2L8KA

Nmr structure of the arterivirus nonstructural protein 7 alpha (nsp7 alpha)
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
123
structure length
123
Chain Sequence
GLTATLAALTDDDFQFLSDVLDCRAVRSAMNLRAALTSFQVAQYRNILNASLQVDRDAARSRRLMAKLADFAVEQEVTAGDRVVVIDGLDRMAHFKDDLVLVPLTTKVVGGSRCTICDVVKEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and Genetic Analysis of the Arterivirus Nonstructural Protein 7{alpha}.
pubmed doi rcsb
source organism Equine arteritis virus
molecule tags Viral protein
molecule keywords Non-structural protein 7
total genus 28
structure length 123
sequence length 123
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2011-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16749 Arteri_nsp7a Arterivirus nonstructural protein 7 alpha
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.950 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2l8kA00
2L8KA
chains in the Genus database with same CATH superfamily
5EK2A 2PJQA 4KP3C 2A3DA 1EZ3A 1NWMX 2XPKA 5AQUB 4EYYR 2ZM0A 1WLXA 4EB6E 4P1NA 4P0BA 4V1Av 4DV6T 1MMGA 2L9QA 3KV4A 3LSVA 3WI3A 3ZKRA 2W63A 3T1HT 1D0XA 3AE4A 2LSJA 3PUAA 4YT0A 4ZHQE 4ZOLE 5J2TE 3EDVA 4X65T 1M62A 3LK3B 5AQJB 3O9XA 3UU6A 3N9PA 4H9RC 5AQFB 2RPAA 3AE9A 1FMVA 2CBJA 5KDMC 2IMLA 3QB5K 3VR9A 3NWIA 2EHOA 2H89A 2WDRA 4PK5A 4ISTA 5DJQC 2XQ6A 2KT9A 2YU1A 4H9NC 4TWHA 1WCRA 2PTFA 5J0ZA 3AVRA 2LOPA 3HL6A 2N1GA 2FJAA 2V6XA 2BDEA 3RH3A 4JI1T 1JNZA 4BJNA 5KX5E 4KBMB 2N2NA 2W4XA 2CE7A 3VRBA 3ZCIA 1BR2A 1M7KA 3PU3A 2W61A 3ZT7A 3RI5A 5ABEA 2IAKA 1HG5A 3BQKA 1W0BA 3L09A 3Q5EA 1G8XA 4UVBB 4IIJE 3CVRA 3ZEFB 3AE7A 4LFBT 1LVKA 4O2BE 5FXVA 2MBGA 5L3GB 2C5JA 2C5KT 2E5VA 1YXRA 2KZ7B 2YKSA 3HA4A 1FJGT 1MNDA 2UXBT 3NKZA 3EVYA 3ZSTA 4ZI7E 3UUNA 3P4SA 4HGAA 3LBXA 4QHOA 5AQHB 5BMVE 3K3OA 2LLYA 5A1LA 1XMQT 3FB2A 4DR5T 1LKXA 5KMGP 2YINA 1Y64B 4IDQA 3V5UA 2VASA 5HEJA 4WNKA 1KF6A 2NWBA 3IA3A 2WU5A 2FUPA 4YJ3E 1ZOYA 5JDGA 3F31A 3FXDB 5BR8T 3S4UA 3HR0A 5FY0A 4DR3T 1N33T 3UU3A 2X51A 3P4PA 3SWHA 5L3CB 3RC8A 2XSBA 1QUUA 3AXJA 5L3BB 5AQRB 4WBNE 2J47A 3D0TA 4Z8XA 4K0KT 4HFHA 3PE0A 4DBQA 5LHGB 2GK9A 2BKPA 2JIWA 2Y6XA 1T98A 4X1KE 2M6IA 4B3RT 4AQYT 4QH5A 2UXNB 2PG8A 3OYXA 5LMUT 3C4XA 1E2AA 4H9OC 4H9PC 5LGNB 1Y01A 3B57A 1ZHCA 4PK4A 4Q25A 3U3IA 5JDNA 1IBKT 4JI3T 1OEDE 3FBZA 4X5TA 3PUZF 4B3TT 1MIWA 2CHOA 2E2AA 4TWDA 2Q9QA 3AB3B 4IDNA 3SOLA 2W66A 4IL9A 2VB6A 3Q5WA 1XDPA 3BQIA 3J7Yq 1UGOA 2ACZA 4OFZA 1YKEB 3PTRB 3RF1A 1HX1B 5HXSA 2ODVA 3VKHA 2VVNA 2W67A 3KVBA 2A9UA 4O4JE 3RRWA 1T7SA 3O1JA 4ZXLA 4X62T 2X66A 3IBPA 2CRBA 5F5WA 4I50E 4ISSA 4LMJA 1WR6A 2E8IA 2W00A 3PUWF 1FIOA 4G63A 4GYRA 4Z91A 4YHJA 5FVKA 2NR4A 3TLSA 3RGLA 4AKGA 3LDQB 2VQFT 5FP3A 2DLRA 4DBRA 2PBIA 4TWFA 4A98A 4PAGA 4JI2T 4IDOA 4UR9A 4CI3B 1LRZA 4CN4A 1UX5A 4GKKT 2K3WA 4X1YE 4YSXA 2MAWA 4UELA 1XNRT 3EAMA 2E5LT 2LJLA 3RC3A 1N32T 5LYJE 3B5MA 4LF8T 2M67A 4JYAT 3ZN0B 3GA8A 3ZJ2A 4TZ4C 4U7IA 1N36T 1D1AA 3ETUA 1X79A 2XM1A 3C51A 2NOXA 2J1DG 3ZT5A 2CPTA 4CXYA 2UUCT 2BBJA 2UUBT 4PJLA 2VKOA 3AEEA 3RPUA 1OEDC 2JMKA 2JPFA 1FEWA 4DIDB 5AQLB 5JDHA 4NXNT 5IHYA 4KI0F 4DV0T 4AKRB 1VRBA 2HN1A 2CMRA 3JCFA 1YD8G 4HE8A 5FMNA 1SE7A 4IE7A 3CWZB 3I9WA 3OBVE 3BQLA 3O4XE 3P7IA 4COFA 3L8RA 4H63V 3CQXC 4ZI3D 3KV5A 3MACA 4Z90A 4WZXA 2LT3A 4MALA 3KBTA 3BK9A 2XASB 3G06A 1HX8A 2XZEA 3H37A 2V1DB 4HWHA 4U3CA 5AQVB 3ANWA 5FYMA 2K9AA 3E08A 5JR9A 2K5BB 3J9X1 4ZEYA 1T8BA 1XMOT 2NTXA 2HHHT 2K24A 2IDOB 3FZHB 2QA7A 3A5XA 4ILBA 3RQUA 2VQET 3WAJA 4O8SA 3ZYLA 5JREA 1DU2A 5LHHB 2KINB 2XAHB 1U5PA 3CPZA 3FHNA 4PK6A 4DR1T 4ILCA 5J2UE 3B13A 1W9RA 4KX6A 2C5IT 4HEAA 4JI0T 2XSAA 4C90A 3KV6A 1YKHB 2B76A 5ABFB 5ADXL 2XY8B 4L9IA 4UXNB 5AQOB 3ETVA 5LBMA 3FZMB 2Z6EA 2ZM2A 4TX5A 3VU7H 4E7SA 3P8CD 3QC9A 2IHR1 3TKLB 1MIVA 5CGMA 5JDLA 2L8KA 4AQFA 1HR0T 3AEAA 3R6NA 4JEHB 3C4ZA 3P4WA 1NEKA 3K1SA 3KINB 2FJBA 2ZM8A 3N2KE 2ZMAA 1WYBA 2FJDA 4QXBB 2YDSA 2NP9A 2OLTA 4IE4A 4ZS3A 2G0UA 2IIUA 4TN7B 4QX8B 4F6RC 1QLBA 4U7YA 2I0MA 4IT4A 3KDSE 4DV7T 4UEMA 4EGWA 5CFBA 4PW8A 3ZLIA 1HNXT 3ONXA 3ANWB 2PFVA 4NXMT 3ZMUB 2IW5B 5DQWA 4B3MT 3ZMTB 5JDMA 5FY7A 2EHOD 1O3XA 1YQ3A 4LF7T 2V5DA 1US7B 3AEGA 3AEDA 3ZYKA 4AKHA 2XQ7A 4X66T 2YU2A 2SPCA 3I0QA 4I0UA 5H6RB 5HCMA 3F2EA 3WAKA 5KXJA 4O4IE 4CZZB 5ABHA 4LF6T 2RP4A 3I1AA 5C2TA 2X9WA 3OPCA 3PUGA 4IE5A 4U2YA 2A2FX 3ONLC 4GK0E 2D5UA 3ZPOA 2DWKA 1WR0A 1YQ4A 3A7MA 3OVUA 2XM2A 5FXZA 5JTGA 4DV3T 1I6ZA 2CCQA 4KHPT 4UV9B 3RIAA 2KLQA 2DI4A 3LG7A 2WWVA 3PUSA 4EV6A 4GKJT 3ZT6A 3T1YT 3OKQA 4DV5T 2BS4A 2BVMA 3AXJB 3AA0B 4PJNA 1IJ5A 4MHCA 5L4HA 5LG4A 3PJAJ 2WBLA 1WRDA 5FL1A 4LF9T 5LBQB 2V5CA 2WDVA 5AQSB 1XZYA 2CXFA 4U2ZA 5LP6E 2BZBA 2WDQA 4QWNB 5JR9C 3NRYA 1MMDA 1NENA 2KSRA 3NRXA 4DR7T 2WAUA 2R6GF 4ZS2A 4DR4T 2LKHA 5L47A 3H3AA 3MKDA 1SHZC 2HH7A 4L0RA 4O2AE 3K8PC 2DCFA 3CQCB 3RKGA 4YTNA 2WZIA 4YSZA 3UUXB 4O4LE 5L3DB 2YDRA 3KV9A 5LXTE 4JI8T 1D0ZA 2CHNA 2Y48B 2LM2A 4A56A 5ABFA 2Q9QB 4FJOA 3N9MA 2YEVC 3M3ZB 2JQQA 3PDYA 5JQGE 2QGSA 1HF8A 1BR4A 2WU2A 4LFAT 3RLFF 5CA0E 3DJBA 3HKBE 3P4RA 1D0YA 1JNRA 1OXZA 2XJ7A 2XQYA 3L3PA 3N9NA 4H9QC 4CI1B 5L3FB 2M6BA 1NAFA 2EHOB 4YFSA 2JQKA 5LNKA 2ES0A 1HFAA 2FBWA 2XAFB 2X9HA 3JC6C 4MBQA 5DQVA 5LA6E 3DTOA 2KMFA 3Q5XA 1LVFA 2CWOA 4ZI3C 5JDQA 4DV2T 3ZC0A 3ZYMA 4TNWA 5H6QB 5JR9B 3RKOA 5LOVE 2LSYA 1IZNB 2CXDA 2K48A 2XQ3A 2YOEA 4H63H 4IDPA 5FL0A 3ABVA 2LRLA 1MMAA 3QNUA 3UULA 3X1DA 4O4HE 3QOFA 4JBWF 4KHZF 4JLEA 4OX9T 2XQAA 3PURA 3RIFA 4AISA 2D0TA 1KNPA 2LEHA 4CN6A 3NBXX 2KWHA 4I55E 4LF5T 3AAIA 4BAYB 4AKIA 2BS2A 2UXCT 2CA5A 3C4WA 3P4QA 4XAXB 4YTMA 3O1IA 2Q9QC 2CBIA 3HKEE 5GONE 4U31A 4CQIA 5L4EA 1UURA 3AEFA 2OV9A 1SA0E 3MZKB 4HWIB 4TV8E 5ETWA 2QVAA 4AI6A 2RA1A 2CLYB 2XUEA 4HWCA 2HN2A 3PJAA 4ILAA 2BVLA 5CB4E 2X9XA 3RIUA 3AEBA 3RYCE 2YDQA 3FZLB 3UTKA 5HXCA 3A8YC 2D2SA 4LMKA 3NVOA 3C98B 3U78A 3UUMA 2BBHA 3CIRA 5AQNB 3ZJ1A 5FY1A 3CQGB 4EYUA 5F3JA 1XWMA 3JAEA 3PU8A 3CMLA 4PJJA 3ZC1A 5LG3A 2AXDS 2VKHA 2OA5A 2Q9QD 5IWAT 3IHRA 3JAFA 4TNVA 1T72A 4UF0A 1WFDA 2YN6A 2N9DA 4YXDA 1AJ3A 1ZKEA 2W0GA 1CUNA 4I43B 4XBFB 5HAXA 3DP7A 2KNDA 2WWUA 4JEUB 4JI5T 3CX8B 3UU8A 4AQFC 2VURA 1QSDA 3N2GE 5HXRA 1S94A 1UCUA 5ABGA 4ZZCA 2LHRA 5C8YE 1L0VA 5CA1E 2W62A 5F8PA 1J5WA 3NZQA 5AQKB 2YK0A 5HXHA 3OJAA 3AA7B 3AE3A 1H7CA 2KWIB 2VWAA 2DHRA 3EUHA 3RYFE 1IAPA 4TUYE 4AKLA 4LFCT 2H3RA 3MXZA 4M1PA 4QH1A 4ZI2C 5FXWA 2ODUA 2E9XC 3HI2A 4L5GA 2UUAT 5AQQB 1FMWA 3H3MA 2J62A 3Q5DA 3RRCA 2XTLA 4IHJE 4HFVA 3ZSSA 5M4YA 1HNWT 2HPJA 2BS3A 5JVDE 3K3NA 3ZMVB 2V7IA 4FI5A 4IE6A 1XNQT 3AE5A 2D0UA 4P0AA 3Q2MA 2WY2A 2V7MA 3FZFB 4ILUA 4XZCA 1D1CA 1HTJF 2H7VC 4HFDA 2VL8A 3AE1A 4GYSA 4EZHA 1BR0A 3I9YA 1KEYA 3E22E 2IC6A 3ZMSB 1VCSA 2WMOA 3LK42 1YW0A 3NZPA 2V7KA 5HEUA 3RQWA 2A72A 4NUVA 3HKDE 3MA9A 1X9BA 1UX4A 3KVAA 2J4GA 4GIWA 2E9XD 3LBXB 4DVDA 3RX6A 4JI4T 3AECA 5HXEA 2JQ9A 4HN9A 2BG9E 3TLWA 3EDUA 3EHZA 4WYVA 3N2OA 1WYCA 2WCAA 4KUMB 4BA9A 2UU9T 5JRCA 3GN5A 1MMNA 3FXEB 2P9BA 3UQ4A 2V6YB 1B7TA 2XHEB 2WMNA 3KFWX 5HYAA 1IBMT 3W15B 2C0SA 3EABA 4HFEA 2JRKA 3UUBA 2ZM6T 2VKJA 3QUJA 2MPKA 4IREA 3QB5A 3KBUA 2XAQB 2LSGA 4PNIA 4QH4A 4YHHT 4HFBA 5FNVE 3UU4A 5FXXA 4CI2B 4IDZA 4BJMA 1HNZT 4EZ4A 3AE8A 4OHFA 1KNRA 3I0OA 2L3LA 4GOUA 3FZKB 4AQGA 4DR2T 2V7JA 2WS3A 1OWAA 4LMLA 4QX7B 2E9XA 1E1HB 2DWGA 3CK6A 1HS7A 4HWDA 4ZI2D 2BKNA 1KK7A 3MJXA 2DNXA 5EZYE 2XAJB 5EK4A 4CXWA 3LFMA 2W2UA 1Z0PA 4PJMA 3QK6A 2BG9A 4PFPA 3F57A 4DO0A 3PUVF 2NW8A 3SFEA 4JV5T 1N34T 1OEDA 3IEEA 3ONJA 4X1IE 1Z8UA 4F8HA 5LGTB 3VHLA 2LM9A 2VK9A 4GK5E 3AA1B 5AQGB 3C50A 3RYIE 3SS1A 3V5SA 3IF8B 5JH7E 2BG9C 4YY3T 3N9LA 4E7ZA 3GMIA 3N9OA 3ZMZB 3PUXF 3CKDA 3UFGA 3LJCA 5DABA 3UU5A 2H7OA 5LHIB 1V9DA 3JC6D 4CN1A 5AQMB 2QYWA 4ZZBA 4EAHA 4QXHB 2MTQA 1SUMB 1S35A 4UIGA 4QKNA 3HKCE 4X20E 2X67A 5FKYA 3CX7B 5FVLA 3AE2A 4A97A 1J5ET 4HFIA 4KMCA 4AXPA 3TLUA 2XQ4A 3RYHE 3GN5B 4HWFA 3LK2B 2V7LA 2Y8DA 4YLHA 2DL1A 4N78D 2UXXB 2X9YA 5TAOA 5LCYA 3TLVA 4YJ2E 3RHWA 4DMWA 2D9DA 2XAGB 4DV4T 2AE9A 3ZN1B 2VKDA 4YSYA 3MK7C 4HTEA 4AIUA 1W09A 2MYSA 1VOMA 2LSIA 5HWYA 3K3QC 3C64A 5JDFA 3TLTA 5IYZE 3UT5E 1U4QA 3UFEA 4EOZB 4ERRA 2F4VT 1R8IA 2V8SV 1ZEEA 4C91A 4UVCB 2FJEA 1OEDB 2CM0A 4P09A 5L2LA 3R84B 1VCTA 2LOSA 4DUYT 4EXTA 4U33A 1MNEA 2BG9B 5HEOA 4IE0A 3T8OA 3O1HA 4UVAB 5LB7B 4UV8B 3AVSA 3PUQA 2NW7A 2X0YA 4WW0A 4NIQA 3AE6A 2EHOC 2KXPB 4ASKA 1E7PA 1XDOA 3OYZA 2NTYA 3L39A 2E9XB 3VRAA 1ZP0A 5AQTB 4ANJA 5AFUL 5CJ5A 2ACXA 4QXCB 3M65A 1KNZA 2LSKA 2JQHA 1IBLT 2JJ9A 5AQPB 1BR1A 1G73A 4DMVA 4IL4A 4TV9E 3ZCJA 2WB5A 4MLKA 5LMNT 4DUZT 2BKOA 2WSSV 3VKGA 3AAEB 2CXLA 5AQIB 4CXXA 2B1EA 4YTPA 2V6YA 2CEAA 5E0OA 5LJMA 4DNDA 1J1JA 1KFYA 4J2CA 4H9SE 2I59A 4HFCA 2WP9A 2XQ8A 4G2AA 4JI6T 5LJNA 2WM9A 5HWXA 1UUSA 4PFOA 3E0ZA 3P50A 4DR6T 2ZLYA 3N5LA 5IUXA 3JADA 3Q9DA 4UF0B 5HEGA 4A5XA 1CHUA 1UK5A 2IC9A 3GWHA 4HKAA 2V26A 5EK3A 2LKGA 3SFDA 4EIWA 4X64T 1D1BA 1W0AA 3FBLA 4JUYA 2WZHA 5HCJA 5LGUB 2IUBA 1GQEA 2LRKA 2CLYC 4IGUA 4U74A 4WBOA 4EEDA 5L3EB 2H88A 2QRXA 1I94T 2HPLA 4B3ST 4LF4T 4K0UA 4NPPA 4U72A 2WQYA 1IJ6A 1HG2A 2MOZA 4I4TE 2VL0A 4OYJA 3AA6B 1HCIA 2X0LB 3PV0F 4OK0A 4MFRA 4OYKA 2JMHA 4B6XA 3RIUC 2LHNA 3VR8A 2I6HA 1ZV4X 2X0HA 2VVSA 5HEHA 4EEBA 3UQ7A 2UXDT 3SRZA 3EI0A 4DV1T 5JRCB 1MIYA 4NUUA 2CWYA 5J1GA 3OTOT 2XQ5A 3AAAB 3CX6B 3ESLA 3N9QA 2NW9A 5C3JA 2X68A 2LE8A 4JI7T 2XQ9A 4ADZA 3PUYF
chains in the Genus database with same CATH topology
5EK2A 2PJQA 4KP3C 2A3DA 1EZ3A 1NWMX 4EYYR 2ZM0A 1WLXA 4EB6E 4P0BA 4V1Av 1MMGA 2L9QA 3KV4A 3WI3A 2W63A 1D0XA 2LSJA 3PUAA 4ZHQE 4ZOLE 5J2TE 3EDVA 3LK3B 3O9XA 3N9PA 4H9RC 5KDMC 1FMVA 2EHOA 5DJQC 4PK5A 4ISTA 4H9NC 2KT9A 2YU1A 3AVRA 2LOPA 3HL6A 2N1GA 3RH3A 2BDEA 4BJNA 4KBMB 2N2NA 2CE7A 3ZCIA 1BR2A 3PU3A 2W61A 2IAKA 1HG5A 3BQKA 3L09A 4UVBB 1G8XA 4IIJE 3CVRA 3ZEFB 1LVKA 4O2BE 5FXVA 2MBGA 5L3GB 2C5JA 2C5KT 2KZ7B 3HA4A 1MNDA 3EVYA 4ZI7E 3UUNA 4HGAA 4QHOA 3LBXA 5BMVE 3K3OA 5A1LA 3FB2A 1LKXA 5KMGP 2YINA 1Y64B 3V5UA 2VASA 4WNKA 2NWBA 4YJ3E 5JDGA 3F31A 3FXDB 3S4UA 3HR0A 5FY0A 2X51A 3SWHA 5L3CB 3RC8A 1QUUA 5L3BB 4WBNE 3D0TA 4Z8XA 3PE0A 4DBQA 5LHGB 2GK9A 2Y6XA 1T98A 4X1KE 2UXNB 2PG8A 3OYXA 3C4XA 4H9OC 5LGNB 4H9PC 3B57A 1ZHCA 4PK4A 3U3IA 5JDNA 3FBZA 1MIWA 3SOLA 2Q9QA 3AB3B 2VB6A 3Q5WA 3BQIA 3J7Yq 4OFZA 1YKEB 3PTRB 5HXSA 2ODVA 3VKHA 3KVBA 4O4JE 3RRWA 3O1JA 2X66A 3IBPA 4I50E 4ISSA 1WR6A 2E8IA 2W00A 4G63A 1FIOA 4GYRA 4YHJA 4AKGA 5FP3A 2DLRA 4DBRA 2PBIA 4PAGA 4CI3B 1LRZA 1UX5A 4X1YE 4UELA 2LJLA 3RC3A 5LYJE 2M67A 3ZN0B 3GA8A 3ZJ2A 4TZ4C 1D1AA 3ETUA 1X79A 3C51A 2NOXA 2J1DG 4CXYA 4PJLA 2VKOA 3RPUA 2JMKA 2JPFA 1FEWA 5JDHA 5IHYA 4AKRB 1VRBA 4HE8A 2CMRA 5FMNA 1YD8G 4IE7A 3CWZB 3I9WA 3OBVE 3BQLA 3O4XE 3P7IA 4H63V 3CQXC 4ZI3D 3KV5A 3MACA 2LT3A 4MALA 3KBTA 3BK9A 2XASB 3H37A 1HX8A 5FYMA 5JR9A 2V1DB 3J9X1 3ANWA 2K9AA 3E08A 2K5BB 2NTXA 2K24A 2QA7A 3A5XA 3WAJA 4O8SA 3ZYLA 5JREA 5LHHB 2KINB 2XAHB 1U5PA 3CPZA 3FHNA 4PK6A 5J2UE 3B13A 2C5IT 4HEAA 4C90A 3KV6A 1YKHB 5ADXL 4L9IA 4UXNB 5LBMA 3ETVA 4TX5A 2Z6EA 2ZM2A 4E7SA 3VU7H 3P8CD 3QC9A 3TKLB 1MIVA 5JDLA 2L8KA 4AQFA 3R6NA 4JEHB 3C4ZA 3KINB 3N2KE 4QXBB 2ZM8A 5DQVA 2ZMAA 1WYBA 4ZS3A 2NP9A 4IE4A 2G0UA 4TN7B 4F6RC 4QX8B 3KDSE 4UEMA 4PW8A 3ZLIA 3ONXA 3ANWB 2PFVA 3ZMUB 2IW5B 5DQWA 3ZMTB 5JDMA 5FY7A 2EHOD 1O3XA 4AKHA 1US7B 3ZYKA 2YU2A 2SPCA 3I0QA 5H6RB 3WAKA 3F2EA 4O4IE 4CZZB 2RP4A 3I1AA 2X9WA 3PUGA 4IE5A 2A2FX 4GK0E 2D5UA 3ZPOA 2DWKA 5FXZA 2CCQA 4UV9B 2KLQA 2DI4A 3LG7A 3PUSA 3OKQA 2BVMA 3AA0B 4PJNA 1IJ5A 4MHCA 5LG4A 2WBLA 1WRDA 5LBQB 2CXFA 5LP6E 2BZBA 4QWNB 5JR9C 3NRYA 1MMDA 3NRXA 2WAUA 4ZS2A 3H3AA 3MKDA 1SHZC 2HH7A 4L0RA 4O2AE 3K8PC 2DCFA 3CQCB 3UUXB 4O4LE 5L3DB 3KV9A 5LXTE 1D0ZA 2Y48B 4A56A 2Q9QB 4FJOA 3N9MA 3PDYA 2JQQA 5JQGE 2QGSA 1HF8A 1BR4A 5CA0E 3DJBA 3HKBE 1D0YA 1OXZA 3L3PA 4H9QC 2XQYA 3N9NA 4CI1B 5L3FB 1NAFA 2EHOB 4YFSA 5LNKA 2ES0A 1HFAA 2XAFB 2X9HA 3JC6C 4MBQA 5LA6E 3DTOA 2KMFA 3Q5XA 1LVFA 2CWOA 4ZI3C 5JDQA 3ZC0A 3ZYMA 5JR9B 5H6QB 3RKOA 5LOVE 2LSYA 1IZNB 2CXDA 2K48A 4H63H 3UULA 5KX5E 1MMAA 4O4HE 4JLEA 3PURA 2D0TA 2LEHA 3NBXX 2KWHA 4I55E 3AAIA 4BAYB 4AKIA 2CA5A 3C4WA 4XAXB 3O1IA 2Q9QC 3HKEE 5GONE 4CQIA 1SA0E 3MZKB 4TV8E 5ETWA 4AI6A 2RA1A 2CLYB 2XUEA 2BVLA 5CB4E 2X9XA 3RYCE 3UTKA 5HXCA 2D2SA 3U78A 3UUMA 3C98B 3ZJ1A 4EYUA 5FY1A 3CQGB 5F3JA 3ZC1A 4PJJA 3PU8A 3CMLA 2VKHA 2OA5A 2Q9QD 3IHRA 4UF0A 1AJ3A 2LE8A 2N9DA 1ZKEA 2W0GA 1CUNA 4I43B 4XBFB 5HAXA 3DP7A 2KNDA 2WWUA 4JEUB 3CX8B 4AQFC 1QSDA 3N2GE 5HXRA 1S94A 1UCUA 2LHRA 5C8YE 5CA1E 2W62A 5F8PA 3NZQA 2YK0A 5HXHA 3OJAA 3AA7B 1H7CA 3EUHA 2KWIB 2DHRA 2VWAA 3RYFE 1IAPA 4TUYE 4AKLA 2H3RA 3MXZA 4M1PA 4ZI2C 5FXWA 2ODUA 2E9XC 3HI2A 4L5GA 1FMWA 3RRCA 2XTLA 4IHJE 4HFVA 5M4YA 2HPJA 5JVDE 3K3NA 3ZMVB 2V7IA 4FI5A 4IE6A 2D0UA 4P0AA 3Q2MA 4ILUA 2V7MA 4XZCA 1D1CA 1HTJF 2H7VC 4EZHA 2VL8A 4GYSA 1BR0A 3I9YA 3E22E 2IC6A 3ZMSB 2WMOA 3LK42 1YW0A 3NZPA 2V7KA 2A72A 4NUVA 3HKDE 3MA9A 1UX4A 3KVAA 4GIWA 2E9XD 3LBXB 4DVDA 3RX6A 5HXEA 4HN9A 3EDUA 3N2OA 1WYCA 4KUMB 4BA9A 5JRCA 3GN5A 1MMNA 3FXEB 2P9BA 1B7TA 2XHEB 2WMNA 3KFWX 5HYAA 3W15B 2C0SA 2JRKA 2VKJA 3QUJA 3KBUA 2XAQB 2LSGA 4PNIA 5FNVE 5FXXA 4CI2B 4IDZA 4BJMA 4EZ4A 4OHFA 3I0OA 2L3LA 4GOUA 4AQGA 2V7JA 1OWAA 4QX7B 2E9XA 1E1HB 2DWGA 1HS7A 4ZI2D 1KK7A 3MJXA 2DNXA 5EZYE 2XAJB 5EK4A 4CXWA 3LFMA 1Z0PA 4PJMA 3QK6A 4PFPA 3F57A 4DO0A 2NW8A 3IEEA 4X1IE 5LGTB 3VHLA 2LM9A 2VK9A 4GK5E 3AA1B 3RYIE 3C50A 3SS1A 3V5SA 3IF8B 5JH7E 3N9LA 4E7ZA 3GMIA 3N9OA 3ZMZB 3CKDA 5LHIB 3LJCA 5DABA 2H7OA 1V9DA 3JC6D 4EAHA 4QXHB 2MTQA 1S35A 4QKNA 3HKCE 4X20E 2X67A 3CX7B 4KMCA 4AXPA 3RYHE 3GN5B 3LK2B 2V7LA 2Y8DA 4YLHA 4N78D 2UXXB 2X9YA 5TAOA 5LCYA 4YJ2E 4DMWA 2XAGB 3ZN1B 2VKDA 3MK7C 4HTEA 2MYSA 1VOMA 2LSIA 5HWYA 3K3QC 3C64A 5JDFA 3UT5E 5IYZE 4EOZB 1U4QA 3UFEA 4ERRA 1ZEEA 4C91A 4UVCB 4P09A 2CM0A 5L2LA 3R84B 2LOSA 1MNEA 4IE0A 3T8OA 3O1HA 4UVAB 4UV8B 3AVSA 3PUQA 2NW7A 4WW0A 2EHOC 2KXPB 4ASKA 3OYZA 2NTYA 5AFUL 2E9XB 4ANJA 2ACXA 4QXCB 3M65A 1KNZA 2LSKA 2JJ9A 1BR1A 1G73A 4DMVA 3ZCJA 4TV9E 4MLKA 2WSSV 3VKGA 3AAEB 2CXLA 4CXXA 2B1EA 2CEAA 5E0OA 5LJMA 4DNDA 4J2CA 4H9SE 2I59A 4G2AA 5LJNA 2WM9A 5HWXA 4PFOA 3E0ZA 2ZLYA 3N5LA 3Q9DA 4UF0B 3GWHA 2IC9A 4HKAA 2V26A 5EK3A 4EIWA 1D1BA 3FBLA 4JUYA 5LGUB 4U74A 5L3EB 2CLYC 4IGUA 4WBOA 2HPLA 4K0UA 4U72A 1IJ6A 1HG2A 2MOZA 4I4TE 4OYJA 3AA6B 1HCIA 2X0LB 4OK0A 4MFRA 4OYKA 2JMHA 4B6XA 2LHNA 1ZV4X 5JRCB 3SRZA 1MIYA 4NUUA 2CWYA 5J1GA 3AAAB 3CX6B 3ESLA 3N9QA 2NW9A 2X68A 2YEVC 4EXTA 4ADZA 4UIGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L8K A; 
#chains in the Genus database with same CATH topology
 5EK2 A;  2PJQ A;  4KP3 C;  2A3D A;  1EZ3 A;  1NWM X;  2XPK A;  5AQU B;  4EYY R;  2ZM0 A;  1WLX A;  4EB6 E;  4P1N A;  4P0B A;  4V1A v;  4DV6 T;  1MMG A;  2L9Q A;  3KV4 A;  3LSV A;  3WI3 A;  3ZKR A;  2W63 A;  3T1H T;  1D0X A;  3AE4 A;  2LSJ A;  3PUA A;  4YT0 A;  4ZHQ E;  4ZOL E;  5J2T E;  3EDV A;  4X65 T;  1M62 A;  3LK3 B;  5AQJ B;  3O9X A;  3UU6 A;  3N9P A;  4H9R C;  5AQF B;  2RPA A;  3AE9 A;  1FMV A;  2CBJ A;  5KDM C;  2IML A;  3QB5 K;  3VR9 A;  3NWI A;  2EHO A;  2H89 A;  2WDR A;  4PK5 A;  4IST A;  5DJQ C;  2XQ6 A;  2KT9 A;  2YU1 A;  4H9N C;  4TWH A;  1WCR A;  2PTF A;  5J0Z A;  3AVR A;  2LOP A;  3HL6 A;  2N1G A;  2FJA A;  2V6X A;  2BDE A;  3RH3 A;  4JI1 T;  1JNZ A;  4BJN A;  5KX5 E;  4KBM B;  2N2N A;  2W4X A;  2CE7 A;  3VRB A;  3ZCI A;  1BR2 A;  1M7K A;  3PU3 A;  2W61 A;  3ZT7 A;  3RI5 A;  5ABE A;  2IAK A;  1HG5 A;  3BQK A;  1W0B A;  3L09 A;  3Q5E A;  1G8X A;  4UVB B;  4IIJ E;  3CVR A;  3ZEF B;  3AE7 A;  4LFB T;  1LVK A;  4O2B E;  5FXV A;  2MBG A;  5L3G B;  2C5J A;  2C5K T;  2E5V A;  1YXR A;  2KZ7 B;  2YKS A;  3HA4 A;  1FJG T;  1MND A;  2UXB T;  3NKZ A;  3EVY A;  3ZST A;  4ZI7 E;  3UUN A;  3P4S A;  4HGA A;  3LBX A;  4QHO A;  5AQH B;  5BMV E;  3K3O A;  2LLY A;  5A1L A;  1XMQ T;  3FB2 A;  4DR5 T;  1LKX A;  5KMG P;  2YIN A;  1Y64 B;  4IDQ A;  3V5U A;  2VAS A;  5HEJ A;  4WNK A;  1KF6 A;  2NWB A;  3IA3 A;  2WU5 A;  2FUP A;  4YJ3 E;  1ZOY A;  5JDG A;  3F31 A;  3FXD B;  5BR8 T;  3S4U A;  3HR0 A;  5FY0 A;  4DR3 T;  1N33 T;  3UU3 A;  2X51 A;  3P4P A;  3SWH A;  5L3C B;  3RC8 A;  2XSB A;  1QUU A;  3AXJ A;  5L3B B;  5AQR B;  4WBN E;  2J47 A;  3D0T A;  4Z8X A;  4K0K T;  4HFH A;  3PE0 A;  4DBQ A;  5LHG B;  2GK9 A;  2BKP A;  2JIW A;  2Y6X A;  1T98 A;  4X1K E;  2M6I A;  4B3R T;  4AQY T;  4QH5 A;  2UXN B;  2PG8 A;  3OYX A;  5LMU T;  3C4X A;  1E2A A;  4H9O C;  4H9P C;  5LGN B;  1Y01 A;  3B57 A;  1ZHC A;  4PK4 A;  4Q25 A;  3U3I A;  5JDN A;  1IBK T;  4JI3 T;  1OED E;  3FBZ A;  4X5T A;  3PUZ F;  4B3T T;  1MIW A;  2CHO A;  2E2A A;  4TWD A;  2Q9Q A;  3AB3 B;  4IDN A;  3SOL A;  2W66 A;  4IL9 A;  2VB6 A;  3Q5W A;  1XDP A;  3BQI A;  3J7Y q;  1UGO A;  2ACZ A;  4OFZ A;  1YKE B;  3PTR B;  3RF1 A;  1HX1 B;  5HXS A;  2ODV A;  3VKH A;  2VVN A;  2W67 A;  3KVB A;  2A9U A;  4O4J E;  3RRW A;  1T7S A;  3O1J A;  4ZXL A;  4X62 T;  2X66 A;  3IBP A;  2CRB A;  5F5W A;  4I50 E;  4ISS A;  4LMJ A;  1WR6 A;  2E8I A;  2W00 A;  3PUW F;  1FIO A;  4G63 A;  4GYR A;  4Z91 A;  4YHJ A;  5FVK A;  2NR4 A;  3TLS A;  3RGL A;  4AKG A;  3LDQ B;  2VQF T;  5FP3 A;  2DLR A;  4DBR A;  2PBI A;  4TWF A;  4A98 A;  4PAG A;  4JI2 T;  4IDO A;  4UR9 A;  4CI3 B;  1LRZ A;  4CN4 A;  1UX5 A;  4GKK T;  2K3W A;  4X1Y E;  4YSX A;  2MAW A;  4UEL A;  1XNR T;  3EAM A;  2E5L T;  2LJL A;  3RC3 A;  1N32 T;  5LYJ E;  3B5M A;  4LF8 T;  2M67 A;  4JYA T;  3ZN0 B;  3GA8 A;  3ZJ2 A;  4TZ4 C;  4U7I A;  1N36 T;  1D1A A;  3ETU A;  1X79 A;  2XM1 A;  3C51 A;  2NOX A;  2J1D G;  3ZT5 A;  2CPT A;  4CXY A;  2UUC T;  2BBJ A;  2UUB T;  4PJL A;  2VKO A;  3AEE A;  3RPU A;  1OED C;  2JMK A;  2JPF A;  1FEW A;  4DID B;  5AQL B;  5JDH A;  4NXN T;  5IHY A;  4KI0 F;  4DV0 T;  4AKR B;  1VRB A;  2HN1 A;  2CMR A;  3JCF A;  1YD8 G;  4HE8 A;  5FMN A;  1SE7 A;  4IE7 A;  3CWZ B;  3I9W A;  3OBV E;  3BQL A;  3O4X E;  3P7I A;  4COF A;  3L8R A;  4H63 V;  3CQX C;  4ZI3 D;  3KV5 A;  3MAC A;  4Z90 A;  4WZX A;  2LT3 A;  4MAL A;  3KBT A;  3BK9 A;  2XAS B;  3G06 A;  1HX8 A;  2XZE A;  3H37 A;  2V1D B;  4HWH A;  4U3C A;  5AQV B;  3ANW A;  5FYM A;  2K9A A;  3E08 A;  5JR9 A;  2K5B B;  3J9X 1;  4ZEY A;  1T8B A;  1XMO T;  2NTX A;  2HHH T;  2K24 A;  2IDO B;  3FZH B;  2QA7 A;  3A5X A;  4ILB A;  3RQU A;  2VQE T;  3WAJ A;  4O8S A;  3ZYL A;  5JRE A;  1DU2 A;  5LHH B;  2KIN B;  2XAH B;  1U5P A;  3CPZ A;  3FHN A;  4PK6 A;  4DR1 T;  4ILC A;  5J2U E;  3B13 A;  1W9R A;  4KX6 A;  2C5I T;  4HEA A;  4JI0 T;  2XSA A;  4C90 A;  3KV6 A;  1YKH B;  2B76 A;  5ABF B;  5ADX L;  2XY8 B;  4L9I A;  4UXN B;  5AQO B;  3ETV A;  5LBM A;  3FZM B;  2Z6E A;  2ZM2 A;  4TX5 A;  3VU7 H;  4E7S A;  3P8C D;  3QC9 A;  2IHR 1;  3TKL B;  1MIV A;  5CGM A;  5JDL A;  2L8K A;  4AQF A;  1HR0 T;  3AEA A;  3R6N A;  4JEH B;  3C4Z A;  3P4W A;  1NEK A;  3K1S A;  3KIN B;  2FJB A;  2ZM8 A;  3N2K E;  2ZMA A;  1WYB A;  2FJD A;  4QXB B;  2YDS A;  2NP9 A;  2OLT A;  4IE4 A;  4ZS3 A;  2G0U A;  2IIU A;  4TN7 B;  4QX8 B;  4F6R C;  1QLB A;  4U7Y A;  2I0M A;  4IT4 A;  3KDS E;  4DV7 T;  4UEM A;  4EGW A;  5CFB A;  4PW8 A;  3ZLI A;  1HNX T;  3ONX A;  3ANW B;  2PFV A;  4NXM T;  3ZMU B;  2IW5 B;  5DQW A;  4B3M T;  3ZMT B;  5JDM A;  5FY7 A;  2EHO D;  1O3X A;  1YQ3 A;  4LF7 T;  2V5D A;  1US7 B;  3AEG A;  3AED A;  3ZYK A;  4AKH A;  2XQ7 A;  4X66 T;  2YU2 A;  2SPC A;  3I0Q A;  4I0U A;  5H6R B;  5HCM A;  3F2E A;  3WAK A;  5KXJ A;  4O4I E;  4CZZ B;  5ABH A;  4LF6 T;  2RP4 A;  3I1A A;  5C2T A;  2X9W A;  3OPC A;  3PUG A;  4IE5 A;  4U2Y A;  2A2F X;  3ONL C;  4GK0 E;  2D5U A;  3ZPO A;  2DWK A;  1WR0 A;  1YQ4 A;  3A7M A;  3OVU A;  2XM2 A;  5FXZ A;  5JTG A;  4DV3 T;  1I6Z A;  2CCQ A;  4KHP T;  4UV9 B;  3RIA A;  2KLQ A;  2DI4 A;  3LG7 A;  2WWV A;  3PUS A;  4EV6 A;  4GKJ T;  3ZT6 A;  3T1Y T;  3OKQ A;  4DV5 T;  2BS4 A;  2BVM A;  3AXJ B;  3AA0 B;  4PJN A;  1IJ5 A;  4MHC A;  5L4H A;  5LG4 A;  3PJA J;  2WBL A;  1WRD A;  5FL1 A;  4LF9 T;  5LBQ B;  2V5C A;  2WDV A;  5AQS B;  1XZY A;  2CXF A;  4U2Z A;  5LP6 E;  2BZB A;  2WDQ A;  4QWN B;  5JR9 C;  3NRY A;  1MMD A;  1NEN A;  2KSR A;  3NRX A;  4DR7 T;  2WAU A;  2R6G F;  4ZS2 A;  4DR4 T;  2LKH A;  5L47 A;  3H3A A;  3MKD A;  1SHZ C;  2HH7 A;  4L0R A;  4O2A E;  3K8P C;  2DCF A;  3CQC B;  3RKG A;  4YTN A;  2WZI A;  4YSZ A;  3UUX B;  4O4L E;  5L3D B;  2YDR A;  3KV9 A;  5LXT E;  4JI8 T;  1D0Z A;  2CHN A;  2Y48 B;  2LM2 A;  4A56 A;  5ABF A;  2Q9Q B;  4FJO A;  3N9M A;  2YEV C;  3M3Z B;  2JQQ A;  3PDY A;  5JQG E;  2QGS A;  1HF8 A;  1BR4 A;  2WU2 A;  4LFA T;  3RLF F;  5CA0 E;  3DJB A;  3HKB E;  3P4R A;  1D0Y A;  1JNR A;  1OXZ A;  2XJ7 A;  2XQY A;  3L3P A;  3N9N A;  4H9Q C;  4CI1 B;  5L3F B;  2M6B A;  1NAF A;  2EHO B;  4YFS A;  2JQK A;  5LNK A;  2ES0 A;  1HFA A;  2FBW A;  2XAF B;  2X9H A;  3JC6 C;  4MBQ A;  5DQV A;  5LA6 E;  3DTO A;  2KMF A;  3Q5X A;  1LVF A;  2CWO A;  4ZI3 C;  5JDQ A;  4DV2 T;  3ZC0 A;  3ZYM A;  4TNW A;  5H6Q B;  5JR9 B;  3RKO A;  5LOV E;  2LSY A;  1IZN B;  2CXD A;  2K48 A;  2XQ3 A;  2YOE A;  4H63 H;  4IDP A;  5FL0 A;  3ABV A;  2LRL A;  1MMA A;  3QNU A;  3UUL A;  3X1D A;  4O4H E;  3QOF A;  4JBW F;  4KHZ F;  4JLE A;  4OX9 T;  2XQA A;  3PUR A;  3RIF A;  4AIS A;  2D0T A;  1KNP A;  2LEH A;  4CN6 A;  3NBX X;  2KWH A;  4I55 E;  4LF5 T;  3AAI A;  4BAY B;  4AKI A;  2BS2 A;  2UXC T;  2CA5 A;  3C4W A;  3P4Q A;  4XAX B;  4YTM A;  3O1I A;  2Q9Q C;  2CBI A;  3HKE E;  5GON E;  4U31 A;  4CQI A;  5L4E A;  1UUR A;  3AEF A;  2OV9 A;  1SA0 E;  3MZK B;  4HWI B;  4TV8 E;  5ETW A;  2QVA A;  4AI6 A;  2RA1 A;  2CLY B;  2XUE A;  4HWC A;  2HN2 A;  3PJA A;  4ILA A;  2BVL A;  5CB4 E;  2X9X A;  3RIU A;  3AEB A;  3RYC E;  2YDQ A;  3FZL B;  3UTK A;  5HXC A;  3A8Y C;  2D2S A;  4LMK A;  3NVO A;  3C98 B;  3U78 A;  3UUM A;  2BBH A;  3CIR A;  5AQN B;  3ZJ1 A;  5FY1 A;  3CQG B;  4EYU A;  5F3J A;  1XWM A;  3JAE A;  3PU8 A;  3CML A;  4PJJ A;  3ZC1 A;  5LG3 A;  2AXD S;  2VKH A;  2OA5 A;  2Q9Q D;  5IWA T;  3IHR A;  3JAF A;  4TNV A;  1T72 A;  4UF0 A;  1WFD A;  2YN6 A;  2N9D A;  4YXD A;  1AJ3 A;  1ZKE A;  2W0G A;  1CUN A;  4I43 B;  4XBF B;  5HAX A;  3DP7 A;  2KND A;  2WWU A;  4JEU B;  4JI5 T;  3CX8 B;  3UU8 A;  4AQF C;  2VUR A;  1QSD A;  3N2G E;  5HXR A;  1S94 A;  1UCU A;  5ABG A;  4ZZC A;  2LHR A;  5C8Y E;  1L0V A;  5CA1 E;  2W62 A;  5F8P A;  1J5W A;  3NZQ A;  5AQK B;  2YK0 A;  5HXH A;  3OJA A;  3AA7 B;  3AE3 A;  1H7C A;  2KWI B;  2VWA A;  2DHR A;  3EUH A;  3RYF E;  1IAP A;  4TUY E;  4AKL A;  4LFC T;  2H3R A;  3MXZ A;  4M1P A;  4QH1 A;  4ZI2 C;  5FXW A;  2ODU A;  2E9X C;  3HI2 A;  4L5G A;  2UUA T;  5AQQ B;  1FMW A;  3H3M A;  2J62 A;  3Q5D A;  3RRC A;  2XTL A;  4IHJ E;  4HFV A;  3ZSS A;  5M4Y A;  1HNW T;  2HPJ A;  2BS3 A;  5JVD E;  3K3N A;  3ZMV B;  2V7I A;  4FI5 A;  4IE6 A;  1XNQ T;  3AE5 A;  2D0U A;  4P0A A;  3Q2M A;  2WY2 A;  2V7M A;  3FZF B;  4ILU A;  4XZC A;  1D1C A;  1HTJ F;  2H7V C;  4HFD A;  2VL8 A;  3AE1 A;  4GYS A;  4EZH A;  1BR0 A;  3I9Y A;  1KEY A;  3E22 E;  2IC6 A;  3ZMS B;  1VCS A;  2WMO A;  3LK4 2;  1YW0 A;  3NZP A;  2V7K A;  5HEU A;  3RQW A;  2A72 A;  4NUV A;  3HKD E;  3MA9 A;  1X9B A;  1UX4 A;  3KVA A;  2J4G A;  4GIW A;  2E9X D;  3LBX B;  4DVD A;  3RX6 A;  4JI4 T;  3AEC A;  5HXE A;  2JQ9 A;  4HN9 A;  2BG9 E;  3TLW A;  3EDU A;  3EHZ A;  4WYV A;  3N2O A;  1WYC A;  2WCA A;  4KUM B;  4BA9 A;  2UU9 T;  5JRC A;  3GN5 A;  1MMN A;  3FXE B;  2P9B A;  3UQ4 A;  2V6Y B;  1B7T A;  2XHE B;  2WMN A;  3KFW X;  5HYA A;  1IBM T;  3W15 B;  2C0S A;  3EAB A;  4HFE A;  2JRK A;  3UUB A;  2ZM6 T;  2VKJ A;  3QUJ A;  2MPK A;  4IRE A;  3QB5 A;  3KBU A;  2XAQ B;  2LSG A;  4PNI A;  4QH4 A;  4YHH T;  4HFB A;  5FNV E;  3UU4 A;  5FXX A;  4CI2 B;  4IDZ A;  4BJM A;  1HNZ T;  4EZ4 A;  3AE8 A;  4OHF A;  1KNR A;  3I0O A;  2L3L A;  4GOU A;  3FZK B;  4AQG A;  4DR2 T;  2V7J A;  2WS3 A;  1OWA A;  4LML A;  4QX7 B;  2E9X A;  1E1H B;  2DWG A;  3CK6 A;  1HS7 A;  4HWD A;  4ZI2 D;  2BKN A;  1KK7 A;  3MJX A;  2DNX A;  5EZY E;  2XAJ B;  5EK4 A;  4CXW A;  3LFM A;  2W2U A;  1Z0P A;  4PJM A;  3QK6 A;  2BG9 A;  4PFP A;  3F57 A;  4DO0 A;  3PUV F;  2NW8 A;  3SFE A;  4JV5 T;  1N34 T;  1OED A;  3IEE A;  3ONJ A;  4X1I E;  1Z8U A;  4F8H A;  5LGT B;  3VHL A;  2LM9 A;  2VK9 A;  4GK5 E;  3AA1 B;  5AQG B;  3C50 A;  3RYI E;  3SS1 A;  3V5S A;  3IF8 B;  5JH7 E;  2BG9 C;  4YY3 T;  3N9L A;  4E7Z A;  3GMI A;  3N9O A;  3ZMZ B;  3PUX F;  3CKD A;  3UFG A;  3LJC A;  5DAB A;  3UU5 A;  2H7O A;  5LHI B;  1V9D A;  3JC6 D;  4CN1 A;  5AQM B;  2QYW A;  4ZZB A;  4EAH A;  4QXH B;  2MTQ A;  1SUM B;  1S35 A;  4UIG A;  4QKN A;  3HKC E;  4X20 E;  2X67 A;  5FKY A;  3CX7 B;  5FVL A;  3AE2 A;  4A97 A;  1J5E T;  4HFI A;  4KMC A;  4AXP A;  3TLU A;  2XQ4 A;  3RYH E;  3GN5 B;  4HWF A;  3LK2 B;  2V7L A;  2Y8D A;  4YLH A;  2DL1 A;  4N78 D;  2UXX B;  2X9Y A;  5TAO A;  5LCY A;  3TLV A;  4YJ2 E;  3RHW A;  4DMW A;  2D9D A;  2XAG B;  4DV4 T;  2AE9 A;  3ZN1 B;  2VKD A;  4YSY A;  3MK7 C;  4HTE A;  4AIU A;  1W09 A;  2MYS A;  1VOM A;  2LSI A;  5HWY A;  3K3Q C;  3C64 A;  5JDF A;  3TLT A;  5IYZ E;  3UT5 E;  1U4Q A;  3UFE A;  4EOZ B;  4ERR A;  2F4V T;  1R8I A;  2V8S V;  1ZEE A;  4C91 A;  4UVC B;  2FJE A;  1OED B;  2CM0 A;  4P09 A;  5L2L A;  3R84 B;  1VCT A;  2LOS A;  4DUY T;  4EXT A;  4U33 A;  1MNE A;  2BG9 B;  5HEO A;  4IE0 A;  3T8O A;  3O1H A;  4UVA B;  5LB7 B;  4UV8 B;  3AVS A;  3PUQ A;  2NW7 A;  2X0Y A;  4WW0 A;  4NIQ A;  3AE6 A;  2EHO C;  2KXP B;  4ASK A;  1E7P A;  1XDO A;  3OYZ A;  2NTY A;  3L39 A;  2E9X B;  3VRA A;  1ZP0 A;  5AQT B;  4ANJ A;  5AFU L;  5CJ5 A;  2ACX A;  4QXC B;  3M65 A;  1KNZ A;  2LSK A;  2JQH A;  1IBL T;  2JJ9 A;  5AQP B;  1BR1 A;  1G73 A;  4DMV A;  4IL4 A;  4TV9 E;  3ZCJ A;  2WB5 A;  4MLK A;  5LMN T;  4DUZ T;  2BKO A;  2WSS V;  3VKG A;  3AAE B;  2CXL A;  5AQI B;  4CXX A;  2B1E A;  4YTP A;  2V6Y A;  2CEA A;  5E0O A;  5LJM A;  4DND A;  1J1J A;  1KFY A;  4J2C A;  4H9S E;  2I59 A;  4HFC A;  2WP9 A;  2XQ8 A;  4G2A A;  4JI6 T;  5LJN A;  2WM9 A;  5HWX A;  1UUS A;  4PFO A;  3E0Z A;  3P50 A;  4DR6 T;  2ZLY A;  3N5L A;  5IUX A;  3JAD A;  3Q9D A;  4UF0 B;  5HEG A;  4A5X A;  1CHU A;  1UK5 A;  2IC9 A;  3GWH A;  4HKA A;  2V26 A;  5EK3 A;  2LKG A;  3SFD A;  4EIW A;  4X64 T;  1D1B A;  1W0A A;  3FBL A;  4JUY A;  2WZH A;  5HCJ A;  5LGU B;  2IUB A;  1GQE A;  2LRK A;  2CLY C;  4IGU A;  4U74 A;  4WBO A;  4EED A;  5L3E B;  2H88 A;  2QRX A;  1I94 T;  2HPL A;  4B3S T;  4LF4 T;  4K0U A;  4NPP A;  4U72 A;  2WQY A;  1IJ6 A;  1HG2 A;  2MOZ A;  4I4T E;  2VL0 A;  4OYJ A;  3AA6 B;  1HCI A;  2X0L B;  3PV0 F;  4OK0 A;  4MFR A;  4OYK A;  2JMH A;  4B6X A;  3RIU C;  2LHN A;  3VR8 A;  2I6H A;  1ZV4 X;  2X0H A;  2VVS A;  5HEH A;  4EEB A;  3UQ7 A;  2UXD T;  3SRZ A;  3EI0 A;  4DV1 T;  5JRC B;  1MIY A;  4NUU A;  2CWY A;  5J1G A;  3OTO T;  2XQ5 A;  3AAA B;  3CX6 B;  3ESL A;  3N9Q A;  2NW9 A;  5C3J A;  2X68 A;  2LE8 A;  4JI7 T;  2XQ9 A;  4ADZ A;  3PUY F; 
#chains in the Genus database with same CATH homology
 5EK2 A;  2PJQ A;  4KP3 C;  2A3D A;  1EZ3 A;  1NWM X;  4EYY R;  2ZM0 A;  1WLX A;  4EB6 E;  4P0B A;  4V1A v;  1MMG A;  2L9Q A;  3KV4 A;  3WI3 A;  2W63 A;  1D0X A;  2LSJ A;  3PUA A;  4ZHQ E;  4ZOL E;  5J2T E;  3EDV A;  3LK3 B;  3O9X A;  3N9P A;  4H9R C;  5KDM C;  1FMV A;  2EHO A;  5DJQ C;  4PK5 A;  4IST A;  4H9N C;  2KT9 A;  2YU1 A;  3AVR A;  2LOP A;  3HL6 A;  2N1G A;  3RH3 A;  2BDE A;  4BJN A;  4KBM B;  2N2N A;  2CE7 A;  3ZCI A;  1BR2 A;  3PU3 A;  2W61 A;  2IAK A;  1HG5 A;  3BQK A;  3L09 A;  4UVB B;  1G8X A;  4IIJ E;  3CVR A;  3ZEF B;  1LVK A;  4O2B E;  5FXV A;  2MBG A;  5L3G B;  2C5J A;  2C5K T;  2KZ7 B;  3HA4 A;  1MND A;  3EVY A;  4ZI7 E;  3UUN A;  4HGA A;  4QHO A;  3LBX A;  5BMV E;  3K3O A;  5A1L A;  3FB2 A;  1LKX A;  5KMG P;  2YIN A;  1Y64 B;  3V5U A;  2VAS A;  4WNK A;  2NWB A;  4YJ3 E;  5JDG A;  3F31 A;  3FXD B;  3S4U A;  3HR0 A;  5FY0 A;  2X51 A;  3SWH A;  5L3C B;  3RC8 A;  1QUU A;  5L3B B;  4WBN E;  3D0T A;  4Z8X A;  3PE0 A;  4DBQ A;  5LHG B;  2GK9 A;  2Y6X A;  1T98 A;  4X1K E;  2UXN B;  2PG8 A;  3OYX A;  3C4X A;  4H9O C;  5LGN B;  4H9P C;  3B57 A;  1ZHC A;  4PK4 A;  3U3I A;  5JDN A;  3FBZ A;  1MIW A;  3SOL A;  2Q9Q A;  3AB3 B;  2VB6 A;  3Q5W A;  3BQI A;  3J7Y q;  4OFZ A;  1YKE B;  3PTR B;  5HXS A;  2ODV A;  3VKH A;  3KVB A;  4O4J E;  3RRW A;  3O1J A;  2X66 A;  3IBP A;  4I50 E;  4ISS A;  1WR6 A;  2E8I A;  2W00 A;  4G63 A;  1FIO A;  4GYR A;  4YHJ A;  4AKG A;  5FP3 A;  2DLR A;  4DBR A;  2PBI A;  4PAG A;  4CI3 B;  1LRZ A;  1UX5 A;  4X1Y E;  4UEL A;  2LJL A;  3RC3 A;  5LYJ E;  2M67 A;  3ZN0 B;  3GA8 A;  3ZJ2 A;  4TZ4 C;  1D1A A;  3ETU A;  1X79 A;  3C51 A;  2NOX A;  2J1D G;  4CXY A;  4PJL A;  2VKO A;  3RPU A;  2JMK A;  2JPF A;  1FEW A;  5JDH A;  5IHY A;  4AKR B;  1VRB A;  4HE8 A;  2CMR A;  5FMN A;  1YD8 G;  4IE7 A;  3CWZ B;  3I9W A;  3OBV E;  3BQL A;  3O4X E;  3P7I A;  4H63 V;  3CQX C;  4ZI3 D;  3KV5 A;  3MAC A;  2LT3 A;  4MAL A;  3KBT A;  3BK9 A;  2XAS B;  3H37 A;  1HX8 A;  5FYM A;  5JR9 A;  2V1D B;  3J9X 1;  3ANW A;  2K9A A;  3E08 A;  2K5B B;  2NTX A;  2K24 A;  2QA7 A;  3A5X A;  3WAJ A;  4O8S A;  3ZYL A;  5JRE A;  5LHH B;  2KIN B;  2XAH B;  1U5P A;  3CPZ A;  3FHN A;  4PK6 A;  5J2U E;  3B13 A;  2C5I T;  4HEA A;  4C90 A;  3KV6 A;  1YKH B;  5ADX L;  4L9I A;  4UXN B;  5LBM A;  3ETV A;  4TX5 A;  2Z6E A;  2ZM2 A;  4E7S A;  3VU7 H;  3P8C D;  3QC9 A;  3TKL B;  1MIV A;  5JDL A;  2L8K A;  4AQF A;  3R6N A;  4JEH B;  3C4Z A;  3KIN B;  3N2K E;  4QXB B;  2ZM8 A;  5DQV A;  2ZMA A;  1WYB A;  4ZS3 A;  2NP9 A;  4IE4 A;  2G0U A;  4TN7 B;  4F6R C;  4QX8 B;  3KDS E;  4UEM A;  4PW8 A;  3ZLI A;  3ONX A;  3ANW B;  2PFV A;  3ZMU B;  2IW5 B;  5DQW A;  3ZMT B;  5JDM A;  5FY7 A;  2EHO D;  1O3X A;  4AKH A;  1US7 B;  3ZYK A;  2YU2 A;  2SPC A;  3I0Q A;  5H6R B;  3WAK A;  3F2E A;  4O4I E;  4CZZ B;  2RP4 A;  3I1A A;  2X9W A;  3PUG A;  4IE5 A;  2A2F X;  4GK0 E;  2D5U A;  3ZPO A;  2DWK A;  5FXZ A;  2CCQ A;  4UV9 B;  2KLQ A;  2DI4 A;  3LG7 A;  3PUS A;  3OKQ A;  2BVM A;  3AA0 B;  4PJN A;  1IJ5 A;  4MHC A;  5LG4 A;  2WBL A;  1WRD A;  5LBQ B;  2CXF A;  5LP6 E;  2BZB A;  4QWN B;  5JR9 C;  3NRY A;  1MMD A;  3NRX A;  2WAU A;  4ZS2 A;  3H3A A;  3MKD A;  1SHZ C;  2HH7 A;  4L0R A;  4O2A E;  3K8P C;  2DCF A;  3CQC B;  3UUX B;  4O4L E;  5L3D B;  3KV9 A;  5LXT E;  1D0Z A;  2Y48 B;  4A56 A;  2Q9Q B;  4FJO A;  3N9M A;  3PDY A;  2JQQ A;  5JQG E;  2QGS A;  1HF8 A;  1BR4 A;  5CA0 E;  3DJB A;  3HKB E;  1D0Y A;  1OXZ A;  3L3P A;  4H9Q C;  2XQY A;  3N9N A;  4CI1 B;  5L3F B;  1NAF A;  2EHO B;  4YFS A;  5LNK A;  2ES0 A;  1HFA A;  2XAF B;  2X9H A;  3JC6 C;  4MBQ A;  5LA6 E;  3DTO A;  2KMF A;  3Q5X A;  1LVF A;  2CWO A;  4ZI3 C;  5JDQ A;  3ZC0 A;  3ZYM A;  5JR9 B;  5H6Q B;  3RKO A;  5LOV E;  2LSY A;  1IZN B;  2CXD A;  2K48 A;  4H63 H;  3UUL A;  5KX5 E;  1MMA A;  4O4H E;  4JLE A;  3PUR A;  2D0T A;  2LEH A;  3NBX X;  2KWH A;  4I55 E;  3AAI A;  4BAY B;  4AKI A;  2CA5 A;  3C4W A;  4XAX B;  3O1I A;  2Q9Q C;  3HKE E;  5GON E;  4CQI A;  1SA0 E;  3MZK B;  4TV8 E;  5ETW A;  4AI6 A;  2RA1 A;  2CLY B;  2XUE A;  2BVL A;  5CB4 E;  2X9X A;  3RYC E;  3UTK A;  5HXC A;  2D2S A;  3U78 A;  3UUM A;  3C98 B;  3ZJ1 A;  4EYU A;  5FY1 A;  3CQG B;  5F3J A;  3ZC1 A;  4PJJ A;  3PU8 A;  3CML A;  2VKH A;  2OA5 A;  2Q9Q D;  3IHR A;  4UF0 A;  1AJ3 A;  2LE8 A;  2N9D A;  1ZKE A;  2W0G A;  1CUN A;  4I43 B;  4XBF B;  5HAX A;  3DP7 A;  2KND A;  2WWU A;  4JEU B;  3CX8 B;  4AQF C;  1QSD A;  3N2G E;  5HXR A;  1S94 A;  1UCU A;  2LHR A;  5C8Y E;  5CA1 E;  2W62 A;  5F8P A;  3NZQ A;  2YK0 A;  5HXH A;  3OJA A;  3AA7 B;  1H7C A;  3EUH A;  2KWI B;  2DHR A;  2VWA A;  3RYF E;  1IAP A;  4TUY E;  4AKL A;  2H3R A;  3MXZ A;  4M1P A;  4ZI2 C;  5FXW A;  2ODU A;  2E9X C;  3HI2 A;  4L5G A;  1FMW A;  3RRC A;  2XTL A;  4IHJ E;  4HFV A;  5M4Y A;  2HPJ A;  5JVD E;  3K3N A;  3ZMV B;  2V7I A;  4FI5 A;  4IE6 A;  2D0U A;  4P0A A;  3Q2M A;  4ILU A;  2V7M A;  4XZC A;  1D1C A;  1HTJ F;  2H7V C;  4EZH A;  2VL8 A;  4GYS A;  1BR0 A;  3I9Y A;  3E22 E;  2IC6 A;  3ZMS B;  2WMO A;  3LK4 2;  1YW0 A;  3NZP A;  2V7K A;  2A72 A;  4NUV A;  3HKD E;  3MA9 A;  1UX4 A;  3KVA A;  4GIW A;  2E9X D;  3LBX B;  4DVD A;  3RX6 A;  5HXE A;  4HN9 A;  3EDU A;  3N2O A;  1WYC A;  4KUM B;  4BA9 A;  5JRC A;  3GN5 A;  1MMN A;  3FXE B;  2P9B A;  1B7T A;  2XHE B;  2WMN A;  3KFW X;  5HYA A;  3W15 B;  2C0S A;  2JRK A;  2VKJ A;  3QUJ A;  3KBU A;  2XAQ B;  2LSG A;  4PNI A;  5FNV E;  5FXX A;  4CI2 B;  4IDZ A;  4BJM A;  4EZ4 A;  4OHF A;  3I0O A;  2L3L A;  4GOU A;  4AQG A;  2V7J A;  1OWA A;  4QX7 B;  2E9X A;  1E1H B;  2DWG A;  1HS7 A;  4ZI2 D;  1KK7 A;  3MJX A;  2DNX A;  5EZY E;  2XAJ B;  5EK4 A;  4CXW A;  3LFM A;  1Z0P A;  4PJM A;  3QK6 A;  4PFP A;  3F57 A;  4DO0 A;  2NW8 A;  3IEE A;  4X1I E;  5LGT B;  3VHL A;  2LM9 A;  2VK9 A;  4GK5 E;  3AA1 B;  3RYI E;  3C50 A;  3SS1 A;  3V5S A;  3IF8 B;  5JH7 E;  3N9L A;  4E7Z A;  3GMI A;  3N9O A;  3ZMZ B;  3CKD A;  5LHI B;  3LJC A;  5DAB A;  2H7O A;  1V9D A;  3JC6 D;  4EAH A;  4QXH B;  2MTQ A;  1S35 A;  4QKN A;  3HKC E;  4X20 E;  2X67 A;  3CX7 B;  4KMC A;  4AXP A;  3RYH E;  3GN5 B;  3LK2 B;  2V7L A;  2Y8D A;  4YLH A;  4N78 D;  2UXX B;  2X9Y A;  5TAO A;  5LCY A;  4YJ2 E;  4DMW A;  2XAG B;  3ZN1 B;  2VKD A;  3MK7 C;  4HTE A;  2MYS A;  1VOM A;  2LSI A;  5HWY A;  3K3Q C;  3C64 A;  5JDF A;  3UT5 E;  5IYZ E;  4EOZ B;  1U4Q A;  3UFE A;  4ERR A;  1ZEE A;  4C91 A;  4UVC B;  4P09 A;  2CM0 A;  5L2L A;  3R84 B;  2LOS A;  1MNE A;  4IE0 A;  3T8O A;  3O1H A;  4UVA B;  4UV8 B;  3AVS A;  3PUQ A;  2NW7 A;  4WW0 A;  2EHO C;  2KXP B;  4ASK A;  3OYZ A;  2NTY A;  5AFU L;  2E9X B;  4ANJ A;  2ACX A;  4QXC B;  3M65 A;  1KNZ A;  2LSK A;  2JJ9 A;  1BR1 A;  1G73 A;  4DMV A;  3ZCJ A;  4TV9 E;  4MLK A;  2WSS V;  3VKG A;  3AAE B;  2CXL A;  4CXX A;  2B1E A;  2CEA A;  5E0O A;  5LJM A;  4DND A;  4J2C A;  4H9S E;  2I59 A;  4G2A A;  5LJN A;  2WM9 A;  5HWX A;  4PFO A;  3E0Z A;  2ZLY A;  3N5L A;  3Q9D A;  4UF0 B;  3GWH A;  2IC9 A;  4HKA A;  2V26 A;  5EK3 A;  4EIW A;  1D1B A;  3FBL A;  4JUY A;  5LGU B;  4U74 A;  5L3E B;  2CLY C;  4IGU A;  4WBO A;  2HPL A;  4K0U A;  4U72 A;  1IJ6 A;  1HG2 A;  2MOZ A;  4I4T E;  4OYJ A;  3AA6 B;  1HCI A;  2X0L B;  4OK0 A;  4MFR A;  4OYK A;  2JMH A;  4B6X A;  2LHN A;  1ZV4 X;  5JRC B;  3SRZ A;  1MIY A;  4NUU A;  2CWY A;  5J1G A;  3AAA B;  3CX6 B;  3ESL A;  3N9Q A;  2NW9 A;  2X68 A;  2YEV C;  4EXT A;  4ADZ A;  4UIG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...