2L8KA

Nmr structure of the arterivirus nonstructural protein 7 alpha (nsp7 alpha)
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
123
structure length
123
Chain Sequence
GLTATLAALTDDDFQFLSDVLDCRAVRSAMNLRAALTSFQVAQYRNILNASLQVDRDAARSRRLMAKLADFAVEQEVTAGDRVVVIDGLDRMAHFKDDLVLVPLTTKVVGGSRCTICDVVKEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Non-structural protein 7
publication title Structure and Genetic Analysis of the Arterivirus Nonstructural Protein 7{alpha}.
pubmed doi rcsb
source organism Equine arteritis virus
molecule tags Viral protein
total genus 28
structure length 123
sequence length 123
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2011-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16749 Arteri_nsp7a Arterivirus nonstructural protein 7 alpha
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.950 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2l8kA00
2L8KA
chains in the Genus database with same CATH superfamily
1KNZA 2D9DA 4MALA 2H88A 3KV4A 2WWVA 2BKPA 3ZCJA 5CA0E 1MIYA 5AQRB 1DU2A 3CQXC 5C2TA 4N78D 3GWHA 3TLSA 3MKDA 3CMLA 3IHRA 3ONLC 5C8YE 2A2FX 4DUYT 1KFYA 1AJ3A 3OVUA 4F8HA 4AQFA 2FJDA 3AA0B 2QRXA 5IYZE 3RGLA 4LF6T 3NRXA 4HEAA 3AEBA 4UXNB 4HWDA 4FJOA 4TWFA 1HNWT 3I0QA 2WMOA 4IDOA 2CA5A 4TNVA 4X1IE 1QUUA 2GK9A 1LVKA 2PG8A 4IE5A 3ZMZB 3AA6B 2V6YB 2VVNA 3FZLB 4WZXA 4AQFC 4JLEA 3MACA 2UXXB 2I0MA 2FJBA 4XBFB 4HWCA 5FL0A 3RC8A 4PJMA 2HHHT 3ZJ1A 3AVSA 1UUSA 3PUGA 3W15B 4U2YA 1HG5A 4EYYR 5LHIB 2XASB 5J2TE 1IJ5A 5AQHB 4ZXLA 1IBLT 2N1GA 4EEBA 4HN9A 3PUQA 2WM9A 2RPAA 2OV9A 5L3EB 5IUXA 4PK4A 5M4YA 3AXJB 5KMGP 3RIUA 4YY3T 3UUXB 3UU6A 4KBMB 4OX9T 2XAFB 2FJEA 3ZMUB 2JMHA 2BVMA 4P0BA 5ABFA 4BA9A 1ZKEA 3GN5A 2DWGA 3E0ZA 4B3ST 3PJAJ 2XSAA 2UUCT 1QLBA 1SHZC 3PJAA 3OYZA 2Y48B 3RIUC 2XJ7A 4ILBA 2V7KA 3NWIA 2YDRA 2KLQA 4ISTA 3P50A 4QWNB 1SUMB 2XAQB 3RLFF 2HN2A 2D0UA 3KV5A 4I0UA 3ZC0A 4IDPA 4DR4T 1LVFA 5AQTB 4AKHA 5EK3A 3VRBA 3AAEB 2IIUA 2BS4A 2EHOA 3L39A 3UTKA 3N2KE 3TLUA 3EUHA 4A5XA 2BG9B 3SRZA 1VCTA 5FXVA 3WI3A 3K1SA 2WP9A 2JJ9A 4ZZBA 1UURA 3EAMA 5FYMA 2HN1A 1EZ3A 2C5IT 2VL8A 2EHOC 4CI1B 3N9PA 2X9HA 1US7B 3GMIA 2E5VA 3K3OA 3KDSE 2VKHA 4X62T 2J62A 4JI6T 3OBVE 4HWHA 5TAOA 3UU8A 3ONXA 4YT0A 1X79A 3DP7A 2L8KA 2NTYA 5AQQB 4IDZA 5FXWA 4ZI3D 2OA5A 4QXHB 3T1YT 1IBMT 4UVCB 3EHZA 2X9YA 4YSYA 2M6IA 2CLYC 4NIQA 3N9QA 2CBIA 3UU5A 3JAEA 3E22E 1GQEA 4A56A 1ZEEA 2LSKA 4I43B 2FJAA 1M62A 3JAFA 2WY2A 4OFZA 2IC9A 4PK5A 3WAJA 1VCSA 2X0LB 1KNRA 2WMNA 4AKGA 4HKAA 4O4LE 1D0ZA 2ES0A 1UX4A 2I6HA 4TWDA 3MXZA 3T8OA 4ERRA 2BVLA 1BR2A 2WDVA 2CPTA 5ABEA 3AEAA 3HKCE 2Y6XA 4U74A 2UXBT 1O3XA 4DR5T 3FXDB 4V1Av 5AQMB 3Q5XA 1ZP0A 4AKRB 4U2ZA 4X66T 1XZYA 2LM2A 2X67A 4AKIA 5JDQA 3CX8B 4YTMA 3KFWX 4U72A 1MNEA 3R84B 2KZ7B 2XQ3A 2Q9QD 4GYSA 4DV5T 5L2LA 3EABA 2ACXA 4LMJA 2LOPA 2VKOA 2VURA 3L8RA 4EAHA 1D0XA 4LMLA 1OXZA 3ZC1A 2LKHA 4EEDA 4YSXA 2V26A 2R6GF 3MA9A 4HGAA 5L3FB 4BJNA 2CE7A 2ZM6T 4TV8E 4YLHA 3F31A 2VL0A 5HXRA 4H9OC 5LOVE 3J7Yq 2XQ9A 4ZI3C 5ADXL 1YKHB 2I59A 2H7OA 1N32T 5HXCA 2CCQA 2XAHB 3FZFB 2LM9A 3I9WA 4QX8B 5LP6E 3F2EA 3SFEA 2D0TA 3EVYA 3O4XE 2CBJA 2ZLYA 4TUYE 5HEGA 3AE1A 4YTNA 4PAGA 5AQJB 1OEDB 4PW8A 2A72A 3JC6C 3ZCIA 4ASKA 3E08A 1WYBA 4DO0A 4U7IA 2D2SA 5JDHA 3CX6B 2CM0A 2V7JA 2JQ9A 3EDVA 4TZ4C 1YQ4A 4E7SA 5JQGE 3ZMTB 1HTJF 4EV6A 2XUEA 2K3WA 4QKNA 5ABHA 5CA1E 1HCIA 1HF8A 2KINB 4I4TE 4DBRA 5LBQB 1KEYA 2BZBA 2NTXA 4O4JE 4FI5A 3MZKB 5AQLB 3VRAA 3OPCA 4NXMT 2XAJB 2CRBA 4GIWA 5HCJA 4JUYA 5KXJA 1S35A 5EK2A 1BR1A 4P0AA 2B1EA 5FY0A 5JREA 4GKKT 2VVSA 4OYKA 3J9X1 1YW0A 3UUMA 2ZM8A 2UXDT 3HA4A 2ODVA 2YU2A 4LFCT 5FY1A 3P4SA 3VR9A 2JMKA 3P4WA 3B57A 2A9UA 2V6YA 2MOZA 2IHR1 4ANJA 4CXXA 5HXEA 4XAXB 4DR3T 4LFBT 3QUJA 3QB5A 4GOUA 2YDQA 1WR6A 4WBOA 3O9XA 3AA7B 4HFHA 3A5XA 2W4XA 1HNZT 3LJCA 5FL1A 2HPLA 3AAAB 4K0UA 3LFMA 3H3AA 2DCFA 4HFIA 1XMQT 4KI0F 4IE6A 3PUSA 4ZHQE 1SA0E 2WU2A 4DV2T 3AXJA 3RRCA 4LF8T 3Q2MA 1ZOYA 2X0YA 2RA1A 3AVRA 3AE9A 4H9SE 5CJ5A 1E1HB 2WZIA 3LBXB 3NZPA 1NEKA 4HE8A 4JI0T 2NW8A 5AQVB 2H7VC 4KUMB 5LYJE 4ILAA 3UT5E 5AQSB 3FXEB 2XQ5A 4H9NC 3ZJ2A 3RYCE 4ZOLE 2KXPB 2XQ8A 4XZCA 3RI5A 3P4PA 4TX5A 4UVBB 1D1AA 3KBUA 4JV5T 2JIWA 4DBQA 3P4RA 1IJ6A 4G2AA 3P8CD 3HKEE 4HFBA 4YJ2E 3CKDA 2BG9A 2W00A 4QHOA 2CWOA 3SFDA 1WLXA 4DNDA 4IE4A 5JDLA 4MLKA 2YINA 3QOFA 3AAIA 5CB4E 4H63V 2V5DA 3MJXA 2F4VT 2VQFT 4LF5T 5BR8T 4JI1T 3JADA 2KNDA 2IW5B 5HCMA 3HI2A 1E7PA 1XDPA 4CN6A 5FXXA 3R6NA 4IGUA 2MTQA 2BG9C 3AECA 3AEGA 2LHRA 1CHUA 3PUZF 3RPUA 3ZT7A 4KHPT 4EGWA 2A3DA 2SPCA 4CI3B 2X9WA 3FZHB 3B5MA 2KT9A 1JNRA 5JDFA 4HFDA 5HXSA 1N34T 4TWHA 5IHYA 2K48A 4QH4A 3QNUA 1HG2A 2QA7A 5JDMA 2NR4A 2X66A 4MFRA 4DV1T 1I94T 5HWXA 3ZYKA 2WDQA 3NKZA 2M67A 3PTRB 2MPKA 2BBJA 5AQUB 1XMOT 4L5GA 3FZKB 1LRZA 4HWFA 5F3JA 1M7KA 1J5ET 2XHEB 2DLRA 4KHZF 3UQ7A 2ZM2A 4K0KT 4DR6T 4HFCA 4PNIA 2WQYA 5LB7B 2NP9A 4PFOA 2VK9A 4WYVA 4YXDA 2WBLA 3PE0A 1WR0A 4MBQA 3HKDE 3K3NA 2LE8A 4O4HE 1XNRT 5FMNA 3RHWA 4AI6A 2JQKA 5L4EA 3ZEFB 2UUBT 3AE8A 5J0ZA 3RQUA 2L9QA 2NW9A 1B7TA 3PUVF 2E9XD 1FJGT 4DR2T 3RIFA 5JRCA 3FZMB 5LHGB 2VWAA 3FB2A 4ISSA 3GN5B 2XQYA 2BKNA 3X1DA 1MIWA 2XQ6A 4X20E 3AB3B 5C3JA 5H6RB 2KWIB 4EYUA 3RF1A 4ZI2D 2FBWA 5FP3A 1XDOA 4C90A 2UU9T 3D0TA 3PV0F 4IDQA 5AQGB 3Q9DA 2VKJA 4F6RC 3N9NA 2RP4A 4JI7T 3LK3B 1OEDA 2CWYA 2EHOB 2KWHA 4IL9A 1G8XA 3A7MA 5EZYE 5CGMA 1T72A 1D0YA 3Q5DA 2XY8B 2HH7A 3IBPA 2J47A 2WSSV 3AEDA 2D5UA 3UU4A 4U3CA 1WRDA 1OEDC 2Y8DA 2V8SV 5JDNA 4J2CA 4PJJA 1XNQT 4UF0B 4H9RC 4H9PC 4AXPA 2XTLA 4HFVA 4U7YA 1MMNA 4JI3T 4GK5E 3ESLA 4BAYB 2H89A 5LMUT 3FHNA 3ETUA 5HEUA 4OHFA 5F5WA 1NWMX 5LMNT 2L3LA 1MMDA 1HNXT 3N5LA 3P4QA 3ZSTA 1MMAA 5J1GA 5ABGA 3KV9A 5FVKA 2PJQA 3OYXA 5LNKA 2E5LT 4MHCA 5FVLA 4H63H 3LK42 1VOMA 2YN6A 1VRBA 4Q25A 4QH5A 1UX5A 2H3RA 2DNXA 2AXDS 3SOLA 1CUNA 4LFAT 3PUAA 4JI5T 3RYHE 4AIUA 4YFSA 2WU5A 4UV8B 3ZLIA 4ILUA 3C98B 2Q9QA 3N9OA 5BMVE 5HEJA 1W0AA 4NUUA 2X51A 2AE9A 3K3QC 2MYSA 4TN7B 3Q5EA 2VB6A 2E9XB 3G06A 1L0VA 4WBNE 3LDQB 1Y64B 1Y01A 1FIOA 3N9MA 2WS3A 2XAGB 2XSBA 2Q9QC 5L3BB 4L9IA 2UUAT 3HKBE 3PU3A 2V6XA 3RRWA 2K5BB 5L4HA 2V7MA 3ZSSA 2ODUA 3IEEA 1Z8UA 3PUYF 2YU1A 4Z90A 2XQ4A 4CN1A 3LBXA 1T7SA 5AQIB 2XZEA 2WAUA 4GYRA 4CZZB 3QB5K 3ANWB 3QC9A 4E7ZA 5A1LA 2W66A 2ACZA 1R8IA 3ETVA 3PUXF 4ZZCA 1XWMA 4Z91A 3CK6A 5L3GB 4DV3T 2WDRA 4UELA 5H6QB 4IDNA 2W61A 1UCUA 3LSVA 2C0SA 2UXCT 3DTOA 5LGUB 1FEWA 5LCYA 1KF6A 3RH3A 2CXDA 1KNPA 5DJQC 3L3PA 4DMWA 4CXWA 3RIAA 4M1PA 4X65T 5JR9B 5AQOB 4UR9A 4X64T 4EIWA 4HWIB 2IDOB 3NZQA 4DR7T 2C5JA 3RQWA 3MK7C 1ZHCA 4CXYA 2XPKA 3KBTA 2QGSA 4ILCA 5LJNA 3NRYA 2N9DA 2HPJA 2LEHA 2E8IA 2W67A 3NBXX 3VKHA 3EDUA 4B3TT 2XM1A 3K8PC 3L09A 3BQLA 4U31A 2YDSA 2BKOA 3H37A 1KK7A 2V5CA 2PFVA 3IF8B 4JI4T 4X1KE 2CHNA 3V5UA 1BR0A 4GKJT 3VHLA 2OLTA 2B76A 3TLWA 2J1DG 3IA3A 2MBGA 1JNZA 4EOZB 5DQWA 4HFEA 5L47A 5JH7E 2Z6EA 1QSDA 3ZMSB 3LK2B 5F8PA 1HX1B 5DABA 3RX6A 4EB6E 3C4XA 3CWZB 4JBWF 2FUPA 2BS3A 3U78A 1N36T 4IHJE 3ZN1B 4O4IE 3OTOT 3AE7A 5JTGA 2J4GA 2EHOD 4BJMA 2CMRA 4B3RT 2XQAA 4DV6T 4UV9B 5L3CB 5KDMC 4DIDB 5CFBA 2IAKA 1YKEB 1WYCA 4COFA 3I0OA 5GONE 2V7IA 5FKYA 4JEUB 1T98A 5HEOA 4DV0T 2W2UA 4YHJA 3CX7B 3AE3A 4NXNT 3CVRA 3ZT5A 3O1JA 3U3IA 1ZV4X 1J5WA 2M6BA 2NW7A 2LSIA 1WFDA 3RC3A 2BG9E 4YSZA 2LHNA 4ZS2A 4Z8XA 1HFAA 4QH1A 3M65A 3TKLB 5JDGA 5LXTE 3RKGA 3O1IA 2WWUA 2IUBA 3QK6A 3A8YC 4IL4A 5J2UE 3B13A 4PJLA 4U33A 4YTPA 5FNVE 2UXNB 4P09A 4ZEYA 2ZM0A 3AEEA 2K9AA 4IE7A 3C51A 2LSYA 3AEFA 2WZHA 3SWHA 1HX8A 2LRLA 4YHHT 3ZKRA 3BQIA 4LF7T 3P7IA 3F57A 4EZHA 2DI4A 3CIRA 2VQET 3UULA 2C5KT 4B6XA 1NENA 4AQGA 4DV4T 2YOEA 1G73A 5AQKB 3N2GE 4L0RA 3RKOA 3ZN0B 4DV7T 3JCFA 1UGOA 1LKXA 2ZMAA 2BDEA 2X68A 1YD8G 1UK5A 4CI2B 1HR0T 4UF0A 4LF9T 3ZPOA 5AQPB 5ETWA 5FXZA 5HXHA 2XQ7A 4EXTA 1MNDA 1FMVA 4QXBB 4IIJE 5HYAA 3TLTA 3BQKA 4I50E 5ABFB 5LGNB 4O2AE 4AKLA 2DL1A 1IAPA 4HTEA 4JI2T 3UQ4A 2BS2A 4KP3C 5KX5E 4X5TA 4IE0A 1D1CA 4O8SA 1YXRA 2G0UA 5AFUL 3C4WA 4O2BE 2YK0A 4OK0A 2X0HA 3O1HA 4DUZT 4AQYT 4TV9E 1MIVA 3OJAA 3AE2A 3JC6D 5JVDE 3N9LA 1NAFA 3PDYA 1D1BA 4CN4A 2KSRA 4UVAB 1U5PA 5LJMA 2LSGA 3KVBA 1E2AA 3Q5WA 3PURA 3AA1B 5LA6E 3KINB 4A98A 3AE6A 2W62A 5EK4A 3HL6A 4GK0E 3V5SA 1MMGA 2QYWA 5DQVA 2LLYA 2E9XA 2CEAA 4DR1T 4B3MT 3CQCB 4G63A 2CLYB 3BK9A 3UUBA 1BR4A 2LOSA 5IWAT 2BBHA 4X1YE 3S4UA 2V1DB 3LG7A 4IREA 3UU3A 2LT3A 4H9QC 4I55E 4UEMA 3RYFE 3PUWF 1T8BA 4LF4T 1FMWA 2LRKA 3KV6A 3I9YA 4UIGA 1IBKT 4JEHB 1V9DA 5JRCB 4LMKA 2E9XC 2V7LA 2JQQA 4WNKA 4PK6A 1N33T 4CQIA 2PBIA 1S94A 1YQ3A 1OEDE 5AQFB 3M3ZB 3EI0A 3ANWA 1W0BA 1SE7A 3C64A 3ZYLA 2JPFA 2WB5A 4DMVA 5LGTB 4YJ3E 4C91A 5HWYA 4NUVA 3CPZA 3C50A 4ZI2C 4JI8T 4IT4A 1H7CA 3VU7H 2JQHA 3RYIE 3T1HT 2K24A 5HEHA 3PU8A 3NVOA 3FBLA 2W63A 4OYJA 1W9RA 2CHOA 1IZNB 3ZYMA 3H3MA 5JR9A 3N2OA 4AISA 2LJLA 1X9BA 2VKDA 5E0OA 4PJNA 2PTFA 3KVAA 2DHRA 4QXCB 3I1AA 3WAKA 3TLVA 2KMFA 4ZS3A 1I6ZA 4QX7B 3UFGA 2YKSA 2LSJA 2IMLA 3ABVA 5LBMA 3FBZA 4ADZA 4JYAT 5JR9C 4KMCA 1J1JA 2N2NA 4P1NA 4NPPA 5LG4A 1U4QA 3AE5A 2DWKA 2W0GA 3AE4A 3SS1A 2CXLA 3OKQA 2NWBA 5AQNB 1Z0PA 3VR8A 2VASA 3VKGA 4EZ4A 3C4ZA 4TNWA 3UFEA 1OWAA 2JRKA 3ZT6A 2WCAA 1W09A 3ONJA 2NOXA 5L3DB 2P9BA 5LG3A 5HAXA 3DJBA 5FY7A 2MAWA 2X9XA 2XM2A 3HR0A 1WCRA 3CQGB 2QVAA 4A97A 4PFPA 4DVDA 4WW0A 3UUNA 4KX6A 4ZI7E 2YEVC 2Q9QB 2IC6A 1HS7A 2E2AA 3ZMVB 2CXFA 2LKGA 5LHHB 3GA8A
chains in the Genus database with same CATH topology
3I0OA 5GONE 1MIWA 2V7IA 4PW8A 1KNZA 2A72A 3JC6C 4X20E 3ZCIA 4JEUB 3AB3B 1T98A 4MALA 4ASKA 5H6RB 4YHJA 3CX7B 2KWIB 3KV4A 3E08A 1WYBA 4DO0A 4EYUA 3ZCJA 4ZI2D 5CA0E 5FP3A 3CVRA 4C90A 1MIYA 2D2SA 3D0TA 5JDHA 3O1JA 3U3IA 3CQXC 4N78D 3CX6B 2VKJA 3Q9DA 2CM0A 1ZV4X 3GWHA 2V7JA 2NW7A 3EDVA 4F6RC 3N9NA 2LSIA 3MKDA 4TZ4C 3RC3A 3CMLA 2RP4A 4E7SA 2LHNA 3IHRA 5JQGE 3LK3B 3ZMTB 1HTJF 2CWYA 2EHOB 2KWHA 4ZS2A 2XUEA 4Z8XA 4QKNA 1HFAA 5C8YE 1G8XA 3M65A 5CA1E 2A2FX 3TKLB 1HCIA 5JDGA 5LXTE 3O1IA 2WWUA 1AJ3A 5EZYE 1HF8A 2KINB 4AQFA 3QK6A 1D0YA 4I4TE 3AA0B 4DBRA 5IYZE 5LBQB 5J2UE 3B13A 4PJLA 5FNVE 2BZBA 2NTXA 2UXNB 3NRXA 4O4JE 2HH7A 3IBPA 2WSSV 4P09A 4HEAA 2ZM0A 4FI5A 3MZKB 4UXNB 2D5UA 2K9AA 4FJOA 4IE7A 3C51A 2LSYA 3I0QA 2WMOA 1WRDA 2Y8DA 2XAJB 3SWHA 2CA5A 1HX8A 4X1IE 1QUUA 4GIWA 2GK9A 1LVKA 5JDNA 2PG8A 4J2CA 4IE5A 4JUYA 4PJJA 3ZMZB 3AA6B 3BQIA 4UF0B 1S35A 5EK2A 3P7IA 1BR1A 4AQFC 3F57A 4H9RC 4H9PC 4AXPA 4JLEA 2B1EA 2DI4A 4EZHA 3MACA 2XTLA 4HFVA 5FY0A 1MMNA 3UULA 5JREA 2C5KT 4B6XA 2UXXB 4OYKA 4GK5E 3J9X1 1YW0A 3ESLA 3UUMA 2ZM8A 4AQGA 4BAYB 1G73A 3FHNA 3ETUA 4XBFB 3N2GE 4L0RA 3RKOA 3ZN0B 3HA4A 2ODVA 2YU2A 3RC8A 4OHFA 1NWMX 1LKXA 4PJMA 2ZMAA 2BDEA 5FY1A 2L3LA 1MMDA 3ZJ1A 2X68A 2JMKA 3AVSA 3N5LA 1YD8G 3B57A 1MMAA 3PUGA 5J1GA 4CI2B 2MOZA 4UF0A 3ZPOA 3KV9A 4ANJA 3W15B 4CXXA 4XAXB 5ETWA 2PJQA 5FXZA 5HXEA 1HG5A 4EYYR 3OYXA 5LHIB 2XASB 5HXHA 5LNKA 5J2TE 1IJ5A 4EXTA 3QUJA 2N1GA 1MNDA 1FMVA 4QXBB 4IIJE 5HYAA 4MHCA 4HN9A 4GOUA 3BQKA 4I50E 3PUQA 4H63H 5LGNB 2WM9A 3LK42 1VOMA 5L3EB 1WR6A 1VRBA 4O2AE 4WBOA 3O9XA 4AKLA 1IAPA 4PK4A 4HTEA 5M4YA 1UX5A 2H3RA 2DNXA 3AA7B 3A5XA 5KMGP 3SOLA 4KP3C 1CUNA 5KX5E 3PUAA 3UUXB 3RYHE 4KBMB 4IE0A 4YFSA 3LJCA 1D1CA 2XAFB 4O8SA 4UV8B 3ZLIA 4ILUA 3C98B 2HPLA 3ZMUB 3AAAB 2Q9QA 2G0UA 4K0UA 5AFUL 2JMHA 3LFMA 3H3AA 2DCFA 2BVMA 3C4WA 4P0BA 3N9OA 4O2BE 4BA9A 5BMVE 2YK0A 1ZKEA 3GN5A 4IE6A 4OK0A 3PUSA 2DWGA 4ZHQE 3O1HA 1SA0E 3E0ZA 4NUUA 4TV9E 1MIVA 3OJAA 3JC6D 5JVDE 3N9LA 2X51A 1NAFA 3PDYA 3RRCA 1D1BA 3K3QC 2MYSA 4TN7B 1SHZC 3Q2MA 2VB6A 2Y48B 3OYZA 2E9XB 4UVAB 1U5PA 4WBNE 2RA1A 5LJMA 3AVRA 2LSGA 2V7KA 3KVBA 1Y64B 4H9SE 1FIOA 3Q5WA 2KLQA 3N9MA 3PURA 4ISTA 1E1HB 3NZPA 3AA1B 3LBXB 2XAQB 4QWNB 5LA6E 2XAGB 2D0UA 3KV5A 2Q9QC 3KINB 4HE8A 3ZC0A 1LVFA 2NW8A 2H7VC 5L3BB 2W62A 4KUMB 5EK4A 4AKHA 5LYJE 5EK3A 3HL6A 3AAEB 3UT5E 4L9IA 3HKBE 3FXEB 4GK0E 3V5SA 3PU3A 2EHOA 4H9NC 3RRWA 2K5BB 1MMGA 3ZJ2A 2V7MA 3RYCE 4ZOLE 3UTKA 5DQVA 3N2KE 3EUHA 2E9XA 3SRZA 2CEAA 2KXPB 3CQCB 4G63A 2CLYB 3BK9A 5FXVA 1BR4A 4XZCA 2ODUA 3IEEA 3WI3A 4TX5A 2JJ9A 2YU1A 2LOSA 4UVBB 4X1YE 3S4UA 2V1DB 3LG7A 1D1AA 3LBXA 2LT3A 2WAUA 4GYRA 3KBUA 4CZZB 4H9QC 5FYMA 3ANWB 3QC9A 4I55E 4E7ZA 5A1LA 4DBQA 4UEMA 1IJ6A 4G2AA 1EZ3A 2C5IT 3P8CD 3HKEE 4YJ2E 3RYFE 3ETVA 2VL8A 2EHOC 3CKDA 4CI1B 2W00A 1FMWA 3KV6A 4QHOA 3N9PA 2X9HA 1US7B 3I9YA 4UIGA 2CWOA 3GMIA 4JEHB 1V9DA 5L3GB 5JRCB 2E9XC 4UELA 2V7LA 2JQQA 3K3OA 1WLXA 4PK6A 3KDSE 4WNKA 5H6QB 4DNDA 2W61A 2VKHA 4IE4A 5JDLA 4MLKA 4CQIA 1UCUA 2YINA 3OBVE 2PBIA 1S94A 5TAOA 3AAIA 2C0SA 3ONXA 5CB4E 4H63V 1X79A 3ANWA 3DP7A 3DTOA 2L8KA 2NTYA 3MJXA 5LGUB 1FEWA 3C64A 5LCYA 3ZYLA 4IDZA 3RH3A 2CXDA 2JPFA 5FXWA 4DMVA 4ZI3D 2KNDA 5LGTB 2OA5A 2IW5B 4YJ3E 3HI2A 4C91A 5DJQC 4QXHB 3L3PA 4DMWA 4UVCB 5FXXA 4CXWA 4M1PA 3R6NA 5HWYA 4P0AA 4IGUA 2MTQA 2X9YA 5JR9B 2LHRA 2CLYC 4EIWA 3N9QA 4NUVA 3RPUA 3CPZA 3C50A 4ZI2C 3E22E 3NZQA 2C5JA 4A56A 1H7CA 1ZEEA 3VU7H 3MK7C 1ZHCA 2LSKA 4CXYA 2A3DA 2SPCA 4CI3B 4I43B 3KBTA 2X9WA 3RYIE 2K24A 3PU8A 2KT9A 3FBLA 2W63A 4OYJA 4OFZA 2IC9A 4PK5A 3WAJA 2X0LB 5JDFA 2QGSA 5LJNA 3NRYA 1IZNB 3ZYMA 2WMNA 2N9DA 4AKGA 5HXSA 4HKAA 2HPJA 2LEHA 4O4LE 1D0ZA 2ES0A 1UX4A 5JR9A 2E8IA 3N2OA 3MXZA 5IHYA 2LJLA 3T8OA 2K48A 2VKDA 5E0OA 4ERRA 2BVLA 1BR2A 4PJNA 1HG2A 3HKCE 2QA7A 3KVAA 2Y6XA 2DHRA 4QXCB 3I1AA 3WAKA 5JDMA 4U74A 2X66A 3NBXX 3VKHA 2KMFA 4ZS3A 1O3XA 4MFRA 3FXDB 3EDUA 4QX7B 4V1Av 3ZYKA 5HWXA 2M67A 3K8PC 3PTRB 3Q5XA 3L09A 3BQLA 2LSJA 4AKRB 4L5GA 3H37A 1KK7A 1LRZA 2PFVA 3IF8B 2X67A 5LBMA 3FBZA 5F3JA 4AKIA 4ADZA 2XHEB 5JDQA 4X1KE 1BR0A 3CX8B 4KMCA 3V5UA 3KFWX 3VHLA 5JR9C 2DLRA 4U72A 1MNEA 3R84B 2KZ7B 2ZM2A 2J1DG 2Q9QD 2MBGA 4GYSA 2N2NA 4PNIA 4EOZB 5DQWA 5L2LA 2ACXA 2LOPA 2NP9A 2VKOA 5LG4A 1U4QA 4PFOA 5JH7E 2DWKA 2VK9A 2Z6EA 4EAHA 2W0GA 1QSDA 3SS1A 3LK2B 3ZMSB 5F8PA 1D0XA 2CXLA 5DABA 2WBLA 2NWBA 3OKQA 3PE0A 3RX6A 4EB6E 1Z0PA 4MBQA 2VASA 3HKDE 3VKGA 1OXZA 3C4XA 4EZ4A 3C4ZA 3ZC1A 3UFEA 3CWZB 1OWAA 3K3NA 2LE8A 4O4HE 2JRKA 2V26A 5FMNA 3MA9A 4HGAA 5L3FB 4BJNA 2CE7A 3U78A 4TV8E 4YLHA 2NOXA 5L3DB 4AI6A 2P9BA 3F31A 4IHJE 5HAXA 3ZN1B 3DJBA 4O4IE 5HXRA 4H9OC 5FY7A 5LOVE 3J7Yq 3ZEFB 2X9XA 4ZI3C 5ADXL 3HR0A 1YKHB 2I59A 2H7OA 2EHOD 5HXCA 2CCQA 2L9QA 4BJMA 2XAHB 2NW9A 2CMRA 3CQGB 1B7TA 2LM9A 3I9WA 2E9XD 4PFPA 4DVDA 4QX8B 5LP6E 3F2EA 4WW0A 5JRCA 2D0TA 3UUNA 5LHGB 3EVYA 3O4XE 4ZI7E 4UV9B 2YEVC 2Q9QB 5L3CB 2IC6A 1HS7A 2VWAA 5KDMC 3FB2A 3ZMVB 2ZLYA 4ISSA 2CXFA 3GN5B 2IAKA 2XQYA 1YKEB 4TUYE 1WYCA 5LHHB 3GA8A 4PAGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L8K A; 
#chains in the Genus database with same CATH topology
 1KNZ A;  2D9D A;  4MAL A;  2H88 A;  3KV4 A;  2WWV A;  2BKP A;  3ZCJ A;  5CA0 E;  1MIY A;  5AQR B;  1DU2 A;  3CQX C;  5C2T A;  4N78 D;  3GWH A;  3TLS A;  3MKD A;  3CML A;  3IHR A;  3ONL C;  5C8Y E;  2A2F X;  4DUY T;  1KFY A;  1AJ3 A;  3OVU A;  4F8H A;  4AQF A;  2FJD A;  3AA0 B;  2QRX A;  5IYZ E;  3RGL A;  4LF6 T;  3NRX A;  4HEA A;  3AEB A;  4UXN B;  4HWD A;  4FJO A;  4TWF A;  1HNW T;  3I0Q A;  2WMO A;  4IDO A;  2CA5 A;  4TNV A;  4X1I E;  1QUU A;  2GK9 A;  1LVK A;  2PG8 A;  4IE5 A;  3ZMZ B;  3AA6 B;  2V6Y B;  2VVN A;  3FZL B;  4WZX A;  4AQF C;  4JLE A;  3MAC A;  2UXX B;  2I0M A;  2FJB A;  4XBF B;  4HWC A;  5FL0 A;  3RC8 A;  4PJM A;  2HHH T;  3ZJ1 A;  3AVS A;  1UUS A;  3PUG A;  3W15 B;  4U2Y A;  1HG5 A;  4EYY R;  5LHI B;  2XAS B;  5J2T E;  1IJ5 A;  5AQH B;  4ZXL A;  1IBL T;  2N1G A;  4EEB A;  4HN9 A;  3PUQ A;  2WM9 A;  2RPA A;  2OV9 A;  5L3E B;  5IUX A;  4PK4 A;  5M4Y A;  3AXJ B;  5KMG P;  3RIU A;  4YY3 T;  3UUX B;  3UU6 A;  4KBM B;  4OX9 T;  2XAF B;  2FJE A;  3ZMU B;  2JMH A;  2BVM A;  4P0B A;  5ABF A;  4BA9 A;  1ZKE A;  3GN5 A;  2DWG A;  3E0Z A;  4B3S T;  3PJA J;  2XSA A;  2UUC T;  1QLB A;  1SHZ C;  3PJA A;  3OYZ A;  2Y48 B;  3RIU C;  2XJ7 A;  4ILB A;  2V7K A;  3NWI A;  2YDR A;  2KLQ A;  4IST A;  3P50 A;  4QWN B;  1SUM B;  2XAQ B;  3RLF F;  2HN2 A;  2D0U A;  3KV5 A;  4I0U A;  3ZC0 A;  4IDP A;  4DR4 T;  1LVF A;  5AQT B;  4AKH A;  5EK3 A;  3VRB A;  3AAE B;  2IIU A;  2BS4 A;  2EHO A;  3L39 A;  3UTK A;  3N2K E;  3TLU A;  3EUH A;  4A5X A;  2BG9 B;  3SRZ A;  1VCT A;  5FXV A;  3WI3 A;  3K1S A;  2WP9 A;  2JJ9 A;  4ZZB A;  1UUR A;  3EAM A;  5FYM A;  2HN1 A;  1EZ3 A;  2C5I T;  2VL8 A;  2EHO C;  4CI1 B;  3N9P A;  2X9H A;  1US7 B;  3GMI A;  2E5V A;  3K3O A;  3KDS E;  2VKH A;  4X62 T;  2J62 A;  4JI6 T;  3OBV E;  4HWH A;  5TAO A;  3UU8 A;  3ONX A;  4YT0 A;  1X79 A;  3DP7 A;  2L8K A;  2NTY A;  5AQQ B;  4IDZ A;  5FXW A;  4ZI3 D;  2OA5 A;  4QXH B;  3T1Y T;  1IBM T;  4UVC B;  3EHZ A;  2X9Y A;  4YSY A;  2M6I A;  2CLY C;  4NIQ A;  3N9Q A;  2CBI A;  3UU5 A;  3JAE A;  3E22 E;  1GQE A;  4A56 A;  1ZEE A;  2LSK A;  4I43 B;  2FJA A;  1M62 A;  3JAF A;  2WY2 A;  4OFZ A;  2IC9 A;  4PK5 A;  3WAJ A;  1VCS A;  2X0L B;  1KNR A;  2WMN A;  4AKG A;  4HKA A;  4O4L E;  1D0Z A;  2ES0 A;  1UX4 A;  2I6H A;  4TWD A;  3MXZ A;  3T8O A;  4ERR A;  2BVL A;  1BR2 A;  2WDV A;  2CPT A;  5ABE A;  3AEA A;  3HKC E;  2Y6X A;  4U74 A;  2UXB T;  1O3X A;  4DR5 T;  3FXD B;  4V1A v;  5AQM B;  3Q5X A;  1ZP0 A;  4AKR B;  4U2Z A;  4X66 T;  1XZY A;  2LM2 A;  2X67 A;  4AKI A;  5JDQ A;  3CX8 B;  4YTM A;  3KFW X;  4U72 A;  1MNE A;  3R84 B;  2KZ7 B;  2XQ3 A;  2Q9Q D;  4GYS A;  4DV5 T;  5L2L A;  3EAB A;  2ACX A;  4LMJ A;  2LOP A;  2VKO A;  2VUR A;  3L8R A;  4EAH A;  1D0X A;  4LML A;  1OXZ A;  3ZC1 A;  2LKH A;  4EED A;  4YSX A;  2V26 A;  2R6G F;  3MA9 A;  4HGA A;  5L3F B;  4BJN A;  2CE7 A;  2ZM6 T;  4TV8 E;  4YLH A;  3F31 A;  2VL0 A;  5HXR A;  4H9O C;  5LOV E;  3J7Y q;  2XQ9 A;  4ZI3 C;  5ADX L;  1YKH B;  2I59 A;  2H7O A;  1N32 T;  5HXC A;  2CCQ A;  2XAH B;  3FZF B;  2LM9 A;  3I9W A;  4QX8 B;  5LP6 E;  3F2E A;  3SFE A;  2D0T A;  3EVY A;  3O4X E;  2CBJ A;  2ZLY A;  4TUY E;  5HEG A;  3AE1 A;  4YTN A;  4PAG A;  5AQJ B;  1OED B;  4PW8 A;  2A72 A;  3JC6 C;  3ZCI A;  4ASK A;  3E08 A;  1WYB A;  4DO0 A;  4U7I A;  2D2S A;  5JDH A;  3CX6 B;  2CM0 A;  2V7J A;  2JQ9 A;  3EDV A;  4TZ4 C;  1YQ4 A;  4E7S A;  5JQG E;  3ZMT B;  1HTJ F;  4EV6 A;  2XUE A;  2K3W A;  4QKN A;  5ABH A;  5CA1 E;  1HCI A;  1HF8 A;  2KIN B;  4I4T E;  4DBR A;  5LBQ B;  1KEY A;  2BZB A;  2NTX A;  4O4J E;  4FI5 A;  3MZK B;  5AQL B;  3VRA A;  3OPC A;  4NXM T;  2XAJ B;  2CRB A;  4GIW A;  5HCJ A;  4JUY A;  5KXJ A;  1S35 A;  5EK2 A;  1BR1 A;  4P0A A;  2B1E A;  5FY0 A;  5JRE A;  4GKK T;  2VVS A;  4OYK A;  3J9X 1;  1YW0 A;  3UUM A;  2ZM8 A;  2UXD T;  3HA4 A;  2ODV A;  2YU2 A;  4LFC T;  5FY1 A;  3P4S A;  3VR9 A;  2JMK A;  3P4W A;  3B57 A;  2A9U A;  2V6Y A;  2MOZ A;  2IHR 1;  4ANJ A;  4CXX A;  5HXE A;  4XAX B;  4DR3 T;  4LFB T;  3QUJ A;  3QB5 A;  4GOU A;  2YDQ A;  1WR6 A;  4WBO A;  3O9X A;  3AA7 B;  4HFH A;  3A5X A;  2W4X A;  1HNZ T;  3LJC A;  5FL1 A;  2HPL A;  3AAA B;  4K0U A;  3LFM A;  3H3A A;  2DCF A;  4HFI A;  1XMQ T;  4KI0 F;  4IE6 A;  3PUS A;  4ZHQ E;  1SA0 E;  2WU2 A;  4DV2 T;  3AXJ A;  3RRC A;  4LF8 T;  3Q2M A;  1ZOY A;  2X0Y A;  2RA1 A;  3AVR A;  3AE9 A;  4H9S E;  5CJ5 A;  1E1H B;  2WZI A;  3LBX B;  3NZP A;  1NEK A;  4HE8 A;  4JI0 T;  2NW8 A;  5AQV B;  2H7V C;  4KUM B;  5LYJ E;  4ILA A;  3UT5 E;  5AQS B;  3FXE B;  2XQ5 A;  4H9N C;  3ZJ2 A;  3RYC E;  4ZOL E;  2KXP B;  2XQ8 A;  4XZC A;  3RI5 A;  3P4P A;  4TX5 A;  4UVB B;  1D1A A;  3KBU A;  4JV5 T;  2JIW A;  4DBQ A;  3P4R A;  1IJ6 A;  4G2A A;  3P8C D;  3HKE E;  4HFB A;  4YJ2 E;  3CKD A;  2BG9 A;  2W00 A;  4QHO A;  2CWO A;  3SFD A;  1WLX A;  4DND A;  4IE4 A;  5JDL A;  4MLK A;  2YIN A;  3QOF A;  3AAI A;  5CB4 E;  4H63 V;  2V5D A;  3MJX A;  2F4V T;  2VQF T;  4LF5 T;  5BR8 T;  4JI1 T;  3JAD A;  2KND A;  2IW5 B;  5HCM A;  3HI2 A;  1E7P A;  1XDP A;  4CN6 A;  5FXX A;  3R6N A;  4IGU A;  2MTQ A;  2BG9 C;  3AEC A;  3AEG A;  2LHR A;  1CHU A;  3PUZ F;  3RPU A;  3ZT7 A;  4KHP T;  4EGW A;  2A3D A;  2SPC A;  4CI3 B;  2X9W A;  3FZH B;  3B5M A;  2KT9 A;  1JNR A;  5JDF A;  4HFD A;  5HXS A;  1N34 T;  4TWH A;  5IHY A;  2K48 A;  4QH4 A;  3QNU A;  1HG2 A;  2QA7 A;  5JDM A;  2NR4 A;  2X66 A;  4MFR A;  4DV1 T;  1I94 T;  5HWX A;  3ZYK A;  2WDQ A;  3NKZ A;  2M67 A;  3PTR B;  2MPK A;  2BBJ A;  5AQU B;  1XMO T;  4L5G A;  3FZK B;  1LRZ A;  4HWF A;  5F3J A;  1M7K A;  1J5E T;  2XHE B;  2DLR A;  4KHZ F;  3UQ7 A;  2ZM2 A;  4K0K T;  4DR6 T;  4HFC A;  4PNI A;  2WQY A;  5LB7 B;  2NP9 A;  4PFO A;  2VK9 A;  4WYV A;  4YXD A;  2WBL A;  3PE0 A;  1WR0 A;  4MBQ A;  3HKD E;  3K3N A;  2LE8 A;  4O4H E;  1XNR T;  5FMN A;  3RHW A;  4AI6 A;  2JQK A;  5L4E A;  3ZEF B;  2UUB T;  3AE8 A;  5J0Z A;  3RQU A;  2L9Q A;  2NW9 A;  1B7T A;  3PUV F;  2E9X D;  1FJG T;  4DR2 T;  3RIF A;  5JRC A;  3FZM B;  5LHG B;  2VWA A;  3FB2 A;  4ISS A;  3GN5 B;  2XQY A;  2BKN A;  3X1D A;  1MIW A;  2XQ6 A;  4X20 E;  3AB3 B;  5C3J A;  5H6R B;  2KWI B;  4EYU A;  3RF1 A;  4ZI2 D;  2FBW A;  5FP3 A;  1XDO A;  4C90 A;  2UU9 T;  3D0T A;  3PV0 F;  4IDQ A;  5AQG B;  3Q9D A;  2VKJ A;  4F6R C;  3N9N A;  2RP4 A;  4JI7 T;  3LK3 B;  1OED A;  2CWY A;  2EHO B;  2KWH A;  4IL9 A;  1G8X A;  3A7M A;  5EZY E;  5CGM A;  1T72 A;  1D0Y A;  3Q5D A;  2XY8 B;  2HH7 A;  3IBP A;  2J47 A;  2WSS V;  3AED A;  2D5U A;  3UU4 A;  4U3C A;  1WRD A;  1OED C;  2Y8D A;  2V8S V;  5JDN A;  4J2C A;  4PJJ A;  1XNQ T;  4UF0 B;  4H9R C;  4H9P C;  4AXP A;  2XTL A;  4HFV A;  4U7Y A;  1MMN A;  4JI3 T;  4GK5 E;  3ESL A;  4BAY B;  2H89 A;  5LMU T;  3FHN A;  3ETU A;  5HEU A;  4OHF A;  5F5W A;  1NWM X;  5LMN T;  2L3L A;  1MMD A;  1HNX T;  3N5L A;  3P4Q A;  3ZST A;  1MMA A;  5J1G A;  5ABG A;  3KV9 A;  5FVK A;  2PJQ A;  3OYX A;  5LNK A;  2E5L T;  4MHC A;  5FVL A;  4H63 H;  3LK4 2;  1VOM A;  2YN6 A;  1VRB A;  4Q25 A;  4QH5 A;  1UX5 A;  2H3R A;  2DNX A;  2AXD S;  3SOL A;  1CUN A;  4LFA T;  3PUA A;  4JI5 T;  3RYH E;  4AIU A;  4YFS A;  2WU5 A;  4UV8 B;  3ZLI A;  4ILU A;  3C98 B;  2Q9Q A;  3N9O A;  5BMV E;  5HEJ A;  1W0A A;  4NUU A;  2X51 A;  2AE9 A;  3K3Q C;  2MYS A;  4TN7 B;  3Q5E A;  2VB6 A;  2E9X B;  3G06 A;  1L0V A;  4WBN E;  3LDQ B;  1Y64 B;  1Y01 A;  1FIO A;  3N9M A;  2WS3 A;  2XAG B;  2XSB A;  2Q9Q C;  5L3B B;  4L9I A;  2UUA T;  3HKB E;  3PU3 A;  2V6X A;  3RRW A;  2K5B B;  5L4H A;  2V7M A;  3ZSS A;  2ODU A;  3IEE A;  1Z8U A;  3PUY F;  2YU1 A;  4Z90 A;  2XQ4 A;  4CN1 A;  3LBX A;  1T7S A;  5AQI B;  2XZE A;  2WAU A;  4GYR A;  4CZZ B;  3QB5 K;  3ANW B;  3QC9 A;  4E7Z A;  5A1L A;  2W66 A;  2ACZ A;  1R8I A;  3ETV A;  3PUX F;  4ZZC A;  1XWM A;  4Z91 A;  3CK6 A;  5L3G B;  4DV3 T;  2WDR A;  4UEL A;  5H6Q B;  4IDN A;  2W61 A;  1UCU A;  3LSV A;  2C0S A;  2UXC T;  3DTO A;  5LGU B;  1FEW A;  5LCY A;  1KF6 A;  3RH3 A;  2CXD A;  1KNP A;  5DJQ C;  3L3P A;  4DMW A;  4CXW A;  3RIA A;  4M1P A;  4X65 T;  5JR9 B;  5AQO B;  4UR9 A;  4X64 T;  4EIW A;  4HWI B;  2IDO B;  3NZQ A;  4DR7 T;  2C5J A;  3RQW A;  3MK7 C;  1ZHC A;  4CXY A;  2XPK A;  3KBT A;  2QGS A;  4ILC A;  5LJN A;  3NRY A;  2N9D A;  2HPJ A;  2LEH A;  2E8I A;  2W67 A;  3NBX X;  3VKH A;  3EDU A;  4B3T T;  2XM1 A;  3K8P C;  3L09 A;  3BQL A;  4U31 A;  2YDS A;  2BKO A;  3H37 A;  1KK7 A;  2V5C A;  2PFV A;  3IF8 B;  4JI4 T;  4X1K E;  2CHN A;  3V5U A;  1BR0 A;  4GKJ T;  3VHL A;  2OLT A;  2B76 A;  3TLW A;  2J1D G;  3IA3 A;  2MBG A;  1JNZ A;  4EOZ B;  5DQW A;  4HFE A;  5L47 A;  5JH7 E;  2Z6E A;  1QSD A;  3ZMS B;  3LK2 B;  5F8P A;  1HX1 B;  5DAB A;  3RX6 A;  4EB6 E;  3C4X A;  3CWZ B;  4JBW F;  2FUP A;  2BS3 A;  3U78 A;  1N36 T;  4IHJ E;  3ZN1 B;  4O4I E;  3OTO T;  3AE7 A;  5JTG A;  2J4G A;  2EHO D;  4BJM A;  2CMR A;  4B3R T;  2XQA A;  4DV6 T;  4UV9 B;  5L3C B;  5KDM C;  4DID B;  5CFB A;  2IAK A;  1YKE B;  1WYC A;  4COF A;  3I0O A;  5GON E;  2V7I A;  5FKY A;  4JEU B;  1T98 A;  5HEO A;  4DV0 T;  2W2U A;  4YHJ A;  3CX7 B;  3AE3 A;  4NXN T;  3CVR A;  3ZT5 A;  3O1J A;  3U3I A;  1ZV4 X;  1J5W A;  2M6B A;  2NW7 A;  2LSI A;  1WFD A;  3RC3 A;  2BG9 E;  4YSZ A;  2LHN A;  4ZS2 A;  4Z8X A;  1HFA A;  4QH1 A;  3M65 A;  3TKL B;  5JDG A;  5LXT E;  3RKG A;  3O1I A;  2WWU A;  2IUB A;  3QK6 A;  3A8Y C;  4IL4 A;  5J2U E;  3B13 A;  4PJL A;  4U33 A;  4YTP A;  5FNV E;  2UXN B;  4P09 A;  4ZEY A;  2ZM0 A;  3AEE A;  2K9A A;  4IE7 A;  3C51 A;  2LSY A;  3AEF A;  2WZH A;  3SWH A;  1HX8 A;  2LRL A;  4YHH T;  3ZKR A;  3BQI A;  4LF7 T;  3P7I A;  3F57 A;  4EZH A;  2DI4 A;  3CIR A;  2VQE T;  3UUL A;  2C5K T;  4B6X A;  1NEN A;  4AQG A;  4DV4 T;  2YOE A;  1G73 A;  5AQK B;  3N2G E;  4L0R A;  3RKO A;  3ZN0 B;  4DV7 T;  3JCF A;  1UGO A;  1LKX A;  2ZMA A;  2BDE A;  2X68 A;  1YD8 G;  1UK5 A;  4CI2 B;  1HR0 T;  4UF0 A;  4LF9 T;  3ZPO A;  5AQP B;  5ETW A;  5FXZ A;  5HXH A;  2XQ7 A;  4EXT A;  1MND A;  1FMV A;  4QXB B;  4IIJ E;  5HYA A;  3TLT A;  3BQK A;  4I50 E;  5ABF B;  5LGN B;  4O2A E;  4AKL A;  2DL1 A;  1IAP A;  4HTE A;  4JI2 T;  3UQ4 A;  2BS2 A;  4KP3 C;  5KX5 E;  4X5T A;  4IE0 A;  1D1C A;  4O8S A;  1YXR A;  2G0U A;  5AFU L;  3C4W A;  4O2B E;  2YK0 A;  4OK0 A;  2X0H A;  3O1H A;  4DUZ T;  4AQY T;  4TV9 E;  1MIV A;  3OJA A;  3AE2 A;  3JC6 D;  5JVD E;  3N9L A;  1NAF A;  3PDY A;  1D1B A;  4CN4 A;  2KSR A;  4UVA B;  1U5P A;  5LJM A;  2LSG A;  3KVB A;  1E2A A;  3Q5W A;  3PUR A;  3AA1 B;  5LA6 E;  3KIN B;  4A98 A;  3AE6 A;  2W62 A;  5EK4 A;  3HL6 A;  4GK0 E;  3V5S A;  1MMG A;  2QYW A;  5DQV A;  2LLY A;  2E9X A;  2CEA A;  4DR1 T;  4B3M T;  3CQC B;  4G63 A;  2CLY B;  3BK9 A;  3UUB A;  1BR4 A;  2LOS A;  5IWA T;  2BBH A;  4X1Y E;  3S4U A;  2V1D B;  3LG7 A;  4IRE A;  3UU3 A;  2LT3 A;  4H9Q C;  4I55 E;  4UEM A;  3RYF E;  3PUW F;  1T8B A;  4LF4 T;  1FMW A;  2LRK A;  3KV6 A;  3I9Y A;  4UIG A;  1IBK T;  4JEH B;  1V9D A;  5JRC B;  4LMK A;  2E9X C;  2V7L A;  2JQQ A;  4WNK A;  4PK6 A;  1N33 T;  4CQI A;  2PBI A;  1S94 A;  1YQ3 A;  1OED E;  5AQF B;  3M3Z B;  3EI0 A;  3ANW A;  1W0B A;  1SE7 A;  3C64 A;  3ZYL A;  2JPF A;  2WB5 A;  4DMV A;  5LGT B;  4YJ3 E;  4C91 A;  5HWY A;  4NUV A;  3CPZ A;  3C50 A;  4ZI2 C;  4JI8 T;  4IT4 A;  1H7C A;  3VU7 H;  2JQH A;  3RYI E;  3T1H T;  2K24 A;  5HEH A;  3PU8 A;  3NVO A;  3FBL A;  2W63 A;  4OYJ A;  1W9R A;  2CHO A;  1IZN B;  3ZYM A;  3H3M A;  5JR9 A;  3N2O A;  4AIS A;  2LJL A;  1X9B A;  2VKD A;  5E0O A;  4PJN A;  2PTF A;  3KVA A;  2DHR A;  4QXC B;  3I1A A;  3WAK A;  3TLV A;  2KMF A;  4ZS3 A;  1I6Z A;  4QX7 B;  3UFG A;  2YKS A;  2LSJ A;  2IML A;  3ABV A;  5LBM A;  3FBZ A;  4ADZ A;  4JYA T;  5JR9 C;  4KMC A;  1J1J A;  2N2N A;  4P1N A;  4NPP A;  5LG4 A;  1U4Q A;  3AE5 A;  2DWK A;  2W0G A;  3AE4 A;  3SS1 A;  2CXL A;  3OKQ A;  2NWB A;  5AQN B;  1Z0P A;  3VR8 A;  2VAS A;  3VKG A;  4EZ4 A;  3C4Z A;  4TNW A;  3UFE A;  1OWA A;  2JRK A;  3ZT6 A;  2WCA A;  1W09 A;  3ONJ A;  2NOX A;  5L3D B;  2P9B A;  5LG3 A;  5HAX A;  3DJB A;  5FY7 A;  2MAW A;  2X9X A;  2XM2 A;  3HR0 A;  1WCR A;  3CQG B;  2QVA A;  4A97 A;  4PFP A;  4DVD A;  4WW0 A;  3UUN A;  4KX6 A;  4ZI7 E;  2YEV C;  2Q9Q B;  2IC6 A;  1HS7 A;  2E2A A;  3ZMV B;  2CXF A;  2LKG A;  5LHH B;  3GA8 A; 
#chains in the Genus database with same CATH homology
 3I0O A;  5GON E;  1MIW A;  2V7I A;  4PW8 A;  1KNZ A;  2A72 A;  3JC6 C;  4X20 E;  3ZCI A;  4JEU B;  3AB3 B;  1T98 A;  4MAL A;  4ASK A;  5H6R B;  4YHJ A;  3CX7 B;  2KWI B;  3KV4 A;  3E08 A;  1WYB A;  4DO0 A;  4EYU A;  3ZCJ A;  4ZI2 D;  5CA0 E;  5FP3 A;  3CVR A;  4C90 A;  1MIY A;  2D2S A;  3D0T A;  5JDH A;  3O1J A;  3U3I A;  3CQX C;  4N78 D;  3CX6 B;  2VKJ A;  3Q9D A;  2CM0 A;  1ZV4 X;  3GWH A;  2V7J A;  2NW7 A;  3EDV A;  4F6R C;  3N9N A;  2LSI A;  3MKD A;  4TZ4 C;  3RC3 A;  3CML A;  2RP4 A;  4E7S A;  2LHN A;  3IHR A;  5JQG E;  3LK3 B;  3ZMT B;  1HTJ F;  2CWY A;  2EHO B;  2KWH A;  4ZS2 A;  2XUE A;  4Z8X A;  4QKN A;  1HFA A;  5C8Y E;  1G8X A;  3M65 A;  5CA1 E;  2A2F X;  3TKL B;  1HCI A;  5JDG A;  5LXT E;  3O1I A;  2WWU A;  1AJ3 A;  5EZY E;  1HF8 A;  2KIN B;  4AQF A;  3QK6 A;  1D0Y A;  4I4T E;  3AA0 B;  4DBR A;  5IYZ E;  5LBQ B;  5J2U E;  3B13 A;  4PJL A;  5FNV E;  2BZB A;  2NTX A;  2UXN B;  3NRX A;  4O4J E;  2HH7 A;  3IBP A;  2WSS V;  4P09 A;  4HEA A;  2ZM0 A;  4FI5 A;  3MZK B;  4UXN B;  2D5U A;  2K9A A;  4FJO A;  4IE7 A;  3C51 A;  2LSY A;  3I0Q A;  2WMO A;  1WRD A;  2Y8D A;  2XAJ B;  3SWH A;  2CA5 A;  1HX8 A;  4X1I E;  1QUU A;  4GIW A;  2GK9 A;  1LVK A;  5JDN A;  2PG8 A;  4J2C A;  4IE5 A;  4JUY A;  4PJJ A;  3ZMZ B;  3AA6 B;  3BQI A;  4UF0 B;  1S35 A;  5EK2 A;  3P7I A;  1BR1 A;  4AQF C;  3F57 A;  4H9R C;  4H9P C;  4AXP A;  4JLE A;  2B1E A;  2DI4 A;  4EZH A;  3MAC A;  2XTL A;  4HFV A;  5FY0 A;  1MMN A;  3UUL A;  5JRE A;  2C5K T;  4B6X A;  2UXX B;  4OYK A;  4GK5 E;  3J9X 1;  1YW0 A;  3ESL A;  3UUM A;  2ZM8 A;  4AQG A;  4BAY B;  1G73 A;  3FHN A;  3ETU A;  4XBF B;  3N2G E;  4L0R A;  3RKO A;  3ZN0 B;  3HA4 A;  2ODV A;  2YU2 A;  3RC8 A;  4OHF A;  1NWM X;  1LKX A;  4PJM A;  2ZMA A;  2BDE A;  5FY1 A;  2L3L A;  1MMD A;  3ZJ1 A;  2X68 A;  2JMK A;  3AVS A;  3N5L A;  1YD8 G;  3B57 A;  1MMA A;  3PUG A;  5J1G A;  4CI2 B;  2MOZ A;  4UF0 A;  3ZPO A;  3KV9 A;  4ANJ A;  3W15 B;  4CXX A;  4XAX B;  5ETW A;  2PJQ A;  5FXZ A;  5HXE A;  1HG5 A;  4EYY R;  3OYX A;  5LHI B;  2XAS B;  5HXH A;  5LNK A;  5J2T E;  1IJ5 A;  4EXT A;  3QUJ A;  2N1G A;  1MND A;  1FMV A;  4QXB B;  4IIJ E;  5HYA A;  4MHC A;  4HN9 A;  4GOU A;  3BQK A;  4I50 E;  3PUQ A;  4H63 H;  5LGN B;  2WM9 A;  3LK4 2;  1VOM A;  5L3E B;  1WR6 A;  1VRB A;  4O2A E;  4WBO A;  3O9X A;  4AKL A;  1IAP A;  4PK4 A;  4HTE A;  5M4Y A;  1UX5 A;  2H3R A;  2DNX A;  3AA7 B;  3A5X A;  5KMG P;  3SOL A;  4KP3 C;  1CUN A;  5KX5 E;  3PUA A;  3UUX B;  3RYH E;  4KBM B;  4IE0 A;  4YFS A;  3LJC A;  1D1C A;  2XAF B;  4O8S A;  4UV8 B;  3ZLI A;  4ILU A;  3C98 B;  2HPL A;  3ZMU B;  3AAA B;  2Q9Q A;  2G0U A;  4K0U A;  5AFU L;  2JMH A;  3LFM A;  3H3A A;  2DCF A;  2BVM A;  3C4W A;  4P0B A;  3N9O A;  4O2B E;  4BA9 A;  5BMV E;  2YK0 A;  1ZKE A;  3GN5 A;  4IE6 A;  4OK0 A;  3PUS A;  2DWG A;  4ZHQ E;  3O1H A;  1SA0 E;  3E0Z A;  4NUU A;  4TV9 E;  1MIV A;  3OJA A;  3JC6 D;  5JVD E;  3N9L A;  2X51 A;  1NAF A;  3PDY A;  3RRC A;  1D1B A;  3K3Q C;  2MYS A;  4TN7 B;  1SHZ C;  3Q2M A;  2VB6 A;  2Y48 B;  3OYZ A;  2E9X B;  4UVA B;  1U5P A;  4WBN E;  2RA1 A;  5LJM A;  3AVR A;  2LSG A;  2V7K A;  3KVB A;  1Y64 B;  4H9S E;  1FIO A;  3Q5W A;  2KLQ A;  3N9M A;  3PUR A;  4IST A;  1E1H B;  3NZP A;  3AA1 B;  3LBX B;  2XAQ B;  4QWN B;  5LA6 E;  2XAG B;  2D0U A;  3KV5 A;  2Q9Q C;  3KIN B;  4HE8 A;  3ZC0 A;  1LVF A;  2NW8 A;  2H7V C;  5L3B B;  2W62 A;  4KUM B;  5EK4 A;  4AKH A;  5LYJ E;  5EK3 A;  3HL6 A;  3AAE B;  3UT5 E;  4L9I A;  3HKB E;  3FXE B;  4GK0 E;  3V5S A;  3PU3 A;  2EHO A;  4H9N C;  3RRW A;  2K5B B;  1MMG A;  3ZJ2 A;  2V7M A;  3RYC E;  4ZOL E;  3UTK A;  5DQV A;  3N2K E;  3EUH A;  2E9X A;  3SRZ A;  2CEA A;  2KXP B;  3CQC B;  4G63 A;  2CLY B;  3BK9 A;  5FXV A;  1BR4 A;  4XZC A;  2ODU A;  3IEE A;  3WI3 A;  4TX5 A;  2JJ9 A;  2YU1 A;  2LOS A;  4UVB B;  4X1Y E;  3S4U A;  2V1D B;  3LG7 A;  1D1A A;  3LBX A;  2LT3 A;  2WAU A;  4GYR A;  3KBU A;  4CZZ B;  4H9Q C;  5FYM A;  3ANW B;  3QC9 A;  4I55 E;  4E7Z A;  5A1L A;  4DBQ A;  4UEM A;  1IJ6 A;  4G2A A;  1EZ3 A;  2C5I T;  3P8C D;  3HKE E;  4YJ2 E;  3RYF E;  3ETV A;  2VL8 A;  2EHO C;  3CKD A;  4CI1 B;  2W00 A;  1FMW A;  3KV6 A;  4QHO A;  3N9P A;  2X9H A;  1US7 B;  3I9Y A;  4UIG A;  2CWO A;  3GMI A;  4JEH B;  1V9D A;  5L3G B;  5JRC B;  2E9X C;  4UEL A;  2V7L A;  2JQQ A;  3K3O A;  1WLX A;  4PK6 A;  3KDS E;  4WNK A;  5H6Q B;  4DND A;  2W61 A;  2VKH A;  4IE4 A;  5JDL A;  4MLK A;  4CQI A;  1UCU A;  2YIN A;  3OBV E;  2PBI A;  1S94 A;  5TAO A;  3AAI A;  2C0S A;  3ONX A;  5CB4 E;  4H63 V;  1X79 A;  3ANW A;  3DP7 A;  3DTO A;  2L8K A;  2NTY A;  3MJX A;  5LGU B;  1FEW A;  3C64 A;  5LCY A;  3ZYL A;  4IDZ A;  3RH3 A;  2CXD A;  2JPF A;  5FXW A;  4DMV A;  4ZI3 D;  2KND A;  5LGT B;  2OA5 A;  2IW5 B;  4YJ3 E;  3HI2 A;  4C91 A;  5DJQ C;  4QXH B;  3L3P A;  4DMW A;  4UVC B;  5FXX A;  4CXW A;  4M1P A;  3R6N A;  5HWY A;  4P0A A;  4IGU A;  2MTQ A;  2X9Y A;  5JR9 B;  2LHR A;  2CLY C;  4EIW A;  3N9Q A;  4NUV A;  3RPU A;  3CPZ A;  3C50 A;  4ZI2 C;  3E22 E;  3NZQ A;  2C5J A;  4A56 A;  1H7C A;  1ZEE A;  3VU7 H;  3MK7 C;  1ZHC A;  2LSK A;  4CXY A;  2A3D A;  2SPC A;  4CI3 B;  4I43 B;  3KBT A;  2X9W A;  3RYI E;  2K24 A;  3PU8 A;  2KT9 A;  3FBL A;  2W63 A;  4OYJ A;  4OFZ A;  2IC9 A;  4PK5 A;  3WAJ A;  2X0L B;  5JDF A;  2QGS A;  5LJN A;  3NRY A;  1IZN B;  3ZYM A;  2WMN A;  2N9D A;  4AKG A;  5HXS A;  4HKA A;  2HPJ A;  2LEH A;  4O4L E;  1D0Z A;  2ES0 A;  1UX4 A;  5JR9 A;  2E8I A;  3N2O A;  3MXZ A;  5IHY A;  2LJL A;  3T8O A;  2K48 A;  2VKD A;  5E0O A;  4ERR A;  2BVL A;  1BR2 A;  4PJN A;  1HG2 A;  3HKC E;  2QA7 A;  3KVA A;  2Y6X A;  2DHR A;  4QXC B;  3I1A A;  3WAK A;  5JDM A;  4U74 A;  2X66 A;  3NBX X;  3VKH A;  2KMF A;  4ZS3 A;  1O3X A;  4MFR A;  3FXD B;  3EDU A;  4QX7 B;  4V1A v;  3ZYK A;  5HWX A;  2M67 A;  3K8P C;  3PTR B;  3Q5X A;  3L09 A;  3BQL A;  2LSJ A;  4AKR B;  4L5G A;  3H37 A;  1KK7 A;  1LRZ A;  2PFV A;  3IF8 B;  2X67 A;  5LBM A;  3FBZ A;  5F3J A;  4AKI A;  4ADZ A;  2XHE B;  5JDQ A;  4X1K E;  1BR0 A;  3CX8 B;  4KMC A;  3V5U A;  3KFW X;  3VHL A;  5JR9 C;  2DLR A;  4U72 A;  1MNE A;  3R84 B;  2KZ7 B;  2ZM2 A;  2J1D G;  2Q9Q D;  2MBG A;  4GYS A;  2N2N A;  4PNI A;  4EOZ B;  5DQW A;  5L2L A;  2ACX A;  2LOP A;  2NP9 A;  2VKO A;  5LG4 A;  1U4Q A;  4PFO A;  5JH7 E;  2DWK A;  2VK9 A;  2Z6E A;  4EAH A;  2W0G A;  1QSD A;  3SS1 A;  3LK2 B;  3ZMS B;  5F8P A;  1D0X A;  2CXL A;  5DAB A;  2WBL A;  2NWB A;  3OKQ A;  3PE0 A;  3RX6 A;  4EB6 E;  1Z0P A;  4MBQ A;  2VAS A;  3HKD E;  3VKG A;  1OXZ A;  3C4X A;  4EZ4 A;  3C4Z A;  3ZC1 A;  3UFE A;  3CWZ B;  1OWA A;  3K3N A;  2LE8 A;  4O4H E;  2JRK A;  2V26 A;  5FMN A;  3MA9 A;  4HGA A;  5L3F B;  4BJN A;  2CE7 A;  3U78 A;  4TV8 E;  4YLH A;  2NOX A;  5L3D B;  4AI6 A;  2P9B A;  3F31 A;  4IHJ E;  5HAX A;  3ZN1 B;  3DJB A;  4O4I E;  5HXR A;  4H9O C;  5FY7 A;  5LOV E;  3J7Y q;  3ZEF B;  2X9X A;  4ZI3 C;  5ADX L;  3HR0 A;  1YKH B;  2I59 A;  2H7O A;  2EHO D;  5HXC A;  2CCQ A;  2L9Q A;  4BJM A;  2XAH B;  2NW9 A;  2CMR A;  3CQG B;  1B7T A;  2LM9 A;  3I9W A;  2E9X D;  4PFP A;  4DVD A;  4QX8 B;  5LP6 E;  3F2E A;  4WW0 A;  5JRC A;  2D0T A;  3UUN A;  5LHG B;  3EVY A;  3O4X E;  4ZI7 E;  4UV9 B;  2YEV C;  2Q9Q B;  5L3C B;  2IC6 A;  1HS7 A;  2VWA A;  5KDM C;  3FB2 A;  3ZMV B;  2ZLY A;  4ISS A;  2CXF A;  3GN5 B;  2IAK A;  2XQY A;  1YKE B;  4TUY E;  1WYC A;  5LHH B;  3GA8 A;  4PAG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...