4JI5T

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
total genus 31
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 4ji5T00
4GKKT 1N32T 1IBKT 2UUAT 1IBLT 4JI2T 1N36T 4AQYT 4JI0T 1N33T 4JI5T 4B3TT 4OX9T 4X64T 4DV1T 1XNQT 4B3MT 4JI1T 4LFBT 4JI4T 4NXNT 2UXCT 4DR2T 4K0KT 4JI6T 4DR3T 2UU9T 4JI3T 4YHHT 5IWAT 4DV6T 4LF5T 5LMNT 4JI7T 3T1HT 4DUZT 4LF6T 4DR1T 5LMUT 4LF7T 2UXDT 1J5ET 4DV4T 4LFAT 4B3ST 4LF9T 4DV2T 4LF8T 4DR4T 1IBMT 4JI8T 4LF4T 2ZM6T 1HNXT 1XMOT 4GKJT 4DR7T 4DV7T 1HNZT 1XMQT 2UXBT 4JYAT 4DR6T 3T1YT 1N34T 4DUYT 2VQET 4DV5T 3OTOT 4KHPT 4B3RT 4NXMT 4DV3T 2VQFT 4LFCT 4X62T 1FJGT 2F4VT 1I94T 5BR8T 2UUBT 1HNWT 4DV0T 1HR0T 1XNRT 4JV5T 4X66T 2UUCT 4YY3T 2E5LT 2HHHT 4DR5T 4X65T
chains in the Genus database with same CATH superfamily
2CEAA 3ETVA 3N9MA 4OK0A 5HXRA 3CKDA 3HKBE 1MIWA 5L3GB 3N9LA 2XAFB 1M62A 2AXDS 1T8BA 4BAYB 3LDQB 5LG4A 2A3DA 2G0UA 3TLUA 4QH1A 2EHOD 1LRZA 5LHIB 4FI5A 4ADZA 3VKHA 2M6IA 5AQHB 4L5GA 1MIYA 3NVOA 3K3NA 4IE4A 4U72A 3N9OA 2LM2A 4TX5A 1GQEA 3F31A 3RPUA 5JDMA 3O1IA 3AVSA 3ZC1A 1T72A 2CHNA 1HS7A 1AJ3A 4TNWA 1HNZT 4I55E 4Z8XA 4A98A 2VQET 3OTOT 2K3WA 3NBXX 3ZJ1A 2ACXA 4HGAA 1G8XA 3N9PA 2D9DA 3CX7B 4U74A 4O4HE 4QH5A 2WWUA 5JH7E 4TV9E 2A2FX 2YU2A 3H3AA 1OEDE 3JC6C 3PJAJ 2BS4A 4ZI2C 2E2AA 1QSDA 5AQLB 2CHOA 5AQJB 4TUYE 4B6XA 2WDRA 1Z0PA 2WU2A 4G2AA 3EHZA 5F8PA 3AE9A 3AVRA 4UVBB 4IGUA 2OLTA 4EYYR 2W00A 2QVAA 4H63H 3HI2A 4X5TA 2LSKA 5LCYA 2B1EA 5EK4A 1MMNA 1BR2A 2HH7A 4JI7T 1I6ZA 4LF7T 2NW7A 1MMGA 4IIJE 2R6GF 3UUBA 3N2GE 1ZV4X 2E9XD 5A1LA 3RKOA 5ABHA 4PK6A 3MXZA 4HEAA 4WW0A 3U78A 5LNKA 2JRKA 3IA3A 3FBZA 5AQOB 4QXCB 4DV5T 3H3MA 4TWHA 4DMVA 5EZYE 1ZEEA 3ZYLA 1D0YA 1YXRA 4KBMB 1W0AA 3EVYA 3ZMTB 4IL9A 4G63A 3ZMZB 3RRCA 2V5CA 3I0OA 1HX8A 4DVDA 2UUCT 3UQ4A 4YSXA 2UUAT 5LHGB 3RC8A 2MPKA 2MOZA 4MBQA 3M3ZB 4WBOA 4UIGA 3QK6A 4JI4T 3NWIA 3ETUA 4PAGA 3AXJB 4OHFA 5ETWA 2ZMAA 3HKEE 2FBWA 3KV6A 5E0OA 4QKNA 3UUNA 4DR1T 2EHOB 3FZLB 4ILAA 3KFWX 4PFOA 4C91A 2JQKA 1HX1B 1D1BA 2LOSA 4DV2T 4AKIA 2H7VC 4AKGA 2Y8DA 5HAXA 1BR0A 1WCRA 3K8PC 2NW9A 5IHYA 5AQVB 1L0VA 3FZFB 2NTXA 1KF6A 4JYAT 5JR9C 3GMIA 4Z90A 2D0UA 4CXXA 1WR0A 2IW5B 4FJOA 3UTKA 2QYWA 5FY7A 5CA1E 4DV3T 4BA9A 5CA0E 4ILCA 4U2YA 5C2TA 5HEJA 1VOMA 2FJEA 2JPFA 1Y01A 2XPKA 2LHNA 3CQCB 3EDUA 4JV5T 4QX7B 4PW8A 4CQIA 3CIRA 4ZS2A 2K24A 2J47A 3GN5A 1SUMB 5BMVE 3LK3B 3UUMA 3RGLA 2WZHA 2BS2A 4B3TT 4YXDA 5LG3A 2I59A 4IE7A 4EAHA 3OYXA 1ZOYA 3LFMA 3ZT7A 3SOLA 5GONE 1D0ZA 4YHJA 3LSVA 4JI3T 4XBFB 2M6BA 3ZYKA 3PUYF 2XAHB 3PUXF 4JEUB 4NUUA 5FY1A 5JRCB 5FYMA 3JCFA 4P0BA 3FZKB 3OPCA 2IC9A 1S94A 2LM9A 3ZSSA 2X66A 1CUNA 3VU7H 2NOXA 4IE5A 3RC3A 2WB5A 3JC6D 2XSAA 1UCUA 4ZI2D 3OVUA 2E9XB 4AKLA 4BJMA 5JREA 5HEUA 2ZLYA 5JDHA 2BG9B 3B57A 3DTOA 2V7LA 1IJ5A 5J2UE 3RIFA 4KHPT 3LG7A 2JMKA 4LMKA 3RQUA 3A5XA 3IHRA 2UXNB 3FB2A 4OFZA 4LFCT 3ZEFB 4EEBA 1HNWT 2YU1A 4DMWA 1HR0T 5H6RB 2NWBA 4WYVA 4UR9A 4DNDA 3O1JA 5L3DB 2BS3A 5AFUL 3V5SA 3N2OA 2X0LB 3P7IA 1N36T 2QGSA 2XAJB 1E2AA 4TV8E 4ISTA 4X64T 3PJAA 4CN6A 4DV1T 2K48A 5L3FB 1OEDC 1YKEB 5JQGE 5JTGA 3MA9A 4LMLA 5KX5E 2ZM0A 2BDEA 3N9NA 3AA7B 5HXCA 3JADA 1UGOA 5H6QB 4BJNA 3ANWA 4UXNB 2XJ7A 3ZJ2A 3HR0A 3WI3A 4N78D 2OA5A 3MKDA 3CQGB 5L2LA 4EYUA 3SS1A 2BBHA 2LJLA 3L39A 3HL6A 2LT3A 3TLSA 3T1YT 3PUVF 4MFRA 4E7SA 1LVKA 4IDOA 2LEHA 4B3RT 5FKYA 5HXHA 3AEBA 5CB4E 3ZCJA 5JDFA 4PK5A 4F8HA 2F4VT 2WP9A 2UUBT 2KLQA 3EABA 4A56A 1FEWA 5JDLA 4X66T 4IT4A 5C8YE 2K5BB 2FJDA 1IJ6A 3OKQA 4O8SA 2MTQA 3N9QA 2CWYA 3AEAA 3FHNA 3KINB 3PUAA 2IHR1 2WQYA 1J1JA 5JDNA 4JLEA 4DO0A 2W62A 2X0HA 2CLYC 4LF5T 4YLHA 3RKGA 4KMCA 4COFA 2NW8A 4AQFA 2W63A 3AE5A 3PUGA 2H3RA 4UF0B 5EK2A 5FL1A 2RPAA 3AECA 2N1GA 3ZCIA 2X9WA 2WWVA 5IYZE 3QUJA 4YT0A 3C50A 4HN9A 2XZEA 3Q2MA 3FZMB 2Y6XA 1QLBA 2VL0A 2VKHA 2IAKA 4HFEA 1X79A 2DL1A 4WZXA 3AAAB 2V6YB 5LGNB 3AAEB 4EZHA 5LB7B 4ZZBA 4YY3T 1OWAA 1HTJF 2VKJA 5FNVE 1N32T 2IC6A 4JI2T 3F2EA 2BKOA 1BR4A 2ES0A 4JI5T 1ZHCA 3RH3A 3ZLIA 4JI1T 2LSJA 3SFDA 3HA4A 4X1YE 3I9YA 1W0BA 1D1CA 5AQNB 4YHHT 5FY0A 3PE0A 5LMNT 2YOEA 4LF6T 4ASKA 5LMUT 4IE6A 3MJXA 1KNZA 3P50A 3QOFA 2V6XA 5AQKB 3D0TA 4PJNA 4JBWF 2Z6EA 2DHRA 4CI3B 3PUZF 3LBXA 3VRAA 2DLRA 1FMWA 1XMOT 4ILUA 2C0SA 3SFEA 4H9NC 2BVMA 3MACA 3CX8B 3VR9A 4AXPA 4HWFA 4IREA 3NZPA 5LYJE 2LOPA 1D0XA 3LBXB 5JVDE 4HKAA 5CFBA 2VURA 3AEGA 3Q5WA 2CCQA 2P9BA 5JDGA 3C98B 3KV9A 2E8IA 5KXJA 1S35A 4NIQA 1IBKT 2LLYA 3LK42 2WZIA 5HCJA 2C5KT 5CGMA 2YN6A 4OYKA 4JEHB 3WAJA 3AXJA 3MK7C 4JI6T 2Y48B 4H9RC 4IDPA 1M7KA 2CXFA 5IWAT 3GWHA 5ABFB 5JR9B 2SPCA 1V9DA 1XWMA 2UXDT 2EHOA 4DV4T 4I0UA 4HFHA 3PURA 4L0RA 2V7IA 3Q5XA 2X9XA 4LF8T 4KI0F 2HPLA 2XQYA 4A97A 2FJBA 3UFGA 5LP6E 2VKDA 2DNXA 2XQ7A 3KBTA 3RLFF 4DV7T 2W61A 3R84B 4H9SE 1N34T 4DUYT 4EIWA 3AA1B 1R8IA 3E0ZA 4HWHA 2VKOA 3B13A 4P1NA 1VCTA 3ZPOA 2ODVA 4YFSA 3DP7A 2V7MA 4ERRA 4QXHB 2RA1A 2NR4A 3UT5E 3NZQA 2Q9QD 3ZT5A 5DJQC 2WAUA 4GKKT 5TAOA 4GOUA 1VRBA 4AQYT 4H9OC 1N33T 2J4GA 4OX9T 3PU8A 1XNQT 4H9PC 3UU6A 4I50E 2OV9A 3P4RA 2QRXA 2YEVC 5JDQA 5L4EA 2V1DB 4HFVA 4DV6T 2QA7A 4DUZT 2D5UA 2W2UA 2GK9A 5AQIB 4EOZB 5JRCA 3ABVA 3CWZB 2A9UA 1KK7A 4AI6A 4B3ST 5FL0A 1WRDA 3RYIE 2LRKA 2BVLA 4CXYA 4U3CA 2E9XA 1XDOA 1KNPA 3RYHE 2WSSV 3AEFA 1SA0E 2BG9A 1MMAA 2V7KA 3A7MA 1WR6A 1E7PA 2CRBA 3L8RA 3BK9A 1LVFA 4IE0A 4NUVA 1OEDB 3V5UA 1I94T 4V1Av 1W9RA 1CHUA 5AQSB 3Q9DA 1WYBA 3ZSTA 2BKNA 5FMNA 2HN1A 4HFIA 1IBLT 2WM9A 3HKDE 2D0TA 1W09A 2IDOB 2IMLA 3UUXB 2CM0A 4YJ2E 4TNVA 2MYSA 3AE8A 2X51A 2CXLA 4J2CA 3ZC0A 4NXNT 2UXCT 4K0UA 2X68A 4O4LE 5CJ5A 1OXZA 2JMHA 3PTRB 4TWDA 3P4PA 1G73A 3FXDB 1E1HB 5J0ZA 5AQPB 1Z8UA 2KINB 5AQMB 1UX5A 2YDRA 5HCMA 4JI8T 1MMDA 4H63V 4EV6A 3UU3A 4GKJT 3L09A 2UXXB 3KDSE 2JQ9A 3E08A 4EZ4A 1HF8A 3PV0F 2VQFT 5LHHB 2FUPA 4XZCA 2KNDA 2ZM2A 2AE9A 3EDVA 5FVKA 1XZYA 2JIWA 1US7B 4O2BE 1UK5A 3NRYA 2CBIA 3I0QA 2CLYB 1MNDA 2BBJA 1HFAA 3UQ7A 2HN2A 2XUEA 2H88A 2YDSA 4ZS3A 2XQ8A 1HCIA 3AEDA 3S4UA 2XQAA 5L3BB 4AIUA 3ZYMA 3VHLA 4HFDA 2M67A 3EUHA 3ZKRA 1KFYA 3HKCE 4AISA 2WU5A 2VB6A 5FXZA 3NRXA 2XQ4A 3I1AA 3RYCE 1T98A 2LKGA 2WS3A 2XAQB 3T1HT 3I9WA 4L9IA 3E22E 3WAKA 3AE6A 4IDZA 3O9XA 3EAMA 2WCAA 4C90A 4LF9T 2FJAA 4TN7B 3AE4A 1SE7A 2C5IT 3ZMSB 4CZZB 4UV9B 2H89A 3RIUC 3GA8A 3W15B 4HFCA 4UF0A 3RRWA 2N9DA 5L47A 4UVCB 4GK5E 1X9BA 4DR6T 2Q9QC 5HXSA 1U4QA 2CA5A 2W4XA 2V7JA 2BZBA 1YKHB 5F3JA 3AE3A 3TLVA 3FXEB 4X1KE 4MHCA 4IDQA 3SWHA 5ADXL 1FJGT 4QHOA 3QB5K 3ZN0B 2L8KA 1J5WA 1XNRT 2V6YA 3UULA 5HWXA 4KHZF 4ZI7E 2E5LT 2HHHT 3J7Yq 3UU5A 2DI4A 3RX6A 5LA6E 3CX6B 1NEKA 5LJNA 2IIUA 3MZKB 4WBNE 4B3MT 5F5WA 4QWNB 3AE2A 3B5MA 4YSZA 4K0KT 3K3QC 3K3OA 4UVAB 2UU9T 2B76A 2KXPB 4IHJE 5LGUB 4ZXLA 4QX8B 4EGWA 2PG8A 3FBLA 2LE8A 2C5JA 2VVNA 2WMNA 3A8YC 3DJBA 2VVSA 4PNIA 4KP3C 4CN1A 2VK9A 3AAIA 2XSBA 4PJLA 5HYAA 2W66A 1FIOA 5KMGP 2X67A 1HNXT 3OYZA 3KBUA 1XMQT 1B7TA 4F6RC 1WYCA 4MLKA 2XM2A 4HE8A 4TWFA 3ZMUB 3PUQA 2KSRA 1NENA 4X62T 4HTEA 4AQFC 1MNEA 2BG9E 3QC9A 2V8SV 3JAFA 5AQQB 2JQQA 3Q5EA 3OJAA 1QUUA 2X9HA 3QNUA 5AQGB 1FMVA 2KZ7B 2RP4A 4DR5T 3ONXA 3BQKA 2CBJA 2VASA 3RYFE 4HWIB 3CVRA 5L3EB 3VR8A 3L3PA 4H9QC 5AQFB 3BQLA 3ESLA 3SRZA 5DQWA 5J1GA 2XQ9A 3T8OA 2V5DA 2XY8B 2KWIB 2W0GA 5ABFA 5JR9A 4GIWA 2XM1A 4I43B 3P4QA 2KMFA 4Z91A 4NPPA 3PUSA 3CMLA 2ODUA 3TLWA 5LJMA 3RIAA 3ONJA 2ZM6T 2IUBA 4ZEYA 2MAWA 4KUMB 1UUSA 2WBLA 3VRBA 1JNRA 4ZHQE 2YINA 4ANJA 4DBRA 3N5LA 3IEEA 1SHZC 5J2TE 2D2SA 1NWMX 4NXMT 3C51A 3Q5DA 4AKRB 5IUXA 5M4YA 4EB6E 5KDMC 2YDQA 3AB3B 3VKGA 1O3XA 4GYRA 3ZT6A 3RHWA 1YW0A 2ACZA 2DCFA 5HEGA 3G06A 2V26A 5EK3A 5DABA 4JI0T 2WY2A 3TLTA 3ONLC 2JJ9A 4ZOLE 4LFBT 2NP9A 2I0MA 4EXTA 4ZI3C 3JAEA 3H37A 2A72A 4YTNA 2CMRA 3RQWA 4XAXB 4DR3T 2XQ5A 1UURA 3F57A 2PTFA 3TKLB 2KT9A 3UU8A 4CXWA 4LFAT 4ZZCA 4EEDA 4UV8B 1IAPA 4DIDB 2K9AA 4CI1B 2BKPA 4Q25A 4X20E 4OYJA 3CPZA 3UFEA 4QXBB 1VCSA 3J9X1 2UXBT 2WDQA 2EHOC 2E5VA 3KVAA 2XQ3A 3R6NA 1ZP0A 1MIVA 4I4TE 2MBGA 1YQ4A 3U3IA 3LK2B 4MALA 1OEDA 3ZN1B 4PFPA 4PJJA 4O2AE 3KV5A 4IL4A 4DV0T 3O4XE 2X0YA 3GN5B 4AKHA 2XQ6A 3CQXC 4GYSA 4U7YA 4X65T 5HEHA 1DU2A 1HG5A 3C4WA 5ABEA 3N2KE 2DWGA 2LSYA 2ZM8A 3PUWF 3K1SA 2YKSA 1WLXA 4O4IE 3QB5A 1EZ3A 4P09A 2XAGB 1BR1A 3P4WA 1T7SA 2LHRA 2XASB 4X1IE 1J5ET 5C3JA 1WFDA 5FXVA 4PJMA 5LXTE 4U7IA 3AE7A 3P8CD 4HWCA 4DBQA 4U2ZA 5HXEA 3UU4A 3IF8B 2KWHA 4ILBA 4DR4T 1IBMT 3CK6A 5LBQB 4A5XA 2I6HA 4LF4T 2CXDA 5LGTB 4PK4A 4UELA 1KEYA 4AQGA 5AQTB 4KX6A 1JNZA 3OBVE 4CN4A 5DQVA 1U5PA 4M1PA 3C64A 4O4JE 2CPTA 3PDYA 4CI2B 2VWAA 2LRLA 3PU3A 4YTMA 5HWYA 5FXXA 1Y64B 3AA0B 2J62A 2E9XC 5L4HA 4YTPA 3C4ZA 1LKXA 3RIUA 5L3CB 1YD8G 3EI0A 2BG9C 3C4XA 3M65A 4YSYA 1UX4A 2Q9QA 2N2NA 3FZHB 3O1HA 2WDVA 5FXWA 4HFBA 3AA6B 4QH4A 4DR2T 3KVBA 2HPJA 2YK0A 2XHEB 4ISSA 2L3LA 3ZMVB 5AQRB 2PFVA 5AQUB 2XTLA 3P4SA 4HWDA 5FVLA 3ANWB 2Q9QB 1XDPA 4JUYA 5ABGA 4GK0E 1HG2A 2JQHA 2PBIA 4U31A 5LOVE 4E7ZA 1D1AA 3RI5A 4YJ3E 2CWOA 1YQ3A 2CE7A 1KNRA 3IBPA 2H7OA 3LJCA 5FP3A 4DR7T 2X9YA 4IDNA 4U33A 4TZ4C 4WNKA 2LSGA 2LSIA 1NAFA 1H7CA 4ZI3D 4UEMA 1ZKEA 1IZNB 3BQIA 2DWKA 2LKHA 2WMOA 4LMJA 2NTYA 2VL8A 2J1DG 5BR8T 3KV4A 2PJQA 3NKZA 2L9QA 5LBMA 3RF1A 3AE1A 3AEEA 4P0AA 2W67A 3X1DA 5HEOA
chains in the Genus database with same CATH topology
4GKKT 1N32T 1IBKT 2UUAT 1IBLT 4JI2T 1N36T 4AQYT 4JI0T 1N33T 4JI5T 4B3TT 4OX9T 4X64T 4DV1T 1XNQT 4B3MT 4JI1T 4LFBT 4JI4T 4NXNT 2UXCT 4DR2T 4K0KT 4JI6T 4DR3T 2UU9T 4JI3T 4YHHT 5IWAT 4DV6T 4LF5T 5LMNT 4JI7T 3T1HT 4DUZT 4LF6T 4DR1T 5LMUT 4LF7T 2UXDT 1J5ET 4DV4T 4LFAT 4B3ST 4LF9T 4DV2T 4LF8T 4DR4T 1IBMT 4JI8T 4LF4T 2ZM6T 1HNXT 1XMOT 4GKJT 4DR7T 4DV7T 1HNZT 1XMQT 2UXBT 4JYAT 4DR6T 3T1YT 1N34T 4DUYT 2VQET 4DV5T 3OTOT 4KHPT 4B3RT 4NXMT 4DV3T 2VQFT 4LFCT 4X62T 1FJGT 2F4VT 1I94T 5BR8T 2UUBT 1HNWT 4DV0T 1HR0T 1XNRT 4JV5T 4X66T 2UUCT 4YY3T 2E5LT 2HHHT 4DR5T 4X65T
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GKK T;  1N32 T;  1IBK T;  2UUA T;  1IBL T;  4JI2 T;  1N36 T;  4AQY T;  4JI0 T;  1N33 T;  4JI5 T;  4B3T T;  4OX9 T;  4X64 T;  4DV1 T;  1XNQ T;  4B3M T;  4JI1 T;  4LFB T;  4JI4 T;  4NXN T;  2UXC T;  4DR2 T;  4K0K T;  4JI6 T;  4DR3 T;  2UU9 T;  4JI3 T;  4YHH T;  5IWA T;  4DV6 T;  4LF5 T;  5LMN T;  4JI7 T;  3T1H T;  4DUZ T;  4LF6 T;  4DR1 T;  5LMU T;  4LF7 T;  2UXD T;  1J5E T;  4DV4 T;  4LFA T;  4B3S T;  4LF9 T;  4DV2 T;  4LF8 T;  4DR4 T;  1IBM T;  4JI8 T;  4LF4 T;  2ZM6 T;  1HNX T;  1XMO T;  4GKJ T;  4DR7 T;  4DV7 T;  1HNZ T;  1XMQ T;  2UXB T;  4JYA T;  4DR6 T;  3T1Y T;  1N34 T;  4DUY T;  2VQE T;  4DV5 T;  3OTO T;  4KHP T;  4B3R T;  4NXM T;  4DV3 T;  2VQF T;  4LFC T;  4X62 T;  1FJG T;  2F4V T;  1I94 T;  5BR8 T;  2UUB T;  1HNW T;  4DV0 T;  1HR0 T;  1XNR T;  4JV5 T;  4X66 T;  2UUC T;  4YY3 T;  2E5L T;  2HHH T;  4DR5 T;  4X65 T; 
#chains in the Genus database with same CATH topology
 2CEA A;  3ETV A;  3N9M A;  4OK0 A;  5HXR A;  3CKD A;  3HKB E;  1MIW A;  5L3G B;  3N9L A;  2XAF B;  1M62 A;  2AXD S;  1T8B A;  4BAY B;  3LDQ B;  5LG4 A;  2A3D A;  2G0U A;  3TLU A;  4QH1 A;  2EHO D;  1LRZ A;  5LHI B;  4FI5 A;  4ADZ A;  3VKH A;  2M6I A;  5AQH B;  4L5G A;  1MIY A;  3NVO A;  3K3N A;  4IE4 A;  4U72 A;  3N9O A;  2LM2 A;  4TX5 A;  1GQE A;  3F31 A;  3RPU A;  5JDM A;  3O1I A;  3AVS A;  3ZC1 A;  1T72 A;  2CHN A;  1HS7 A;  1AJ3 A;  4TNW A;  1HNZ T;  4I55 E;  4Z8X A;  4A98 A;  2VQE T;  3OTO T;  2K3W A;  3NBX X;  3ZJ1 A;  2ACX A;  4HGA A;  1G8X A;  3N9P A;  2D9D A;  3CX7 B;  4U74 A;  4O4H E;  4QH5 A;  2WWU A;  5JH7 E;  4TV9 E;  2A2F X;  2YU2 A;  3H3A A;  1OED E;  3JC6 C;  3PJA J;  2BS4 A;  4ZI2 C;  2E2A A;  1QSD A;  5AQL B;  2CHO A;  5AQJ B;  4TUY E;  4B6X A;  2WDR A;  1Z0P A;  2WU2 A;  4G2A A;  3EHZ A;  5F8P A;  3AE9 A;  3AVR A;  4UVB B;  4IGU A;  2OLT A;  4EYY R;  2W00 A;  2QVA A;  4H63 H;  3HI2 A;  4X5T A;  2LSK A;  5LCY A;  2B1E A;  5EK4 A;  1MMN A;  1BR2 A;  2HH7 A;  4JI7 T;  1I6Z A;  4LF7 T;  2NW7 A;  1MMG A;  4IIJ E;  2R6G F;  3UUB A;  3N2G E;  1ZV4 X;  2E9X D;  5A1L A;  3RKO A;  5ABH A;  4PK6 A;  3MXZ A;  4HEA A;  4WW0 A;  3U78 A;  5LNK A;  2JRK A;  3IA3 A;  3FBZ A;  5AQO B;  4QXC B;  4DV5 T;  3H3M A;  4TWH A;  4DMV A;  5EZY E;  1ZEE A;  3ZYL A;  1D0Y A;  1YXR A;  4KBM B;  1W0A A;  3EVY A;  3ZMT B;  4IL9 A;  4G63 A;  3ZMZ B;  3RRC A;  2V5C A;  3I0O A;  1HX8 A;  4DVD A;  2UUC T;  3UQ4 A;  4YSX A;  2UUA T;  5LHG B;  3RC8 A;  2MPK A;  2MOZ A;  4MBQ A;  3M3Z B;  4WBO A;  4UIG A;  3QK6 A;  4JI4 T;  3NWI A;  3ETU A;  4PAG A;  3AXJ B;  4OHF A;  5ETW A;  2ZMA A;  3HKE E;  2FBW A;  3KV6 A;  5E0O A;  4QKN A;  3UUN A;  4DR1 T;  2EHO B;  3FZL B;  4ILA A;  3KFW X;  4PFO A;  4C91 A;  2JQK A;  1HX1 B;  1D1B A;  2LOS A;  4DV2 T;  4AKI A;  2H7V C;  4AKG A;  2Y8D A;  5HAX A;  1BR0 A;  1WCR A;  3K8P C;  2NW9 A;  5IHY A;  5AQV B;  1L0V A;  3FZF B;  2NTX A;  1KF6 A;  4JYA T;  5JR9 C;  3GMI A;  4Z90 A;  2D0U A;  4CXX A;  1WR0 A;  2IW5 B;  4FJO A;  3UTK A;  2QYW A;  5FY7 A;  5CA1 E;  4DV3 T;  4BA9 A;  5CA0 E;  4ILC A;  4U2Y A;  5C2T A;  5HEJ A;  1VOM A;  2FJE A;  2JPF A;  1Y01 A;  2XPK A;  2LHN A;  3CQC B;  3EDU A;  4JV5 T;  4QX7 B;  4PW8 A;  4CQI A;  3CIR A;  4ZS2 A;  2K24 A;  2J47 A;  3GN5 A;  1SUM B;  5BMV E;  3LK3 B;  3UUM A;  3RGL A;  2WZH A;  2BS2 A;  4B3T T;  4YXD A;  5LG3 A;  2I59 A;  4IE7 A;  4EAH A;  3OYX A;  1ZOY A;  3LFM A;  3ZT7 A;  3SOL A;  5GON E;  1D0Z A;  4YHJ A;  3LSV A;  4JI3 T;  4XBF B;  2M6B A;  3ZYK A;  3PUY F;  2XAH B;  3PUX F;  4JEU B;  4NUU A;  5FY1 A;  5JRC B;  5FYM A;  3JCF A;  4P0B A;  3FZK B;  3OPC A;  2IC9 A;  1S94 A;  2LM9 A;  3ZSS A;  2X66 A;  1CUN A;  3VU7 H;  2NOX A;  4IE5 A;  3RC3 A;  2WB5 A;  3JC6 D;  2XSA A;  1UCU A;  4ZI2 D;  3OVU A;  2E9X B;  4AKL A;  4BJM A;  5JRE A;  5HEU A;  2ZLY A;  5JDH A;  2BG9 B;  3B57 A;  3DTO A;  2V7L A;  1IJ5 A;  5J2U E;  3RIF A;  4KHP T;  3LG7 A;  2JMK A;  4LMK A;  3RQU A;  3A5X A;  3IHR A;  2UXN B;  3FB2 A;  4OFZ A;  4LFC T;  3ZEF B;  4EEB A;  1HNW T;  2YU1 A;  4DMW A;  1HR0 T;  5H6R B;  2NWB A;  4WYV A;  4UR9 A;  4DND A;  3O1J A;  5L3D B;  2BS3 A;  5AFU L;  3V5S A;  3N2O A;  2X0L B;  3P7I A;  1N36 T;  2QGS A;  2XAJ B;  1E2A A;  4TV8 E;  4IST A;  4X64 T;  3PJA A;  4CN6 A;  4DV1 T;  2K48 A;  5L3F B;  1OED C;  1YKE B;  5JQG E;  5JTG A;  3MA9 A;  4LML A;  5KX5 E;  2ZM0 A;  2BDE A;  3N9N A;  3AA7 B;  5HXC A;  3JAD A;  1UGO A;  5H6Q B;  4BJN A;  3ANW A;  4UXN B;  2XJ7 A;  3ZJ2 A;  3HR0 A;  3WI3 A;  4N78 D;  2OA5 A;  3MKD A;  3CQG B;  5L2L A;  4EYU A;  3SS1 A;  2BBH A;  2LJL A;  3L39 A;  3HL6 A;  2LT3 A;  3TLS A;  3T1Y T;  3PUV F;  4MFR A;  4E7S A;  1LVK A;  4IDO A;  2LEH A;  4B3R T;  5FKY A;  5HXH A;  3AEB A;  5CB4 E;  3ZCJ A;  5JDF A;  4PK5 A;  4F8H A;  2F4V T;  2WP9 A;  2UUB T;  2KLQ A;  3EAB A;  4A56 A;  1FEW A;  5JDL A;  4X66 T;  4IT4 A;  5C8Y E;  2K5B B;  2FJD A;  1IJ6 A;  3OKQ A;  4O8S A;  2MTQ A;  3N9Q A;  2CWY A;  3AEA A;  3FHN A;  3KIN B;  3PUA A;  2IHR 1;  2WQY A;  1J1J A;  5JDN A;  4JLE A;  4DO0 A;  2W62 A;  2X0H A;  2CLY C;  4LF5 T;  4YLH A;  3RKG A;  4KMC A;  4COF A;  2NW8 A;  4AQF A;  2W63 A;  3AE5 A;  3PUG A;  2H3R A;  4UF0 B;  5EK2 A;  5FL1 A;  2RPA A;  3AEC A;  2N1G A;  3ZCI A;  2X9W A;  2WWV A;  5IYZ E;  3QUJ A;  4YT0 A;  3C50 A;  4HN9 A;  2XZE A;  3Q2M A;  3FZM B;  2Y6X A;  1QLB A;  2VL0 A;  2VKH A;  2IAK A;  4HFE A;  1X79 A;  2DL1 A;  4WZX A;  3AAA B;  2V6Y B;  5LGN B;  3AAE B;  4EZH A;  5LB7 B;  4ZZB A;  4YY3 T;  1OWA A;  1HTJ F;  2VKJ A;  5FNV E;  1N32 T;  2IC6 A;  4JI2 T;  3F2E A;  2BKO A;  1BR4 A;  2ES0 A;  4JI5 T;  1ZHC A;  3RH3 A;  3ZLI A;  4JI1 T;  2LSJ A;  3SFD A;  3HA4 A;  4X1Y E;  3I9Y A;  1W0B A;  1D1C A;  5AQN B;  4YHH T;  5FY0 A;  3PE0 A;  5LMN T;  2YOE A;  4LF6 T;  4ASK A;  5LMU T;  4IE6 A;  3MJX A;  1KNZ A;  3P50 A;  3QOF A;  2V6X A;  5AQK B;  3D0T A;  4PJN A;  4JBW F;  2Z6E A;  2DHR A;  4CI3 B;  3PUZ F;  3LBX A;  3VRA A;  2DLR A;  1FMW A;  1XMO T;  4ILU A;  2C0S A;  3SFE A;  4H9N C;  2BVM A;  3MAC A;  3CX8 B;  3VR9 A;  4AXP A;  4HWF A;  4IRE A;  3NZP A;  5LYJ E;  2LOP A;  1D0X A;  3LBX B;  5JVD E;  4HKA A;  5CFB A;  2VUR A;  3AEG A;  3Q5W A;  2CCQ A;  2P9B A;  5JDG A;  3C98 B;  3KV9 A;  2E8I A;  5KXJ A;  1S35 A;  4NIQ A;  1IBK T;  2LLY A;  3LK4 2;  2WZI A;  5HCJ A;  2C5K T;  5CGM A;  2YN6 A;  4OYK A;  4JEH B;  3WAJ A;  3AXJ A;  3MK7 C;  4JI6 T;  2Y48 B;  4H9R C;  4IDP A;  1M7K A;  2CXF A;  5IWA T;  3GWH A;  5ABF B;  5JR9 B;  2SPC A;  1V9D A;  1XWM A;  2UXD T;  2EHO A;  4DV4 T;  4I0U A;  4HFH A;  3PUR A;  4L0R A;  2V7I A;  3Q5X A;  2X9X A;  4LF8 T;  4KI0 F;  2HPL A;  2XQY A;  4A97 A;  2FJB A;  3UFG A;  5LP6 E;  2VKD A;  2DNX A;  2XQ7 A;  3KBT A;  3RLF F;  4DV7 T;  2W61 A;  3R84 B;  4H9S E;  1N34 T;  4DUY T;  4EIW A;  3AA1 B;  1R8I A;  3E0Z A;  4HWH A;  2VKO A;  3B13 A;  4P1N A;  1VCT A;  3ZPO A;  2ODV A;  4YFS A;  3DP7 A;  2V7M A;  4ERR A;  4QXH B;  2RA1 A;  2NR4 A;  3UT5 E;  3NZQ A;  2Q9Q D;  3ZT5 A;  5DJQ C;  2WAU A;  4GKK T;  5TAO A;  4GOU A;  1VRB A;  4AQY T;  4H9O C;  1N33 T;  2J4G A;  4OX9 T;  3PU8 A;  1XNQ T;  4H9P C;  3UU6 A;  4I50 E;  2OV9 A;  3P4R A;  2QRX A;  2YEV C;  5JDQ A;  5L4E A;  2V1D B;  4HFV A;  4DV6 T;  2QA7 A;  4DUZ T;  2D5U A;  2W2U A;  2GK9 A;  5AQI B;  4EOZ B;  5JRC A;  3ABV A;  3CWZ B;  2A9U A;  1KK7 A;  4AI6 A;  4B3S T;  5FL0 A;  1WRD A;  3RYI E;  2LRK A;  2BVL A;  4CXY A;  4U3C A;  2E9X A;  1XDO A;  1KNP A;  3RYH E;  2WSS V;  3AEF A;  1SA0 E;  2BG9 A;  1MMA A;  2V7K A;  3A7M A;  1WR6 A;  1E7P A;  2CRB A;  3L8R A;  3BK9 A;  1LVF A;  4IE0 A;  4NUV A;  1OED B;  3V5U A;  1I94 T;  4V1A v;  1W9R A;  1CHU A;  5AQS B;  3Q9D A;  1WYB A;  3ZST A;  2BKN A;  5FMN A;  2HN1 A;  4HFI A;  1IBL T;  2WM9 A;  3HKD E;  2D0T A;  1W09 A;  2IDO B;  2IML A;  3UUX B;  2CM0 A;  4YJ2 E;  4TNV A;  2MYS A;  3AE8 A;  2X51 A;  2CXL A;  4J2C A;  3ZC0 A;  4NXN T;  2UXC T;  4K0U A;  2X68 A;  4O4L E;  5CJ5 A;  1OXZ A;  2JMH A;  3PTR B;  4TWD A;  3P4P A;  1G73 A;  3FXD B;  1E1H B;  5J0Z A;  5AQP B;  1Z8U A;  2KIN B;  5AQM B;  1UX5 A;  2YDR A;  5HCM A;  4JI8 T;  1MMD A;  4H63 V;  4EV6 A;  3UU3 A;  4GKJ T;  3L09 A;  2UXX B;  3KDS E;  2JQ9 A;  3E08 A;  4EZ4 A;  1HF8 A;  3PV0 F;  2VQF T;  5LHH B;  2FUP A;  4XZC A;  2KND A;  2ZM2 A;  2AE9 A;  3EDV A;  5FVK A;  1XZY A;  2JIW A;  1US7 B;  4O2B E;  1UK5 A;  3NRY A;  2CBI A;  3I0Q A;  2CLY B;  1MND A;  2BBJ A;  1HFA A;  3UQ7 A;  2HN2 A;  2XUE A;  2H88 A;  2YDS A;  4ZS3 A;  2XQ8 A;  1HCI A;  3AED A;  3S4U A;  2XQA A;  5L3B B;  4AIU A;  3ZYM A;  3VHL A;  4HFD A;  2M67 A;  3EUH A;  3ZKR A;  1KFY A;  3HKC E;  4AIS A;  2WU5 A;  2VB6 A;  5FXZ A;  3NRX A;  2XQ4 A;  3I1A A;  3RYC E;  1T98 A;  2LKG A;  2WS3 A;  2XAQ B;  3T1H T;  3I9W A;  4L9I A;  3E22 E;  3WAK A;  3AE6 A;  4IDZ A;  3O9X A;  3EAM A;  2WCA A;  4C90 A;  4LF9 T;  2FJA A;  4TN7 B;  3AE4 A;  1SE7 A;  2C5I T;  3ZMS B;  4CZZ B;  4UV9 B;  2H89 A;  3RIU C;  3GA8 A;  3W15 B;  4HFC A;  4UF0 A;  3RRW A;  2N9D A;  5L47 A;  4UVC B;  4GK5 E;  1X9B A;  4DR6 T;  2Q9Q C;  5HXS A;  1U4Q A;  2CA5 A;  2W4X A;  2V7J A;  2BZB A;  1YKH B;  5F3J A;  3AE3 A;  3TLV A;  3FXE B;  4X1K E;  4MHC A;  4IDQ A;  3SWH A;  5ADX L;  1FJG T;  4QHO A;  3QB5 K;  3ZN0 B;  2L8K A;  1J5W A;  1XNR T;  2V6Y A;  3UUL A;  5HWX A;  4KHZ F;  4ZI7 E;  2E5L T;  2HHH T;  3J7Y q;  3UU5 A;  2DI4 A;  3RX6 A;  5LA6 E;  3CX6 B;  1NEK A;  5LJN A;  2IIU A;  3MZK B;  4WBN E;  4B3M T;  5F5W A;  4QWN B;  3AE2 A;  3B5M A;  4YSZ A;  4K0K T;  3K3Q C;  3K3O A;  4UVA B;  2UU9 T;  2B76 A;  2KXP B;  4IHJ E;  5LGU B;  4ZXL A;  4QX8 B;  4EGW A;  2PG8 A;  3FBL A;  2LE8 A;  2C5J A;  2VVN A;  2WMN A;  3A8Y C;  3DJB A;  2VVS A;  4PNI A;  4KP3 C;  4CN1 A;  2VK9 A;  3AAI A;  2XSB A;  4PJL A;  5HYA A;  2W66 A;  1FIO A;  5KMG P;  2X67 A;  1HNX T;  3OYZ A;  3KBU A;  1XMQ T;  1B7T A;  4F6R C;  1WYC A;  4MLK A;  2XM2 A;  4HE8 A;  4TWF A;  3ZMU B;  3PUQ A;  2KSR A;  1NEN A;  4X62 T;  4HTE A;  4AQF C;  1MNE A;  2BG9 E;  3QC9 A;  2V8S V;  3JAF A;  5AQQ B;  2JQQ A;  3Q5E A;  3OJA A;  1QUU A;  2X9H A;  3QNU A;  5AQG B;  1FMV A;  2KZ7 B;  2RP4 A;  4DR5 T;  3ONX A;  3BQK A;  2CBJ A;  2VAS A;  3RYF E;  4HWI B;  3CVR A;  5L3E B;  3VR8 A;  3L3P A;  4H9Q C;  5AQF B;  3BQL A;  3ESL A;  3SRZ A;  5DQW A;  5J1G A;  2XQ9 A;  3T8O A;  2V5D A;  2XY8 B;  2KWI B;  2W0G A;  5ABF A;  5JR9 A;  4GIW A;  2XM1 A;  4I43 B;  3P4Q A;  2KMF A;  4Z91 A;  4NPP A;  3PUS A;  3CML A;  2ODU A;  3TLW A;  5LJM A;  3RIA A;  3ONJ A;  2ZM6 T;  2IUB A;  4ZEY A;  2MAW A;  4KUM B;  1UUS A;  2WBL A;  3VRB A;  1JNR A;  4ZHQ E;  2YIN A;  4ANJ A;  4DBR A;  3N5L A;  3IEE A;  1SHZ C;  5J2T E;  2D2S A;  1NWM X;  4NXM T;  3C51 A;  3Q5D A;  4AKR B;  5IUX A;  5M4Y A;  4EB6 E;  5KDM C;  2YDQ A;  3AB3 B;  3VKG A;  1O3X A;  4GYR A;  3ZT6 A;  3RHW A;  1YW0 A;  2ACZ A;  2DCF A;  5HEG A;  3G06 A;  2V26 A;  5EK3 A;  5DAB A;  4JI0 T;  2WY2 A;  3TLT A;  3ONL C;  2JJ9 A;  4ZOL E;  4LFB T;  2NP9 A;  2I0M A;  4EXT A;  4ZI3 C;  3JAE A;  3H37 A;  2A72 A;  4YTN A;  2CMR A;  3RQW A;  4XAX B;  4DR3 T;  2XQ5 A;  1UUR A;  3F57 A;  2PTF A;  3TKL B;  2KT9 A;  3UU8 A;  4CXW A;  4LFA T;  4ZZC A;  4EED A;  4UV8 B;  1IAP A;  4DID B;  2K9A A;  4CI1 B;  2BKP A;  4Q25 A;  4X20 E;  4OYJ A;  3CPZ A;  3UFE A;  4QXB B;  1VCS A;  3J9X 1;  2UXB T;  2WDQ A;  2EHO C;  2E5V A;  3KVA A;  2XQ3 A;  3R6N A;  1ZP0 A;  1MIV A;  4I4T E;  2MBG A;  1YQ4 A;  3U3I A;  3LK2 B;  4MAL A;  1OED A;  3ZN1 B;  4PFP A;  4PJJ A;  4O2A E;  3KV5 A;  4IL4 A;  4DV0 T;  3O4X E;  2X0Y A;  3GN5 B;  4AKH A;  2XQ6 A;  3CQX C;  4GYS A;  4U7Y A;  4X65 T;  5HEH A;  1DU2 A;  1HG5 A;  3C4W A;  5ABE A;  3N2K E;  2DWG A;  2LSY A;  2ZM8 A;  3PUW F;  3K1S A;  2YKS A;  1WLX A;  4O4I E;  3QB5 A;  1EZ3 A;  4P09 A;  2XAG B;  1BR1 A;  3P4W A;  1T7S A;  2LHR A;  2XAS B;  4X1I E;  1J5E T;  5C3J A;  1WFD A;  5FXV A;  4PJM A;  5LXT E;  4U7I A;  3AE7 A;  3P8C D;  4HWC A;  4DBQ A;  4U2Z A;  5HXE A;  3UU4 A;  3IF8 B;  2KWH A;  4ILB A;  4DR4 T;  1IBM T;  3CK6 A;  5LBQ B;  4A5X A;  2I6H A;  4LF4 T;  2CXD A;  5LGT B;  4PK4 A;  4UEL A;  1KEY A;  4AQG A;  5AQT B;  4KX6 A;  1JNZ A;  3OBV E;  4CN4 A;  5DQV A;  1U5P A;  4M1P A;  3C64 A;  4O4J E;  2CPT A;  3PDY A;  4CI2 B;  2VWA A;  2LRL A;  3PU3 A;  4YTM A;  5HWY A;  5FXX A;  1Y64 B;  3AA0 B;  2J62 A;  2E9X C;  5L4H A;  4YTP A;  3C4Z A;  1LKX A;  3RIU A;  5L3C B;  1YD8 G;  3EI0 A;  2BG9 C;  3C4X A;  3M65 A;  4YSY A;  1UX4 A;  2Q9Q A;  2N2N A;  3FZH B;  3O1H A;  2WDV A;  5FXW A;  4HFB A;  3AA6 B;  4QH4 A;  4DR2 T;  3KVB A;  2HPJ A;  2YK0 A;  2XHE B;  4ISS A;  2L3L A;  3ZMV B;  5AQR B;  2PFV A;  5AQU B;  2XTL A;  3P4S A;  4HWD A;  5FVL A;  3ANW B;  2Q9Q B;  1XDP A;  4JUY A;  5ABG A;  4GK0 E;  1HG2 A;  2JQH A;  2PBI A;  4U31 A;  5LOV E;  4E7Z A;  1D1A A;  3RI5 A;  4YJ3 E;  2CWO A;  1YQ3 A;  2CE7 A;  1KNR A;  3IBP A;  2H7O A;  3LJC A;  5FP3 A;  4DR7 T;  2X9Y A;  4IDN A;  4U33 A;  4TZ4 C;  4WNK A;  2LSG A;  2LSI A;  1NAF A;  1H7C A;  4ZI3 D;  4UEM A;  1ZKE A;  1IZN B;  3BQI A;  2DWK A;  2LKH A;  2WMO A;  4LMJ A;  2NTY A;  2VL8 A;  2J1D G;  5BR8 T;  3KV4 A;  2PJQ A;  3NKZ A;  2L9Q A;  5LBM A;  3RF1 A;  3AE1 A;  3AEE A;  4P0A A;  2W67 A;  3X1D A;  5HEO A; 
#chains in the Genus database with same CATH homology
 4GKK T;  1N32 T;  1IBK T;  2UUA T;  1IBL T;  4JI2 T;  1N36 T;  4AQY T;  4JI0 T;  1N33 T;  4JI5 T;  4B3T T;  4OX9 T;  4X64 T;  4DV1 T;  1XNQ T;  4B3M T;  4JI1 T;  4LFB T;  4JI4 T;  4NXN T;  2UXC T;  4DR2 T;  4K0K T;  4JI6 T;  4DR3 T;  2UU9 T;  4JI3 T;  4YHH T;  5IWA T;  4DV6 T;  4LF5 T;  5LMN T;  4JI7 T;  3T1H T;  4DUZ T;  4LF6 T;  4DR1 T;  5LMU T;  4LF7 T;  2UXD T;  1J5E T;  4DV4 T;  4LFA T;  4B3S T;  4LF9 T;  4DV2 T;  4LF8 T;  4DR4 T;  1IBM T;  4JI8 T;  4LF4 T;  2ZM6 T;  1HNX T;  1XMO T;  4GKJ T;  4DR7 T;  4DV7 T;  1HNZ T;  1XMQ T;  2UXB T;  4JYA T;  4DR6 T;  3T1Y T;  1N34 T;  4DUY T;  2VQE T;  4DV5 T;  3OTO T;  4KHP T;  4B3R T;  4NXM T;  4DV3 T;  2VQF T;  4LFC T;  4X62 T;  1FJG T;  2F4V T;  1I94 T;  5BR8 T;  2UUB T;  1HNW T;  4DV0 T;  1HR0 T;  1XNR T;  4JV5 T;  4X66 T;  2UUC T;  4YY3 T;  2E5L T;  2HHH T;  4DR5 T;  4X65 T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...