doi rcsb
source organism Equine arteritis virus
total genus 28
structure length 123
sequence length 123
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2011-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16749 Arteri_nsp7a Arterivirus nonstructural protein 7 alpha
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.950 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2l8kA00
2L8KA
chains in the Genus database with same CATH superfamily
5EK2A 1N32T 3ZLIA 4WBOA 4WZXA 2ACZA 4HWDA 3F31A 1YKHB 4HE8A 3ZT6A 2XSAA 4B6XA 4FI5A 5C3JA 3K8PC 2XM1A 3ZT5A 2X9WA 2CMRA 5LHHB 2L8KA 2NOXA 3TKLB 3IBPA 4COFA 1LVFA 3A8YC 3AVSA 2LKGA 3EABA 4F6RC 3IEEA 2DHRA 2KLQA 5JREA 1WLXA 3RYCE 4AI6A 1M7KA 4UV9B 4PNIA 3LJCA 3ONJA 1ZKEA 2BVMA 2XZEA 2QVAA 4QH1A 3VR9A 4CXYA 2XQ4A 3GWHA 4QXCB 2A72A 4OFZA 4JI4T 3RIAA 3KV4A 4E7ZA 1HG5A 4TWFA 2X9YA 3RHWA 4X64T 2MTQA 1MNEA 1T7SA 3LK2B 1S35A 2W66A 2PG8A 4O4IE 2E9XD 1WRDA 4HFVA 4X1KE 4HFDA 3B57A 2WP9A 4EB6E 3FXDB 4H9NC 2VL8A 3RQUA 4E7SA 1AJ3A 4PJJA 1YQ3A 5JR9B 2IC6A 5LBMA 4EOZB 3PUGA 2DCFA 4JUYA 4QHOA 2BZBA 3P4SA 4AKIA 2WWUA 1IBKT 2WWVA 5J2TE 3S4UA 4GKKT 4P0AA 3O9XA 4U74A 2ZM2A 1HX8A 4PFOA 5KMGP 3ZMSB 4HFEA 1US7B 3ZEFB 1MMNA 3ZJ2A 2W2UA 2BKNA 5LOVE 5JR9A 4ILUA 4ZI2D 4UR9A 3VU7H 4Z8XA 3AE1A 2H3RA 5CFBA 2CPTA 5LG4A 2MYSA 4TN7B 4X1YE 2LHNA 3CIRA 5HCJA 2XUEA 3PUYF 1O3XA 4P0BA 3ZYMA 2KT9A 2DLRA 2K48A 2KZ7B 4A5XA 1BR0A 4DV1T 5CGMA 1KFYA 2LEHA 4J2CA 4JI8T 4GYRA 2WQYA 3UU3A 3QK6A 3AEDA 1UX4A 4DUZT 1T8BA 4U7IA 2FUPA 4AKRB 4QH5A 3B5MA 4DV4T 2VASA 3ZN0B 5FXWA 1MIYA 2F4VT 1D0XA 2E8IA 4IREA 2J62A 2UXNB 2X0HA 4UVBB 3OKQA 2CCQA 1MMAA 2BBJA 3U78A 3N2GE 5AQTB 4ZEYA 3TLSA 5AQHB 3ETUA 4O4HE 2XASB 1HCIA 2P9BA 3DJBA 3AE7A 2X67A 3MJXA 3PJAJ 2CXFA 2WMOA 4ZZCA 5L4HA 2I6HA 1UUSA 2A3DA 1EZ3A 4L9IA 1D0YA 3FB2A 4ZI3C 2XQYA 2KINB 3UTKA 2M6IA 5CB4E 2J1DG 2VWAA 4HGAA 3CKDA 3L39A 2E2AA 5LMUT 4IHJE 5AQLB 3UU5A 4UV8B 2AE9A 4OYKA 4TNVA 4EXTA 2E5LT 2XY8B 2K5BB 5LJNA 1XNQT 2VVSA 4U2ZA 1IBMT 4JEUB 4PJNA 3RC8A 1HFAA 1N33T 1CHUA 4KP3C 2WCAA 4GK0E 4AKHA 2CRBA 2A2FX 5L3GB 4DV7T 4YFSA 5FMNA 5LBQB 5BR8T 3C50A 3FZMB 2ODVA 3HKCE 1OWAA 2CHNA 2UXXB 4LF6T 3AE3A 4PJLA 2XAQB 2BBHA 2H89A 4IDPA 3RYFE 3RKOA 2CWOA 3OYZA 4B3ST 3AA0B 1QSDA 2D0UA 4MHCA 4DR3T 3HKBE 5FL0A 3Q5EA 5JDHA 1J1JA 5IYZE 2VQET 3PUQA 3P4QA 3RX6A 2XSBA 2X51A 1T72A 4YHJA 2BG9A 4H63H 4H63V 2YOEA 3R84B 4Z90A 5HXEA 5L3EB 3UFEA 2HPLA 1XDOA 4NXMT 3Q5WA 2N9DA 5JDFA 2V5DA 2JQKA 3RRWA 3UU8A 1U5PA 5JDLA 2CLYB 3RYIE 3F2EA 4DR5T 5HWXA 3C4ZA 2JMKA 5L3FB 4LF8T 1IAPA 2XQ7A 1I6ZA 1UX5A 3AEBA 3P4PA 5JDMA 3RRCA 5JTGA 1SE7A 3ZCIA 3ANWB 3AB3B 3BQKA 3N9NA 3CWZB 5A1LA 1NWMX 3AE5A 3U3IA 2IW5B 1SA0E 2UXCT 2N2NA 3PUVF 3OVUA 3JADA 1XMOT 2MPKA 2BG9E 1YKEB 1HNZT 2G0UA 3E22E 3W15B 2DL1A 2OV9A 2VB6A 3CVRA 4IDZA 3HKDE 5FVLA 5AFUL 4GYSA 4IDQA 3MZKB 2WB5A 4BJMA 3V5UA 4O4LE 3LK42 3UQ7A 3JAFA 3K3OA 3ZCJA 2EHOB 2ODUA 3P4WA 4K0KT 4WNKA 4UXNB 2BG9C 3ANWA 1E2AA 2AXDS 4Q25A 4LF9T 3FXEB 3ZC0A 5LP6E 2J4GA 3KDSE 2W00A 1S94A 3SS1A 3Q5DA 5LNKA 2UUCT 2LLYA 2WDRA 4C91A 3ZN1B 4IE0A 4YTMA 2PBIA 2XM2A 3CPZA 1N36T 4DBRA 2D9DA 3PTRB 2EHOA 5IUXA 4ISTA 2XPKA 3JC6D 4JLEA 3LK3B 2CXDA 3T8OA 3P7IA 3N5LA 3ZKRA 4LFAT 4DVDA 3B13A 3F57A 3H3MA 1UURA 3CX8B 3ZMTB 2CBIA 3ZMZB 3QC9A 1MMGA 4NPPA 2E9XA 4YHHT 5FXVA 4TNWA 1HNXT 1DU2A 4UVAB 3KV6A 3KINB 5HXCA 5HWYA 4DMWA 1HX1B 2DWGA 4HFHA 3VKGA 4IL9A 4X20E 3VR8A 4PAGA 2JQHA 5L3DB 4CI2B 2EHOD 2VL0A 4IGUA 4QWNB 3V5SA 5HYAA 4UIGA 4I4TE 1XWMA 2LSGA 1HTJF 4CI1B 5DQWA 3RI5A 4QXHB 3N9LA 3ZJ1A 2CHOA 3UUNA 3UULA 3LFMA 1FEWA 3N9QA 1KNRA 1IJ6A 2JMHA 4HEAA 4EAHA 4O2AE 4P09A 5KDMC 5FXZA 4ERRA 5J1GA 2EHOC 1OEDB 2XQ9A 3UQ4A 3WAKA 2CA5A 1ZHCA 2XAGB 4IL4A 2I59A 3PJAA 2LSYA 3M65A 3TLTA 1LVKA 3ABVA 4KMCA 2X9XA 3AAIA 4ZOLE 1BR2A 4JBWF 5C8YE 3QB5K 3TLWA 3ETVA 4JEHB 4UF0B 3C51A 1UK5A 2CM0A 5AQKB 5JDNA 4C90A 3NRXA 3VHLA 4YJ3E 2VKDA 2E9XC 2LJLA 2B1EA 5HXSA 3CQGB 1I94T 1WFDA 3TLUA 2QYWA 3HL6A 1UCUA 3QUJA 2VQFT 4YJ2E 5ABEA 1WR6A 4X62T 4HTEA 3CMLA 5L4EA 3L09A 3OPCA 4EEBA 2XQ8A 5TAOA 1OEDA 3N9MA 2DNXA 4XAXB 5EK3A 2VVNA 1YQ4A 5C2TA 2WY2A 5KXJA 4FJOA 4DV2T 4UF0A 2JJ9A 3K1SA 2RP4A 1W0AA 3AAEB 2WDQA 4ZZBA 3CX6B 5LHGB 3J7Yq 4LFBT 2X9HA 5JRCB 3OBVE 2PFVA 1W09A 3FBZA 2C0SA 4AQFA 4ISSA 1ZP0A 2YINA 1J5ET 4LMJA 2Q9QB 3ZT7A 4ZI2C 4U72A 5LHIB 4HWHA 4LMKA 2LRLA 3AE4A 3O1HA 4AIUA 3PUXF 4PK5A 3I0QA 4H9PC 2LM2A 4IE5A 3IHRA 4KHZF 4EV6A 3ZSSA 4MLKA 4ANJA 1QUUA 3R6NA 5FL1A 1ZV4X 2QA7A 4YSXA 1FMVA 4BA9A 2LOSA 2UUBT 3AXJB 2LSKA 3RIUA 2KWIB 2LOPA 4QH4A 5H6RB 4DUYT 1VCTA 4A56A 3PURA 5AQNB 3CK6A 5FVKA 5LA6E 3L8RA 2Q9QA 1IBLT 5J0ZA 2NP9A 3VRBA 5JR9C 2WAUA 2FJEA 2XQ5A 4AXPA 2X0YA 2NW7A 2VK9A 4ILAA 2WZIA 4BJNA 4CN6A 5JH7E 2LSJA 2QGSA 3AXJA 2IUBA 2K3WA 3QNUA 2XAFB 2Y48B 4YTPA 4UELA 5LJMA 5LG3A 3UUBA 1JNZA 4AQFC 1X9BA 5HEHA 2YDSA 5FKYA 1FMWA 2Q9QD 4ZS3A 2KMFA 3FHNA 3QB5A 2JQQA 2OLTA 4PK4A 3Q5XA 4TV8E 4WYVA 5J2UE 2XQ6A 5HEOA 3SFEA 1G8XA 3PDYA 3RPUA 1Z8UA 3C4XA 3BK9A 4EIWA 3NVOA 5LMNT 3K3QC 4NUVA 3P50A 3EDUA 3GMIA 2LM9A 3MA9A 2NW9A 4ILCA 2FJAA 4YXDA 3C4WA 4CZZB 1LKXA 5M4YA 1MMDA 5FYMA 3ZMUB 1NEKA 3AEAA 1HF8A 1B7TA 2ZM0A 3AA1B 1R8IA 2JIWA 2PJQA 1WR0A 2RPAA 2W61A 2IC9A 2MOZA 4OYJA 2HHHT 4LFCT 4XBFB 2XQAA 4MBQA 4AQGA 4DV0T 3G06A 2WDVA 3RC3A 3AECA 2WSSV 2JPFA 3A7MA 4ADZA 4HFBA 2YU1A 3CQXC 4F8HA 5F8PA 5AQFB 5KX5E 2KSRA 1HS7A 4JI0T 3Q2MA 3ZPOA 4JI7T 1J5WA 1D1BA 1W9RA 1VCSA 4EZHA 1NAFA 4G2AA 4YLHA 2V7JA 4HFCA 3OTOT 2V6YB 4OK0A 1HG2A 4I55E 3I9WA 2IHR1 1BR4A 3EI0A 2K24A 2X0LB 4ZI7E 3PE0A 4B3TT 2M67A 2HN1A 4CQIA 2V7KA 5ADXL 4CXWA 4TWDA 4AISA 3BQLA 4DV5T 2LRKA 4QX7B 3KFWX 2FJBA 3KBUA 1QLBA 4I50E 5L3BB 4B3MT 1E7PA 4QX8B 1GQEA 2OA5A 3K3NA 3WI3A 2C5IT 2CEAA 2DWKA 2V6YA 2V7MA 2WMNA 1XMQT 1D1AA 3ZYKA 3L3PA 5AQPB 3C64A 3OJAA 3AVRA 2V26A 4O8SA 1YXRA 4CI3B 3ZYLA 4DR6T 3FZLB 3UU6A 5ETWA 4GOUA 5FP3A 3RLFF 1MIWA 3O4XE 4OX9T 4IE4A 3N2OA 2A9UA 3HR0A 5FY1A 3JAEA 1NENA 1ZEEA 4DR7T 2C5KT 2MBGA 3RH3A 4NXNT 3QOFA 2VKJA 2LSIA 4EEDA 4LF7T 2L3LA 2HN2A 3AEEA 4QXBB 4L0RA 5HXHA 3D0TA 2X68A 3H37A 3LDQB 5AQRB 2WS3A 3AE2A 2LE8A 4X1IE 1KF6A 5JDQA 4A98A 1XNRT 5HEGA 3ZMVB 3FZFB 2ZLYA 2I0MA 1X79A 3EDVA 4DR4T 4K0UA 3UU4A 1UGOA 2ES0A 2K9AA 2IIUA 1V9DA 3H3AA 4ILBA 1YD8G 2CLYC 5HXRA 3PU8A 5EK4A 4DMVA 4ASKA 4KUMB 3EVYA 4B3RT 5LGNB 5CJ5A 5LCYA 3JC6C 3ESLA 3E08A 5HAXA 2IDOB 2UU9T 5IWAT 1VRBA 4DNDA 3LBXB 2V5CA 2B76A 2YDQA 4GK5E 4DBQA 2KXPB 5AQSB 3J9X1 2CXLA 4ZXLA 5JDGA 5F3JA 1IJ5A 4JI6T 4LMLA 4KBMB 4PFPA 2VKHA 3EHZA 1FJGT 1H7CA 3KVAA 2XHEB 2BDEA 2ZMAA 4IDNA 5L3CB 2WZHA 2IMLA 4U3CA 2BS3A 2J47A 3PUAA 3LBXA 4IE7A 3KVBA 2VKOA 1OXZA 1BR1A 3O1IA 3IF8B 3PV0F 4JI3T 5FY7A 3AE9A 3LSVA 4KI0F 4WBNE 3BQIA 2YKSA 3DTOA 1D1CA 1HNWT 3RF1A 2XQ3A 5JQGE 3UUMA 4IT4A 1HR0T 4N78D 2L9QA 5DABA 2D5UA 2NR4A 4XZCA 2W63A 4KX6A 3SFDA 5LGTB 4EZ4A 3P4RA 4CXXA 2UXDT 3IA3A 4TZ4C 3GA8A 3RIFA 4AKGA 4U33A 4EYYR 3CQCB 3RQWA 3OYXA 5GONE 4HN9A 1U4QA 4QKNA 4V1Av 2N1GA 4IDOA 4U2YA 5LGUB 3DP7A 4HFIA 5AQJB 1N34T 3I0OA 3T1YT 2MAWA 2ACXA 2D2SA 3VKHA 2CE7A 2HPJA 4A97A 4G63A 4OHFA 4NIQA 4MALA 5AQVB 5L47A 5IHYA 1WYBA 5AQGB 2YU2A 4GKJT 2FBWA 3UT5E 3N9PA 3N2KE 4UEMA 3UFGA 2XAHB 4H9OC 3FZKB 2BKOA 3SOLA 4TX5A 2M6BA 3ONLC 2QRXA 1OEDE 4ZI3D 3SRZA 3P8CD 3NBXX 2H7VC 5JRCA 2C5JA 2BS2A 4I0UA 4X65T 3LG7A 3PUWF 3FZHB 3RYHE 4CN1A 1ZOYA 5DJQC 4DR1T 4U31A 4LF5T 3C98B 2W67A 1OEDC 4X66T 5DQVA 2YN6A 5ABHA 4M1PA 2H7OA 4DV6T 2HH7A 4HKAA 2YDRA 5HEJA 3AE6A 2V8SV 1KNPA 2ZM8A 2NW8A 3X1DA 2YEVC 4TUYE 2NWBA 2KNDA 4JI1T 4IIJE 1WYCA 1Z0PA 1D0ZA 3NRYA 3AA7B 2UUAT 4YSZA 4JI5T 3T1HT 4PK6A 4CN4A 3WAJA 5AQOB 4YSYA 2IAKA 3I9YA 1SUMB 3AEFA 4GIWA 4O4JE 1KK7A 4AKLA 2JRKA 2KWHA 5JVDE 2LHRA 4MFRA 2BG9B 2WU5A 2V7LA 3AA6B 2CBJA 3GN5B 3ONXA 3RIUC 5BMVE 2SPCA 4U7YA 5CA0E 3N9OA 4DV3T 2BS4A 2NTYA 3KV9A 2FJDA 2Q9QC 3MACA 2JQ9A 4NUUA 1IZNB 1Y01A 3ZSTA 3HKEE 2Y8DA 4HWFA 5ABGA 3Q9DA 2UXBT 2RA1A 3FBLA 3AAAB 5AQQB 5LXTE 4TV9E 5L2LA 1LRZA 5ABFB 2CWYA 4BAYB 1W0BA 2DI4A 3TLVA 4IE6A 1JNRA 1Y64B 3GN5A 4HWIB 2NTXA 3O1JA 3SWHA 2PTFA 2LT3A 2W62A 4EYUA 3RKGA 1L0VA 4L5GA 4ZHQE 5F5WA 4LF4T 3CX7B 4JV5T 4H9RC 4YTNA 2W4XA 4YY3T 1G73A 2XJ7A 2LKHA 4TWHA 4YT0A 3MKDA 3NKZA 2WM9A 2BKPA 5FY0A 2XAJB 5AQUB 5ABFA 3I1AA 2W0GA 4EGWA 1E1HB 5AQMB 4H9SE 3EAMA 2YK0A 3PUZF 1VOMA 4I43B 2GK9A 3VRAA 3AE8A 5FNVE 2VURA 1MNDA 1XDPA 2R6GF 1YW0A 2V7IA 4HWCA 3PU3A 4WW0A 3NZQA 1XZYA 3MK7C 1KNZA 3NWIA 1KEYA 4X5TA 4P1NA 4O2BE 4AQYT 3AEGA 2E5VA 4Z91A 4KHPT 2H88A 2XTLA 3HI2A 3NZPA 2Y6XA 1T98A 4PW8A 3A5XA 2X66A 3EUHA 1MIVA 3E0ZA 5H6QB 1CUNA 1SHZC 3KBTA 4DO0A 1FIOA 5EZYE 5LYJE 2WU2A 3UUXB 2WBLA 3JCFA 3ZC1A 2E9XB 3MXZA 5LB7B 5FXXA 3KV5A 4H9QC 2D0TA 2V6XA 2Z6EA 5CA1E 3PUSA 4PJMA 5HEUA 5AQIB 4DIDB 3M3ZB 1WCRA 3RGLA 5E0OA 2BVLA 4JI2T 5HCMA 2ZM6T 2V1DB 1M62A 3HA4A 4DR2T 4JYAT 4UVCB 4ZS2A
chains in the Genus database with same CATH topology
2QGSA 5EK2A 3C4ZA 5LGTB 4EZ4A 3ZLIA 2JMKA 5L3FB 4WBOA 4CXXA 1IAPA 3F31A 1YKHB 4HE8A 4TZ4C 4B6XA 1UX5A 3GA8A 4AKGA 5JDMA 4FI5A 3RRCA 3K8PC 2XAFB 2Y48B 4UELA 2X9WA 2CMRA 5LJMA 4EYYR 3ZCIA 5LHHB 3CQCB 2L8KA 3ANWB 3AB3B 2NOXA 3TKLB 3OYXA 4AQFC 5GONE 3BQKA 3N9NA 4HN9A 3IBPA 1U4QA 4QKNA 1FMWA 3CWZB 4V1Av 1LVFA 2N1GA 2Q9QD 3AVSA 4ZS3A 4F6RC 5A1LA 3IEEA 5LGUB 1NWMX 2KMFA 3FHNA 3DP7A 2JQQA 4PK4A 3Q5XA 3U3IA 4TV8E 2IW5B 1SA0E 2DHRA 2KLQA 2N2NA 5J2UE 5JREA 3I0OA 1YKEB 1G8XA 1WLXA 2G0UA 3E22E 3PDYA 3RYCE 3W15B 4AI6A 3RPUA 2ACXA 3C4XA 4UV9B 3BK9A 4PNIA 2VB6A 3CVRA 4EIWA 4IDZA 3LJCA 2D2SA 3HKDE 5AFUL 4GYSA 3VKHA 3K3QC 1ZKEA 2BVMA 2CE7A 2HPJA 4G63A 4NUVA 3MZKB 4CXYA 3GWHA 4QXCB 4OHFA 2A72A 4OFZA 3EDUA 3GMIA 2LM9A 4BJMA 4MALA 5IHYA 3KV4A 1WYBA 3V5UA 4E7ZA 3MA9A 4O4LE 1HG5A 2NW9A 3LK42 2X9YA 2YU2A 3K3OA 3ZCJA 3UT5E 2MTQA 2EHOB 3C4WA 2ODUA 3N9PA 3N2KE 1MNEA 4CZZB 3LK2B 1S35A 4UEMA 1LKXA 5M4YA 2XAHB 4H9OC 4WNKA 1MMDA 2PG8A 4O4IE 2E9XD 4UXNB 5FYMA 3ZMUB 1WRDA 3ANWA 3SOLA 4HFVA 4X1KE 1HF8A 3B57A 4TX5A 4EB6E 1B7TA 3FXDB 3FXEB 3ZC0A 5LP6E 4H9NC 2ZM0A 4ZI3D 3AA1B 2VL8A 3SRZA 3P8CD 3KDSE 3NBXX 2H7VC 2W00A 1S94A 3SS1A 5JRCA 4E7SA 1AJ3A 2C5JA 4PJJA 2PJQA 5LNKA 2W61A 3LG7A 2IC9A 2MOZA 4OYJA 4XBFB 5JR9B 3RYHE 2IC6A 4MBQA 5LBMA 4C91A 3ZN1B 5DJQC 4EOZB 4IE0A 2PBIA 3PUGA 4AQGA 2DCFA 4JUYA 3C98B 3CPZA 4QHOA 2BZBA 4DBRA 3RC3A 2WWUA 4AKIA 5DQVA 3PTRB 2WSSV 4M1PA 5J2TE 2EHOA 3S4UA 2JPFA 2H7OA 4ISTA 3JC6D 2HH7A 4JLEA 4HKAA 4ADZA 3LK3B 3O9XA 4P0AA 2CXDA 3T8OA 3P7IA 3N5LA 2YU1A 4U74A 3CQXC 2ZM2A 4DVDA 1HX8A 2ZM8A 4PFOA 5KMGP 3B13A 3F57A 5F8PA 3ZMSB 5KX5E 2NW8A 1US7B 3CX8B 3ZEFB 3ZMTB 3ZMZB 2YEVC 4TUYE 1MMNA 1HS7A 3ZJ2A 2NWBA 2KNDA 4IIJE 1WYCA 3Q2MA 3QC9A 5LOVE 1MMGA 3ZPOA 1Z0PA 1D0ZA 3NRYA 1D1BA 3AA7B 5JR9A 4ILUA 4ZI2D 2E9XA 3VU7H 5FXVA 4Z8XA 2H3RA 4PK6A 4EZHA 1NAFA 4G2AA 4UVAB 4YLHA 3WAJA 2V7JA 2IAKA 4OK0A 3KV6A 1HG2A 3I9YA 3KINB 5HXCA 5HWYA 4DMWA 4I55E 2DWGA 5LG4A 3I9WA 3VKGA 1BR4A 2MYSA 4TN7B 4X20E 2LHNA 4X1YE 4PAGA 5L3DB 4CI2B 2EHOD 4GIWA 4O4JE 4IGUA 2K24A 2XUEA 4QWNB 3V5SA 1O3XA 5HYAA 4P0BA 4UIGA 3ZYMA 2X0LB 2KT9A 4I4TE 2DLRA 1KK7A 4ZI7E 3PE0A 2JRKA 2KWHA 4AKLA 5JVDE 2K48A 2M67A 2LSGA 4CQIA 1HTJF 2V7KA 4CXWA 5ADXL 2KZ7B 3BQLA 4CI1B 5DQWA 4QX7B 2LHRA 1BR0A 3KFWX 4MFRA 2V7LA 3AA6B 4QXHB 3N9LA 3KBUA 3ZJ1A 4I50E 3GN5B 3ONXA 3UUNA 2LEHA 3UULA 5L3BB 5BMVE 2SPCA 4QX8B 4J2CA 5CA0E 4GYRA 3N9OA 2OA5A 3LFMA 3K3NA 3QK6A 1UX4A 3WI3A 1FEWA 3N9QA 2C5IT 4AKRB 2NTYA 3KV9A 2CEAA 2DWKA 2V7MA 2WMNA 1IJ6A 1D1AA 3ZYKA 2JMHA 2Q9QC 4HEAA 3MACA 4EAHA 4O2AE 4P09A 3L3PA 2VASA 3ZN0B 5FXWA 5KDMC 1MIYA 4NUUA 1IZNB 5FXZA 3C64A 3OJAA 1D0XA 2E8IA 3AVRA 2Y8DA 3HKEE 2V26A 4O8SA 2UXNB 4ERRA 5JH7E 5J1GA 4CI3B 4UVBB 2EHOC 3Q9DA 3ZYLA 2RA1A 3FBLA 3AAAB 3OKQA 2CCQA 3WAKA 2CA5A 1MMAA 5LXTE 5ETWA 4TV9E 5L2LA 4GOUA 5FP3A 3U78A 1MIWA 1ZHCA 2XAGB 2I59A 3N2GE 3O4XE 1LRZA 2CWYA 4BAYB 4IE4A 2DI4A 3N2OA 3HR0A 4IE6A 5FY1A 1Y64B 3ETUA 2LSYA 3M65A 4O4HE 3GN5A 1LVKA 2NTXA 1ZEEA 4KMCA 2X9XA 3AAIA 3O1JA 2C5KT 2XASB 3SWHA 1HCIA 4ZOLE 2MBGA 1BR2A 2P9BA 3DJBA 2LT3A 2W62A 2X67A 3MJXA 4EYUA 3RH3A 3ETVA 5C8YE 4JEHB 4UF0B 3C51A 2VKJA 2LSIA 2CM0A 2CXFA 2L3LA 2WMOA 4QXBB 5JDNA 4C90A 4L0RA 3NRXA 5HXHA 3D0TA 3VHLA 4YJ3E 2VKDA 2X68A 3H37A 2E9XC 2LJLA 2B1EA 4L5GA 4ZHQE 5HXSA 2LE8A 3CQGB 3CX7B 4X1IE 5JDQA 2A3DA 1EZ3A 4L9IA 3HL6A 1UCUA 1D0YA 4H9RC 3QUJA 3FB2A 4ZI3C 3ZMVB 2XQYA 2KINB 4YJ2E 1G73A 3UTKA 1WR6A 2ZLYA 3MKDA 5CB4E 1X79A 3EDVA 3CMLA 2J1DG 2WM9A 4HTEA 4K0UA 3L09A 2VWAA 4HGAA 3CKDA 5TAOA 3N9MA 5FY0A 2ES0A 2DNXA 2K9AA 4IHJE 2XAJB 4XAXB 1V9DA 3H3AA 1YD8G 3I1AA 4UV8B 2CLYC 5HXRA 2W0GA 3PU8A 4OYKA 1E1HB 5EK3A 4H9SE 4EXTA 2K5BB 5EK4A 4DMVA 4ASKA 5LJNA 4KUMB 2YK0A 3EVYA 5LGNB 1VOMA 4I43B 4FJOA 4UF0A 2GK9A 2JJ9A 4JEUB 5LCYA 2RP4A 3JC6C 3ESLA 5FNVE 3E08A 3AAEB 4PJNA 1MNDA 3CX6B 5HAXA 5LHGB 3J7Yq 1YW0A 2V7IA 3RC8A 1VRBA 1HFAA 2X9HA 4DNDA 3PU3A 3LBXB 5JRCB 4WW0A 3OBVE 3NZQA 4KP3C 2PFVA 3MK7C 4GK0E 4AKHA 5HWXA 4GK5E 4DBQA 1KNZA 2KXPB 2C0SA 3FBZA 2A2FX 4AQFA 3J9X1 2CXLA 5JDGA 5L3GB 4ISSA 4YFSA 5FMNA 5LBQB 2YINA 5F3JA 1IJ5A 3C50A 2ODVA 3HKCE 1OWAA 4O2BE 2Q9QB 4KBMB 4PFPA 2VKHA 4U72A 2UXXB 4ZI2C 5LHIB 4PJLA 2XAQB 2XTLA 3O1HA 4PK5A 3HI2A 3NZPA 3I0QA 2Y6XA 1H7CA 4H9PC 3KVAA 3IHRA 2XHEB 1T98A 4IE5A 4PW8A 2BDEA 3RYFE 2ZMAA 4MLKA 3RKOA 2CWOA 3A5XA 3OYZA 2X66A 4ANJA 1QUUA 3EUHA 5L3CB 3R6NA 3AA0B 1QSDA 1ZV4X 1MIVA 2D0UA 2QA7A 3E0ZA 4MHCA 3HKBE 1FMVA 4BA9A 2LOSA 5JDHA 5H6QB 1CUNA 5IYZE 3PUQA 1SHZC 3PUAA 2LSKA 3KBTA 4DO0A 3RX6A 3LBXA 2KWIB 4IE7A 2LOPA 1FIOA 2X51A 5H6RB 5EZYE 4YHJA 5LYJE 4H63H 3KVBA 2VKOA 1OXZA 3UUXB 4H63V 2WBLA 4A56A 1BR1A 3R84B 3PURA 3O1IA 5HXEA 5L3EB 3ZC1A 2E9XB 3IF8B 3MXZA 3UFEA 5LA6E 5FY7A 2HPLA 5FXXA 3KV5A 4H9QC 2Q9QA 2D0TA 2NP9A 2Z6EA 5CA1E 5JR9C 4WBNE 3PUSA 3BQIA 2WAUA 3Q5WA 4PJMA 3DTOA 1D1CA 2N9DA 5JDFA 5E0OA 2BVLA 3RRWA 4AXPA 1U5PA 5JQGE 3UUMA 2NW7A 2VK9A 4N78D 2L9QA 2V1DB 3HA4A 5DABA 5JDLA 4BJNA 2D5UA 4XZCA 2CLYB 3RYIE 3F2EA 2W63A 4UVCB 4ZS2A 2LSJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L8K A; 
#chains in the Genus database with same CATH topology
 5EK2 A;  1N32 T;  3ZLI A;  4WBO A;  4WZX A;  2ACZ A;  4HWD A;  3F31 A;  1YKH B;  4HE8 A;  3ZT6 A;  2XSA A;  4B6X A;  4FI5 A;  5C3J A;  3K8P C;  2XM1 A;  3ZT5 A;  2X9W A;  2CMR A;  5LHH B;  2L8K A;  2NOX A;  3TKL B;  3IBP A;  4COF A;  1LVF A;  3A8Y C;  3AVS A;  2LKG A;  3EAB A;  4F6R C;  3IEE A;  2DHR A;  2KLQ A;  5JRE A;  1WLX A;  3RYC E;  4AI6 A;  1M7K A;  4UV9 B;  4PNI A;  3LJC A;  3ONJ A;  1ZKE A;  2BVM A;  2XZE A;  2QVA A;  4QH1 A;  3VR9 A;  4CXY A;  2XQ4 A;  3GWH A;  4QXC B;  2A72 A;  4OFZ A;  4JI4 T;  3RIA A;  3KV4 A;  4E7Z A;  1HG5 A;  4TWF A;  2X9Y A;  3RHW A;  4X64 T;  2MTQ A;  1MNE A;  1T7S A;  3LK2 B;  1S35 A;  2W66 A;  2PG8 A;  4O4I E;  2E9X D;  1WRD A;  4HFV A;  4X1K E;  4HFD A;  3B57 A;  2WP9 A;  4EB6 E;  3FXD B;  4H9N C;  2VL8 A;  3RQU A;  4E7S A;  1AJ3 A;  4PJJ A;  1YQ3 A;  5JR9 B;  2IC6 A;  5LBM A;  4EOZ B;  3PUG A;  2DCF A;  4JUY A;  4QHO A;  2BZB A;  3P4S A;  4AKI A;  2WWU A;  1IBK T;  2WWV A;  5J2T E;  3S4U A;  4GKK T;  4P0A A;  3O9X A;  4U74 A;  2ZM2 A;  1HX8 A;  4PFO A;  5KMG P;  3ZMS B;  4HFE A;  1US7 B;  3ZEF B;  1MMN A;  3ZJ2 A;  2W2U A;  2BKN A;  5LOV E;  5JR9 A;  4ILU A;  4ZI2 D;  4UR9 A;  3VU7 H;  4Z8X A;  3AE1 A;  2H3R A;  5CFB A;  2CPT A;  5LG4 A;  2MYS A;  4TN7 B;  4X1Y E;  2LHN A;  3CIR A;  5HCJ A;  2XUE A;  3PUY F;  1O3X A;  4P0B A;  3ZYM A;  2KT9 A;  2DLR A;  2K48 A;  2KZ7 B;  4A5X A;  1BR0 A;  4DV1 T;  5CGM A;  1KFY A;  2LEH A;  4J2C A;  4JI8 T;  4GYR A;  2WQY A;  3UU3 A;  3QK6 A;  3AED A;  1UX4 A;  4DUZ T;  1T8B A;  4U7I A;  2FUP A;  4AKR B;  4QH5 A;  3B5M A;  4DV4 T;  2VAS A;  3ZN0 B;  5FXW A;  1MIY A;  2F4V T;  1D0X A;  2E8I A;  4IRE A;  2J62 A;  2UXN B;  2X0H A;  4UVB B;  3OKQ A;  2CCQ A;  1MMA A;  2BBJ A;  3U78 A;  3N2G E;  5AQT B;  4ZEY A;  3TLS A;  5AQH B;  3ETU A;  4O4H E;  2XAS B;  1HCI A;  2P9B A;  3DJB A;  3AE7 A;  2X67 A;  3MJX A;  3PJA J;  2CXF A;  2WMO A;  4ZZC A;  5L4H A;  2I6H A;  1UUS A;  2A3D A;  1EZ3 A;  4L9I A;  1D0Y A;  3FB2 A;  4ZI3 C;  2XQY A;  2KIN B;  3UTK A;  2M6I A;  5CB4 E;  2J1D G;  2VWA A;  4HGA A;  3CKD A;  3L39 A;  2E2A A;  5LMU T;  4IHJ E;  5AQL B;  3UU5 A;  4UV8 B;  2AE9 A;  4OYK A;  4TNV A;  4EXT A;  2E5L T;  2XY8 B;  2K5B B;  5LJN A;  1XNQ T;  2VVS A;  4U2Z A;  1IBM T;  4JEU B;  4PJN A;  3RC8 A;  1HFA A;  1N33 T;  1CHU A;  4KP3 C;  2WCA A;  4GK0 E;  4AKH A;  2CRB A;  2A2F X;  5L3G B;  4DV7 T;  4YFS A;  5FMN A;  5LBQ B;  5BR8 T;  3C50 A;  3FZM B;  2ODV A;  3HKC E;  1OWA A;  2CHN A;  2UXX B;  4LF6 T;  3AE3 A;  4PJL A;  2XAQ B;  2BBH A;  2H89 A;  4IDP A;  3RYF E;  3RKO A;  2CWO A;  3OYZ A;  4B3S T;  3AA0 B;  1QSD A;  2D0U A;  4MHC A;  4DR3 T;  3HKB E;  5FL0 A;  3Q5E A;  5JDH A;  1J1J A;  5IYZ E;  2VQE T;  3PUQ A;  3P4Q A;  3RX6 A;  2XSB A;  2X51 A;  1T72 A;  4YHJ A;  2BG9 A;  4H63 H;  4H63 V;  2YOE A;  3R84 B;  4Z90 A;  5HXE A;  5L3E B;  3UFE A;  2HPL A;  1XDO A;  4NXM T;  3Q5W A;  2N9D A;  5JDF A;  2V5D A;  2JQK A;  3RRW A;  3UU8 A;  1U5P A;  5JDL A;  2CLY B;  3RYI E;  3F2E A;  4DR5 T;  5HWX A;  3C4Z A;  2JMK A;  5L3F B;  4LF8 T;  1IAP A;  2XQ7 A;  1I6Z A;  1UX5 A;  3AEB A;  3P4P A;  5JDM A;  3RRC A;  5JTG A;  1SE7 A;  3ZCI A;  3ANW B;  3AB3 B;  3BQK A;  3N9N A;  3CWZ B;  5A1L A;  1NWM X;  3AE5 A;  3U3I A;  2IW5 B;  1SA0 E;  2UXC T;  2N2N A;  3PUV F;  3OVU A;  3JAD A;  1XMO T;  2MPK A;  2BG9 E;  1YKE B;  1HNZ T;  2G0U A;  3E22 E;  3W15 B;  2DL1 A;  2OV9 A;  2VB6 A;  3CVR A;  4IDZ A;  3HKD E;  5FVL A;  5AFU L;  4GYS A;  4IDQ A;  3MZK B;  2WB5 A;  4BJM A;  3V5U A;  4O4L E;  3LK4 2;  3UQ7 A;  3JAF A;  3K3O A;  3ZCJ A;  2EHO B;  2ODU A;  3P4W A;  4K0K T;  4WNK A;  4UXN B;  2BG9 C;  3ANW A;  1E2A A;  2AXD S;  4Q25 A;  4LF9 T;  3FXE B;  3ZC0 A;  5LP6 E;  2J4G A;  3KDS E;  2W00 A;  1S94 A;  3SS1 A;  3Q5D A;  5LNK A;  2UUC T;  2LLY A;  2WDR A;  4C91 A;  3ZN1 B;  4IE0 A;  4YTM A;  2PBI A;  2XM2 A;  3CPZ A;  1N36 T;  4DBR A;  2D9D A;  3PTR B;  2EHO A;  5IUX A;  4IST A;  2XPK A;  3JC6 D;  4JLE A;  3LK3 B;  2CXD A;  3T8O A;  3P7I A;  3N5L A;  3ZKR A;  4LFA T;  4DVD A;  3B13 A;  3F57 A;  3H3M A;  1UUR A;  3CX8 B;  3ZMT B;  2CBI A;  3ZMZ B;  3QC9 A;  1MMG A;  4NPP A;  2E9X A;  4YHH T;  5FXV A;  4TNW A;  1HNX T;  1DU2 A;  4UVA B;  3KV6 A;  3KIN B;  5HXC A;  5HWY A;  4DMW A;  1HX1 B;  2DWG A;  4HFH A;  3VKG A;  4IL9 A;  4X20 E;  3VR8 A;  4PAG A;  2JQH A;  5L3D B;  4CI2 B;  2EHO D;  2VL0 A;  4IGU A;  4QWN B;  3V5S A;  5HYA A;  4UIG A;  4I4T E;  1XWM A;  2LSG A;  1HTJ F;  4CI1 B;  5DQW A;  3RI5 A;  4QXH B;  3N9L A;  3ZJ1 A;  2CHO A;  3UUN A;  3UUL A;  3LFM A;  1FEW A;  3N9Q A;  1KNR A;  1IJ6 A;  2JMH A;  4HEA A;  4EAH A;  4O2A E;  4P09 A;  5KDM C;  5FXZ A;  4ERR A;  5J1G A;  2EHO C;  1OED B;  2XQ9 A;  3UQ4 A;  3WAK A;  2CA5 A;  1ZHC A;  2XAG B;  4IL4 A;  2I59 A;  3PJA A;  2LSY A;  3M65 A;  3TLT A;  1LVK A;  3ABV A;  4KMC A;  2X9X A;  3AAI A;  4ZOL E;  1BR2 A;  4JBW F;  5C8Y E;  3QB5 K;  3TLW A;  3ETV A;  4JEH B;  4UF0 B;  3C51 A;  1UK5 A;  2CM0 A;  5AQK B;  5JDN A;  4C90 A;  3NRX A;  3VHL A;  4YJ3 E;  2VKD A;  2E9X C;  2LJL A;  2B1E A;  5HXS A;  3CQG B;  1I94 T;  1WFD A;  3TLU A;  2QYW A;  3HL6 A;  1UCU A;  3QUJ A;  2VQF T;  4YJ2 E;  5ABE A;  1WR6 A;  4X62 T;  4HTE A;  3CML A;  5L4E A;  3L09 A;  3OPC A;  4EEB A;  2XQ8 A;  5TAO A;  1OED A;  3N9M A;  2DNX A;  4XAX B;  5EK3 A;  2VVN A;  1YQ4 A;  5C2T A;  2WY2 A;  5KXJ A;  4FJO A;  4DV2 T;  4UF0 A;  2JJ9 A;  3K1S A;  2RP4 A;  1W0A A;  3AAE B;  2WDQ A;  4ZZB A;  3CX6 B;  5LHG B;  3J7Y q;  4LFB T;  2X9H A;  5JRC B;  3OBV E;  2PFV A;  1W09 A;  3FBZ A;  2C0S A;  4AQF A;  4ISS A;  1ZP0 A;  2YIN A;  1J5E T;  4LMJ A;  2Q9Q B;  3ZT7 A;  4ZI2 C;  4U72 A;  5LHI B;  4HWH A;  4LMK A;  2LRL A;  3AE4 A;  3O1H A;  4AIU A;  3PUX F;  4PK5 A;  3I0Q A;  4H9P C;  2LM2 A;  4IE5 A;  3IHR A;  4KHZ F;  4EV6 A;  3ZSS A;  4MLK A;  4ANJ A;  1QUU A;  3R6N A;  5FL1 A;  1ZV4 X;  2QA7 A;  4YSX A;  1FMV A;  4BA9 A;  2LOS A;  2UUB T;  3AXJ B;  2LSK A;  3RIU A;  2KWI B;  2LOP A;  4QH4 A;  5H6R B;  4DUY T;  1VCT A;  4A56 A;  3PUR A;  5AQN B;  3CK6 A;  5FVK A;  5LA6 E;  3L8R A;  2Q9Q A;  1IBL T;  5J0Z A;  2NP9 A;  3VRB A;  5JR9 C;  2WAU A;  2FJE A;  2XQ5 A;  4AXP A;  2X0Y A;  2NW7 A;  2VK9 A;  4ILA A;  2WZI A;  4BJN A;  4CN6 A;  5JH7 E;  2LSJ A;  2QGS A;  3AXJ A;  2IUB A;  2K3W A;  3QNU A;  2XAF B;  2Y48 B;  4YTP A;  4UEL A;  5LJM A;  5LG3 A;  3UUB A;  1JNZ A;  4AQF C;  1X9B A;  5HEH A;  2YDS A;  5FKY A;  1FMW A;  2Q9Q D;  4ZS3 A;  2KMF A;  3FHN A;  3QB5 A;  2JQQ A;  2OLT A;  4PK4 A;  3Q5X A;  4TV8 E;  4WYV A;  5J2U E;  2XQ6 A;  5HEO A;  3SFE A;  1G8X A;  3PDY A;  3RPU A;  1Z8U A;  3C4X A;  3BK9 A;  4EIW A;  3NVO A;  5LMN T;  3K3Q C;  4NUV A;  3P50 A;  3EDU A;  3GMI A;  2LM9 A;  3MA9 A;  2NW9 A;  4ILC A;  2FJA A;  4YXD A;  3C4W A;  4CZZ B;  1LKX A;  5M4Y A;  1MMD A;  5FYM A;  3ZMU B;  1NEK A;  3AEA A;  1HF8 A;  1B7T A;  2ZM0 A;  3AA1 B;  1R8I A;  2JIW A;  2PJQ A;  1WR0 A;  2RPA A;  2W61 A;  2IC9 A;  2MOZ A;  4OYJ A;  2HHH T;  4LFC T;  4XBF B;  2XQA A;  4MBQ A;  4AQG A;  4DV0 T;  3G06 A;  2WDV A;  3RC3 A;  3AEC A;  2WSS V;  2JPF A;  3A7M A;  4ADZ A;  4HFB A;  2YU1 A;  3CQX C;  4F8H A;  5F8P A;  5AQF B;  5KX5 E;  2KSR A;  1HS7 A;  4JI0 T;  3Q2M A;  3ZPO A;  4JI7 T;  1J5W A;  1D1B A;  1W9R A;  1VCS A;  4EZH A;  1NAF A;  4G2A A;  4YLH A;  2V7J A;  4HFC A;  3OTO T;  2V6Y B;  4OK0 A;  1HG2 A;  4I55 E;  3I9W A;  2IHR 1;  1BR4 A;  3EI0 A;  2K24 A;  2X0L B;  4ZI7 E;  3PE0 A;  4B3T T;  2M67 A;  2HN1 A;  4CQI A;  2V7K A;  5ADX L;  4CXW A;  4TWD A;  4AIS A;  3BQL A;  4DV5 T;  2LRK A;  4QX7 B;  3KFW X;  2FJB A;  3KBU A;  1QLB A;  4I50 E;  5L3B B;  4B3M T;  1E7P A;  4QX8 B;  1GQE A;  2OA5 A;  3K3N A;  3WI3 A;  2C5I T;  2CEA A;  2DWK A;  2V6Y A;  2V7M A;  2WMN A;  1XMQ T;  1D1A A;  3ZYK A;  3L3P A;  5AQP B;  3C64 A;  3OJA A;  3AVR A;  2V26 A;  4O8S A;  1YXR A;  4CI3 B;  3ZYL A;  4DR6 T;  3FZL B;  3UU6 A;  5ETW A;  4GOU A;  5FP3 A;  3RLF F;  1MIW A;  3O4X E;  4OX9 T;  4IE4 A;  3N2O A;  2A9U A;  3HR0 A;  5FY1 A;  3JAE A;  1NEN A;  1ZEE A;  4DR7 T;  2C5K T;  2MBG A;  3RH3 A;  4NXN T;  3QOF A;  2VKJ A;  2LSI A;  4EED A;  4LF7 T;  2L3L A;  2HN2 A;  3AEE A;  4QXB B;  4L0R A;  5HXH A;  3D0T A;  2X68 A;  3H37 A;  3LDQ B;  5AQR B;  2WS3 A;  3AE2 A;  2LE8 A;  4X1I E;  1KF6 A;  5JDQ A;  4A98 A;  1XNR T;  5HEG A;  3ZMV B;  3FZF B;  2ZLY A;  2I0M A;  1X79 A;  3EDV A;  4DR4 T;  4K0U A;  3UU4 A;  1UGO A;  2ES0 A;  2K9A A;  2IIU A;  1V9D A;  3H3A A;  4ILB A;  1YD8 G;  2CLY C;  5HXR A;  3PU8 A;  5EK4 A;  4DMV A;  4ASK A;  4KUM B;  3EVY A;  4B3R T;  5LGN B;  5CJ5 A;  5LCY A;  3JC6 C;  3ESL A;  3E08 A;  5HAX A;  2IDO B;  2UU9 T;  5IWA T;  1VRB A;  4DND A;  3LBX B;  2V5C A;  2B76 A;  2YDQ A;  4GK5 E;  4DBQ A;  2KXP B;  5AQS B;  3J9X 1;  2CXL A;  4ZXL A;  5JDG A;  5F3J A;  1IJ5 A;  4JI6 T;  4LML A;  4KBM B;  4PFP A;  2VKH A;  3EHZ A;  1FJG T;  1H7C A;  3KVA A;  2XHE B;  2BDE A;  2ZMA A;  4IDN A;  5L3C B;  2WZH A;  2IML A;  4U3C A;  2BS3 A;  2J47 A;  3PUA A;  3LBX A;  4IE7 A;  3KVB A;  2VKO A;  1OXZ A;  1BR1 A;  3O1I A;  3IF8 B;  3PV0 F;  4JI3 T;  5FY7 A;  3AE9 A;  3LSV A;  4KI0 F;  4WBN E;  3BQI A;  2YKS A;  3DTO A;  1D1C A;  1HNW T;  3RF1 A;  2XQ3 A;  5JQG E;  3UUM A;  4IT4 A;  1HR0 T;  4N78 D;  2L9Q A;  5DAB A;  2D5U A;  2NR4 A;  4XZC A;  2W63 A;  4KX6 A;  3SFD A;  5LGT B;  4EZ4 A;  3P4R A;  4CXX A;  2UXD T;  3IA3 A;  4TZ4 C;  3GA8 A;  3RIF A;  4AKG A;  4U33 A;  4EYY R;  3CQC B;  3RQW A;  3OYX A;  5GON E;  4HN9 A;  1U4Q A;  4QKN A;  4V1A v;  2N1G A;  4IDO A;  4U2Y A;  5LGU B;  3DP7 A;  4HFI A;  5AQJ B;  1N34 T;  3I0O A;  3T1Y T;  2MAW A;  2ACX A;  2D2S A;  3VKH A;  2CE7 A;  2HPJ A;  4A97 A;  4G63 A;  4OHF A;  4NIQ A;  4MAL A;  5AQV B;  5L47 A;  5IHY A;  1WYB A;  5AQG B;  2YU2 A;  4GKJ T;  2FBW A;  3UT5 E;  3N9P A;  3N2K E;  4UEM A;  3UFG A;  2XAH B;  4H9O C;  3FZK B;  2BKO A;  3SOL A;  4TX5 A;  2M6B A;  3ONL C;  2QRX A;  1OED E;  4ZI3 D;  3SRZ A;  3P8C D;  3NBX X;  2H7V C;  5JRC A;  2C5J A;  2BS2 A;  4I0U A;  4X65 T;  3LG7 A;  3PUW F;  3FZH B;  3RYH E;  4CN1 A;  1ZOY A;  5DJQ C;  4DR1 T;  4U31 A;  4LF5 T;  3C98 B;  2W67 A;  1OED C;  4X66 T;  5DQV A;  2YN6 A;  5ABH A;  4M1P A;  2H7O A;  4DV6 T;  2HH7 A;  4HKA A;  2YDR A;  5HEJ A;  3AE6 A;  2V8S V;  1KNP A;  2ZM8 A;  2NW8 A;  3X1D A;  2YEV C;  4TUY E;  2NWB A;  2KND A;  4JI1 T;  4IIJ E;  1WYC A;  1Z0P A;  1D0Z A;  3NRY A;  3AA7 B;  2UUA T;  4YSZ A;  4JI5 T;  3T1H T;  4PK6 A;  4CN4 A;  3WAJ A;  5AQO B;  4YSY A;  2IAK A;  3I9Y A;  1SUM B;  3AEF A;  4GIW A;  4O4J E;  1KK7 A;  4AKL A;  2JRK A;  2KWH A;  5JVD E;  2LHR A;  4MFR A;  2BG9 B;  2WU5 A;  2V7L A;  3AA6 B;  2CBJ A;  3GN5 B;  3ONX A;  3RIU C;  5BMV E;  2SPC A;  4U7Y A;  5CA0 E;  3N9O A;  4DV3 T;  2BS4 A;  2NTY A;  3KV9 A;  2FJD A;  2Q9Q C;  3MAC A;  2JQ9 A;  4NUU A;  1IZN B;  1Y01 A;  3ZST A;  3HKE E;  2Y8D A;  4HWF A;  5ABG A;  3Q9D A;  2UXB T;  2RA1 A;  3FBL A;  3AAA B;  5AQQ B;  5LXT E;  4TV9 E;  5L2L A;  1LRZ A;  5ABF B;  2CWY A;  4BAY B;  1W0B A;  2DI4 A;  3TLV A;  4IE6 A;  1JNR A;  1Y64 B;  3GN5 A;  4HWI B;  2NTX A;  3O1J A;  3SWH A;  2PTF A;  2LT3 A;  2W62 A;  4EYU A;  3RKG A;  1L0V A;  4L5G A;  4ZHQ E;  5F5W A;  4LF4 T;  3CX7 B;  4JV5 T;  4H9R C;  4YTN A;  2W4X A;  4YY3 T;  1G73 A;  2XJ7 A;  2LKH A;  4TWH A;  4YT0 A;  3MKD A;  3NKZ A;  2WM9 A;  2BKP A;  5FY0 A;  2XAJ B;  5AQU B;  5ABF A;  3I1A A;  2W0G A;  4EGW A;  1E1H B;  5AQM B;  4H9S E;  3EAM A;  2YK0 A;  3PUZ F;  1VOM A;  4I43 B;  2GK9 A;  3VRA A;  3AE8 A;  5FNV E;  2VUR A;  1MND A;  1XDP A;  2R6G F;  1YW0 A;  2V7I A;  4HWC A;  3PU3 A;  4WW0 A;  3NZQ A;  1XZY A;  3MK7 C;  1KNZ A;  3NWI A;  1KEY A;  4X5T A;  4P1N A;  4O2B E;  4AQY T;  3AEG A;  2E5V A;  4Z91 A;  4KHP T;  2H88 A;  2XTL A;  3HI2 A;  3NZP A;  2Y6X A;  1T98 A;  4PW8 A;  3A5X A;  2X66 A;  3EUH A;  1MIV A;  3E0Z A;  5H6Q B;  1CUN A;  1SHZ C;  3KBT A;  4DO0 A;  1FIO A;  5EZY E;  5LYJ E;  2WU2 A;  3UUX B;  2WBL A;  3JCF A;  3ZC1 A;  2E9X B;  3MXZ A;  5LB7 B;  5FXX A;  3KV5 A;  4H9Q C;  2D0T A;  2V6X A;  2Z6E A;  5CA1 E;  3PUS A;  4PJM A;  5HEU A;  5AQI B;  4DID B;  3M3Z B;  1WCR A;  3RGL A;  5E0O A;  2BVL A;  4JI2 T;  5HCM A;  2ZM6 T;  2V1D B;  1M62 A;  3HA4 A;  4DR2 T;  4JYA T;  4UVC B;  4ZS2 A; 
#chains in the Genus database with same CATH homology
 2QGS A;  5EK2 A;  3C4Z A;  5LGT B;  4EZ4 A;  3ZLI A;  2JMK A;  5L3F B;  4WBO A;  4CXX A;  1IAP A;  3F31 A;  1YKH B;  4HE8 A;  4TZ4 C;  4B6X A;  1UX5 A;  3GA8 A;  4AKG A;  5JDM A;  4FI5 A;  3RRC A;  3K8P C;  2XAF B;  2Y48 B;  4UEL A;  2X9W A;  2CMR A;  5LJM A;  4EYY R;  3ZCI A;  5LHH B;  3CQC B;  2L8K A;  3ANW B;  3AB3 B;  2NOX A;  3TKL B;  3OYX A;  4AQF C;  5GON E;  3BQK A;  3N9N A;  4HN9 A;  3IBP A;  1U4Q A;  4QKN A;  1FMW A;  3CWZ B;  4V1A v;  1LVF A;  2N1G A;  2Q9Q D;  3AVS A;  4ZS3 A;  4F6R C;  5A1L A;  3IEE A;  5LGU B;  1NWM X;  2KMF A;  3FHN A;  3DP7 A;  2JQQ A;  4PK4 A;  3Q5X A;  3U3I A;  4TV8 E;  2IW5 B;  1SA0 E;  2DHR A;  2KLQ A;  2N2N A;  5J2U E;  5JRE A;  3I0O A;  1YKE B;  1G8X A;  1WLX A;  2G0U A;  3E22 E;  3PDY A;  3RYC E;  3W15 B;  4AI6 A;  3RPU A;  2ACX A;  3C4X A;  4UV9 B;  3BK9 A;  4PNI A;  2VB6 A;  3CVR A;  4EIW A;  4IDZ A;  3LJC A;  2D2S A;  3HKD E;  5AFU L;  4GYS A;  3VKH A;  3K3Q C;  1ZKE A;  2BVM A;  2CE7 A;  2HPJ A;  4G63 A;  4NUV A;  3MZK B;  4CXY A;  3GWH A;  4QXC B;  4OHF A;  2A72 A;  4OFZ A;  3EDU A;  3GMI A;  2LM9 A;  4BJM A;  4MAL A;  5IHY A;  3KV4 A;  1WYB A;  3V5U A;  4E7Z A;  3MA9 A;  4O4L E;  1HG5 A;  2NW9 A;  3LK4 2;  2X9Y A;  2YU2 A;  3K3O A;  3ZCJ A;  3UT5 E;  2MTQ A;  2EHO B;  3C4W A;  2ODU A;  3N9P A;  3N2K E;  1MNE A;  4CZZ B;  3LK2 B;  1S35 A;  4UEM A;  1LKX A;  5M4Y A;  2XAH B;  4H9O C;  4WNK A;  1MMD A;  2PG8 A;  4O4I E;  2E9X D;  4UXN B;  5FYM A;  3ZMU B;  1WRD A;  3ANW A;  3SOL A;  4HFV A;  4X1K E;  1HF8 A;  3B57 A;  4TX5 A;  4EB6 E;  1B7T A;  3FXD B;  3FXE B;  3ZC0 A;  5LP6 E;  4H9N C;  2ZM0 A;  4ZI3 D;  3AA1 B;  2VL8 A;  3SRZ A;  3P8C D;  3KDS E;  3NBX X;  2H7V C;  2W00 A;  1S94 A;  3SS1 A;  5JRC A;  4E7S A;  1AJ3 A;  2C5J A;  4PJJ A;  2PJQ A;  5LNK A;  2W61 A;  3LG7 A;  2IC9 A;  2MOZ A;  4OYJ A;  4XBF B;  5JR9 B;  3RYH E;  2IC6 A;  4MBQ A;  5LBM A;  4C91 A;  3ZN1 B;  5DJQ C;  4EOZ B;  4IE0 A;  2PBI A;  3PUG A;  4AQG A;  2DCF A;  4JUY A;  3C98 B;  3CPZ A;  4QHO A;  2BZB A;  4DBR A;  3RC3 A;  2WWU A;  4AKI A;  5DQV A;  3PTR B;  2WSS V;  4M1P A;  5J2T E;  2EHO A;  3S4U A;  2JPF A;  2H7O A;  4IST A;  3JC6 D;  2HH7 A;  4JLE A;  4HKA A;  4ADZ A;  3LK3 B;  3O9X A;  4P0A A;  2CXD A;  3T8O A;  3P7I A;  3N5L A;  2YU1 A;  4U74 A;  3CQX C;  2ZM2 A;  4DVD A;  1HX8 A;  2ZM8 A;  4PFO A;  5KMG P;  3B13 A;  3F57 A;  5F8P A;  3ZMS B;  5KX5 E;  2NW8 A;  1US7 B;  3CX8 B;  3ZEF B;  3ZMT B;  3ZMZ B;  2YEV C;  4TUY E;  1MMN A;  1HS7 A;  3ZJ2 A;  2NWB A;  2KND A;  4IIJ E;  1WYC A;  3Q2M A;  3QC9 A;  5LOV E;  1MMG A;  3ZPO A;  1Z0P A;  1D0Z A;  3NRY A;  1D1B A;  3AA7 B;  5JR9 A;  4ILU A;  4ZI2 D;  2E9X A;  3VU7 H;  5FXV A;  4Z8X A;  2H3R A;  4PK6 A;  4EZH A;  1NAF A;  4G2A A;  4UVA B;  4YLH A;  3WAJ A;  2V7J A;  2IAK A;  4OK0 A;  3KV6 A;  1HG2 A;  3I9Y A;  3KIN B;  5HXC A;  5HWY A;  4DMW A;  4I55 E;  2DWG A;  5LG4 A;  3I9W A;  3VKG A;  1BR4 A;  2MYS A;  4TN7 B;  4X20 E;  2LHN A;  4X1Y E;  4PAG A;  5L3D B;  4CI2 B;  2EHO D;  4GIW A;  4O4J E;  4IGU A;  2K24 A;  2XUE A;  4QWN B;  3V5S A;  1O3X A;  5HYA A;  4P0B A;  4UIG A;  3ZYM A;  2X0L B;  2KT9 A;  4I4T E;  2DLR A;  1KK7 A;  4ZI7 E;  3PE0 A;  2JRK A;  2KWH A;  4AKL A;  5JVD E;  2K48 A;  2M67 A;  2LSG A;  4CQI A;  1HTJ F;  2V7K A;  4CXW A;  5ADX L;  2KZ7 B;  3BQL A;  4CI1 B;  5DQW A;  4QX7 B;  2LHR A;  1BR0 A;  3KFW X;  4MFR A;  2V7L A;  3AA6 B;  4QXH B;  3N9L A;  3KBU A;  3ZJ1 A;  4I50 E;  3GN5 B;  3ONX A;  3UUN A;  2LEH A;  3UUL A;  5L3B B;  5BMV E;  2SPC A;  4QX8 B;  4J2C A;  5CA0 E;  4GYR A;  3N9O A;  2OA5 A;  3LFM A;  3K3N A;  3QK6 A;  1UX4 A;  3WI3 A;  1FEW A;  3N9Q A;  2C5I T;  4AKR B;  2NTY A;  3KV9 A;  2CEA A;  2DWK A;  2V7M A;  2WMN A;  1IJ6 A;  1D1A A;  3ZYK A;  2JMH A;  2Q9Q C;  4HEA A;  3MAC A;  4EAH A;  4O2A E;  4P09 A;  3L3P A;  2VAS A;  3ZN0 B;  5FXW A;  5KDM C;  1MIY A;  4NUU A;  1IZN B;  5FXZ A;  3C64 A;  3OJA A;  1D0X A;  2E8I A;  3AVR A;  2Y8D A;  3HKE E;  2V26 A;  4O8S A;  2UXN B;  4ERR A;  5JH7 E;  5J1G A;  4CI3 B;  4UVB B;  2EHO C;  3Q9D A;  3ZYL A;  2RA1 A;  3FBL A;  3AAA B;  3OKQ A;  2CCQ A;  3WAK A;  2CA5 A;  1MMA A;  5LXT E;  5ETW A;  4TV9 E;  5L2L A;  4GOU A;  5FP3 A;  3U78 A;  1MIW A;  1ZHC A;  2XAG B;  2I59 A;  3N2G E;  3O4X E;  1LRZ A;  2CWY A;  4BAY B;  4IE4 A;  2DI4 A;  3N2O A;  3HR0 A;  4IE6 A;  5FY1 A;  1Y64 B;  3ETU A;  2LSY A;  3M65 A;  4O4H E;  3GN5 A;  1LVK A;  2NTX A;  1ZEE A;  4KMC A;  2X9X A;  3AAI A;  3O1J A;  2C5K T;  2XAS B;  3SWH A;  1HCI A;  4ZOL E;  2MBG A;  1BR2 A;  2P9B A;  3DJB A;  2LT3 A;  2W62 A;  2X67 A;  3MJX A;  4EYU A;  3RH3 A;  3ETV A;  5C8Y E;  4JEH B;  4UF0 B;  3C51 A;  2VKJ A;  2LSI A;  2CM0 A;  2CXF A;  2L3L A;  2WMO A;  4QXB B;  5JDN A;  4C90 A;  4L0R A;  3NRX A;  5HXH A;  3D0T A;  3VHL A;  4YJ3 E;  2VKD A;  2X68 A;  3H37 A;  2E9X C;  2LJL A;  2B1E A;  4L5G A;  4ZHQ E;  5HXS A;  2LE8 A;  3CQG B;  3CX7 B;  4X1I E;  5JDQ A;  2A3D A;  1EZ3 A;  4L9I A;  3HL6 A;  1UCU A;  1D0Y A;  4H9R C;  3QUJ A;  3FB2 A;  4ZI3 C;  3ZMV B;  2XQY A;  2KIN B;  4YJ2 E;  1G73 A;  3UTK A;  1WR6 A;  2ZLY A;  3MKD A;  5CB4 E;  1X79 A;  3EDV A;  3CML A;  2J1D G;  2WM9 A;  4HTE A;  4K0U A;  3L09 A;  2VWA A;  4HGA A;  3CKD A;  5TAO A;  3N9M A;  5FY0 A;  2ES0 A;  2DNX A;  2K9A A;  4IHJ E;  2XAJ B;  4XAX B;  1V9D A;  3H3A A;  1YD8 G;  3I1A A;  4UV8 B;  2CLY C;  5HXR A;  2W0G A;  3PU8 A;  4OYK A;  1E1H B;  5EK3 A;  4H9S E;  4EXT A;  2K5B B;  5EK4 A;  4DMV A;  4ASK A;  5LJN A;  4KUM B;  2YK0 A;  3EVY A;  5LGN B;  1VOM A;  4I43 B;  4FJO A;  4UF0 A;  2GK9 A;  2JJ9 A;  4JEU B;  5LCY A;  2RP4 A;  3JC6 C;  3ESL A;  5FNV E;  3E08 A;  3AAE B;  4PJN A;  1MND A;  3CX6 B;  5HAX A;  5LHG B;  3J7Y q;  1YW0 A;  2V7I A;  3RC8 A;  1VRB A;  1HFA A;  2X9H A;  4DND A;  3PU3 A;  3LBX B;  5JRC B;  4WW0 A;  3OBV E;  3NZQ A;  4KP3 C;  2PFV A;  3MK7 C;  4GK0 E;  4AKH A;  5HWX A;  4GK5 E;  4DBQ A;  1KNZ A;  2KXP B;  2C0S A;  3FBZ A;  2A2F X;  4AQF A;  3J9X 1;  2CXL A;  5JDG A;  5L3G B;  4ISS A;  4YFS A;  5FMN A;  5LBQ B;  2YIN A;  5F3J A;  1IJ5 A;  3C50 A;  2ODV A;  3HKC E;  1OWA A;  4O2B E;  2Q9Q B;  4KBM B;  4PFP A;  2VKH A;  4U72 A;  2UXX B;  4ZI2 C;  5LHI B;  4PJL A;  2XAQ B;  2XTL A;  3O1H A;  4PK5 A;  3HI2 A;  3NZP A;  3I0Q A;  2Y6X A;  1H7C A;  4H9P C;  3KVA A;  3IHR A;  2XHE B;  1T98 A;  4IE5 A;  4PW8 A;  2BDE A;  3RYF E;  2ZMA A;  4MLK A;  3RKO A;  2CWO A;  3A5X A;  3OYZ A;  2X66 A;  4ANJ A;  1QUU A;  3EUH A;  5L3C B;  3R6N A;  3AA0 B;  1QSD A;  1ZV4 X;  1MIV A;  2D0U A;  2QA7 A;  3E0Z A;  4MHC A;  3HKB E;  1FMV A;  4BA9 A;  2LOS A;  5JDH A;  5H6Q B;  1CUN A;  5IYZ E;  3PUQ A;  1SHZ C;  3PUA A;  2LSK A;  3KBT A;  4DO0 A;  3RX6 A;  3LBX A;  2KWI B;  4IE7 A;  2LOP A;  1FIO A;  2X51 A;  5H6R B;  5EZY E;  4YHJ A;  5LYJ E;  4H63 H;  3KVB A;  2VKO A;  1OXZ A;  3UUX B;  4H63 V;  2WBL A;  4A56 A;  1BR1 A;  3R84 B;  3PUR A;  3O1I A;  5HXE A;  5L3E B;  3ZC1 A;  2E9X B;  3IF8 B;  3MXZ A;  3UFE A;  5LA6 E;  5FY7 A;  2HPL A;  5FXX A;  3KV5 A;  4H9Q C;  2Q9Q A;  2D0T A;  2NP9 A;  2Z6E A;  5CA1 E;  5JR9 C;  4WBN E;  3PUS A;  3BQI A;  2WAU A;  3Q5W A;  4PJM A;  3DTO A;  1D1C A;  2N9D A;  5JDF A;  5E0O A;  2BVL A;  3RRW A;  4AXP A;  1U5P A;  5JQG E;  3UUM A;  2NW7 A;  2VK9 A;  4N78 D;  2L9Q A;  2V1D B;  3HA4 A;  5DAB A;  5JDL A;  4BJN A;  2D5U A;  4XZC A;  2CLY B;  3RYI E;  3F2E A;  2W63 A;  4UVC B;  4ZS2 A;  2LSJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...