2L8KA

Nmr structure of the arterivirus nonstructural protein 7 alpha (nsp7 alpha)
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
123
structure length
123
Chain Sequence
b'GLTATLAALTDDDFQFLSDVLDCRAVRSAMNLRAALTSFQVAQYRNILNASLQVDRDAARSRRLMAKLADFAVEQEVTAGDRVVVIDGLDRMAHFKDDLVLVPLTTKVVGGSRCTICDVVKEE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Non-structural protein 7
publication title Structure and Genetic Analysis of the Arterivirus Nonstructural Protein 7{alpha}.
pubmed doi rcsb
source organism Equine arteritis virus
molecule tags Viral protein
total genus 28
structure length 123
sequence length 123
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2011-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16749 Arteri_nsp7a Arterivirus nonstructural protein 7 alpha
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.950 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2l8kA00
2L8KA
chains in the Genus database with same CATH superfamily
3HA4A 2JQQA 1XMOT 3LK3B 1OEDB 1O3XA 5L47A 3DJBA 4QHOA 3R6NA 1KEYA 2DLRA 2BS4A 4JI4T 1IZNB 4H9NC 2YDQA 5CA1E 4DV2T 2BG9C 2YKSA 2XSBA 3KVBA 4P0BA 2K5BB 3AEAA 2CXDA 2XQ3A 3RGLA 3AVRA 2QA7A 3J9X1 2D5UA 2FJAA 3F2EA 1LVFA 3H3MA 5ABEA 5LBMA 2H7VC 5JR9B 3FZHB 3NWIA 1CUNA 2FJEA 4AKLA 3RIAA 4JYAT 1X79A 1QUUA 2HH7A 3EHZA 2XQ9A 4HFBA 1MIYA 2D2SA 4CXYA 5AQHB 5HCMA 1KNZA 5HXHA 5FY1A 2YOEA 5L3DB 3C4XA 4HN9A 5BMVE 4QH4A 4TUYE 4KBMB 2ZMAA 2HHHT 4U33A 3PUXF 2BBHA 3A5XA 5FVLA 2QGSA 5ABFA 3JADA 2JQKA 4LMKA 1V9DA 3BQLA 2A9UA 2VWAA 3ONJA 4O4IE 4QWNB 2XQ4A 2VVNA 5IHYA 2JJ9A 2MAWA 1NENA 1WYCA 5F5WA 3C50A 5ABGA 3UUNA 4O2BE 5H6QB 4YHHT 1XDOA 4AIUA 3UU6A 4ILAA 2ES0A 3ZN0B 2XM2A 1XNQT 3SOLA 2MOZA 1S35A 2LKGA 5AQLB 2EHOB 3UQ4A 2FBWA 2LE8A 4X65T 3AA0B 3SFEA 2WY2A 4O2AE 4DR5T 3RHWA 2W66A 5HEHA 3RX6A 2R6GF 5FKYA 2KT9A 5AQQB 4X62T 2NR4A 5L3CB 4F6RC 3KV5A 3ZSSA 2MPKA 4ZI3C 5L3FB 3F31A 2KINB 4TV9E 2VVSA 5ABFB 2JMKA 3SWHA 2ACXA 1HFAA 4AKRB 5LHHB 3P8CD 3UT5E 2XTLA 4UEMA 4GOUA 3M65A 4MHCA 3N5LA 4PAGA 3TLSA 5DJQC 3W15B 2XUEA 3P4QA 4PJLA 3N9QA 5JVDE 4PK6A 4EYUA 2Y8DA 3Q9DA 1MIVA 3ZLIA 3AAIA 3PU3A 2I6HA 2LSYA 2IIUA 1XNRT 4DV0T 4AQGA 3ZT7A 4ZS3A 1WRDA 4UVCB 4ADZA 4JBWF 2Y48B 3UTKA 4HKAA 1YQ3A 2BBJA 4PK5A 2N2NA 2CHNA 5JQGE 3JAFA 4BA9A 3A7MA 5L4EA 2WU5A 4E7SA 2BKPA 2HN1A 2WM9A 3O9XA 2VASA 1HR0T 2CA5A 2LSIA 4MBQA 3CK6A 3AA6B 1UURA 4EV6A 1MMAA 3N2GE 3P4PA 2NOXA 4DNDA 1WR6A 3OBVE 3ZMZB 1HNWT 1M7KA 4QH5A 4EZHA 3FXDB 1HTJF 4K0UA 4UF0A 4EZ4A 3P7IA 2V5CA 3KDSE 1MNEA 2KLQA 4B3TT 3V5UA 4X64T 3VHLA 1HNXT 3ABVA 3JCFA 2V26A 2M6BA 1YKEB 3SFDA 4B3ST 4HWHA 3HL6A 4IT4A 2ODUA 3FBLA 2CBJA 4G63A 2L8KA 2XZEA 4LFCT 2WDQA 4GKKT 3BQKA 3UFEA 1EZ3A 5JRCA 3C98B 4OYJA 3G06A 2W67A 2W61A 3ZJ1A 3LG7A 4ZI7E 1KF6A 2CPTA 2X9HA 4QXCB 4A5XA 3M3ZB 2B76A 2WZHA 1X9BA 3TKLB 4A56A 4HWCA 4UF0B 3Q5XA 5KMGP 1YQ4A 2ZM8A 3AE9A 5GONE 5ABHA 4A98A 2I0MA 3JAEA 3DTOA 4BJMA 2YK0A 5AQJB 3RRCA 4LFBT 5HWYA 2YEVC 3NRYA 3E0ZA 2E9XA 3QB5A 2M6IA 4OYKA 4I55E 4PJJA 4OX9T 3MK7C 1L0VA 2RA1A 5DQVA 5JRCB 3I9WA 4WBOA 3B13A 2XJ7A 1Z0PA 4O4JE 3RC8A 2ZM6T 3WI3A 4X66T 4EXTA 1G8XA 4YT0A 4N78D 4ZEYA 4IE5A 3HKDE 3WAKA 4CXWA 3ZC1A 3PU8A 2LHRA 4V1Av 3SRZA 3UQ7A 4NPPA 4QKNA 4NUUA 2IMLA 3TLVA 5AQPB 3A8YC 3BQIA 1VCTA 3ZMSB 3AVSA 4LF9T 4DV4T 3KV4A 5FL1A 1H7CA 1VRBA 4PJMA 1U4QA 2LRLA 3T1YT 5FY7A 2E9XB 3O4XE 2J1DG 3HKBE 2QVAA 5KX5E 1T98A 5CA0E 4HWIB 5F3JA 2LLYA 4OK0A 2CHOA 4DBRA 1UK5A 5C2TA 3IBPA 4L5GA 5HEGA 2V7KA 1Y64B 1HG5A 3UUMA 2H7OA 3VU7H 4P0AA 3DP7A 1KFYA 3EAMA 4IDOA 4NXNT 1UX4A 3V5SA 5FP3A 3U3IA 4U74A 3Q5WA 3MACA 2CWOA 5AQVB 5LHGB 3N9NA 4FI5A 4UVAB 3EDUA 1D0XA 2WAUA 2ODVA 2HPJA 2IW5B 2CMRA 4U72A 3FB2A 2IC9A 4JI3T 4HFHA 3IA3A 3N9PA 2KZ7B 3ZKRA 2XQ8A 2UXCT 3ZMUB 3RLFF 4WBNE 5LJMA 2JPFA 2Q9QD 5LGUB 5CJ5A 2N9DA 2XHEB 3I1AA 2ZM0A 3GN5A 4X5TA 5AQNB 2L9QA 4LMJA 5AQOB 4XAXB 4YTMA 3OVUA 4HFIA 3PUSA 3I0QA 4IDZA 3T1HT 2JQHA 4ISTA 2WWVA 4DMVA 5IUXA 2C5JA 2WDRA 4DUZT 2V7MA 2W4XA 2BKNA 4CI1B 3KVAA 4LFAT 4XBFB 2MBGA 2LEHA 3L39A 3P4WA 4UIGA 5DQWA 4EEDA 5JDNA 4Z8XA 5CB4E 4H9SE 3IEEA 5FVKA 2XAQB 2WSSV 4H9OC 2BVMA 2PTFA 4H9QC 2UXDT 4Q25A 3QNUA 1UGOA 3RQUA 2BG9A 2YU2A 4FJOA 5IWAT 2V7LA 3AE7A 1MMGA 4DR3T 2J4GA 4IDPA 3H3AA 2CXLA 3Q2MA 2YU1A 1IAPA 3GN5B 2WU2A 4ZZCA 2CCQA 2E2AA 3WAJA 2LT3A 2KXPB 5FYMA 3AEGA 2IUBA 1G73A 1JNRA 4P09A 5LNKA 1GQEA 2CWYA 3ZYLA 2PJQA 1BR4A 1D0ZA 5LG3A 3CQGB 4KI0F 3CX8B 3RYIE 4DV1T 3EUHA 3C64A 4JI7T 4IREA 1MNDA 1I94T 2K9AA 3ETVA 4TV8E 4UV8B 1OXZA 1VOMA 3P4RA 2BS2A 4AKHA 4LF6T 2DL1A 3RIUC 4ZI2D 3OYZA 2ZLYA 2BG9B 3RF1A 2LJLA 4Z91A 1D1CA 4DR2T 1AJ3A 2KSRA 5FXVA 3RYHE 5FXZA 3UUXB 1KNPA 3GA8A 5L3GB 4JEHB 2UUBT 2NTXA 4Z90A 4GIWA 2HN2A 3I9YA 2E5LT 2K3WA 3CVRA 3E22E 4IE7A 5AQIB 2ZM2A 2NW9A 3QB5K 4DO0A 5EK3A 1R8IA 2DWGA 2BDEA 4U3CA 3C4ZA 3HKEE 1VCSA 2X67A 4JI8T 5LYJE 5JDMA 3F57A 1OEDE 1J5ET 2X51A 3OPCA 3OKQA 2RPAA 3LSVA 2EHOD 5J1GA 3GWHA 4JI2T 1WYBA 4U31A 4NUVA 1ZV4X 1HX8A 4I4TE 2YN6A 4DR7T 4CN1A 1KK7A 2XQ7A 2WBLA 5HEJA 2X0HA 4F8HA 4MFRA 3PUWF 1S94A 5AQTB 4YSXA 2CLYC 3RPUA 3RIUA 1B7TA 3ZN1B 2QRXA 3PUQA 1FEWA 1YXRA 2J62A 3S4UA 3AE4A 3NBXX 2V7IA 4ISSA 3ZCJA 4EYYR 1SHZC 4PW8A 2C5IT 1MMDA 4TNWA 4GYRA 3FBZA 2MYSA 3UUBA 2V5DA 4IE6A 2BS3A 2LHNA 5JDHA 2VL8A 4CXXA 1IBMT 2IC6A 2WP9A 3ETUA 2JRKA 3IF8B 3AE5A 3CQXC 3ONLC 3UU8A 3PTRB 2DI4A 3PJAJ 3AB3B 4KMCA 1US7B 1FMWA 5FMNA 1HX1B 4LF4T 3N9OA 3O1JA 5FL0A 1N36T 2LRKA 2H3RA 4HFCA 1ZOYA 2G0UA 2SPCA 3AA1B 5LG4A 3B57A 5FXXA 3KBTA 5LJNA 1WFDA 4C90A 1WLXA 3I0OA 3GMIA 1W0AA 3R84B 3D0TA 4PNIA 2CM0A 2N1GA 4UV9B 3ZEFB 2P9BA 2XQ6A 2YINA 1D1BA 3AAAB 3E08A 4ZZBA 2H88A 2W00A 4TNVA 4CI3B 5JDQA 4U2ZA 2VKJA 3QUJA 4B6XA 2XQAA 3ZMTB 1WR0A 1NWMX 4HGAA 4JUYA 2JQ9A 2CBIA 5AQFB 1QSDA 4BAYB 4ZI2C 3UU4A 3EDVA 2XPKA 3FXEB 4QXHB 4YHJA 5FNVE 2LSJA 4O4HE 3NZPA 3CPZA 3AEEA 3ZJ2A 5ETWA 5EZYE 3KV6A 4C91A 4EGWA 5C8YE 2WMNA 2I59A 2KWHA 5EK4A 3PURA 3HKCE 2V8SV 2YDRA 3AA7B 3N9LA 3EI0A 2WCAA 1YD8G 1E7PA 1NEKA 4AQYT 4DBQA 3TLUA 3UULA 1CHUA 4WYVA 4ZI3D 2CXFA 2CRBA 4LF7T 3QK6A 1J1JA 2CLYB 4JI5T 3OYXA 3AXJA 3RH3A 2V1DB 4DR4T 4CI2B 4HWFA 4AKIA 2A3DA 3CWZB 2QYWA 2KWIB 1QLBA 1XMQT 3AEDA 3KV9A 5AQUB 2IDOB 2D0UA 2EHOC 3P50A 3FZMB 2FUPA 4LMLA 2VB6A 4ANJA 4AI6A 4QXBB 3RC3A 5HXRA 4JV5T 3X1DA 3K3NA 2UXBT 5TAOA 3K8PC 1LKXA 5HWXA 5LCYA 4CN4A 3NZQA 4L0RA 4DV3T 2XY8B 2J47A 3AEFA 4UELA 5HYAA 5J2TE 3VKGA 2X9YA 4ASKA 3L09A 3L8RA 3JC6D 3VR9A 3B5MA 4DVDA 4KX6A 3VR8A 2LSKA 4HE8A 2AE9A 4NIQA 4LF5T 4PK4A 5IYZE 5LMNT 3ONXA 4ZHQE 3AXJB 1ZP0A 3CMLA 4IDNA 3AE8A 5JH7E 4AISA 3O1HA 4B3MT 5LBQB 1OWAA 3ZYMA 1J5WA 4UR9A 4ZS2A 2DNXA 5J0ZA 4GK0E 2WMOA 2XM1A 4U7YA 3C4WA 3MA9A 5HEUA 4QX7B 2YDSA 2LOPA 3FHNA 4O4LE 3RRWA 2LOSA 2BVLA 3VRAA 3ZPOA 3ZSTA 4X1YE 2XAHB 4YTPA 1JNZA 5E0OA 2X9WA 4DR1T 2EHOA 3QOFA 3ZT5A 1W9RA 4ILCA 2XAFB 4CZZB 2E9XD 2OV9A 2WB5A 4ILBA 1T7SA 5ADXL 2X0YA 5M4YA 4IGUA 3PUZF 1HF8A 2K24A 2LM2A 2M67A 2WZIA 2D0TA 3FZFB 2W2UA 5HXEA 4KHZF 1T8BA 3AE6A 2L3LA 4MLKA 2WS3A 2BKOA 3ZMVB 4JI6T 3UU5A 2X68A 3L3PA 5C3JA 1E2AA 3LJCA 2UXXB 5LGTB 3Q5EA 2RP4A 2JIWA 4TWDA 4HFDA 4WZXA 3CQCB 4DV5T 2OLTA 4EOZB 3PUVF 4KUMB 3NRXA 5A1LA 2GK9A 4ZXLA 2LSGA 3LBXA 2W62A 2E8IA 4ILUA 5JDFA 3AECA 3TLTA 3K3QC 3FZKB 2W0GA 1YKHB 4COFA 1Y01A 4CQIA 4EEBA 1U5PA 1T72A 4L9IA 2XAJB 4EAHA 4U2YA 3PUAA 4KHPT 5LMUT 5JTGA 3PUYF 4H9PC 5AQSB 2FJDA 4HTEA 3SS1A 4CN6A 2B1EA 5DABA 5LOVE 2C5KT 3EABA 4IHJE 4J2CA 2K48A 2VURA 2UU9T 1N34T 4AXPA 3LDQB 3NVOA 2E5VA 4KP3C 4YJ2E 3RI5A 4YSYA 2VKOA 3HI2A 4UVBB 2VL0A 1N32T 3LBXB 3OJAA 2F4VT 3HR0A 4A97A 5CGMA 3ZCIA 4NXMT 4QX8B 2Z6EA 4EIWA 5JREA 2XQ5A 2WWUA 3AE3A 3JC6C 3AE2A 2Y6XA 3K3OA 2WDVA 4YJ3E 3KINB 3J7Yq 4K0KT 4LF8T 2IAKA 1XWMA 4IE4A 3MJXA 5AQKB 4JEUB 5HEOA 1W09A 1FJGT 2KNDA 4AQFC 5HXSA 5EK2A 4H9RC 4XZCA 4BJNA 3ZC0A 2PBIA 2W63A 1HS7A 1WCRA 4P1NA 5AFUL 5KDMC 1ZKEA 5AQRB 2Q9QC 3UU3A 5JDLA 5AQMB 1SUMB 3ZYKA 1DU2A 1YW0A 1Z8UA 4IE0A 2HPLA 3Q5DA 3PUGA 2KMFA 1E1HB 2XAGB 5LGNB 4YY3T 2E9XC 3ANWA 4YFSA 4DIDB 3U78A 4I0UA 1HG2A 4TWHA 4IDQA 5HCJA 2UUAT 4PFOA 2NWBA 3N2OA 3CX6B 4ERRA 4M1PA 4HFVA 4YLHA 1N33T 1ZHCA 3AEBA 2FJBA 4YSZA 2VK9A 1SA0E 1IJ5A 2C0SA 4WNKA 2A72A 4DMWA 4JI1T 1BR2A 3K1SA 3LK42 4I43B 2XSAA 4IL4A 2V7JA 2ACZA 3ESLA 4IIJE 2H89A 4AQFA 4GYSA 4GKJT 5KXJA 1OEDC 4TWFA 4E7ZA 1BR1A 1XDPA 4EB6E 3TLWA 2IHR1 3MKDA 1XZYA 3RQWA 2NW7A 3EVYA 4DUYT 4UXNB 2NTYA 2Q9QA 5HXCA 4TN7B 3CKDA 1UCUA 2BZBA 2V6YA 3ANWB 5LA6E 2V6XA 5L3EB 3CX7B 4X1IE 1SE7A 4H63V 3PDYA 3N2KE 4X1KE 3RYCE 3RKOA 3LFMA 1UX5A 4WW0A 5LXTE 2PG8A 5AQGB 5JR9C 4YXDA 2LM9A 3P4SA 4B3RT 3MXZA 4DR6T 1HCIA 3UFGA 1NAFA 5LB7B 2MTQA 1KNRA 5H6RB 1HNZT 3VRBA 5HAXA 3LK2B 4TX5A 3AAEB 1BR0A 3N9MA 2JMHA 2XQYA 5J2UE 2BG9E 3BK9A 4PFPA 1ZEEA 4HFEA 2X0LB 3O1IA 5CFBA 2AXDS 1M62A 5FY0A 4GK5E 4H63H 2A2FX 3PE0A 2DCFA 1IBKT 3RKGA 4OHFA 5L4HA 2DHRA 3NKZA 5BR8T 4I50E 2PFVA 2NP9A 2VKHA 3QC9A 2VQFT 3MZKB 2D9DA 2Q9QB 4AKGA 2OA5A 4G2AA 1FIOA 2V6YB 3IHRA 3ZT6A 4DV6T 2UUCT 3RYFE 2WQYA 2VKDA 5L3BB 1MIWA 1OEDA 1UUSA 2UXNB 3KFWX 1I6ZA 1D0YA 4OFZA 3KBUA 4ZOLE 1FMVA 3AE1A 1LRZA 4QH1A 1MMNA 2NW8A 2X66A 4DV7T 3T8OA 4X20E 3H37A 5FXWA 4O8SA 2VQET 3CIRA 1LVKA 5LP6E 4JI0T 3C51A 5JR9A 5LHIB 2DWKA 2CE7A 3FZLB 4U7IA 5F8PA 4TZ4C 5L2LA 1IBLT 3OTOT 3PJAA 2LKHA 3RIFA 2XASB 1D1AA 4YTNA 4PJNA 2CEAA 3PV0F 4JLEA 4IL9A 4HWDA 3VKHA 4HEAA 1W0BA 2X9XA 5JDGA 1IJ6A 4MALA
chains in the Genus database with same CATH topology
2W62A 1ZV4X 4I55E 4PJJA 3HA4A 1HX8A 2E8IA 2JQQA 3MK7C 4I4TE 4ILUA 3LK3B 2RA1A 5JDFA 5DQVA 1O3XA 3K3QC 3DJBA 5JRCB 4QHOA 1KK7A 2W0GA 3I9WA 1YKHB 3R6NA 4WBOA 2WBLA 2DLRA 3B13A 1IZNB 4MFRA 4H9NC 4CQIA 1S94A 1U5PA 5CA1E 1Z0PA 4O4JE 4L9IA 2XAJB 4EAHA 2CLYC 3RPUA 1B7TA 3RC8A 3KVBA 3PUAA 4P0BA 2K5BB 3WI3A 4EXTA 3ZN1B 2CXDA 1G8XA 3AVRA 2QA7A 3PUQA 3J9X1 1FEWA 4N78D 4H9PC 2D5UA 4IE5A 4HTEA 3S4UA 3HKDE 3NBXX 3SS1A 3WAKA 4CXWA 2V7IA 3F2EA 1LVFA 4ISSA 3ZC1A 2B1EA 3ZCJA 3PU8A 4EYYR 1SHZC 2LHRA 4V1Av 5DABA 5LOVE 4PW8A 2C5KT 5LBMA 3SRZA 2C5IT 2H7VC 4IHJE 5JR9B 4J2CA 1MMDA 4QKNA 2K48A 1CUNA 4NUUA 4GYRA 3FBZA 2MYSA 4AKLA 3BQIA 1X79A 1QUUA 2HH7A 3ZMSB 4IE6A 3AVSA 4AXPA 2LHNA 5JDHA 2VL8A 1MIYA 2D2SA 3KV4A 4CXXA 1H7CA 2IC6A 1VRBA 4PJMA 1U4QA 4KP3C 4YJ2E 4CXYA 1KNZA 5HXHA 3ETUA 5FY1A 5FY7A 5L3DB 3C4XA 2JRKA 4HN9A 5BMVE 4TUYE 2VKOA 3IF8B 2E9XB 3CQXC 3O4XE 4KBMB 3HI2A 3PTRB 4UVBB 2ZMAA 2J1DG 2DI4A 3LBXB 3OJAA 3HR0A 3A5XA 3HKBE 3AB3B 4KMCA 3ZCIA 1US7B 5KX5E 1FMWA 2QGSA 5FMNA 4QX8B 1T98A 5CA0E 2Z6EA 5F3JA 4OK0A 4DBRA 3N9OA 3O1JA 4EIWA 5JREA 1V9DA 3BQLA 2VWAA 3IBPA 2WWUA 3JC6C 2H3RA 4L5GA 2G0UA 3AA1B 2SPCA 4O4IE 2Y6XA 3K3OA 5LG4A 3B57A 5FXXA 3KBTA 2V7KA 5LJNA 1Y64B 4QWNB 4YJ3E 3KINB 3J7Yq 5IHYA 1HG5A 4C90A 1WLXA 2JJ9A 3I0OA 2IAKA 3GMIA 1WYCA 3UUMA 2H7OA 3C50A 3MJXA 3D0TA 4IE4A 3R84B 3VU7H 4PNIA 4P0AA 2CM0A 3UUNA 4O2BE 5H6QB 2N1GA 3DP7A 4JEUB 4UV9B 2ES0A 3ZN0B 3ZEFB 2KNDA 2P9BA 4AQFC 5HXSA 5EK2A 3SOLA 4H9RC 2MOZA 4XZCA 4BJNA 1S35A 2YINA 1UX4A 1D1BA 2EHOB 3ZC0A 2LE8A 3V5SA 5FP3A 3AAAB 3E08A 3U3IA 3AA0B 2PBIA 2W00A 2W63A 4CI3B 4O2AE 5JDQA 1HS7A 3RX6A 5AFUL 2KT9A 2VKJA 4U74A 5KDMC 3Q5WA 1ZKEA 3MACA 2CWOA 2Q9QC 3QUJA 5JDLA 5LHGB 4B6XA 5L3CB 3ZMTB 3ZYKA 1NWMX 3N9NA 4FI5A 4HGAA 1YW0A 4JUYA 4UVAB 4F6RC 3EDUA 3KV5A 1D0XA 2WAUA 2ODVA 1QSDA 4BAYB 2HPJA 2IW5B 2CMRA 4IE0A 4ZI3C 4ZI2C 5L3FB 3F31A 3FB2A 2HPLA 2KINB 3EDVA 2IC9A 4U72A 3FXEB 4TV9E 4QXHB 3N9PA 3PUGA 2KZ7B 4YHJA 5FNVE 2KMFA 1E1HB 2LSJA 2XAGB 4O4HE 3NZPA 5LGNB 2JMKA 3CPZA 3ZJ2A 5ETWA 3SWHA 2E9XC 3ANWA 4YFSA 3ZMUB 5EZYE 2ACXA 3KV6A 4C91A 3U78A 1HFAA 5C8YE 4AKRB 4WBNE 2WMNA 1HG2A 2I59A 2KWHA 5LHHB 5EK4A 3PURA 4PFOA 5LJMA 3HKCE 3AA7B 3N9LA 2NWBA 3P8CD 2JPFA 2Q9QD 3UT5E 5LGUB 3N2OA 2N9DA 2XHEB 3I1AA 3CX6B 2XTLA 2ZM0A 4UEMA 4GOUA 1YD8G 3M65A 3GN5A 4ERRA 4MHCA 4M1PA 4HFVA 4DBQA 4YLHA 3UULA 2L9QA 1ZHCA 3N5LA 4PAGA 4ZI3D 2CXFA 5DJQC 3W15B 3QK6A 2VK9A 4XAXB 2XUEA 1SA0E 4PJLA 2CLYB 1IJ5A 3N9QA 2C0SA 5JVDE 4WNKA 3OYXA 3PUSA 4PK6A 3I0QA 4IDZA 2A72A 4EYUA 4DMWA 4ISTA 2Y8DA 1BR2A 3RH3A 3LK42 3Q9DA 4I43B 2V1DB 1MIVA 3ZLIA 3AAIA 4CI2B 3PU3A 4DMVA 2V7JA 4AKIA 2C5JA 2LSYA 2A3DA 2V7MA 3CWZB 4CI1B 3KVAA 4AQGA 4XBFB 2KWIB 3ESLA 2MBGA 4IIJE 4ZS3A 1WRDA 3KV9A 4UVCB 2LEHA 4AQFA 4UIGA 5DQWA 4GYSA 4ADZA 2D0UA 2EHOC 5JDNA 4Z8XA 2Y48B 5CB4E 4H9SE 3IEEA 2XAQB 4E7ZA 2WSSV 4H9OC 1BR1A 2VB6A 2BVMA 4ANJA 4H9QC 3UTKA 4EB6E 4AI6A 4QXBB 3RC3A 4HKAA 5HXRA 3MKDA 3K3NA 2NW7A 3EVYA 5TAOA 3K8PC 4PK5A 1LKXA 4UXNB 2NTYA 2N2NA 5LCYA 5HWXA 2Q9QA 5HXCA 4TN7B 3CKDA 1UCUA 2BZBA 3NZQA 5JQGE 4L0RA 3ANWB 2YU2A 4FJOA 5LA6E 4BA9A 2V7LA 1MMGA 3CX7B 5L3EB 4X1IE 4UELA 5HYAA 5J2TE 4H63V 4E7SA 3PDYA 2X9YA 3VKGA 3N2KE 3L09A 4ASKA 4X1KE 3RYCE 2WM9A 3RKOA 3H3AA 3O9XA 3JC6D 2CXLA 1UX5A 3LFMA 2VASA 3Q2MA 2YU1A 1IAPA 3GN5B 4WW0A 4DVDA 5LXTE 2CA5A 2CCQA 2PG8A 2LSIA 4MBQA 5JR9C 3AA6B 2LM9A 3WAJA 2LT3A 3MXZA 2KXPB 2LSKA 5FYMA 1HCIA 1MMAA 1NAFA 1G73A 4HE8A 2MTQA 4P09A 3N2GE 5LNKA 2NOXA 5H6RB 2CWYA 4DNDA 1WR6A 3OBVE 2PJQA 3ZMZB 3ZYLA 1BR4A 4PK4A 5IYZE 3ONXA 4ZHQE 1D0ZA 5HAXA 3LK2B 4TX5A 3AAEB 3CMLA 1BR0A 3N9MA 5JH7E 2JMHA 4EZHA 3CQGB 3O1HA 3FXDB 2XQYA 5J2UE 5LBQB 1HTJF 4K0UA 4UF0A 1OWAA 3CX8B 4EZ4A 3P7IA 3KDSE 3RYIE 3ZYMA 3BK9A 4PFPA 1ZEEA 3EUHA 2X0LB 3C64A 3O1IA 1MNEA 4ZS2A 2DNXA 2KLQA 1MNDA 5FY0A 4GK0E 2WMOA 4GK5E 4H63H 2K9AA 3ETVA 4TV8E 3V5UA 2A2FX 4UV8B 3VHLA 3PE0A 2DCFA 3C4WA 3MA9A 4QX7B 4OHFA 2V26A 2DHRA 1YKEB 2LOPA 3FHNA 4O4LE 1OXZA 3RRWA 2LOSA 2BVLA 1VOMA 3ZPOA 4I50E 4X1YE 2PFVA 4AKHA 2NP9A 2XAHB 3HL6A 2VKHA 3QC9A 3MZKB 4ZI2D 2ODUA 3FBLA 2Q9QB 4AKGA 3OYZA 2OA5A 5E0OA 2ZLYA 4G63A 2L8KA 2X9WA 4G2AA 1FIOA 3IHRA 3RYFE 2EHOA 2VKDA 5L3BB 1MIWA 2LJLA 3BQKA 3UFEA 1EZ3A 5JRCA 3C98B 1D1CA 2UXNB 3KFWX 2XAFB 4CZZB 2E9XD 4OYJA 1D0YA 1AJ3A 5ADXL 5FXVA 4OFZA 3RYHE 5FXZA 3UUXB 3GA8A 5L3GB 3KBUA 2W61A 4JEHB 5M4YA 4IGUA 4ZOLE 3ZJ1A 1FMVA 3LG7A 1LRZA 2NTXA 4ZI7E 1MMNA 4GIWA 1HF8A 2K24A 2NW8A 2X9HA 4QXCB 3I9YA 2X66A 2M67A 2D0TA 3T8OA 4X20E 3H37A 3CVRA 5HXEA 5FXWA 3E22E 4IE7A 4O8SA 2ZM2A 2NW9A 3TKLB 4A56A 1LVKA 5LP6E 4DO0A 3C51A 5EK3A 5JR9A 4UF0B 2L3LA 2DWGA 3Q5XA 2BDEA 4MLKA 5KMGP 5LHIB 3C4ZA 2DWKA 3ZMVB 2CE7A 2ZM8A 3HKEE 2X67A 2X68A 3L3PA 5LYJE 5JDMA 5GONE 3F57A 5F8PA 4TZ4C 3LJCA 3DTOA 5L2LA 4BJMA 2UXXB 2YK0A 2X51A 5LGTB 3RRCA 2XASB 1D1AA 3OKQA 4PJNA 2CEAA 2RP4A 2EHOD 3CQCB 4JLEA 3VKHA 5J1GA 5HWYA 2YEVC 4EOZB 3GWHA 4HEAA 3NRXA 3NRYA 4KUMB 1WYBA 5A1LA 2X9XA 3E0ZA 2E9XA 2GK9A 5JDGA 1IJ6A 4MALA 4NUVA 2LSGA 3LBXA 4OYKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L8K A; 
#chains in the Genus database with same CATH topology
 3HA4 A;  2JQQ A;  1XMO T;  3LK3 B;  1OED B;  1O3X A;  5L47 A;  3DJB A;  4QHO A;  3R6N A;  1KEY A;  2DLR A;  2BS4 A;  4JI4 T;  1IZN B;  4H9N C;  2YDQ A;  5CA1 E;  4DV2 T;  2BG9 C;  2YKS A;  2XSB A;  3KVB A;  4P0B A;  2K5B B;  3AEA A;  2CXD A;  2XQ3 A;  3RGL A;  3AVR A;  2QA7 A;  3J9X 1;  2D5U A;  2FJA A;  3F2E A;  1LVF A;  3H3M A;  5ABE A;  5LBM A;  2H7V C;  5JR9 B;  3FZH B;  3NWI A;  1CUN A;  2FJE A;  4AKL A;  3RIA A;  4JYA T;  1X79 A;  1QUU A;  2HH7 A;  3EHZ A;  2XQ9 A;  4HFB A;  1MIY A;  2D2S A;  4CXY A;  5AQH B;  5HCM A;  1KNZ A;  5HXH A;  5FY1 A;  2YOE A;  5L3D B;  3C4X A;  4HN9 A;  5BMV E;  4QH4 A;  4TUY E;  4KBM B;  2ZMA A;  2HHH T;  4U33 A;  3PUX F;  2BBH A;  3A5X A;  5FVL A;  2QGS A;  5ABF A;  3JAD A;  2JQK A;  4LMK A;  1V9D A;  3BQL A;  2A9U A;  2VWA A;  3ONJ A;  4O4I E;  4QWN B;  2XQ4 A;  2VVN A;  5IHY A;  2JJ9 A;  2MAW A;  1NEN A;  1WYC A;  5F5W A;  3C50 A;  5ABG A;  3UUN A;  4O2B E;  5H6Q B;  4YHH T;  1XDO A;  4AIU A;  3UU6 A;  4ILA A;  2ES0 A;  3ZN0 B;  2XM2 A;  1XNQ T;  3SOL A;  2MOZ A;  1S35 A;  2LKG A;  5AQL B;  2EHO B;  3UQ4 A;  2FBW A;  2LE8 A;  4X65 T;  3AA0 B;  3SFE A;  2WY2 A;  4O2A E;  4DR5 T;  3RHW A;  2W66 A;  5HEH A;  3RX6 A;  2R6G F;  5FKY A;  2KT9 A;  5AQQ B;  4X62 T;  2NR4 A;  5L3C B;  4F6R C;  3KV5 A;  3ZSS A;  2MPK A;  4ZI3 C;  5L3F B;  3F31 A;  2KIN B;  4TV9 E;  2VVS A;  5ABF B;  2JMK A;  3SWH A;  2ACX A;  1HFA A;  4AKR B;  5LHH B;  3P8C D;  3UT5 E;  2XTL A;  4UEM A;  4GOU A;  3M65 A;  4MHC A;  3N5L A;  4PAG A;  3TLS A;  5DJQ C;  3W15 B;  2XUE A;  3P4Q A;  4PJL A;  3N9Q A;  5JVD E;  4PK6 A;  4EYU A;  2Y8D A;  3Q9D A;  1MIV A;  3ZLI A;  3AAI A;  3PU3 A;  2I6H A;  2LSY A;  2IIU A;  1XNR T;  4DV0 T;  4AQG A;  3ZT7 A;  4ZS3 A;  1WRD A;  4UVC B;  4ADZ A;  4JBW F;  2Y48 B;  3UTK A;  4HKA A;  1YQ3 A;  2BBJ A;  4PK5 A;  2N2N A;  2CHN A;  5JQG E;  3JAF A;  4BA9 A;  3A7M A;  5L4E A;  2WU5 A;  4E7S A;  2BKP A;  2HN1 A;  2WM9 A;  3O9X A;  2VAS A;  1HR0 T;  2CA5 A;  2LSI A;  4MBQ A;  3CK6 A;  3AA6 B;  1UUR A;  4EV6 A;  1MMA A;  3N2G E;  3P4P A;  2NOX A;  4DND A;  1WR6 A;  3OBV E;  3ZMZ B;  1HNW T;  1M7K A;  4QH5 A;  4EZH A;  3FXD B;  1HTJ F;  4K0U A;  4UF0 A;  4EZ4 A;  3P7I A;  2V5C A;  3KDS E;  1MNE A;  2KLQ A;  4B3T T;  3V5U A;  4X64 T;  3VHL A;  1HNX T;  3ABV A;  3JCF A;  2V26 A;  2M6B A;  1YKE B;  3SFD A;  4B3S T;  4HWH A;  3HL6 A;  4IT4 A;  2ODU A;  3FBL A;  2CBJ A;  4G63 A;  2L8K A;  2XZE A;  4LFC T;  2WDQ A;  4GKK T;  3BQK A;  3UFE A;  1EZ3 A;  5JRC A;  3C98 B;  4OYJ A;  3G06 A;  2W67 A;  2W61 A;  3ZJ1 A;  3LG7 A;  4ZI7 E;  1KF6 A;  2CPT A;  2X9H A;  4QXC B;  4A5X A;  3M3Z B;  2B76 A;  2WZH A;  1X9B A;  3TKL B;  4A56 A;  4HWC A;  4UF0 B;  3Q5X A;  5KMG P;  1YQ4 A;  2ZM8 A;  3AE9 A;  5GON E;  5ABH A;  4A98 A;  2I0M A;  3JAE A;  3DTO A;  4BJM A;  2YK0 A;  5AQJ B;  3RRC A;  4LFB T;  5HWY A;  2YEV C;  3NRY A;  3E0Z A;  2E9X A;  3QB5 A;  2M6I A;  4OYK A;  4I55 E;  4PJJ A;  4OX9 T;  3MK7 C;  1L0V A;  2RA1 A;  5DQV A;  5JRC B;  3I9W A;  4WBO A;  3B13 A;  2XJ7 A;  1Z0P A;  4O4J E;  3RC8 A;  2ZM6 T;  3WI3 A;  4X66 T;  4EXT A;  1G8X A;  4YT0 A;  4N78 D;  4ZEY A;  4IE5 A;  3HKD E;  3WAK A;  4CXW A;  3ZC1 A;  3PU8 A;  2LHR A;  4V1A v;  3SRZ A;  3UQ7 A;  4NPP A;  4QKN A;  4NUU A;  2IML A;  3TLV A;  5AQP B;  3A8Y C;  3BQI A;  1VCT A;  3ZMS B;  3AVS A;  4LF9 T;  4DV4 T;  3KV4 A;  5FL1 A;  1H7C A;  1VRB A;  4PJM A;  1U4Q A;  2LRL A;  3T1Y T;  5FY7 A;  2E9X B;  3O4X E;  2J1D G;  3HKB E;  2QVA A;  5KX5 E;  1T98 A;  5CA0 E;  4HWI B;  5F3J A;  2LLY A;  4OK0 A;  2CHO A;  4DBR A;  1UK5 A;  5C2T A;  3IBP A;  4L5G A;  5HEG A;  2V7K A;  1Y64 B;  1HG5 A;  3UUM A;  2H7O A;  3VU7 H;  4P0A A;  3DP7 A;  1KFY A;  3EAM A;  4IDO A;  4NXN T;  1UX4 A;  3V5S A;  5FP3 A;  3U3I A;  4U74 A;  3Q5W A;  3MAC A;  2CWO A;  5AQV B;  5LHG B;  3N9N A;  4FI5 A;  4UVA B;  3EDU A;  1D0X A;  2WAU A;  2ODV A;  2HPJ A;  2IW5 B;  2CMR A;  4U72 A;  3FB2 A;  2IC9 A;  4JI3 T;  4HFH A;  3IA3 A;  3N9P A;  2KZ7 B;  3ZKR A;  2XQ8 A;  2UXC T;  3ZMU B;  3RLF F;  4WBN E;  5LJM A;  2JPF A;  2Q9Q D;  5LGU B;  5CJ5 A;  2N9D A;  2XHE B;  3I1A A;  2ZM0 A;  3GN5 A;  4X5T A;  5AQN B;  2L9Q A;  4LMJ A;  5AQO B;  4XAX B;  4YTM A;  3OVU A;  4HFI A;  3PUS A;  3I0Q A;  4IDZ A;  3T1H T;  2JQH A;  4IST A;  2WWV A;  4DMV A;  5IUX A;  2C5J A;  2WDR A;  4DUZ T;  2V7M A;  2W4X A;  2BKN A;  4CI1 B;  3KVA A;  4LFA T;  4XBF B;  2MBG A;  2LEH A;  3L39 A;  3P4W A;  4UIG A;  5DQW A;  4EED A;  5JDN A;  4Z8X A;  5CB4 E;  4H9S E;  3IEE A;  5FVK A;  2XAQ B;  2WSS V;  4H9O C;  2BVM A;  2PTF A;  4H9Q C;  2UXD T;  4Q25 A;  3QNU A;  1UGO A;  3RQU A;  2BG9 A;  2YU2 A;  4FJO A;  5IWA T;  2V7L A;  3AE7 A;  1MMG A;  4DR3 T;  2J4G A;  4IDP A;  3H3A A;  2CXL A;  3Q2M A;  2YU1 A;  1IAP A;  3GN5 B;  2WU2 A;  4ZZC A;  2CCQ A;  2E2A A;  3WAJ A;  2LT3 A;  2KXP B;  5FYM A;  3AEG A;  2IUB A;  1G73 A;  1JNR A;  4P09 A;  5LNK A;  1GQE A;  2CWY A;  3ZYL A;  2PJQ A;  1BR4 A;  1D0Z A;  5LG3 A;  3CQG B;  4KI0 F;  3CX8 B;  3RYI E;  4DV1 T;  3EUH A;  3C64 A;  4JI7 T;  4IRE A;  1MND A;  1I94 T;  2K9A A;  3ETV A;  4TV8 E;  4UV8 B;  1OXZ A;  1VOM A;  3P4R A;  2BS2 A;  4AKH A;  4LF6 T;  2DL1 A;  3RIU C;  4ZI2 D;  3OYZ A;  2ZLY A;  2BG9 B;  3RF1 A;  2LJL A;  4Z91 A;  1D1C A;  4DR2 T;  1AJ3 A;  2KSR A;  5FXV A;  3RYH E;  5FXZ A;  3UUX B;  1KNP A;  3GA8 A;  5L3G B;  4JEH B;  2UUB T;  2NTX A;  4Z90 A;  4GIW A;  2HN2 A;  3I9Y A;  2E5L T;  2K3W A;  3CVR A;  3E22 E;  4IE7 A;  5AQI B;  2ZM2 A;  2NW9 A;  3QB5 K;  4DO0 A;  5EK3 A;  1R8I A;  2DWG A;  2BDE A;  4U3C A;  3C4Z A;  3HKE E;  1VCS A;  2X67 A;  4JI8 T;  5LYJ E;  5JDM A;  3F57 A;  1OED E;  1J5E T;  2X51 A;  3OPC A;  3OKQ A;  2RPA A;  3LSV A;  2EHO D;  5J1G A;  3GWH A;  4JI2 T;  1WYB A;  4U31 A;  4NUV A;  1ZV4 X;  1HX8 A;  4I4T E;  2YN6 A;  4DR7 T;  4CN1 A;  1KK7 A;  2XQ7 A;  2WBL A;  5HEJ A;  2X0H A;  4F8H A;  4MFR A;  3PUW F;  1S94 A;  5AQT B;  4YSX A;  2CLY C;  3RPU A;  3RIU A;  1B7T A;  3ZN1 B;  2QRX A;  3PUQ A;  1FEW A;  1YXR A;  2J62 A;  3S4U A;  3AE4 A;  3NBX X;  2V7I A;  4ISS A;  3ZCJ A;  4EYY R;  1SHZ C;  4PW8 A;  2C5I T;  1MMD A;  4TNW A;  4GYR A;  3FBZ A;  2MYS A;  3UUB A;  2V5D A;  4IE6 A;  2BS3 A;  2LHN A;  5JDH A;  2VL8 A;  4CXX A;  1IBM T;  2IC6 A;  2WP9 A;  3ETU A;  2JRK A;  3IF8 B;  3AE5 A;  3CQX C;  3ONL C;  3UU8 A;  3PTR B;  2DI4 A;  3PJA J;  3AB3 B;  4KMC A;  1US7 B;  1FMW A;  5FMN A;  1HX1 B;  4LF4 T;  3N9O A;  3O1J A;  5FL0 A;  1N36 T;  2LRK A;  2H3R A;  4HFC A;  1ZOY A;  2G0U A;  2SPC A;  3AA1 B;  5LG4 A;  3B57 A;  5FXX A;  3KBT A;  5LJN A;  1WFD A;  4C90 A;  1WLX A;  3I0O A;  3GMI A;  1W0A A;  3R84 B;  3D0T A;  4PNI A;  2CM0 A;  2N1G A;  4UV9 B;  3ZEF B;  2P9B A;  2XQ6 A;  2YIN A;  1D1B A;  3AAA B;  3E08 A;  4ZZB A;  2H88 A;  2W00 A;  4TNV A;  4CI3 B;  5JDQ A;  4U2Z A;  2VKJ A;  3QUJ A;  4B6X A;  2XQA A;  3ZMT B;  1WR0 A;  1NWM X;  4HGA A;  4JUY A;  2JQ9 A;  2CBI A;  5AQF B;  1QSD A;  4BAY B;  4ZI2 C;  3UU4 A;  3EDV A;  2XPK A;  3FXE B;  4QXH B;  4YHJ A;  5FNV E;  2LSJ A;  4O4H E;  3NZP A;  3CPZ A;  3AEE A;  3ZJ2 A;  5ETW A;  5EZY E;  3KV6 A;  4C91 A;  4EGW A;  5C8Y E;  2WMN A;  2I59 A;  2KWH A;  5EK4 A;  3PUR A;  3HKC E;  2V8S V;  2YDR A;  3AA7 B;  3N9L A;  3EI0 A;  2WCA A;  1YD8 G;  1E7P A;  1NEK A;  4AQY T;  4DBQ A;  3TLU A;  3UUL A;  1CHU A;  4WYV A;  4ZI3 D;  2CXF A;  2CRB A;  4LF7 T;  3QK6 A;  1J1J A;  2CLY B;  4JI5 T;  3OYX A;  3AXJ A;  3RH3 A;  2V1D B;  4DR4 T;  4CI2 B;  4HWF A;  4AKI A;  2A3D A;  3CWZ B;  2QYW A;  2KWI B;  1QLB A;  1XMQ T;  3AED A;  3KV9 A;  5AQU B;  2IDO B;  2D0U A;  2EHO C;  3P50 A;  3FZM B;  2FUP A;  4LML A;  2VB6 A;  4ANJ A;  4AI6 A;  4QXB B;  3RC3 A;  5HXR A;  4JV5 T;  3X1D A;  3K3N A;  2UXB T;  5TAO A;  3K8P C;  1LKX A;  5HWX A;  5LCY A;  4CN4 A;  3NZQ A;  4L0R A;  4DV3 T;  2XY8 B;  2J47 A;  3AEF A;  4UEL A;  5HYA A;  5J2T E;  3VKG A;  2X9Y A;  4ASK A;  3L09 A;  3L8R A;  3JC6 D;  3VR9 A;  3B5M A;  4DVD A;  4KX6 A;  3VR8 A;  2LSK A;  4HE8 A;  2AE9 A;  4NIQ A;  4LF5 T;  4PK4 A;  5IYZ E;  5LMN T;  3ONX A;  4ZHQ E;  3AXJ B;  1ZP0 A;  3CML A;  4IDN A;  3AE8 A;  5JH7 E;  4AIS A;  3O1H A;  4B3M T;  5LBQ B;  1OWA A;  3ZYM A;  1J5W A;  4UR9 A;  4ZS2 A;  2DNX A;  5J0Z A;  4GK0 E;  2WMO A;  2XM1 A;  4U7Y A;  3C4W A;  3MA9 A;  5HEU A;  4QX7 B;  2YDS A;  2LOP A;  3FHN A;  4O4L E;  3RRW A;  2LOS A;  2BVL A;  3VRA A;  3ZPO A;  3ZST A;  4X1Y E;  2XAH B;  4YTP A;  1JNZ A;  5E0O A;  2X9W A;  4DR1 T;  2EHO A;  3QOF A;  3ZT5 A;  1W9R A;  4ILC A;  2XAF B;  4CZZ B;  2E9X D;  2OV9 A;  2WB5 A;  4ILB A;  1T7S A;  5ADX L;  2X0Y A;  5M4Y A;  4IGU A;  3PUZ F;  1HF8 A;  2K24 A;  2LM2 A;  2M67 A;  2WZI A;  2D0T A;  3FZF B;  2W2U A;  5HXE A;  4KHZ F;  1T8B A;  3AE6 A;  2L3L A;  4MLK A;  2WS3 A;  2BKO A;  3ZMV B;  4JI6 T;  3UU5 A;  2X68 A;  3L3P A;  5C3J A;  1E2A A;  3LJC A;  2UXX B;  5LGT B;  3Q5E A;  2RP4 A;  2JIW A;  4TWD A;  4HFD A;  4WZX A;  3CQC B;  4DV5 T;  2OLT A;  4EOZ B;  3PUV F;  4KUM B;  3NRX A;  5A1L A;  2GK9 A;  4ZXL A;  2LSG A;  3LBX A;  2W62 A;  2E8I A;  4ILU A;  5JDF A;  3AEC A;  3TLT A;  3K3Q C;  3FZK B;  2W0G A;  1YKH B;  4COF A;  1Y01 A;  4CQI A;  4EEB A;  1U5P A;  1T72 A;  4L9I A;  2XAJ B;  4EAH A;  4U2Y A;  3PUA A;  4KHP T;  5LMU T;  5JTG A;  3PUY F;  4H9P C;  5AQS B;  2FJD A;  4HTE A;  3SS1 A;  4CN6 A;  2B1E A;  5DAB A;  5LOV E;  2C5K T;  3EAB A;  4IHJ E;  4J2C A;  2K48 A;  2VUR A;  2UU9 T;  1N34 T;  4AXP A;  3LDQ B;  3NVO A;  2E5V A;  4KP3 C;  4YJ2 E;  3RI5 A;  4YSY A;  2VKO A;  3HI2 A;  4UVB B;  2VL0 A;  1N32 T;  3LBX B;  3OJA A;  2F4V T;  3HR0 A;  4A97 A;  5CGM A;  3ZCI A;  4NXM T;  4QX8 B;  2Z6E A;  4EIW A;  5JRE A;  2XQ5 A;  2WWU A;  3AE3 A;  3JC6 C;  3AE2 A;  2Y6X A;  3K3O A;  2WDV A;  4YJ3 E;  3KIN B;  3J7Y q;  4K0K T;  4LF8 T;  2IAK A;  1XWM A;  4IE4 A;  3MJX A;  5AQK B;  4JEU B;  5HEO A;  1W09 A;  1FJG T;  2KND A;  4AQF C;  5HXS A;  5EK2 A;  4H9R C;  4XZC A;  4BJN A;  3ZC0 A;  2PBI A;  2W63 A;  1HS7 A;  1WCR A;  4P1N A;  5AFU L;  5KDM C;  1ZKE A;  5AQR B;  2Q9Q C;  3UU3 A;  5JDL A;  5AQM B;  1SUM B;  3ZYK A;  1DU2 A;  1YW0 A;  1Z8U A;  4IE0 A;  2HPL A;  3Q5D A;  3PUG A;  2KMF A;  1E1H B;  2XAG B;  5LGN B;  4YY3 T;  2E9X C;  3ANW A;  4YFS A;  4DID B;  3U78 A;  4I0U A;  1HG2 A;  4TWH A;  4IDQ A;  5HCJ A;  2UUA T;  4PFO A;  2NWB A;  3N2O A;  3CX6 B;  4ERR A;  4M1P A;  4HFV A;  4YLH A;  1N33 T;  1ZHC A;  3AEB A;  2FJB A;  4YSZ A;  2VK9 A;  1SA0 E;  1IJ5 A;  2C0S A;  4WNK A;  2A72 A;  4DMW A;  4JI1 T;  1BR2 A;  3K1S A;  3LK4 2;  4I43 B;  2XSA A;  4IL4 A;  2V7J A;  2ACZ A;  3ESL A;  4IIJ E;  2H89 A;  4AQF A;  4GYS A;  4GKJ T;  5KXJ A;  1OED C;  4TWF A;  4E7Z A;  1BR1 A;  1XDP A;  4EB6 E;  3TLW A;  2IHR 1;  3MKD A;  1XZY A;  3RQW A;  2NW7 A;  3EVY A;  4DUY T;  4UXN B;  2NTY A;  2Q9Q A;  5HXC A;  4TN7 B;  3CKD A;  1UCU A;  2BZB A;  2V6Y A;  3ANW B;  5LA6 E;  2V6X A;  5L3E B;  3CX7 B;  4X1I E;  1SE7 A;  4H63 V;  3PDY A;  3N2K E;  4X1K E;  3RYC E;  3RKO A;  3LFM A;  1UX5 A;  4WW0 A;  5LXT E;  2PG8 A;  5AQG B;  5JR9 C;  4YXD A;  2LM9 A;  3P4S A;  4B3R T;  3MXZ A;  4DR6 T;  1HCI A;  3UFG A;  1NAF A;  5LB7 B;  2MTQ A;  1KNR A;  5H6R B;  1HNZ T;  3VRB A;  5HAX A;  3LK2 B;  4TX5 A;  3AAE B;  1BR0 A;  3N9M A;  2JMH A;  2XQY A;  5J2U E;  2BG9 E;  3BK9 A;  4PFP A;  1ZEE A;  4HFE A;  2X0L B;  3O1I A;  5CFB A;  2AXD S;  1M62 A;  5FY0 A;  4GK5 E;  4H63 H;  2A2F X;  3PE0 A;  2DCF A;  1IBK T;  3RKG A;  4OHF A;  5L4H A;  2DHR A;  3NKZ A;  5BR8 T;  4I50 E;  2PFV A;  2NP9 A;  2VKH A;  3QC9 A;  2VQF T;  3MZK B;  2D9D A;  2Q9Q B;  4AKG A;  2OA5 A;  4G2A A;  1FIO A;  2V6Y B;  3IHR A;  3ZT6 A;  4DV6 T;  2UUC T;  3RYF E;  2WQY A;  2VKD A;  5L3B B;  1MIW A;  1OED A;  1UUS A;  2UXN B;  3KFW X;  1I6Z A;  1D0Y A;  4OFZ A;  3KBU A;  4ZOL E;  1FMV A;  3AE1 A;  1LRZ A;  4QH1 A;  1MMN A;  2NW8 A;  2X66 A;  4DV7 T;  3T8O A;  4X20 E;  3H37 A;  5FXW A;  4O8S A;  2VQE T;  3CIR A;  1LVK A;  5LP6 E;  4JI0 T;  3C51 A;  5JR9 A;  5LHI B;  2DWK A;  2CE7 A;  3FZL B;  4U7I A;  5F8P A;  4TZ4 C;  5L2L A;  1IBL T;  3OTO T;  3PJA A;  2LKH A;  3RIF A;  2XAS B;  1D1A A;  4YTN A;  4PJN A;  2CEA A;  3PV0 F;  4JLE A;  4IL9 A;  4HWD A;  3VKH A;  4HEA A;  1W0B A;  2X9X A;  5JDG A;  1IJ6 A;  4MAL A; 
#chains in the Genus database with same CATH homology
 2W62 A;  1ZV4 X;  4I55 E;  4PJJ A;  3HA4 A;  1HX8 A;  2E8I A;  2JQQ A;  3MK7 C;  4I4T E;  4ILU A;  3LK3 B;  2RA1 A;  5JDF A;  5DQV A;  1O3X A;  3K3Q C;  3DJB A;  5JRC B;  4QHO A;  1KK7 A;  2W0G A;  3I9W A;  1YKH B;  3R6N A;  4WBO A;  2WBL A;  2DLR A;  3B13 A;  1IZN B;  4MFR A;  4H9N C;  4CQI A;  1S94 A;  1U5P A;  5CA1 E;  1Z0P A;  4O4J E;  4L9I A;  2XAJ B;  4EAH A;  2CLY C;  3RPU A;  1B7T A;  3RC8 A;  3KVB A;  3PUA A;  4P0B A;  2K5B B;  3WI3 A;  4EXT A;  3ZN1 B;  2CXD A;  1G8X A;  3AVR A;  2QA7 A;  3PUQ A;  3J9X 1;  1FEW A;  4N78 D;  4H9P C;  2D5U A;  4IE5 A;  4HTE A;  3S4U A;  3HKD E;  3NBX X;  3SS1 A;  3WAK A;  4CXW A;  2V7I A;  3F2E A;  1LVF A;  4ISS A;  3ZC1 A;  2B1E A;  3ZCJ A;  3PU8 A;  4EYY R;  1SHZ C;  2LHR A;  4V1A v;  5DAB A;  5LOV E;  4PW8 A;  2C5K T;  5LBM A;  3SRZ A;  2C5I T;  2H7V C;  4IHJ E;  5JR9 B;  4J2C A;  1MMD A;  4QKN A;  2K48 A;  1CUN A;  4NUU A;  4GYR A;  3FBZ A;  2MYS A;  4AKL A;  3BQI A;  1X79 A;  1QUU A;  2HH7 A;  3ZMS B;  4IE6 A;  3AVS A;  4AXP A;  2LHN A;  5JDH A;  2VL8 A;  1MIY A;  2D2S A;  3KV4 A;  4CXX A;  1H7C A;  2IC6 A;  1VRB A;  4PJM A;  1U4Q A;  4KP3 C;  4YJ2 E;  4CXY A;  1KNZ A;  5HXH A;  3ETU A;  5FY1 A;  5FY7 A;  5L3D B;  3C4X A;  2JRK A;  4HN9 A;  5BMV E;  4TUY E;  2VKO A;  3IF8 B;  2E9X B;  3CQX C;  3O4X E;  4KBM B;  3HI2 A;  3PTR B;  4UVB B;  2ZMA A;  2J1D G;  2DI4 A;  3LBX B;  3OJA A;  3HR0 A;  3A5X A;  3HKB E;  3AB3 B;  4KMC A;  3ZCI A;  1US7 B;  5KX5 E;  1FMW A;  2QGS A;  5FMN A;  4QX8 B;  1T98 A;  5CA0 E;  2Z6E A;  5F3J A;  4OK0 A;  4DBR A;  3N9O A;  3O1J A;  4EIW A;  5JRE A;  1V9D A;  3BQL A;  2VWA A;  3IBP A;  2WWU A;  3JC6 C;  2H3R A;  4L5G A;  2G0U A;  3AA1 B;  2SPC A;  4O4I E;  2Y6X A;  3K3O A;  5LG4 A;  3B57 A;  5FXX A;  3KBT A;  2V7K A;  5LJN A;  1Y64 B;  4QWN B;  4YJ3 E;  3KIN B;  3J7Y q;  5IHY A;  1HG5 A;  4C90 A;  1WLX A;  2JJ9 A;  3I0O A;  2IAK A;  3GMI A;  1WYC A;  3UUM A;  2H7O A;  3C50 A;  3MJX A;  3D0T A;  4IE4 A;  3R84 B;  3VU7 H;  4PNI A;  4P0A A;  2CM0 A;  3UUN A;  4O2B E;  5H6Q B;  2N1G A;  3DP7 A;  4JEU B;  4UV9 B;  2ES0 A;  3ZN0 B;  3ZEF B;  2KND A;  2P9B A;  4AQF C;  5HXS A;  5EK2 A;  3SOL A;  4H9R C;  2MOZ A;  4XZC A;  4BJN A;  1S35 A;  2YIN A;  1UX4 A;  1D1B A;  2EHO B;  3ZC0 A;  2LE8 A;  3V5S A;  5FP3 A;  3AAA B;  3E08 A;  3U3I A;  3AA0 B;  2PBI A;  2W00 A;  2W63 A;  4CI3 B;  4O2A E;  5JDQ A;  1HS7 A;  3RX6 A;  5AFU L;  2KT9 A;  2VKJ A;  4U74 A;  5KDM C;  3Q5W A;  1ZKE A;  3MAC A;  2CWO A;  2Q9Q C;  3QUJ A;  5JDL A;  5LHG B;  4B6X A;  5L3C B;  3ZMT B;  3ZYK A;  1NWM X;  3N9N A;  4FI5 A;  4HGA A;  1YW0 A;  4JUY A;  4UVA B;  4F6R C;  3EDU A;  3KV5 A;  1D0X A;  2WAU A;  2ODV A;  1QSD A;  4BAY B;  2HPJ A;  2IW5 B;  2CMR A;  4IE0 A;  4ZI3 C;  4ZI2 C;  5L3F B;  3F31 A;  3FB2 A;  2HPL A;  2KIN B;  3EDV A;  2IC9 A;  4U72 A;  3FXE B;  4TV9 E;  4QXH B;  3N9P A;  3PUG A;  2KZ7 B;  4YHJ A;  5FNV E;  2KMF A;  1E1H B;  2LSJ A;  2XAG B;  4O4H E;  3NZP A;  5LGN B;  2JMK A;  3CPZ A;  3ZJ2 A;  5ETW A;  3SWH A;  2E9X C;  3ANW A;  4YFS A;  3ZMU B;  5EZY E;  2ACX A;  3KV6 A;  4C91 A;  3U78 A;  1HFA A;  5C8Y E;  4AKR B;  4WBN E;  2WMN A;  1HG2 A;  2I59 A;  2KWH A;  5LHH B;  5EK4 A;  3PUR A;  4PFO A;  5LJM A;  3HKC E;  3AA7 B;  3N9L A;  2NWB A;  3P8C D;  2JPF A;  2Q9Q D;  3UT5 E;  5LGU B;  3N2O A;  2N9D A;  2XHE B;  3I1A A;  3CX6 B;  2XTL A;  2ZM0 A;  4UEM A;  4GOU A;  1YD8 G;  3M65 A;  3GN5 A;  4ERR A;  4MHC A;  4M1P A;  4HFV A;  4DBQ A;  4YLH A;  3UUL A;  2L9Q A;  1ZHC A;  3N5L A;  4PAG A;  4ZI3 D;  2CXF A;  5DJQ C;  3W15 B;  3QK6 A;  2VK9 A;  4XAX B;  2XUE A;  1SA0 E;  4PJL A;  2CLY B;  1IJ5 A;  3N9Q A;  2C0S A;  5JVD E;  4WNK A;  3OYX A;  3PUS A;  4PK6 A;  3I0Q A;  4IDZ A;  2A72 A;  4EYU A;  4DMW A;  4IST A;  2Y8D A;  1BR2 A;  3RH3 A;  3LK4 2;  3Q9D A;  4I43 B;  2V1D B;  1MIV A;  3ZLI A;  3AAI A;  4CI2 B;  3PU3 A;  4DMV A;  2V7J A;  4AKI A;  2C5J A;  2LSY A;  2A3D A;  2V7M A;  3CWZ B;  4CI1 B;  3KVA A;  4AQG A;  4XBF B;  2KWI B;  3ESL A;  2MBG A;  4IIJ E;  4ZS3 A;  1WRD A;  3KV9 A;  4UVC B;  2LEH A;  4AQF A;  4UIG A;  5DQW A;  4GYS A;  4ADZ A;  2D0U A;  2EHO C;  5JDN A;  4Z8X A;  2Y48 B;  5CB4 E;  4H9S E;  3IEE A;  2XAQ B;  4E7Z A;  2WSS V;  4H9O C;  1BR1 A;  2VB6 A;  2BVM A;  4ANJ A;  4H9Q C;  3UTK A;  4EB6 E;  4AI6 A;  4QXB B;  3RC3 A;  4HKA A;  5HXR A;  3MKD A;  3K3N A;  2NW7 A;  3EVY A;  5TAO A;  3K8P C;  4PK5 A;  1LKX A;  4UXN B;  2NTY A;  2N2N A;  5LCY A;  5HWX A;  2Q9Q A;  5HXC A;  4TN7 B;  3CKD A;  1UCU A;  2BZB A;  3NZQ A;  5JQG E;  4L0R A;  3ANW B;  2YU2 A;  4FJO A;  5LA6 E;  4BA9 A;  2V7L A;  1MMG A;  3CX7 B;  5L3E B;  4X1I E;  4UEL A;  5HYA A;  5J2T E;  4H63 V;  4E7S A;  3PDY A;  2X9Y A;  3VKG A;  3N2K E;  3L09 A;  4ASK A;  4X1K E;  3RYC E;  2WM9 A;  3RKO A;  3H3A A;  3O9X A;  3JC6 D;  2CXL A;  1UX5 A;  3LFM A;  2VAS A;  3Q2M A;  2YU1 A;  1IAP A;  3GN5 B;  4WW0 A;  4DVD A;  5LXT E;  2CA5 A;  2CCQ A;  2PG8 A;  2LSI A;  4MBQ A;  5JR9 C;  3AA6 B;  2LM9 A;  3WAJ A;  2LT3 A;  3MXZ A;  2KXP B;  2LSK A;  5FYM A;  1HCI A;  1MMA A;  1NAF A;  1G73 A;  4HE8 A;  2MTQ A;  4P09 A;  3N2G E;  5LNK A;  2NOX A;  5H6R B;  2CWY A;  4DND A;  1WR6 A;  3OBV E;  2PJQ A;  3ZMZ B;  3ZYL A;  1BR4 A;  4PK4 A;  5IYZ E;  3ONX A;  4ZHQ E;  1D0Z A;  5HAX A;  3LK2 B;  4TX5 A;  3AAE B;  3CML A;  1BR0 A;  3N9M A;  5JH7 E;  2JMH A;  4EZH A;  3CQG B;  3O1H A;  3FXD B;  2XQY A;  5J2U E;  5LBQ B;  1HTJ F;  4K0U A;  4UF0 A;  1OWA A;  3CX8 B;  4EZ4 A;  3P7I A;  3KDS E;  3RYI E;  3ZYM A;  3BK9 A;  4PFP A;  1ZEE A;  3EUH A;  2X0L B;  3C64 A;  3O1I A;  1MNE A;  4ZS2 A;  2DNX A;  2KLQ A;  1MND A;  5FY0 A;  4GK0 E;  2WMO A;  4GK5 E;  4H63 H;  2K9A A;  3ETV A;  4TV8 E;  3V5U A;  2A2F X;  4UV8 B;  3VHL A;  3PE0 A;  2DCF A;  3C4W A;  3MA9 A;  4QX7 B;  4OHF A;  2V26 A;  2DHR A;  1YKE B;  2LOP A;  3FHN A;  4O4L E;  1OXZ A;  3RRW A;  2LOS A;  2BVL A;  1VOM A;  3ZPO A;  4I50 E;  4X1Y E;  2PFV A;  4AKH A;  2NP9 A;  2XAH B;  3HL6 A;  2VKH A;  3QC9 A;  3MZK B;  4ZI2 D;  2ODU A;  3FBL A;  2Q9Q B;  4AKG A;  3OYZ A;  2OA5 A;  5E0O A;  2ZLY A;  4G63 A;  2L8K A;  2X9W A;  4G2A A;  1FIO A;  3IHR A;  3RYF E;  2EHO A;  2VKD A;  5L3B B;  1MIW A;  2LJL A;  3BQK A;  3UFE A;  1EZ3 A;  5JRC A;  3C98 B;  1D1C A;  2UXN B;  3KFW X;  2XAF B;  4CZZ B;  2E9X D;  4OYJ A;  1D0Y A;  1AJ3 A;  5ADX L;  5FXV A;  4OFZ A;  3RYH E;  5FXZ A;  3UUX B;  3GA8 A;  5L3G B;  3KBU A;  2W61 A;  4JEH B;  5M4Y A;  4IGU A;  4ZOL E;  3ZJ1 A;  1FMV A;  3LG7 A;  1LRZ A;  2NTX A;  4ZI7 E;  1MMN A;  4GIW A;  1HF8 A;  2K24 A;  2NW8 A;  2X9H A;  4QXC B;  3I9Y A;  2X66 A;  2M67 A;  2D0T A;  3T8O A;  4X20 E;  3H37 A;  3CVR A;  5HXE A;  5FXW A;  3E22 E;  4IE7 A;  4O8S A;  2ZM2 A;  2NW9 A;  3TKL B;  4A56 A;  1LVK A;  5LP6 E;  4DO0 A;  3C51 A;  5EK3 A;  5JR9 A;  4UF0 B;  2L3L A;  2DWG A;  3Q5X A;  2BDE A;  4MLK A;  5KMG P;  5LHI B;  3C4Z A;  2DWK A;  3ZMV B;  2CE7 A;  2ZM8 A;  3HKE E;  2X67 A;  2X68 A;  3L3P A;  5LYJ E;  5JDM A;  5GON E;  3F57 A;  5F8P A;  4TZ4 C;  3LJC A;  3DTO A;  5L2L A;  4BJM A;  2UXX B;  2YK0 A;  2X51 A;  5LGT B;  3RRC A;  2XAS B;  1D1A A;  3OKQ A;  4PJN A;  2CEA A;  2RP4 A;  2EHO D;  3CQC B;  4JLE A;  3VKH A;  5J1G A;  5HWY A;  2YEV C;  4EOZ B;  3GWH A;  4HEA A;  3NRX A;  3NRY A;  4KUM B;  1WYB A;  5A1L A;  2X9X A;  3E0Z A;  2E9X A;  2GK9 A;  5JDG A;  1IJ6 A;  4MAL A;  4NUV A;  2LSG A;  3LBX A;  4OYK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...