2L8KA

Nmr structure of the arterivirus nonstructural protein 7 alpha (nsp7 alpha)
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
123
structure length
123
Chain Sequence
GLTATLAALTDDDFQFLSDVLDCRAVRSAMNLRAALTSFQVAQYRNILNASLQVDRDAARSRRLMAKLADFAVEQEVTAGDRVVVIDGLDRMAHFKDDLVLVPLTTKVVGGSRCTICDVVKEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and Genetic Analysis of the Arterivirus Nonstructural Protein 7{alpha}.
pubmed doi rcsb
source organism Equine arteritis virus
molecule tags Viral protein
molecule keywords Non-structural protein 7
total genus 28
structure length 123
sequence length 123
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2011-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16749 Arteri_nsp7a Arterivirus nonstructural protein 7 alpha
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.950 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2l8kA00
2L8KA
chains in the Genus database with same CATH superfamily
3CIRA 3EDUA 2NW9A 2M6IA 2MYSA 2ODVA 1ZV4X 2VKDA 3AAIA 3O1IA 5JR9C 1E2AA 2EHOA 2K9AA 5JDFA 5JREA 4XAXB 5HXEA 1T98A 4IE4A 4I4TE 2L8KA 2QA7A 1FMVA 1SHZC 3PJAJ 4U7IA 3AE1A 3L09A 3LBXB 2I6HA 4P0BA 1UGOA 5CB4E 2A72A 2H7VC 2YK0A 3K3QC 3KINB 2LM9A 1MIWA 3OPCA 4EOZB 2XQ4A 4IGUA 4QH1A 5IYZE 5LA6E 3KBTA 2Z6EA 3ZSSA 4LFBT 2DWKA 5F5WA 4YXDA 3BK9A 3AEBA 4WZXA 1N36T 3QC9A 5J2TE 2VVNA 2WY2A 2W62A 4JI1T 4TZ4C 2WU5A 1I6ZA 4V1Av 3OBVE 4P0AA 2HHHT 3MKDA 3IEEA 2DHRA 4DV2T 1UURA 3AEDA 3J7Yq 3QNUA 2WWVA 5ETWA 4EXTA 2AE9A 1XMQT 1HS7A 3FZKB 2YDSA 4TWDA 1ZKEA 3QB5K 3FBZA 2WDRA 3KV4A 4FJOA 5AQNB 2MPKA 4YJ3E 2UUBT 5L3CB 1U4QA 2XUEA 2XQ8A 4M1PA 4KHPT 2X0LB 3AE4A 4H9OC 3HI2A 1T72A 1MMNA 1UCUA 3G06A 3ZMTB 2CCQA 1UK5A 5M4YA 3RF1A 4KHZF 4B3ST 3AE3A 2VWAA 3TLVA 5AQKB 3P8CD 4QHOA 3N5LA 2VASA 3P4WA 4G63A 4Q25A 3H37A 5C2TA 4X1YE 2LSKA 1HNZT 4O4LE 4ZZBA 1D0XA 4MLKA 4ISSA 2HPLA 3ONJA 2CBJA 4GK0E 5FL0A 2NW7A 4U33A 4BJMA 5EK3A 2UUCT 2ACZA 2FUPA 4TNVA 1WYBA 2JQKA 2IHR1 2VKOA 2K48A 2YU2A 2WQYA 4IHJE 2JMKA 3JC6C 2VL8A 5FVKA 3SRZA 2D0UA 1EZ3A 2K5BB 4FI5A 2C5KT 4IL4A 4YFSA 3B57A 5AQJB 5FYMA 4DMVA 4ZI2D 1S35A 5LBMA 4CN4A 5LJNA 4YTPA 3RQWA 4DV0T 4HFHA 4HGAA 4AKRB 4K0UA 1N33T 3BQKA 3K8PC 3PUZF 2NTYA 4O4JE 5HEJA 3RYFE 4AI6A 2C5IT 4QWNB 5A1LA 1NWMX 2WB5A 2JIWA 3ZT6A 1OEDA 1UX5A 2Q9QB 2X9WA 5L4HA 5JDHA 4JI6T 1KNRA 2JJ9A 2A3DA 2BS2A 3SWHA 3ZC1A 2LSJA 4MHCA 2X68A 2XJ7A 3MXZA 3PUYF 5BMVE 3P4SA 4F8HA 3RIFA 1S94A 2EHOC 3SS1A 2R6GF 4P09A 3F57A 3KV9A 2E9XC 2W2UA 3Q5XA 4IE7A 2ZM8A 4JLEA 4YHJA 3PUXF 3RKGA 4C90A 5BR8T 1Z8UA 3ETUA 1YQ4A 4H9NC 3Q9DA 2V7MA 3HKBE 4YHHT 4DV6T 5KXJA 1QUUA 5EK4A 4PK5A 3ZLIA 3TLWA 4GKJT 4QKNA 2YDQA 1MNEA 5FY1A 1BR4A 2CWYA 3ZSTA 4EV6A 1GQEA 2IAKA 4UF0B 3AA7B 5FVLA 3ZN0B 4DR7T 1HG5A 4HN9A 2Q9QC 4IDOA 4NUUA 5FY7A 5HWYA 1I94T 3E08A 4JI3T 1JNRA 5FY0A 2LOSA 3P4QA 2C5JA 2WDVA 1HR0T 3QOFA 2KZ7B 3KVBA 3MA9A 4HFIA 4CXYA 5FXXA 3UU4A 1MIVA 1FIOA 5JRCA 3S4UA 4PK6A 4UVBB 3AA6B 3UT5E 2EHOB 1MIYA 1MNDA 3PU8A 4AQFC 5KMGP 3SFDA 5JDQA 5JRCB 2OLTA 3AVSA 3N2OA 2L9QA 3PUGA 4TV9E 5LHHB 4LMJA 4EZHA 2XAFB 4EGWA 2OA5A 2UXXB 2Y6XA 2LE8A 4H9RC 2XAQB 4HWIB 4KX6A 4TX5A 5AQHB 3RRWA 2VL0A 3ZYKA 4H9QC 1IJ5A 3SFEA 4PW8A 2CXLA 3RIUA 5AQSB 1L0VA 3VR9A 4U7YA 5AQFB 3FXEB 4IDNA 3VKHA 1HNWT 4DR6T 2BVMA 2ZMAA 5JTGA 4MFRA 2ACXA 4KUMB 1HX8A 3K1SA 5DJQC 1US7B 4IE6A 4LF8T 4AQFA 3N9MA 3WI3A 1XZYA 3PE0A 5L3GB 4EAHA 2KLQA 3O4XE 2IIUA 3JC6D 3PV0F 4QH4A 3P50A 3ZPOA 4DUYT 4Z90A 2BS3A 2NOXA 1W9RA 2UXDT 1KK7A 3OYZA 1KNPA 5HEHA 3UTKA 2JQ9A 2X0HA 3M65A 1X9BA 4AKGA 5AQLB 1YQ3A 3P7IA 5LMUT 1VCTA 2XQ6A 5JDNA 2JQHA 5HXRA 2V7JA 3I9YA 4X66T 4LF6T 2VB6A 4ZHQE 3ZYMA 4JI7T 3K3OA 3ZC0A 5L2LA 2GK9A 2QYWA 4HFEA 3R84B 3N2GE 4CXXA 2IC6A 3V5SA 5FXZA 3AE9A 4IDZA 1KFYA 3AXJB 2YDRA 4MBQA 4UVCB 1ZP0A 4H63H 1OXZA 2H7OA 3FZFB 3KFWX 1VRBA 3MJXA 4OK0A 4Z91A 3U78A 4TUYE 4K0KT 3KVAA 1E1HB 3HKEE 1LVFA 5DQWA 2H3RA 1IBMT 3JCFA 3B13A 4DBQA 3RX6A 2CWOA 4BAYB 4JI0T 2C0SA 3PU3A 3UUNA 4LF7T 1J5WA 2CA5A 2FJEA 2J47A 4LMLA 4NIQA 4A56A 3UQ7A 2YOEA 4B6XA 5FXVA 3V5UA 4LFAT 4NXMT 1XNQT 2BDEA 2V6YB 3IHRA 4IDQA 4EYYR 5FL1A 3J9X1 2N9DA 3DP7A 3N9PA 2E9XA 5C3JA 3PUSA 3N2KE 2PBIA 2LT3A 4UIGA 3ZMVB 2E2AA 2BKPA 1HF8A 3WAJA 4OX9T 3I0QA 5FMNA 2IMLA 1BR1A 3HR0A 1VCSA 3LDQB 3CPZA 3RH3A 3AEGA 3NKZA 1BR0A 2WSSV 4QXHB 1OEDC 2E5LT 2W67A 4PJJA 4U2ZA 3FZLB 3EUHA 2HPJA 2XQAA 3CQGB 3ZCJA 5JH7E 2BS4A 4PJNA 5LHGB 1O3XA 2J62A 2M67A 1G73A 1T8BA 3CX6B 4O4IE 3X1DA 5ABFA 2DCFA 5F3JA 2WP9A 2YEVC 3IBPA 3NVOA 5LB7B 3L39A 1W0BA 2JQQA 3O9XA 3OJAA 4L9IA 4B3RT 2CLYB 2XM2A 2YU1A 2HN2A 4TWHA 3U3IA 4NUVA 2D2SA 2XM1A 2D0TA 3UU6A 1WYCA 3FZMB 4XBFB 5KDMC 2WZHA 2BG9A 3ETVA 1T7SA 1CHUA 1LKXA 2KWHA 2LKHA 2I0MA 3MACA 1BR2A 4LFCT 1FEWA 1G8XA 1YKEB 3ANWA 5LYJE 3N9QA 1J5ET 1B7TA 4WNKA 5LCYA 4A98A 3UUMA 3NWIA 2VURA 3QK6A 4GYSA 2MAWA 5CGMA 1QSDA 3AAEB 3KDSE 4MALA 3RC8A 4EB6E 2X66A 3ZJ1A 4AISA 5EK2A 2RPAA 4DR5T 5HEUA 3C4ZA 4QH5A 1M7KA 3NBXX 2VK9A 2DLRA 2IC9A 4N78D 3AEFA 4QX7B 3TLUA 3C4WA 3CQCB 4P1NA 5HAXA 3I9WA 1N34T 2LSIA 3RI5A 3F31A 3MK7C 3N9NA 3AVRA 4GKKT 2WWUA 2V6XA 1WCRA 1Y01A 3EAMA 3H3MA 3ZMUB 4GOUA 2K3WA 3KV5A 2IUBA 2W00A 5HCMA 5LBQB 4ILUA 4ILBA 1V9DA 3ZN1B 1AJ3A 4IE0A 4X65T 3HL6A 3OKQA 4HE8A 2NP9A 4EIWA 2N2NA 5LG4A 2V26A 3N9LA 4X20E 4J2CA 3BQIA 4H9SE 4DV1T 4QXBB 2XQYA 4ZXLA 5L3BB 4LF5T 5AQVB 3C50A 5JVDE 4EYUA 1QLBA 4JEUB 1SUMB 3A8YC 3AEAA 5AQUB 2D5UA 4WBOA 3C4XA 3ESLA 4HWCA 4A5XA 2MBGA 2HH7A 2XY8B 2LRLA 2XSAA 4DR1T 1CUNA 2ODUA 5HXHA 2KINB 2XZEA 3RIAA 3Q2MA 5HEGA 4HFVA 3GN5A 4I55E 3IA3A 4AQGA 4AKIA 3E22E 4HWFA 4JI5T 4YSYA 1OEDB 3AE7A 2CM0A 3AE2A 3VHLA 1IAPA 1UUSA 4DO0A 3ZEFB 1H7CA 3T8OA 2LM2A 2LJLA 2W66A 5JDLA 4H63V 3LG7A 3NRXA 3DTOA 4CZZB 4I43B 2ZM6T 2G0UA 2CHOA 4I0UA 4JBWF 3M3ZB 3H3AA 1YW0A 4IDPA 2XASB 5H6QB 4U74A 1OEDE 3AB3B 3QUJA 3ZYLA 4Z8XA 2CHNA 4WW0A 3VKGA 4O8SA 4ANJA 3EHZA 3FXDB 3JAFA 2KSRA 4DVDA 3EDVA 5ABGA 4PFPA 3GA8A 3RYHE 3VR8A 2UXCT 4HTEA 2XAJB 1XDPA 3EI0A 4HFDA 2I59A 2X9YA 4OYJA 5L3EB 4E7SA 5J0ZA 2W63A 2V8SV 3HKCE 3RHWA 4BJNA 2PG8A 4CI3B 1YD8G 2VQET 4ERRA 1X79A 1E7PA 4IE5A 1J1JA 1M62A 2FJAA 5CFBA 2V1DB 5L3FB 3O1JA 3BQLA 1OWAA 4PJLA 4YT0A 2W4XA 2YKSA 4WBNE 5CA0E 2V5CA 2N1GA 2QRXA 2E9XB 4OFZA 5HCJA 4ZI7E 5E0OA 4YLHA 3RYCE 3UULA 4AKHA 2W61A 2BKNA 3NZQA 5IHYA 2XQ9A 4YY3T 4U72A 5CJ5A 4JV5T 2BG9B 2X0YA 1XWMA 4GK5E 5CA1E 2LHRA 2B76A 2X9HA 2X51A 4DIDB 3NZPA 4EEDA 2CMRA 2BBJA 3CKDA 4IT4A 4UF0A 3VU7H 2LHNA 2XQ5A 2M6BA 4KMCA 3AA0B 4ILCA 2UXNB 4ISTA 1SA0E 4UXNB 4ASKA 3FZHB 3CX8B 3LK3B 1Y64B 1D0YA 3LFMA 1XMOT 2UU9T 4OYKA 2FJBA 3AECA 3HA4A 3AA1B 1MMGA 4DV3T 4HWHA 3EVYA 2PFVA 2VVSA 3AE5A 5L4EA 1D1AA 3PUWF 2CE7A 2XHEB 4DUZT 4CI2B 4YSXA 5JQGE 4ZI3C 3Q5WA 3L8RA 2CRBA 2KMFA 3GN5B 4CN1A 4LF4T 4DBRA 2XQ7A 2LKGA 2P9BA 3D0TA 4OHFA 3IF8B 2LSGA 1FMWA 4PK4A 4C91A 3Q5EA 1WLXA 1ZEEA 5HXCA 2NR4A 3ONLC 5DABA 2Q9QA 2PJQA 3CVRA 3GMIA 3R6NA 4JI8T 4NXNT 3PUAA 4UR9A 2E5VA 5GONE 2L3LA 4ADZA 5HWXA 4ZEYA 2WDQA 1IBKT 4JI4T 2NW8A 3JADA 5AFUL 4X64T 4YTNA 2WMOA 4ILAA 2WU2A 4EZ4A 2XPKA 3ABVA 3AE6A 3GWHA 3PURA 2BG9E 2QVAA 2F4VT 3RRCA 5JDMA 1W0AA 2J4GA 5AQPB 2FJDA 1D1CA 1IZNB 2SPCA 1DU2A 4HFBA 2X9XA 2LRKA 3B5MA 2UXBT 4CQIA 5AQIB 2DWGA 2RA1A 5LXTE 3ZMSB 3RLFF 1UX4A 1VOMA 2KNDA 3FB2A 3N9OA 4QX8B 4TV8E 4TWFA 2A9UA 4YTMA 2JPFA 1WRDA 2JRKA 5HXSA 2CEAA 4B3MT 5LNKA 5IWAT 2XQ3A 2NTXA 2V7KA 2V7LA 2LOPA 5ABHA 3VRBA 5LGNB 1LRZA 3JAEA 3RKOA 4CI1B 1NEKA 5LJMA 1Z0PA 5J2UE 5FXWA 4O2BE 5ADXL 4AQYT 3L3PA 4DV4T 4HFCA 5KX5E 3KBUA 3AXJA 3T1HT 2A2FX 4L5GA 1HX1B 2Y48B 4PNIA 2WBLA 4U2YA 3TLSA 3C64A 3O1HA 3ZCIA 2ES0A 4LMKA 4KBMB 5EZYE 4PAGA 2AXDS 5HEOA 5LGTB 1MMAA 2ZM0A 5AQOB 1HG2A 4ZS2A 3UUXB 4ZI2C 2RP4A 4QXCB 3CWZB 2YN6A 4JI2T 3TLTA 5L47A 4ZZCA 4CN6A 4LF9T 2UUAT 2E8IA 2V5DA 2NWBA 1D0ZA 3RQUA 2J1DG 4NPPA 3ZMZB 3AAAB 4TN7B 4I50E 4X1KE 3SOLA 4DNDA 1XDOA 2IW5B 3RGLA 2W0GA 2CPTA 1NENA 3AEEA 5TAOA 3OTOT 2DNXA 2V7IA 4CXWA 2CXDA 1HNXT 4ZOLE 2WAUA 4O4HE 3UUBA 4UEMA 2YINA 3DJBA 4L0RA 3A5XA 2X67A 4TNWA 4KP3C 3C51A 1ZOYA 4O2AE 4KI0F 3ONXA 3RIUC 3P4PA 5LP6E 1U5PA 5AQMB 1JNZA 1HCIA 2LLYA 3LK2B 4PFOA 2BVLA 4X1IE 2PTFA 3LSVA 5AQRB 4YSZA 5ABFB 3W15B 5IUXA 2KXPB 2XAGB 3CMLA 3I1AA 4ZS3A 4YJ2E 2VQFT 1YXRA 2KT9A 2K24A 2LSYA 1HFAA 1KF6A 2BG9C 2BZBA 2IDOB 4HWDA 4IL9A 2B1EA 1IJ6A 3AE8A 1NAFA 3UU3A 5HYAA 3E0ZA 2LEHA 5C8YE 2WCAA 1D1BA 1YKHB 4DV7T 3ZT7A 2Q9QD 1R8IA 3UU5A 2XTLA 2EHOD 3KV6A 5AQQB 5FP3A 3TKLB 4JYAT 1ZHCA 3CK6A 3PUVF 4IIJE 5J1GA 5H6RB 3UFGA 2H88A 4AKLA 4DR3T 2JMHA 2XSBA 4EEBA 2WM9A 3MZKB 3RC3A 4ZI3D 2MTQA 2WZIA 3LJCA 4X62T 1FJGT 2D9DA 4COFA 1XNRT 1LVKA 3A7MA 3CQXC 2VKHA 2BBHA 3LBXA 3OVUA 3C98B 3PTRB 4G2AA 4PJMA 4UELA 4AIUA 4DMWA 1KNZA 4AXPA 3ZKRA 3P4RA 3UQ4A 4DR2T 3CX7B 2V6YA 4U31A 3PUQA 4JEHB 4JUYA 5AQTB 4X5TA 4F6RC 5FNVE 3LK42 2CXFA 2XAHB 4UV9B 2FBWA 5LOVE 5JR9B 3UU8A 3RYIE 3FBLA 3ANWB 4WYVA 3PJAA 5DQVA 5LMNT 1SE7A 3T1YT 2VKJA 4UV8B 5F8PA 3Q5DA 4U3CA 4H9PC 3RPUA 3VRAA 3ZT5A 3NRYA 5JDGA 4DR4T 2OV9A 2ZLYA 1N32T 1MMDA 1WR6A 1WFDA 2CBIA 3OYXA 3F2EA 3QB5A 4XZCA 5LG3A 1IBLT 2ZM2A 2HN1A 4UVAB 2E9XD 3WAKA 4A97A 4DV5T 2Y8DA 2H89A 2MOZA 3HKDE 5LHIB 2WS3A 1KEYA 5FKYA 2BKOA 1WR0A 2DI4A 5L3DB 3PDYA 3ZJ2A 5ABEA 1HTJF 4HKAA 3EABA 3UFEA 4B3TT 4HEAA 4BA9A 5LGUB 2QGSA 3K3NA 4IREA 2CLYC 3FHNA 1W09A 4GIWA 5AQGB 2KWIB 3I0OA 2WMNA 2DL1A 4E7ZA 4GYRA 5JR9A
chains in the Genus database with same CATH topology
3EDUA 2NW9A 2MYSA 2ODVA 1ZV4X 2VKDA 3AAIA 3O1IA 5JR9C 2EHOA 2K9AA 5JDFA 5JREA 4XAXB 5HXEA 1T98A 4IE4A 4I4TE 2L8KA 2QA7A 1FMVA 1SHZC 3L09A 3LBXB 4P0BA 5CB4E 2A72A 2H7VC 2YK0A 3K3QC 3KINB 2LM9A 1MIWA 4EOZB 4IGUA 5IYZE 5LA6E 3KBTA 2Z6EA 2DWKA 3BK9A 3QC9A 5J2TE 2W62A 4TZ4C 4V1Av 3OBVE 4P0AA 3MKDA 3IEEA 2DHRA 3J7Yq 4EXTA 5ETWA 1HS7A 1ZKEA 3FBZA 4FJOA 4YJ3E 5L3CB 1U4QA 2XUEA 4M1PA 2X0LB 4H9OC 3HI2A 1MMNA 1UCUA 3ZMTB 2CCQA 2VWAA 3P8CD 4QHOA 3N5LA 2VASA 4G63A 3H37A 4X1YE 2LSKA 4O4LE 1D0XA 4MLKA 4ISSA 2HPLA 4GK0E 2NW7A 4BJMA 5EK3A 1WYBA 2VKOA 4AQFA 2K48A 2YU2A 4IHJE 3SRZA 2JMKA 3JC6C 2VL8A 5M4YA 2D0UA 1EZ3A 2K5BB 4FI5A 2C5KT 4YFSA 5FYMA 3B57A 4DMVA 4ZI2D 1S35A 5LBMA 5LJNA 4HGAA 4AKRB 4K0UA 3BQKA 3K8PC 2NTYA 4O4JE 3RYFE 4AI6A 2C5IT 4QWNB 5A1LA 1NWMX 5JDHA 1UX5A 2Q9QB 2X9WA 2JJ9A 2A3DA 3SWHA 3ZC1A 2LSJA 4MHCA 2X68A 3MXZA 5BMVE 1S94A 2EHOC 3SS1A 4P09A 3F57A 3KV9A 2E9XC 4IE7A 3Q5XA 4JLEA 2ZM8A 4YHJA 4C90A 3ETUA 4H9NC 3Q9DA 2V7MA 3HKBE 1QUUA 5EK4A 4PK5A 3ZLIA 4QKNA 5FY1A 1MNEA 1BR4A 2CWYA 4UF0B 2IAKA 3AA7B 3ZN0B 1HG5A 4HN9A 2Q9QC 5FY7A 4NUUA 5HWYA 3E08A 5FY0A 2LOSA 2C5JA 2KZ7B 3KVBA 3MA9A 4CXYA 5FXXA 1MIVA 1FIOA 5JRCA 3S4UA 4PK6A 4UVBB 3AA6B 3UT5E 2EHOB 1MIYA 1MNDA 3PU8A 4AQFC 5KMGP 5JDQA 5JRCB 3AVSA 3N2OA 2L9QA 3PUGA 4TV9E 5LHHB 4EZHA 2XAFB 2OA5A 2UXXB 2Y6XA 2LE8A 4H9RC 2XAQB 4TX5A 3RRWA 5L3FB 3ZYKA 4H9QC 1IJ5A 4PW8A 2CXLA 3FXEB 3VKHA 2BVMA 2ZMAA 4MFRA 2ACXA 4KUMB 1HX8A 5DJQC 1US7B 4IE6A 5L3GB 3N9MA 3WI3A 3PE0A 4EAHA 2KLQA 3O4XE 3ZPOA 3JC6D 2NOXA 1KK7A 3OYZA 3UTKA 3M65A 4AKGA 3P7IA 5JDNA 5HXRA 2V7JA 3I9YA 2VB6A 4ZHQE 3ZYMA 3K3OA 3ZC0A 5L2LA 2GK9A 3R84B 3N2GE 4CXXA 2IC6A 3V5SA 5FXZA 4IDZA 4UVCB 4MBQA 4H63H 1OXZA 2H7OA 3KFWX 3MJXA 1VRBA 4OK0A 3U78A 4TUYE 3KVAA 1E1HB 3HKEE 1LVFA 5DQWA 2H3RA 3B13A 4DBQA 3RX6A 2CWOA 4BAYB 2C0SA 3PU3A 3UUNA 2CA5A 4A56A 4B6XA 5FXVA 3V5UA 2BDEA 3IHRA 4EYYR 3J9X1 2N9DA 3DP7A 3N9PA 2E9XA 3PUSA 3N2KE 2PBIA 2LT3A 4UIGA 3ZMVB 1HF8A 3WAJA 3I0QA 5FMNA 1BR1A 3HR0A 3RH3A 3CPZA 1BR0A 2WSSV 4QXHB 4PJJA 3EUHA 2HPJA 5JH7E 3CQGB 3ZCJA 5LHGB 4PJNA 1O3XA 2M67A 1G73A 3CX6B 4O4IE 2DCFA 5F3JA 2YEVC 3IBPA 3O9XA 2JQQA 3OJAA 4L9IA 2CLYB 2YU1A 3U3IA 4NUVA 2D2SA 2D0TA 1WYCA 4XBFB 5KDMC 3ETVA 1LKXA 2KWHA 3MACA 1BR2A 1FEWA 1G8XA 1YKEB 3ANWA 5LYJE 3N9QA 1B7TA 4WNKA 5LCYA 3UUMA 4GYSA 3QK6A 1QSDA 3AAEB 3KDSE 4MALA 4EB6E 2X66A 3ZJ1A 5EK2A 3C4ZA 3NBXX 2VK9A 2DLRA 2IC9A 4N78D 4QX7B 3C4WA 3CQCB 5HAXA 3I9WA 2LSIA 3F31A 3MK7C 3N9NA 3AVRA 2WWUA 3ZMUB 4GOUA 5LBQB 3KV5A 2W00A 4ILUA 1V9DA 3ZN1B 1AJ3A 4IE0A 3HL6A 3OKQA 4HE8A 2NP9A 4EIWA 2N2NA 5LG4A 2V26A 3N9LA 4X20E 4J2CA 3BQIA 4H9SE 4QXBB 2XQYA 5L3BB 3C50A 5JVDE 4EYUA 4JEUB 2D5UA 4WBOA 3C4XA 3ESLA 2MBGA 2HH7A 1CUNA 2ODUA 5HXHA 2KINB 3Q2MA 4HFVA 3GN5A 4I55E 4AQGA 4AKIA 3E22E 2CM0A 3VHLA 1IAPA 4DO0A 3ZEFB 1H7CA 3T8OA 2LJLA 5JDLA 4H63V 3LG7A 3NRXA 3DTOA 4CZZB 4I43B 2G0UA 3H3AA 1YW0A 2XASB 5H6QB 4U74A 3AB3B 3QUJA 3ZYLA 4Z8XA 4WW0A 3VKGA 4O8SA 4ANJA 3FXDB 4DVDA 3EDVA 4PFPA 3GA8A 4HTEA 2XAJB 2I59A 2X9YA 4OYJA 5L3EB 4E7SA 2W63A 3HKCE 4BJNA 2PG8A 4CI3B 1YD8G 4ERRA 1X79A 4IE5A 2V1DB 3O1JA 3BQLA 1OWAA 4PJLA 5CA0E 4WBNE 2N1GA 2E9XB 4OFZA 4ZI7E 5E0OA 4YLHA 3RYCE 3UULA 4AKHA 2W61A 3NZQA 5IHYA 4U72A 4GK5E 5CA1E 2LHRA 2X9HA 2X51A 3NZPA 2CMRA 3CKDA 4UF0A 3VU7H 2LHNA 4KMCA 3AA0B 2UXNB 4ISTA 1SA0E 4UXNB 4ASKA 3CX8B 3LK3B 1Y64B 1D0YA 3LFMA 4OYKA 3HA4A 3AA1B 1MMGA 3EVYA 2PFVA 1D1AA 2CE7A 2XHEB 4CI2B 5JQGE 4ZI3C 3Q5WA 2KMFA 3GN5B 4DBRA 3D0TA 4OHFA 2P9BA 3IF8B 2LSGA 1FMWA 4PK4A 4C91A 1WLXA 1ZEEA 5HXCA 5DABA 2Q9QA 2PJQA 3CVRA 3GMIA 3R6NA 3PUAA 5GONE 2L3LA 4ADZA 5HWXA 2NW8A 5AFUL 2WMOA 4EZ4A 3GWHA 3PURA 3RRCA 5JDMA 1D1CA 1IZNB 2SPCA 2X9XA 4CQIA 2DWGA 2RA1A 5LXTE 3ZMSB 1UX4A 1VOMA 2KNDA 3FB2A 3N9OA 4QX8B 4TV8E 3RYHE 5HXSA 2JPFA 1WRDA 2JRKA 2CEAA 5LNKA 2NTXA 2V7KA 2V7LA 2LOPA 5LGNB 5LJMA 1LRZA 3RKOA 4CI1B 1Z0PA 5J2UE 5FXWA 4O2BE 5ADXL 3L3PA 5KX5E 3KBUA 2A2FX 4L5GA 2Y48B 4PNIA 2WBLA 3C64A 3O1HA 3ZCIA 2ES0A 5EZYE 4KBMB 4PAGA 5LGTB 1MMAA 2ZM0A 1HG2A 4ZS2A 3UUXB 4ZI2C 2RP4A 4QXCB 3CWZB 2E8IA 2NWBA 1D0ZA 2J1DG 3ZMZB 3AAAB 4TN7B 4I50E 4X1KE 3SOLA 4DNDA 2IW5B 2W0GA 5TAOA 2DNXA 2V7IA 4CXWA 2CXDA 4ZOLE 2WAUA 4O4HE 4UEMA 2YINA 3DJBA 4L0RA 3A5XA 2X67A 4KP3C 3C51A 4O2AE 3ONXA 5LP6E 1U5PA 4X1IE 1HCIA 4PFOA 3LK2B 3RC8A 2BVLA 3W15B 2KXPB 2XAGB 3CMLA 3I1AA 4ZS3A 4YJ2E 1HFAA 2K24A 2KT9A 2LSYA 2BZBA 5HYAA 2B1EA 1IJ6A 1NAFA 3E0ZA 2LEHA 5C8YE 1D1BA 1YKHB 2Q9QD 2XTLA 2EHOD 3KV6A 5FP3A 3TKLB 1ZHCA 4IIJE 5J1GA 5H6RB 4AKLA 2JMHA 4ZI3D 2WM9A 3MZKB 3RC3A 2MTQA 3LJCA 1LVKA 3CQXC 2VKHA 3LBXA 3PTRB 4G2AA 3C98B 4UELA 4PJMA 4DMWA 1KNZA 4AXPA 3CX7B 3PUQA 4JEHB 4JUYA 4F6RC 5FNVE 3LK42 2CXFA 2XAHB 4UV9B 5LOVE 5JR9B 3RYIE 3FBLA 3ANWB 5DQVA 2VKJA 4UV8B 5F8PA 4H9PC 3RPUA 5JDGA 3NRYA 2ZLYA 1MMDA 1WR6A 3OYXA 4XZCA 3F2EA 2ZM2A 4UVAB 3WAKA 2E9XD 2Y8DA 2MOZA 3HKDE 5LHIB 2DI4A 5L3DB 3PDYA 3ZJ2A 1HTJF 4HKAA 3UFEA 4HEAA 4BA9A 5LGUB 2QGSA 3K3NA 2CLYC 3FHNA 4GIWA 2KWIB 3I0OA 2WMNA 3KV4A 4E7ZA 4GYRA 5JR9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L8K A; 
#chains in the Genus database with same CATH topology
 3CIR A;  3EDU A;  2NW9 A;  2M6I A;  2MYS A;  2ODV A;  1ZV4 X;  2VKD A;  3AAI A;  3O1I A;  5JR9 C;  1E2A A;  2EHO A;  2K9A A;  5JDF A;  5JRE A;  4XAX B;  5HXE A;  1T98 A;  4IE4 A;  4I4T E;  2L8K A;  2QA7 A;  1FMV A;  1SHZ C;  3PJA J;  4U7I A;  3AE1 A;  3L09 A;  3LBX B;  2I6H A;  4P0B A;  1UGO A;  5CB4 E;  2A72 A;  2H7V C;  2YK0 A;  3K3Q C;  3KIN B;  2LM9 A;  1MIW A;  3OPC A;  4EOZ B;  2XQ4 A;  4IGU A;  4QH1 A;  5IYZ E;  5LA6 E;  3KBT A;  2Z6E A;  3ZSS A;  4LFB T;  2DWK A;  5F5W A;  4YXD A;  3BK9 A;  3AEB A;  4WZX A;  1N36 T;  3QC9 A;  5J2T E;  2VVN A;  2WY2 A;  2W62 A;  4JI1 T;  4TZ4 C;  2WU5 A;  1I6Z A;  4V1A v;  3OBV E;  4P0A A;  2HHH T;  3MKD A;  3IEE A;  2DHR A;  4DV2 T;  1UUR A;  3AED A;  3J7Y q;  3QNU A;  2WWV A;  5ETW A;  4EXT A;  2AE9 A;  1XMQ T;  1HS7 A;  3FZK B;  2YDS A;  4TWD A;  1ZKE A;  3QB5 K;  3FBZ A;  2WDR A;  3KV4 A;  4FJO A;  5AQN B;  2MPK A;  4YJ3 E;  2UUB T;  5L3C B;  1U4Q A;  2XUE A;  2XQ8 A;  4M1P A;  4KHP T;  2X0L B;  3AE4 A;  4H9O C;  3HI2 A;  1T72 A;  1MMN A;  1UCU A;  3G06 A;  3ZMT B;  2CCQ A;  1UK5 A;  5M4Y A;  3RF1 A;  4KHZ F;  4B3S T;  3AE3 A;  2VWA A;  3TLV A;  5AQK B;  3P8C D;  4QHO A;  3N5L A;  2VAS A;  3P4W A;  4G63 A;  4Q25 A;  3H37 A;  5C2T A;  4X1Y E;  2LSK A;  1HNZ T;  4O4L E;  4ZZB A;  1D0X A;  4MLK A;  4ISS A;  2HPL A;  3ONJ A;  2CBJ A;  4GK0 E;  5FL0 A;  2NW7 A;  4U33 A;  4BJM A;  5EK3 A;  2UUC T;  2ACZ A;  2FUP A;  4TNV A;  1WYB A;  2JQK A;  2IHR 1;  2VKO A;  2K48 A;  2YU2 A;  2WQY A;  4IHJ E;  2JMK A;  3JC6 C;  2VL8 A;  5FVK A;  3SRZ A;  2D0U A;  1EZ3 A;  2K5B B;  4FI5 A;  2C5K T;  4IL4 A;  4YFS A;  3B57 A;  5AQJ B;  5FYM A;  4DMV A;  4ZI2 D;  1S35 A;  5LBM A;  4CN4 A;  5LJN A;  4YTP A;  3RQW A;  4DV0 T;  4HFH A;  4HGA A;  4AKR B;  4K0U A;  1N33 T;  3BQK A;  3K8P C;  3PUZ F;  2NTY A;  4O4J E;  5HEJ A;  3RYF E;  4AI6 A;  2C5I T;  4QWN B;  5A1L A;  1NWM X;  2WB5 A;  2JIW A;  3ZT6 A;  1OED A;  1UX5 A;  2Q9Q B;  2X9W A;  5L4H A;  5JDH A;  4JI6 T;  1KNR A;  2JJ9 A;  2A3D A;  2BS2 A;  3SWH A;  3ZC1 A;  2LSJ A;  4MHC A;  2X68 A;  2XJ7 A;  3MXZ A;  3PUY F;  5BMV E;  3P4S A;  4F8H A;  3RIF A;  1S94 A;  2EHO C;  3SS1 A;  2R6G F;  4P09 A;  3F57 A;  3KV9 A;  2E9X C;  2W2U A;  3Q5X A;  4IE7 A;  2ZM8 A;  4JLE A;  4YHJ A;  3PUX F;  3RKG A;  4C90 A;  5BR8 T;  1Z8U A;  3ETU A;  1YQ4 A;  4H9N C;  3Q9D A;  2V7M A;  3HKB E;  4YHH T;  4DV6 T;  5KXJ A;  1QUU A;  5EK4 A;  4PK5 A;  3ZLI A;  3TLW A;  4GKJ T;  4QKN A;  2YDQ A;  1MNE A;  5FY1 A;  1BR4 A;  2CWY A;  3ZST A;  4EV6 A;  1GQE A;  2IAK A;  4UF0 B;  3AA7 B;  5FVL A;  3ZN0 B;  4DR7 T;  1HG5 A;  4HN9 A;  2Q9Q C;  4IDO A;  4NUU A;  5FY7 A;  5HWY A;  1I94 T;  3E08 A;  4JI3 T;  1JNR A;  5FY0 A;  2LOS A;  3P4Q A;  2C5J A;  2WDV A;  1HR0 T;  3QOF A;  2KZ7 B;  3KVB A;  3MA9 A;  4HFI A;  4CXY A;  5FXX A;  3UU4 A;  1MIV A;  1FIO A;  5JRC A;  3S4U A;  4PK6 A;  4UVB B;  3AA6 B;  3UT5 E;  2EHO B;  1MIY A;  1MND A;  3PU8 A;  4AQF C;  5KMG P;  3SFD A;  5JDQ A;  5JRC B;  2OLT A;  3AVS A;  3N2O A;  2L9Q A;  3PUG A;  4TV9 E;  5LHH B;  4LMJ A;  4EZH A;  2XAF B;  4EGW A;  2OA5 A;  2UXX B;  2Y6X A;  2LE8 A;  4H9R C;  2XAQ B;  4HWI B;  4KX6 A;  4TX5 A;  5AQH B;  3RRW A;  2VL0 A;  3ZYK A;  4H9Q C;  1IJ5 A;  3SFE A;  4PW8 A;  2CXL A;  3RIU A;  5AQS B;  1L0V A;  3VR9 A;  4U7Y A;  5AQF B;  3FXE B;  4IDN A;  3VKH A;  1HNW T;  4DR6 T;  2BVM A;  2ZMA A;  5JTG A;  4MFR A;  2ACX A;  4KUM B;  1HX8 A;  3K1S A;  5DJQ C;  1US7 B;  4IE6 A;  4LF8 T;  4AQF A;  3N9M A;  3WI3 A;  1XZY A;  3PE0 A;  5L3G B;  4EAH A;  2KLQ A;  3O4X E;  2IIU A;  3JC6 D;  3PV0 F;  4QH4 A;  3P50 A;  3ZPO A;  4DUY T;  4Z90 A;  2BS3 A;  2NOX A;  1W9R A;  2UXD T;  1KK7 A;  3OYZ A;  1KNP A;  5HEH A;  3UTK A;  2JQ9 A;  2X0H A;  3M65 A;  1X9B A;  4AKG A;  5AQL B;  1YQ3 A;  3P7I A;  5LMU T;  1VCT A;  2XQ6 A;  5JDN A;  2JQH A;  5HXR A;  2V7J A;  3I9Y A;  4X66 T;  4LF6 T;  2VB6 A;  4ZHQ E;  3ZYM A;  4JI7 T;  3K3O A;  3ZC0 A;  5L2L A;  2GK9 A;  2QYW A;  4HFE A;  3R84 B;  3N2G E;  4CXX A;  2IC6 A;  3V5S A;  5FXZ A;  3AE9 A;  4IDZ A;  1KFY A;  3AXJ B;  2YDR A;  4MBQ A;  4UVC B;  1ZP0 A;  4H63 H;  1OXZ A;  2H7O A;  3FZF B;  3KFW X;  1VRB A;  3MJX A;  4OK0 A;  4Z91 A;  3U78 A;  4TUY E;  4K0K T;  3KVA A;  1E1H B;  3HKE E;  1LVF A;  5DQW A;  2H3R A;  1IBM T;  3JCF A;  3B13 A;  4DBQ A;  3RX6 A;  2CWO A;  4BAY B;  4JI0 T;  2C0S A;  3PU3 A;  3UUN A;  4LF7 T;  1J5W A;  2CA5 A;  2FJE A;  2J47 A;  4LML A;  4NIQ A;  4A56 A;  3UQ7 A;  2YOE A;  4B6X A;  5FXV A;  3V5U A;  4LFA T;  4NXM T;  1XNQ T;  2BDE A;  2V6Y B;  3IHR A;  4IDQ A;  4EYY R;  5FL1 A;  3J9X 1;  2N9D A;  3DP7 A;  3N9P A;  2E9X A;  5C3J A;  3PUS A;  3N2K E;  2PBI A;  2LT3 A;  4UIG A;  3ZMV B;  2E2A A;  2BKP A;  1HF8 A;  3WAJ A;  4OX9 T;  3I0Q A;  5FMN A;  2IML A;  1BR1 A;  3HR0 A;  1VCS A;  3LDQ B;  3CPZ A;  3RH3 A;  3AEG A;  3NKZ A;  1BR0 A;  2WSS V;  4QXH B;  1OED C;  2E5L T;  2W67 A;  4PJJ A;  4U2Z A;  3FZL B;  3EUH A;  2HPJ A;  2XQA A;  3CQG B;  3ZCJ A;  5JH7 E;  2BS4 A;  4PJN A;  5LHG B;  1O3X A;  2J62 A;  2M67 A;  1G73 A;  1T8B A;  3CX6 B;  4O4I E;  3X1D A;  5ABF A;  2DCF A;  5F3J A;  2WP9 A;  2YEV C;  3IBP A;  3NVO A;  5LB7 B;  3L39 A;  1W0B A;  2JQQ A;  3O9X A;  3OJA A;  4L9I A;  4B3R T;  2CLY B;  2XM2 A;  2YU1 A;  2HN2 A;  4TWH A;  3U3I A;  4NUV A;  2D2S A;  2XM1 A;  2D0T A;  3UU6 A;  1WYC A;  3FZM B;  4XBF B;  5KDM C;  2WZH A;  2BG9 A;  3ETV A;  1T7S A;  1CHU A;  1LKX A;  2KWH A;  2LKH A;  2I0M A;  3MAC A;  1BR2 A;  4LFC T;  1FEW A;  1G8X A;  1YKE B;  3ANW A;  5LYJ E;  3N9Q A;  1J5E T;  1B7T A;  4WNK A;  5LCY A;  4A98 A;  3UUM A;  3NWI A;  2VUR A;  3QK6 A;  4GYS A;  2MAW A;  5CGM A;  1QSD A;  3AAE B;  3KDS E;  4MAL A;  3RC8 A;  4EB6 E;  2X66 A;  3ZJ1 A;  4AIS A;  5EK2 A;  2RPA A;  4DR5 T;  5HEU A;  3C4Z A;  4QH5 A;  1M7K A;  3NBX X;  2VK9 A;  2DLR A;  2IC9 A;  4N78 D;  3AEF A;  4QX7 B;  3TLU A;  3C4W A;  3CQC B;  4P1N A;  5HAX A;  3I9W A;  1N34 T;  2LSI A;  3RI5 A;  3F31 A;  3MK7 C;  3N9N A;  3AVR A;  4GKK T;  2WWU A;  2V6X A;  1WCR A;  1Y01 A;  3EAM A;  3H3M A;  3ZMU B;  4GOU A;  2K3W A;  3KV5 A;  2IUB A;  2W00 A;  5HCM A;  5LBQ B;  4ILU A;  4ILB A;  1V9D A;  3ZN1 B;  1AJ3 A;  4IE0 A;  4X65 T;  3HL6 A;  3OKQ A;  4HE8 A;  2NP9 A;  4EIW A;  2N2N A;  5LG4 A;  2V26 A;  3N9L A;  4X20 E;  4J2C A;  3BQI A;  4H9S E;  4DV1 T;  4QXB B;  2XQY A;  4ZXL A;  5L3B B;  4LF5 T;  5AQV B;  3C50 A;  5JVD E;  4EYU A;  1QLB A;  4JEU B;  1SUM B;  3A8Y C;  3AEA A;  5AQU B;  2D5U A;  4WBO A;  3C4X A;  3ESL A;  4HWC A;  4A5X A;  2MBG A;  2HH7 A;  2XY8 B;  2LRL A;  2XSA A;  4DR1 T;  1CUN A;  2ODU A;  5HXH A;  2KIN B;  2XZE A;  3RIA A;  3Q2M A;  5HEG A;  4HFV A;  3GN5 A;  4I55 E;  3IA3 A;  4AQG A;  4AKI A;  3E22 E;  4HWF A;  4JI5 T;  4YSY A;  1OED B;  3AE7 A;  2CM0 A;  3AE2 A;  3VHL A;  1IAP A;  1UUS A;  4DO0 A;  3ZEF B;  1H7C A;  3T8O A;  2LM2 A;  2LJL A;  2W66 A;  5JDL A;  4H63 V;  3LG7 A;  3NRX A;  3DTO A;  4CZZ B;  4I43 B;  2ZM6 T;  2G0U A;  2CHO A;  4I0U A;  4JBW F;  3M3Z B;  3H3A A;  1YW0 A;  4IDP A;  2XAS B;  5H6Q B;  4U74 A;  1OED E;  3AB3 B;  3QUJ A;  3ZYL A;  4Z8X A;  2CHN A;  4WW0 A;  3VKG A;  4O8S A;  4ANJ A;  3EHZ A;  3FXD B;  3JAF A;  2KSR A;  4DVD A;  3EDV A;  5ABG A;  4PFP A;  3GA8 A;  3RYH E;  3VR8 A;  2UXC T;  4HTE A;  2XAJ B;  1XDP A;  3EI0 A;  4HFD A;  2I59 A;  2X9Y A;  4OYJ A;  5L3E B;  4E7S A;  5J0Z A;  2W63 A;  2V8S V;  3HKC E;  3RHW A;  4BJN A;  2PG8 A;  4CI3 B;  1YD8 G;  2VQE T;  4ERR A;  1X79 A;  1E7P A;  4IE5 A;  1J1J A;  1M62 A;  2FJA A;  5CFB A;  2V1D B;  5L3F B;  3O1J A;  3BQL A;  1OWA A;  4PJL A;  4YT0 A;  2W4X A;  2YKS A;  4WBN E;  5CA0 E;  2V5C A;  2N1G A;  2QRX A;  2E9X B;  4OFZ A;  5HCJ A;  4ZI7 E;  5E0O A;  4YLH A;  3RYC E;  3UUL A;  4AKH A;  2W61 A;  2BKN A;  3NZQ A;  5IHY A;  2XQ9 A;  4YY3 T;  4U72 A;  5CJ5 A;  4JV5 T;  2BG9 B;  2X0Y A;  1XWM A;  4GK5 E;  5CA1 E;  2LHR A;  2B76 A;  2X9H A;  2X51 A;  4DID B;  3NZP A;  4EED A;  2CMR A;  2BBJ A;  3CKD A;  4IT4 A;  4UF0 A;  3VU7 H;  2LHN A;  2XQ5 A;  2M6B A;  4KMC A;  3AA0 B;  4ILC A;  2UXN B;  4IST A;  1SA0 E;  4UXN B;  4ASK A;  3FZH B;  3CX8 B;  3LK3 B;  1Y64 B;  1D0Y A;  3LFM A;  1XMO T;  2UU9 T;  4OYK A;  2FJB A;  3AEC A;  3HA4 A;  3AA1 B;  1MMG A;  4DV3 T;  4HWH A;  3EVY A;  2PFV A;  2VVS A;  3AE5 A;  5L4E A;  1D1A A;  3PUW F;  2CE7 A;  2XHE B;  4DUZ T;  4CI2 B;  4YSX A;  5JQG E;  4ZI3 C;  3Q5W A;  3L8R A;  2CRB A;  2KMF A;  3GN5 B;  4CN1 A;  4LF4 T;  4DBR A;  2XQ7 A;  2LKG A;  2P9B A;  3D0T A;  4OHF A;  3IF8 B;  2LSG A;  1FMW A;  4PK4 A;  4C91 A;  3Q5E A;  1WLX A;  1ZEE A;  5HXC A;  2NR4 A;  3ONL C;  5DAB A;  2Q9Q A;  2PJQ A;  3CVR A;  3GMI A;  3R6N A;  4JI8 T;  4NXN T;  3PUA A;  4UR9 A;  2E5V A;  5GON E;  2L3L A;  4ADZ A;  5HWX A;  4ZEY A;  2WDQ A;  1IBK T;  4JI4 T;  2NW8 A;  3JAD A;  5AFU L;  4X64 T;  4YTN A;  2WMO A;  4ILA A;  2WU2 A;  4EZ4 A;  2XPK A;  3ABV A;  3AE6 A;  3GWH A;  3PUR A;  2BG9 E;  2QVA A;  2F4V T;  3RRC A;  5JDM A;  1W0A A;  2J4G A;  5AQP B;  2FJD A;  1D1C A;  1IZN B;  2SPC A;  1DU2 A;  4HFB A;  2X9X A;  2LRK A;  3B5M A;  2UXB T;  4CQI A;  5AQI B;  2DWG A;  2RA1 A;  5LXT E;  3ZMS B;  3RLF F;  1UX4 A;  1VOM A;  2KND A;  3FB2 A;  3N9O A;  4QX8 B;  4TV8 E;  4TWF A;  2A9U A;  4YTM A;  2JPF A;  1WRD A;  2JRK A;  5HXS A;  2CEA A;  4B3M T;  5LNK A;  5IWA T;  2XQ3 A;  2NTX A;  2V7K A;  2V7L A;  2LOP A;  5ABH A;  3VRB A;  5LGN B;  1LRZ A;  3JAE A;  3RKO A;  4CI1 B;  1NEK A;  5LJM A;  1Z0P A;  5J2U E;  5FXW A;  4O2B E;  5ADX L;  4AQY T;  3L3P A;  4DV4 T;  4HFC A;  5KX5 E;  3KBU A;  3AXJ A;  3T1H T;  2A2F X;  4L5G A;  1HX1 B;  2Y48 B;  4PNI A;  2WBL A;  4U2Y A;  3TLS A;  3C64 A;  3O1H A;  3ZCI A;  2ES0 A;  4LMK A;  4KBM B;  5EZY E;  4PAG A;  2AXD S;  5HEO A;  5LGT B;  1MMA A;  2ZM0 A;  5AQO B;  1HG2 A;  4ZS2 A;  3UUX B;  4ZI2 C;  2RP4 A;  4QXC B;  3CWZ B;  2YN6 A;  4JI2 T;  3TLT A;  5L47 A;  4ZZC A;  4CN6 A;  4LF9 T;  2UUA T;  2E8I A;  2V5D A;  2NWB A;  1D0Z A;  3RQU A;  2J1D G;  4NPP A;  3ZMZ B;  3AAA B;  4TN7 B;  4I50 E;  4X1K E;  3SOL A;  4DND A;  1XDO A;  2IW5 B;  3RGL A;  2W0G A;  2CPT A;  1NEN A;  3AEE A;  5TAO A;  3OTO T;  2DNX A;  2V7I A;  4CXW A;  2CXD A;  1HNX T;  4ZOL E;  2WAU A;  4O4H E;  3UUB A;  4UEM A;  2YIN A;  3DJB A;  4L0R A;  3A5X A;  2X67 A;  4TNW A;  4KP3 C;  3C51 A;  1ZOY A;  4O2A E;  4KI0 F;  3ONX A;  3RIU C;  3P4P A;  5LP6 E;  1U5P A;  5AQM B;  1JNZ A;  1HCI A;  2LLY A;  3LK2 B;  4PFO A;  2BVL A;  4X1I E;  2PTF A;  3LSV A;  5AQR B;  4YSZ A;  5ABF B;  3W15 B;  5IUX A;  2KXP B;  2XAG B;  3CML A;  3I1A A;  4ZS3 A;  4YJ2 E;  2VQF T;  1YXR A;  2KT9 A;  2K24 A;  2LSY A;  1HFA A;  1KF6 A;  2BG9 C;  2BZB A;  2IDO B;  4HWD A;  4IL9 A;  2B1E A;  1IJ6 A;  3AE8 A;  1NAF A;  3UU3 A;  5HYA A;  3E0Z A;  2LEH A;  5C8Y E;  2WCA A;  1D1B A;  1YKH B;  4DV7 T;  3ZT7 A;  2Q9Q D;  1R8I A;  3UU5 A;  2XTL A;  2EHO D;  3KV6 A;  5AQQ B;  5FP3 A;  3TKL B;  4JYA T;  1ZHC A;  3CK6 A;  3PUV F;  4IIJ E;  5J1G A;  5H6R B;  3UFG A;  2H88 A;  4AKL A;  4DR3 T;  2JMH A;  2XSB A;  4EEB A;  2WM9 A;  3MZK B;  3RC3 A;  4ZI3 D;  2MTQ A;  2WZI A;  3LJC A;  4X62 T;  1FJG T;  2D9D A;  4COF A;  1XNR T;  1LVK A;  3A7M A;  3CQX C;  2VKH A;  2BBH A;  3LBX A;  3OVU A;  3C98 B;  3PTR B;  4G2A A;  4PJM A;  4UEL A;  4AIU A;  4DMW A;  1KNZ A;  4AXP A;  3ZKR A;  3P4R A;  3UQ4 A;  4DR2 T;  3CX7 B;  2V6Y A;  4U31 A;  3PUQ A;  4JEH B;  4JUY A;  5AQT B;  4X5T A;  4F6R C;  5FNV E;  3LK4 2;  2CXF A;  2XAH B;  4UV9 B;  2FBW A;  5LOV E;  5JR9 B;  3UU8 A;  3RYI E;  3FBL A;  3ANW B;  4WYV A;  3PJA A;  5DQV A;  5LMN T;  1SE7 A;  3T1Y T;  2VKJ A;  4UV8 B;  5F8P A;  3Q5D A;  4U3C A;  4H9P C;  3RPU A;  3VRA A;  3ZT5 A;  3NRY A;  5JDG A;  4DR4 T;  2OV9 A;  2ZLY A;  1N32 T;  1MMD A;  1WR6 A;  1WFD A;  2CBI A;  3OYX A;  3F2E A;  3QB5 A;  4XZC A;  5LG3 A;  1IBL T;  2ZM2 A;  2HN1 A;  4UVA B;  2E9X D;  3WAK A;  4A97 A;  4DV5 T;  2Y8D A;  2H89 A;  2MOZ A;  3HKD E;  5LHI B;  2WS3 A;  1KEY A;  5FKY A;  2BKO A;  1WR0 A;  2DI4 A;  5L3D B;  3PDY A;  3ZJ2 A;  5ABE A;  1HTJ F;  4HKA A;  3EAB A;  3UFE A;  4B3T T;  4HEA A;  4BA9 A;  5LGU B;  2QGS A;  3K3N A;  4IRE A;  2CLY C;  3FHN A;  1W09 A;  4GIW A;  5AQG B;  2KWI B;  3I0O A;  2WMN A;  2DL1 A;  4E7Z A;  4GYR A;  5JR9 A; 
#chains in the Genus database with same CATH homology
 3EDU A;  2NW9 A;  2MYS A;  2ODV A;  1ZV4 X;  2VKD A;  3AAI A;  3O1I A;  5JR9 C;  2EHO A;  2K9A A;  5JDF A;  5JRE A;  4XAX B;  5HXE A;  1T98 A;  4IE4 A;  4I4T E;  2L8K A;  2QA7 A;  1FMV A;  1SHZ C;  3L09 A;  3LBX B;  4P0B A;  5CB4 E;  2A72 A;  2H7V C;  2YK0 A;  3K3Q C;  3KIN B;  2LM9 A;  1MIW A;  4EOZ B;  4IGU A;  5IYZ E;  5LA6 E;  3KBT A;  2Z6E A;  2DWK A;  3BK9 A;  3QC9 A;  5J2T E;  2W62 A;  4TZ4 C;  4V1A v;  3OBV E;  4P0A A;  3MKD A;  3IEE A;  2DHR A;  3J7Y q;  4EXT A;  5ETW A;  1HS7 A;  1ZKE A;  3FBZ A;  4FJO A;  4YJ3 E;  5L3C B;  1U4Q A;  2XUE A;  4M1P A;  2X0L B;  4H9O C;  3HI2 A;  1MMN A;  1UCU A;  3ZMT B;  2CCQ A;  2VWA A;  3P8C D;  4QHO A;  3N5L A;  2VAS A;  4G63 A;  3H37 A;  4X1Y E;  2LSK A;  4O4L E;  1D0X A;  4MLK A;  4ISS A;  2HPL A;  4GK0 E;  2NW7 A;  4BJM A;  5EK3 A;  1WYB A;  2VKO A;  4AQF A;  2K48 A;  2YU2 A;  4IHJ E;  3SRZ A;  2JMK A;  3JC6 C;  2VL8 A;  5M4Y A;  2D0U A;  1EZ3 A;  2K5B B;  4FI5 A;  2C5K T;  4YFS A;  5FYM A;  3B57 A;  4DMV A;  4ZI2 D;  1S35 A;  5LBM A;  5LJN A;  4HGA A;  4AKR B;  4K0U A;  3BQK A;  3K8P C;  2NTY A;  4O4J E;  3RYF E;  4AI6 A;  2C5I T;  4QWN B;  5A1L A;  1NWM X;  5JDH A;  1UX5 A;  2Q9Q B;  2X9W A;  2JJ9 A;  2A3D A;  3SWH A;  3ZC1 A;  2LSJ A;  4MHC A;  2X68 A;  3MXZ A;  5BMV E;  1S94 A;  2EHO C;  3SS1 A;  4P09 A;  3F57 A;  3KV9 A;  2E9X C;  4IE7 A;  3Q5X A;  4JLE A;  2ZM8 A;  4YHJ A;  4C90 A;  3ETU A;  4H9N C;  3Q9D A;  2V7M A;  3HKB E;  1QUU A;  5EK4 A;  4PK5 A;  3ZLI A;  4QKN A;  5FY1 A;  1MNE A;  1BR4 A;  2CWY A;  4UF0 B;  2IAK A;  3AA7 B;  3ZN0 B;  1HG5 A;  4HN9 A;  2Q9Q C;  5FY7 A;  4NUU A;  5HWY A;  3E08 A;  5FY0 A;  2LOS A;  2C5J A;  2KZ7 B;  3KVB A;  3MA9 A;  4CXY A;  5FXX A;  1MIV A;  1FIO A;  5JRC A;  3S4U A;  4PK6 A;  4UVB B;  3AA6 B;  3UT5 E;  2EHO B;  1MIY A;  1MND A;  3PU8 A;  4AQF C;  5KMG P;  5JDQ A;  5JRC B;  3AVS A;  3N2O A;  2L9Q A;  3PUG A;  4TV9 E;  5LHH B;  4EZH A;  2XAF B;  2OA5 A;  2UXX B;  2Y6X A;  2LE8 A;  4H9R C;  2XAQ B;  4TX5 A;  3RRW A;  5L3F B;  3ZYK A;  4H9Q C;  1IJ5 A;  4PW8 A;  2CXL A;  3FXE B;  3VKH A;  2BVM A;  2ZMA A;  4MFR A;  2ACX A;  4KUM B;  1HX8 A;  5DJQ C;  1US7 B;  4IE6 A;  5L3G B;  3N9M A;  3WI3 A;  3PE0 A;  4EAH A;  2KLQ A;  3O4X E;  3ZPO A;  3JC6 D;  2NOX A;  1KK7 A;  3OYZ A;  3UTK A;  3M65 A;  4AKG A;  3P7I A;  5JDN A;  5HXR A;  2V7J A;  3I9Y A;  2VB6 A;  4ZHQ E;  3ZYM A;  3K3O A;  3ZC0 A;  5L2L A;  2GK9 A;  3R84 B;  3N2G E;  4CXX A;  2IC6 A;  3V5S A;  5FXZ A;  4IDZ A;  4UVC B;  4MBQ A;  4H63 H;  1OXZ A;  2H7O A;  3KFW X;  3MJX A;  1VRB A;  4OK0 A;  3U78 A;  4TUY E;  3KVA A;  1E1H B;  3HKE E;  1LVF A;  5DQW A;  2H3R A;  3B13 A;  4DBQ A;  3RX6 A;  2CWO A;  4BAY B;  2C0S A;  3PU3 A;  3UUN A;  2CA5 A;  4A56 A;  4B6X A;  5FXV A;  3V5U A;  2BDE A;  3IHR A;  4EYY R;  3J9X 1;  2N9D A;  3DP7 A;  3N9P A;  2E9X A;  3PUS A;  3N2K E;  2PBI A;  2LT3 A;  4UIG A;  3ZMV B;  1HF8 A;  3WAJ A;  3I0Q A;  5FMN A;  1BR1 A;  3HR0 A;  3RH3 A;  3CPZ A;  1BR0 A;  2WSS V;  4QXH B;  4PJJ A;  3EUH A;  2HPJ A;  5JH7 E;  3CQG B;  3ZCJ A;  5LHG B;  4PJN A;  1O3X A;  2M67 A;  1G73 A;  3CX6 B;  4O4I E;  2DCF A;  5F3J A;  2YEV C;  3IBP A;  3O9X A;  2JQQ A;  3OJA A;  4L9I A;  2CLY B;  2YU1 A;  3U3I A;  4NUV A;  2D2S A;  2D0T A;  1WYC A;  4XBF B;  5KDM C;  3ETV A;  1LKX A;  2KWH A;  3MAC A;  1BR2 A;  1FEW A;  1G8X A;  1YKE B;  3ANW A;  5LYJ E;  3N9Q A;  1B7T A;  4WNK A;  5LCY A;  3UUM A;  4GYS A;  3QK6 A;  1QSD A;  3AAE B;  3KDS E;  4MAL A;  4EB6 E;  2X66 A;  3ZJ1 A;  5EK2 A;  3C4Z A;  3NBX X;  2VK9 A;  2DLR A;  2IC9 A;  4N78 D;  4QX7 B;  3C4W A;  3CQC B;  5HAX A;  3I9W A;  2LSI A;  3F31 A;  3MK7 C;  3N9N A;  3AVR A;  2WWU A;  3ZMU B;  4GOU A;  5LBQ B;  3KV5 A;  2W00 A;  4ILU A;  1V9D A;  3ZN1 B;  1AJ3 A;  4IE0 A;  3HL6 A;  3OKQ A;  4HE8 A;  2NP9 A;  4EIW A;  2N2N A;  5LG4 A;  2V26 A;  3N9L A;  4X20 E;  4J2C A;  3BQI A;  4H9S E;  4QXB B;  2XQY A;  5L3B B;  3C50 A;  5JVD E;  4EYU A;  4JEU B;  2D5U A;  4WBO A;  3C4X A;  3ESL A;  2MBG A;  2HH7 A;  1CUN A;  2ODU A;  5HXH A;  2KIN B;  3Q2M A;  4HFV A;  3GN5 A;  4I55 E;  4AQG A;  4AKI A;  3E22 E;  2CM0 A;  3VHL A;  1IAP A;  4DO0 A;  3ZEF B;  1H7C A;  3T8O A;  2LJL A;  5JDL A;  4H63 V;  3LG7 A;  3NRX A;  3DTO A;  4CZZ B;  4I43 B;  2G0U A;  3H3A A;  1YW0 A;  2XAS B;  5H6Q B;  4U74 A;  3AB3 B;  3QUJ A;  3ZYL A;  4Z8X A;  4WW0 A;  3VKG A;  4O8S A;  4ANJ A;  3FXD B;  4DVD A;  3EDV A;  4PFP A;  3GA8 A;  4HTE A;  2XAJ B;  2I59 A;  2X9Y A;  4OYJ A;  5L3E B;  4E7S A;  2W63 A;  3HKC E;  4BJN A;  2PG8 A;  4CI3 B;  1YD8 G;  4ERR A;  1X79 A;  4IE5 A;  2V1D B;  3O1J A;  3BQL A;  1OWA A;  4PJL A;  5CA0 E;  4WBN E;  2N1G A;  2E9X B;  4OFZ A;  4ZI7 E;  5E0O A;  4YLH A;  3RYC E;  3UUL A;  4AKH A;  2W61 A;  3NZQ A;  5IHY A;  4U72 A;  4GK5 E;  5CA1 E;  2LHR A;  2X9H A;  2X51 A;  3NZP A;  2CMR A;  3CKD A;  4UF0 A;  3VU7 H;  2LHN A;  4KMC A;  3AA0 B;  2UXN B;  4IST A;  1SA0 E;  4UXN B;  4ASK A;  3CX8 B;  3LK3 B;  1Y64 B;  1D0Y A;  3LFM A;  4OYK A;  3HA4 A;  3AA1 B;  1MMG A;  3EVY A;  2PFV A;  1D1A A;  2CE7 A;  2XHE B;  4CI2 B;  5JQG E;  4ZI3 C;  3Q5W A;  2KMF A;  3GN5 B;  4DBR A;  3D0T A;  4OHF A;  2P9B A;  3IF8 B;  2LSG A;  1FMW A;  4PK4 A;  4C91 A;  1WLX A;  1ZEE A;  5HXC A;  5DAB A;  2Q9Q A;  2PJQ A;  3CVR A;  3GMI A;  3R6N A;  3PUA A;  5GON E;  2L3L A;  4ADZ A;  5HWX A;  2NW8 A;  5AFU L;  2WMO A;  4EZ4 A;  3GWH A;  3PUR A;  3RRC A;  5JDM A;  1D1C A;  1IZN B;  2SPC A;  2X9X A;  4CQI A;  2DWG A;  2RA1 A;  5LXT E;  3ZMS B;  1UX4 A;  1VOM A;  2KND A;  3FB2 A;  3N9O A;  4QX8 B;  4TV8 E;  3RYH E;  5HXS A;  2JPF A;  1WRD A;  2JRK A;  2CEA A;  5LNK A;  2NTX A;  2V7K A;  2V7L A;  2LOP A;  5LGN B;  5LJM A;  1LRZ A;  3RKO A;  4CI1 B;  1Z0P A;  5J2U E;  5FXW A;  4O2B E;  5ADX L;  3L3P A;  5KX5 E;  3KBU A;  2A2F X;  4L5G A;  2Y48 B;  4PNI A;  2WBL A;  3C64 A;  3O1H A;  3ZCI A;  2ES0 A;  5EZY E;  4KBM B;  4PAG A;  5LGT B;  1MMA A;  2ZM0 A;  1HG2 A;  4ZS2 A;  3UUX B;  4ZI2 C;  2RP4 A;  4QXC B;  3CWZ B;  2E8I A;  2NWB A;  1D0Z A;  2J1D G;  3ZMZ B;  3AAA B;  4TN7 B;  4I50 E;  4X1K E;  3SOL A;  4DND A;  2IW5 B;  2W0G A;  5TAO A;  2DNX A;  2V7I A;  4CXW A;  2CXD A;  4ZOL E;  2WAU A;  4O4H E;  4UEM A;  2YIN A;  3DJB A;  4L0R A;  3A5X A;  2X67 A;  4KP3 C;  3C51 A;  4O2A E;  3ONX A;  5LP6 E;  1U5P A;  4X1I E;  1HCI A;  4PFO A;  3LK2 B;  3RC8 A;  2BVL A;  3W15 B;  2KXP B;  2XAG B;  3CML A;  3I1A A;  4ZS3 A;  4YJ2 E;  1HFA A;  2K24 A;  2KT9 A;  2LSY A;  2BZB A;  5HYA A;  2B1E A;  1IJ6 A;  1NAF A;  3E0Z A;  2LEH A;  5C8Y E;  1D1B A;  1YKH B;  2Q9Q D;  2XTL A;  2EHO D;  3KV6 A;  5FP3 A;  3TKL B;  1ZHC A;  4IIJ E;  5J1G A;  5H6R B;  4AKL A;  2JMH A;  4ZI3 D;  2WM9 A;  3MZK B;  3RC3 A;  2MTQ A;  3LJC A;  1LVK A;  3CQX C;  2VKH A;  3LBX A;  3PTR B;  4G2A A;  3C98 B;  4UEL A;  4PJM A;  4DMW A;  1KNZ A;  4AXP A;  3CX7 B;  3PUQ A;  4JEH B;  4JUY A;  4F6R C;  5FNV E;  3LK4 2;  2CXF A;  2XAH B;  4UV9 B;  5LOV E;  5JR9 B;  3RYI E;  3FBL A;  3ANW B;  5DQV A;  2VKJ A;  4UV8 B;  5F8P A;  4H9P C;  3RPU A;  5JDG A;  3NRY A;  2ZLY A;  1MMD A;  1WR6 A;  3OYX A;  4XZC A;  3F2E A;  2ZM2 A;  4UVA B;  3WAK A;  2E9X D;  2Y8D A;  2MOZ A;  3HKD E;  5LHI B;  2DI4 A;  5L3D B;  3PDY A;  3ZJ2 A;  1HTJ F;  4HKA A;  3UFE A;  4HEA A;  4BA9 A;  5LGU B;  2QGS A;  3K3N A;  2CLY C;  3FHN A;  4GIW A;  2KWI B;  3I0O A;  2WMN A;  3KV4 A;  4E7Z A;  4GYR A;  5JR9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...