4MBQA

Tpr3 of fimv from p. aeruginosa (pao1)
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
49
structure length
49
Chain Sequence
b'DEAATKLDLARAYIDMGDSEGARDILDEVLAEGNDSQQAEARELLERLA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Motility protein FimV
publication title Crystal structure of TPR2 from FimV
rcsb
source organism Pseudomonas aeruginosa
molecule tags Unknown function
total genus 22
structure length 49
sequence length 49
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2013-08-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.2200 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4mbqA00
4MALA 4MBQA
chains in the Genus database with same CATH superfamily
4B6XA 2CPTA 4UIGA 3RYIE 1T98A 2LT3A 2ZM6T 3S4UA 2E5LT 4A98A 5TAOA 4U74A 2BKNA 2BS3A 2GK9A 4CN1A 4LFCT 2E9XD 3BQIA 2UUCT 5HEOA 1HNXT 2JRKA 5HEHA 2ACXA 3C51A 2EHOC 2X67A 3CQXC 2V7KA 5FL1A 4U33A 1N33T 5EK3A 5FXZA 4DV4T 3C50A 3AEAA 4JI3T 4NPPA 5AQSB 3G06A 4HE8A 3AECA 3PJAJ 2V7JA 4XZCA 5FYMA 3UU3A 4B3RT 4P09A 4B3ST 1MIYA 3EAMA 4EV6A 4X1KE 2XQ5A 1JNRA 2XAJB 2V6YB 3ZMSB 1HTJF 4TX5A 2MAWA 5LXTE 3KVBA 2NOXA 1XMQT 1HNWT 3AEBA 2UXCT 4QWNB 2LSGA 4YHHT 1KEYA 3K3OA 5FL0A 3RQWA 4H63V 3EDUA 3AE3A 3KINB 4MLKA 5FP3A 1S35A 3CX7B 3HR0A 5JDGA 5LGTB 1UGOA 2BVLA 3MA9A 4ANJA 4QXHB 2LHRA 3OYXA 5DABA 3ZMUB 1D1CA 4Z90A 2JQ9A 2N9DA 3ZMVB 3ABVA 5LBMA 4X1YE 5HCJA 5A1LA 1WCRA 5JRCB 3RX6A 1NENA 2B1EA 4KUMB 4ILAA 3HI2A 2LSKA 3T1HT 3Q5WA 3BK9A 4TUYE 4L5GA 2XZEA 3CX6B 3ZYKA 3V5UA 4DUYT 4AKGA 3I9WA 3F57A 2WSSV 3FZLB 5FY1A 3AXJA 4YLHA 4LFAT 2W4XA 5AQKB 1KFYA 3FXEB 2FJEA 5JR9A 1YKHB 2ZMAA 3SFDA 3ZT5A 4AKHA 4DNDA 3EVYA 5L2LA 1ZV4X 5HYAA 4KBMB 2A3DA 5AQHB 2YEVC 2OLTA 2DWKA 3AA1B 4IDOA 2X0YA 3K3QC 5LG3A 4HKAA 5H6QB 3AAEB 2WZHA 4V1Av 5JH7E 1IBMT 1EZ3A 1W9RA 3SFEA 1AJ3A 3PTRB 1IJ5A 1Z0PA 3R84B 3ETUA 2XQ4A 1X79A 1VRBA 2Y48B 5LGUB 5FMNA 2K3WA 2D2SA 1J5ET 2HN2A 3H37A 2YU1A 3QC9A 5IHYA 3NWIA 1YQ3A 2CEAA 5HEGA 1LKXA 2EHOB 4ISTA 4ZZBA 3FBZA 4K0UA 3MACA 4O2BE 4EIWA 1IZNB 4CZZB 3ZKRA 3Q9DA 5H6RB 2N1GA 4M1PA 2C5KT 5C8YE 2XM1A 1CHUA 3U3IA 1HX8A 5JDFA 3H3MA 4DO0A 1CUNA 2V7MA 4LF6T 4QX8B 2WMNA 4L0RA 2XQYA 2IUBA 5L4HA 1HS7A 4OYKA 2LSIA 5JR9C 5C2TA 5HXEA 2LSYA 3KFWX 1I6ZA 4AQFA 4AI6A 3VR9A 4GK5E 3EDVA 5ABFA 5CJ5A 4YHJA 4QX7B 3HKCE 4PJNA 4GKJT 5HXSA 2A2FX 4EYUA 1D1AA 3I0OA 1G73A 2V1DB 4ZZCA 5HAXA 3X1DA 4PNIA 5AQOB 4DV6T 1XWMA 4HFHA 1WYBA 5FKYA 3RPUA 4PFOA 2I0MA 2LHNA 3MJXA 3AA7B 5C3JA 3RI5A 1HX1B 3P7IA 3N9NA 4U3CA 4KX6A 4PJJA 3P4SA 2CM0A 3HKEE 5IYZE 2XSBA 5AQLB 2KNDA 4I43B 3RC3A 2D9DA 2KT9A 4UEMA 4LF5T 2LJLA 2VKHA 4YSZA 1WR0A 3CVRA 4IDZA 1D0XA 3ETVA 2PTFA 1T72A 2WMOA 2IAKA 2L9QA 2L8KA 3LFMA 4JI8T 3CKDA 2BG9A 2DCFA 2XJ7A 2IW5B 3UQ7A 4O4HE 3FB2A 4HEAA 2YOEA 5IWAT 1SUMB 3FZFB 3LG7A 4GYSA 4JUYA 3N2KE 3AAAB 3UTKA 4B3MT 4AQFC 3IF8B 3TLSA 4FJOA 3PUGA 3AEFA 2Q9QD 4LFBT 3JC6C 3KVAA 3VKHA 3R6NA 2VKOA 2KINB 1NEKA 4TN7B 2BVMA 2XSAA 1DU2A 2V7LA 5BR8T 4H9PC 4F8HA 3NVOA 3I0QA 4EOZB 1W0BA 2WQYA 3AE4A 2XM2A 2VQFT 4MFRA 3L39A 1KF6A 3B5MA 4IDPA 4F6RC 5KXJA 2NWBA 3M65A 4CI3B 1U5PA 2V26A 4ZI7E 5LMNT 5CA0E 5FNVE 4BAYB 2HPJA 3UUXB 4DR4T 2N2NA 2VVNA 2HPLA 2IMLA 2K5BB 2UU9T 3HL6A 2ZLYA 5CGMA 2KMFA 3NKZA 3KV5A 5L3EB 4DUZT 2ES0A 3TLVA 2UUBT 4UVAB 2ACZA 4DR3T 3VHLA 3AXJB 4ZI2D 1Y64B 3N2OA 3JCFA 3Q5XA 3MXZA 2LOPA 5JR9B 1IAPA 2BG9C 2XAFB 1J1JA 3RIFA 4ZHQE 4HTEA 3N9LA 2Y8DA 2H88A 3EABA 1BR0A 4JI6T 1HF8A 2NP9A 1M62A 3OTOT 1J5WA 2VWAA 1OEDA 2D0TA 3FZKB 4NXMT 4ZS3A 4PJMA 3JAEA 3PU8A 2WCAA 4A5XA 3OVUA 3ANWB 3VR8A 3AEDA 2XAQB 3VU7H 1YQ4A 5L47A 4PW8A 4LF4T 4JI4T 2CA5A 3ZCJA 3J9X1 2OA5A 4PAGA 3RLFF 1KNPA 2V7IA 3A8YC 2X9YA 5ETWA 2IIUA 3C98B 2NTYA 5ABGA 1SA0E 5AQMB 2UXNB 2BBJA 1QSDA 2LRLA 4ZI3D 5L3GB 3C64A 1XMOT 4LMJA 1WLXA 2HH7A 5LHIB 1E2AA 2CHNA 2MOZA 3QK6A 3NRYA 3UT5E 4ZOLE 3UU8A 4FI5A 2W00A 3PUVF 4P0AA 4AQGA 3UUMA 5JREA 2JMKA 4EGWA 2CWOA 4YTMA 4X1IE 2QA7A 2E9XA 3T8OA 3N2GE 2VK9A 4G63A 3ONJA 3FBLA 2WAUA 2Z6EA 1KNRA 5FXWA 5ABFB 3O1IA 3O1JA 4XBFB 4DV2T 3ZMZB 2PJQA 4YT0A 4TWDA 2X9HA 3U78A 1M7KA 1I94T 2YDQA 4PK4A 1OEDC 3IHRA 3I9YA 4HWFA 4HFEA 2F4VT 2D0UA 3QUJA 2XQ3A 3I1AA 3CQCB 4I0UA 4EAHA 2VVSA 2WDQA 4X20E 5EZYE 1UX5A 4CXXA 3TLTA 2WP9A 2RA1A 3UUBA 2XQ7A 2JQKA 2FUPA 2MPKA 3FHNA 3UU4A 5HXHA 4AKRB 3MZKB 5KX5E 3VRBA 4P1NA 3QNUA 2NR4A 2XQ6A 2CE7A 2WWVA 1NAFA 2W62A 2WB5A 3VKGA 4ZI2C 4XAXB 4KHZF 2ODUA 3LJCA 5ABEA 2C5JA 4TZ4C 4BA9A 3PUWF 2KLQA 2YDSA 3ZN1B 2DI4A 5LHGB 2DHRA 1XDOA 3SS1A 3ZYLA 5L3DB 2NW8A 5JTGA 2VKDA 2CCQA 4TNWA 2BG9B 3Q2MA 3OYZA 4TV9E 3CMLA 3ANWA 3FXDB 3KV9A 4LF8T 1OXZA 4GK0E 4CI2B 2H89A 5F3JA 3RC8A 1SHZC 4UVCB 4IIJE 4DR7T 2E9XC 3LK2B 1ZOYA 4EXTA 5L4EA 4DMVA 2ODVA 3PE0A 5JDNA 4TNVA 3KBUA 5DQVA 4UV9B 4DR5T 4KMCA 3PUQA 4WW0A 1FMVA 3A7MA 3L3PA 5LJMA 4UV8B 4HWIB 2XPKA 4HFBA 2QVAA 3N9QA 3BQKA 1E1HB 4DR2T 3ZSTA 4DV0T 5FY7A 1V9DA 4A97A 4X64T 4DV1T 2XUEA 4O4LE 1E7PA 4AKLA 2WY2A 4ZI3C 3WI3A 3TLUA 4DMWA 4BJMA 3DP7A 2XQ9A 4MBQA 5DJQC 4JBWF 2LSJA 3AEEA 2FJBA 4YSYA 4G2AA 3LDQB 4GOUA 3F31A 1W0AA 2VQET 1S94A 1D0ZA 3O9XA 4X5TA 3AEGA 3E0ZA 2IC6A 3MK7C 2IC9A 2Q9QB 2IDOB 3DTOA 2XAHB 4JI5T 4IGUA 2BS2A 5LBQB 3P4PA 1MMNA 3LSVA 4AKIA 2BKPA 4X65T 1YXRA 2W66A 4KP3C 3P50A 1OEDB 1KK7A 3Q5DA 4C90A 3E22E 5AQGB 2FJAA 2LOSA 3AB3B 4WNKA 5LJNA 1IJ6A 4QXCB 3L09A 1UX4A 4DR6T 2P9BA 1UURA 3RRWA 5CA1E 3KV6A 4L9IA 1VCTA 4OX9T 5LMUT 4KI0F 2JPFA 2BS4A 4OYJA 3UFGA 2BBHA 4QH5A 4YJ3E 4YJ2E 2YINA 3AAIA 3RIAA 1IBLT 4E7ZA 2J4GA 4GYRA 5CB4E 2KWIB 3V5SA 2WWUA 5J0ZA 3AE1A 5AFUL 4A56A 2NW7A 3WAJA 3RKOA 4I55E 5AQFB 4H9SE 1MMDA 3AE8A 2JQQA 3KDSE 4YXDA 3CPZA 3CIRA 3ZC0A 2WU5A 4YFSA 4WZXA 1B7TA 4DVDA 5HEUA 2G0UA 1D0YA 2J47A 2I59A 3HKBE 5M4YA 3QB5K 4MHCA 2NTXA 1R8IA 4U72A 4ILBA 1NWMX 3UU6A 1ZKEA 2E9XB 2CWYA 5J1GA 1ZHCA 4I50E 2CXLA 1YKEB 4IHJE 2XASB 4ILCA 5FVLA 4JEUB 1MIVA 4NXNT 2BDEA 2XHEB 3JAFA 1N32T 5JDMA 1VCSA 3IBPA 5EK4A 4AQYT 5J2UE 3QOFA 3M3ZB 4DV5T 4P0BA 3CQGB 1XZYA 4DBRA 3ZSSA 1H7CA 1HR0T 4OFZA 3SOLA 2KWHA 4EYYR 5EK2A 1YW0A 2I6HA 2XQ8A 4ADZA 2V5DA 2X0HA 2X66A 1BR2A 2WDRA 5LCYA 2Q9QA 3GWHA 5FXXA 1ZP0A 4YY3T 5HCMA 1VOMA 2SPCA 4B3TT 4JEHB 4UVBB 4N78D 4YTNA 3UU5A 2W67A 4UF0A 3ZYMA 1W09A 4HWHA 3CK6A 5AQJB 3RYCE 4JI1T 5LHHB 4IDNA 3NZPA 3TLWA 4CN4A 2JJ9A 1Z8UA 2LLYA 4EZ4A 3E08A 4K0KT 2X9WA 4J2CA 4U7IA 4IL4A 3N9PA 3J7Yq 4IDQA 2M67A 4QH4A 2JQHA 2LKHA 3SWHA 5LYJE 1LRZA 5F8PA 4H9NC 4U2ZA 4LMKA 4WBOA 3AA6B 1MNDA 2YN6A 3ZJ2A 4H9RC 4CXWA 2CLYC 3AE7A 4O2AE 2UUAT 2J1DG 1X9BA 3LBXA 5AQQB 5GONE 2V8SV 1LVFA 3UFEA 4Q25A 3PJAA 5ABHA 3N5LA 1WYCA 5KDMC 2X51A 5IUXA 2XY8B 3EI0A 2CXFA 2DL1A 4IE6A 3NZQA 3RGLA 3RYHE 2XQAA 3RIUC 2VL0A 1MMGA 5JDLA 3GN5A 3QB5A 1HNZT 3C4ZA 1HCIA 2Q9QC 4IE0A 1HG5A 2FBWA 1UUSA 3ZC1A 2CXDA 4IE5A 5AQTB 4H9OC 3DJBA 5JVDE 2VURA 2UXXB 2LRKA 5AQPB 4NUUA 5HXCA 4ASKA 1BR4A 2LEHA 3P4QA 4EB6E 2V6XA 4HN9A 2KZ7B 3SRZA 2MTQA 2KSRA 2WS3A 3PUYF 2DLRA 1N34T 4YTPA 3F2EA 3ZJ1A 5BMVE 2H3RA 3PURA 3AE9A 4O4JE 5CFBA 4DV3T 4OHFA 5AQVB 4QHOA 2E5VA 1L0VA 3RHWA 2VKJA 3A5XA 3TKLB 4H9QC 3GA8A 4I4TE 3HA4A 4UR9A 3K8PC 4QKNA 4U2YA 4IT4A 3AA0B 4EEDA 2WBLA 4KHPT 2LM9A 3O4XE 5JDHA 3RKGA 4LMLA 5L3BB 4NIQA 1U4QA 4DR1T 2RPAA 4O4IE 3NRXA 5FXVA 3PUXF 4QXBB 5LB7B 3WAKA 2IHR1 4TV8E 3CX8B 1ZEEA 2QRXA 3K3NA 3C4WA 5LNKA 3ZN0B 2M6IA 5FVKA 1KNZA 4GKKT 1WR6A 3KBTA 2UXDT 2DWGA 2VL8A 1FJGT 2A72A 1XNQT 1US7B 2YK0A 2W2UA 3JC6D 3OPCA 2ZM8A 2HN1A 5LOVE 2Y6XA 3OBVE 3HKDE 4X62T 3IEEA 1SE7A 1T7SA 1LVKA 4BJNA 4QH1A 2CBJA 3JADA 4DIDB 3OJAA 2R6GF 2JIWA 4AIUA 4UXNB 4HFIA 2AE9A 1N36T 1UCUA 3O1HA 4DBQA 5JDQA 1MNEA 4PFPA 2BKOA 2D5UA 2V6YA 3PUAA 1MMAA 2OV9A 2VB6A 3P4WA 4CN6A 2YDRA 1QLBA 1WFDA 3PUSA 4O8SA 4ISSA 1G8XA 2K24A 1FEWA 3B57A 3NBXX 5F5WA 2CLYB 1FMWA 2LKGA 1Y01A 2CBIA 5HXRA 2W63A 2BZBA 5J2TE 3PUZF 4LF9T 4UELA 2C5IT 1YD8G 5LG4A 5AQRB 3B13A 2HHHT 2ZM2A 4HGAA 4EZHA 2MBGA 4CXYA 1MIWA 4JI2T 4LF7T 2CMRA 5ADXL 2JMHA 3ZPOA 4JYAT 4COFA 2DNXA 2CHOA 4WYVA 4HFCA 2YU2A 2BG9E 3EUHA 3MKDA 4GIWA 5JRCA 4PJLA 2XAGB 3PV0F 3ZT7A 3ESLA 1XDPA 2X0LB 1XNRT 2AXDS 3ZT6A 3RRCA 1HFAA 1BR1A 2EHOD 3AE5A 4ZEYA 4JV5T 3IA3A 4UF0B 3LK3B 4CI1B 2J62A 5HWYA 4IL9A 2ZM0A 3W15B 4ILUA 5AQUB 4C91A 1FIOA 2VASA 4U31A 4AXPA 3AE2A 2B76A 4IE7A 3ONXA 4DV7T 4U7YA 3KV4A 3OKQA 3ONLC 3L8RA 5AQNB 2WDVA 1UK5A 3PU3A 4Z91A 1HG2A 2K9AA 3GMIA 2QYWA 5DQWA 3P8CD 2W61A 5LGNB 2X68A 5AQIB 5LA6E 2FJDA 2WM9A 1D1BA 3ZLIA 1O3XA 2LE8A 4PK5A 3BQLA 3LK42 4IE4A 2E8IA 3ZMTB 5KMGP 4Z8XA 4OK0A 2PG8A 3LBXB 1GQEA 3P4RA 5LP6E 4JLEA 3PDYA 4WBNE 4HFDA 2V5CA 1QUUA 3RQUA 3T1YT 3AE6A 4HFVA 3UUNA 4EEBA 4JI7T 3ZEFB 4IREA 5L3CB 2UXBT 4HWCA 1JNZA 2EHOA 2L3LA 2LM2A 2CRBA 2E2AA 2A9UA 2XTLA 3D0TA 5HWXA 3Q5EA 2QGSA 4JI0T 2M6BA 2PBIA 3GN5B 4TWFA 2K48A 3AVRA 5HEJA 2KXPB 3VRAA 2H7OA 2W0GA 2NW9A 2PFVA 4PK6A 1T8BA 3UQ4A 2RP4A 3FZMB 1OEDE 2C0SA 4CQIA 4X66T 4HWDA 1IBKT 4YSXA 4ZS2A 2MYSA 4ZXLA 3FZHB 2WU2A 3RF1A 3CWZB 3ZCIA 5E0OA 2X9XA 4ERRA 3AVSA 3EHZA 3RIUA 3RYFE 3N9OA 2WZIA 3N9MA 3K1SA 4MALA 2YKSA 4H63H 3H3AA 5FY0A 5JQGE 5L3FB 3RH3A 4AISA 3C4XA 4NUVA 2H7VC 4TWHA 1OWAA 3UULA 1WRDA 4E7SA
chains in the Genus database with same CATH topology
2L9QA 2L8KA 3LFMA 4H9OC 4B6XA 3DJBA 5JVDE 2UXXB 3CKDA 3L3PA 4NUUA 5HXCA 5LJMA 4UIGA 4UV8B 3RYIE 2DCFA 1T98A 4ASKA 2IW5B 1BR4A 4O4HE 2LT3A 2LEHA 3FB2A 4EB6E 4HEAA 3N9QA 4HN9A 3S4UA 2KZ7B 3BQKA 3SRZA 2MTQA 2DLRA 1E1HB 5TAOA 4U74A 3F2EA 5FY7A 3ZJ1A 5BMVE 1V9DA 3LG7A 4GYSA 2H3RA 2XUEA 2GK9A 3PURA 4O4LE 4JUYA 4O4JE 4AKLA 4OHFA 3N2KE 4ZI3C 4QHOA 3WI3A 3AAAB 2E9XD 3BQIA 3UTKA 4DMWA 2JRKA 2VKJA 2ACXA 3A5XA 3C51A 3TKLB 4AQFC 3IF8B 2EHOC 2X67A 4H9QC 4BJMA 3GA8A 3CQXC 2V7KA 4FJOA 4I4TE 3HA4A 3DP7A 3PUGA 3K8PC 4MBQA 2Q9QD 3JC6C 4QKNA 3KVAA 5EK3A 5FXZA 3VKHA 5DJQC 3R6NA 2LSJA 3C50A 3AA0B 2VKOA 2WBLA 2KINB 2LM9A 3O4XE 4TN7B 2BVMA 5JDHA 2V7LA 4HE8A 4H9PC 4G2AA 4GOUA 5L3BB 3F31A 2V7JA 4XZCA 1U4QA 3I0QA 4EOZB 1S94A 1D0ZA 5FYMA 4O4IE 3NRXA 5FXVA 4MFRA 3O9XA 4QXBB 4P09A 3E0ZA 2IC6A 3WAKA 3MK7C 1MIYA 4TV8E 4F6RC 2IC9A 3CX8B 1ZEEA 2Q9QB 2NWBA 3M65A 4CI3B 1U5PA 4X1KE 3K3NA 3DTOA 2XAHB 3C4WA 5LNKA 3ZN0B 4IGUA 2XAJB 2V26A 4ZI7E 3ZMSB 5CA0E 5FNVE 1KNZA 1HTJF 4TX5A 5LBQB 4BAYB 1MMNA 1WR6A 3KBTA 5LXTE 4AKIA 3KVBA 2NOXA 2DWGA 2HPJA 3UUXB 2VL8A 4QWNB 2N2NA 2LSGA 2A72A 2HPLA 1US7B 2YK0A 3K3OA 4H63V 3EDUA 3KINB 3JC6D 4MLKA 2K5BB 2ZM8A 4KP3C 3HL6A 2ZLYA 5FP3A 1KK7A 1S35A 3CX7B 5LOVE 2Y6XA 2KMFA 3HR0A 3KV5A 5L3EB 4C90A 2ES0A 3E22E 3OBVE 5JDGA 5LGTB 4UVAB 3HKDE 3VHLA 4ZI2D 1Y64B 2LOSA 3AB3B 4WNKA 2BVLA 3N2OA 5LJNA 1IJ6A 3IEEA 4QXCB 1LVKA 3MA9A 3Q5XA 4ANJA 4QXHB 3MXZA 4BJNA 2LOPA 2LHRA 3L09A 3OYXA 5DABA 1UX4A 5JR9B 2P9BA 3ZMUB 1D1CA 3RRWA 3KV6A 5CA1E 1IAPA 4L9IA 2N9DA 3OJAA 3ZMVB 5LBMA 2XAFB 4X1YE 4UXNB 5A1LA 1UCUA 3O1HA 4DBQA 5JDQA 1MNEA 4ZHQE 2JPFA 4HTEA 4PFPA 5JRCB 2D5UA 3RX6A 3PUAA 1MMAA 3N9LA 2Y8DA 4OYJA 2B1EA 2VB6A 4KUMB 4YJ3E 4YJ2E 3HI2A 2LSKA 2YINA 1BR0A 3AAIA 3Q5WA 3BK9A 3PUSA 4O8SA 4ISSA 1G8XA 1HF8A 1FEWA 2K24A 3B57A 3NBXX 4L5GA 4TUYE 4E7ZA 2CLYB 1FMWA 2NP9A 4GYRA 5CB4E 2VWAA 3CX6B 2KWIB 5HXRA 3V5SA 2W63A 2BZBA 3ZYKA 2WWUA 5J2TE 3V5UA 4AKGA 3I9WA 2D0TA 4UELA 5AFUL 3F57A 2WSSV 2C5IT 4A56A 2NW7A 1YD8G 5LG4A 3WAJA 5FY1A 3RKOA 4ZS3A 4I55E 3B13A 4PJMA 2ZM2A 4HGAA 4EZHA 4YLHA 3PU8A 2MBGA 4H9SE 1MMDA 4CXYA 1MIWA 3ANWB 2JQQA 3KDSE 2CMRA 3FXEB 5ADXL 5JR9A 2JMHA 1YKHB 2XAQB 3CPZA 3ZPOA 2ZMAA 3ZC0A 3VU7H 4YFSA 1B7TA 4DVDA 2G0UA 4PW8A 1D0YA 2I59A 2DNXA 3HKBE 5M4YA 4AKHA 4MHCA 2NTXA 2YU2A 4DNDA 2CA5A 3EUHA 3ZCJA 3EVYA 4U72A 5L2LA 1ZV4X 3J9X1 1NWMX 1ZKEA 2E9XB 3MKDA 4GIWA 2OA5A 5HYAA 4PAGA 2CWYA 4KBMB 5J1GA 5JRCA 1ZHCA 4PJLA 2A3DA 2V7IA 2X9YA 4I50E 2CXLA 2XAGB 1YKEB 2YEVC 4IHJE 2XASB 2DWKA 4JEUB 3AA1B 5ETWA 1MIVA 3ESLA 3C98B 3K3QC 4HKAA 2NTYA 2BDEA 1SA0E 2XHEB 2UXNB 5H6QB 2X0LB 1QSDA 5JDMA 3AAEB 4ZI3D 4V1Av 5L3GB 5JH7E 3C64A 3IBPA 5EK4A 1WLXA 2HH7A 1EZ3A 5J2UE 5LHIB 1AJ3A 3RRCA 3PTRB 1HFAA 1IJ5A 1BR1A 1Z0PA 2EHOD 4P0BA 3CQGB 3R84B 2MOZA 3QK6A 3NRYA 3UT5E 4ZOLE 3ETUA 4UF0B 4DBRA 3LK3B 4FI5A 4CI1B 1X79A 1H7CA 2W00A 4P0AA 5HWYA 1VRBA 4AQGA 2ZM0A 3UUMA 2Y48B 3W15B 5LGUB 4ILUA 4C91A 5JREA 1FIOA 2JMKA 2VASA 4AXPA 4OFZA 5FMNA 4IE7A 3SOLA 2D2SA 2KWHA 4EYYR 5EK2A 3ONXA 2CWOA 1YW0A 3KV4A 3OKQA 3H37A 2YU1A 3QC9A 4X1IE 5IHYA 2QA7A 2E9XA 3T8OA 3N2GE 2VK9A 2CEAA 4ADZA 3PU3A 4G63A 2X66A 2WAUA 3FBLA 1LKXA 1HG2A 2Z6EA 1BR2A 2EHOB 5LCYA 4ISTA 2K9AA 3GMIA 2Q9QA 3GWHA 5DQWA 3FBZA 3P8CD 4K0UA 2W61A 3MACA 5FXWA 4O2BE 2X68A 5LGNB 3O1IA 4EIWA 5FXXA 1IZNB 3O1JA 5LA6E 4XBFB 4CZZB 2WM9A 1D1BA 3Q9DA 3ZLIA 1VOMA 2SPCA 3ZMZB 1O3XA 4JEHB 2LE8A 5H6RB 2PJQA 2N1GA 4M1PA 4PK5A 3BQLA 2C5KT 3LK42 4UVBB 2X9HA 5C8YE 4IE4A 4N78D 3U78A 2E8IA 4UF0A 4PK4A 3ZYMA 3IHRA 3I9YA 3ZMTB 5KMGP 4Z8XA 1HX8A 4OK0A 2PG8A 5JDFA 3LBXB 3U3IA 2D0UA 3QUJA 5LP6E 4JLEA 3I1AA 3RYCE 3CQCB 4DO0A 3PDYA 4E7SA 5LHHB 2V7MA 1CUNA 4EAHA 3NZPA 4WBNE 4QX8B 2JJ9A 1QUUA 5EZYE 4X20E 2WMNA 4EZ4A 1UX5A 4CXXA 3E08A 2X9WA 4L0RA 4HFVA 2XQYA 3UUNA 1HS7A 2RA1A 3ZEFB 4J2CA 4OYKA 2LSIA 3N9PA 5JR9C 3J7Yq 5HXEA 2M67A 2LSYA 5L3CB 3KFWX 3SWHA 4AQFA 3FHNA 5LYJE 5HXHA 2EHOA 4AI6A 2L3LA 4AKRB 1LRZA 4GK5E 3EDVA 5F8PA 3MZKB 2XTLA 5KX5E 3D0TA 4H9NC 5HWXA 4YHJA 2QGSA 3GN5B 2PBIA 2CE7A 4WBOA 4QX7B 3HKCE 3AA6B 2K48A 1MNDA 3AVRA 1NAFA 4PJNA 2W62A 3ZJ2A 2KXPB 5HXSA 3VKGA 2A2FX 4H9RC 4CXWA 4ZI2C 4EYUA 4XAXB 2H7OA 2CLYC 1D1AA 2ODUA 3I0OA 4O2AE 1G73A 2V1DB 3LJCA 2C5JA 2W0GA 4TZ4C 5HAXA 4BA9A 2J1DG 2NW9A 2KLQA 4PNIA 2PFVA 3ZN1B 4PK6A 2DI4A 5LHGB 2DHRA 3LBXA 3SS1A 5GONE 3ZYLA 2RP4A 1LVFA 3UFEA 5L3DB 2NW8A 1WYBA 3RPUA 2VKDA 2C0SA 4PFOA 2CCQA 4CQIA 2LHNA 3MJXA 3Q2MA 3AA7B 4ZS2A 2MYSA 3OYZA 4TV9E 3CMLA 3ANWA 3P7IA 3N9NA 3FXDB 3N5LA 1WYCA 5KDMC 2X51A 3KV9A 4PJJA 2CM0A 1OXZA 3CWZB 4GK0E 2CXFA 3ZCIA 3HKEE 2X9XA 5E0OA 4CI2B 5F3JA 5IYZE 4IE6A 3RC8A 1SHZC 2KNDA 3NZQA 4I43B 3RYHE 4ERRA 3RC3A 3AVSA 4UVCB 2KT9A 4IIJE 4UEMA 2E9XC 2LJLA 2VKHA 3LK2B 3RYFE 3N9OA 3N9MA 1MMGA 5JDLA 4EXTA 3GN5A 4DMVA 2ODVA 3PE0A 3C4ZA 4MALA 5JDNA 3CVRA 4H63H 3KBUA 3H3AA 5FY0A 4IDZA 1D0XA 5JQGE 3ETVA 5DQVA 1HCIA 5L3FB 4UV9B 2Q9QC 4IE0A 1HG5A 2WMOA 3RH3A 3ZC1A 2CXDA 3C4XA 4KMCA 4NUVA 2H7VC 3PUQA 3UULA 1OWAA 4WW0A 1FMVA 4IE5A 1WRDA 2IAKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MAL A;  4MBQ A; 
#chains in the Genus database with same CATH topology
 4B6X A;  2CPT A;  4UIG A;  3RYI E;  1T98 A;  2LT3 A;  2ZM6 T;  3S4U A;  2E5L T;  4A98 A;  5TAO A;  4U74 A;  2BKN A;  2BS3 A;  2GK9 A;  4CN1 A;  4LFC T;  2E9X D;  3BQI A;  2UUC T;  5HEO A;  1HNX T;  2JRK A;  5HEH A;  2ACX A;  3C51 A;  2EHO C;  2X67 A;  3CQX C;  2V7K A;  5FL1 A;  4U33 A;  1N33 T;  5EK3 A;  5FXZ A;  4DV4 T;  3C50 A;  3AEA A;  4JI3 T;  4NPP A;  5AQS B;  3G06 A;  4HE8 A;  3AEC A;  3PJA J;  2V7J A;  4XZC A;  5FYM A;  3UU3 A;  4B3R T;  4P09 A;  4B3S T;  1MIY A;  3EAM A;  4EV6 A;  4X1K E;  2XQ5 A;  1JNR A;  2XAJ B;  2V6Y B;  3ZMS B;  1HTJ F;  4TX5 A;  2MAW A;  5LXT E;  3KVB A;  2NOX A;  1XMQ T;  1HNW T;  3AEB A;  2UXC T;  4QWN B;  2LSG A;  4YHH T;  1KEY A;  3K3O A;  5FL0 A;  3RQW A;  4H63 V;  3EDU A;  3AE3 A;  3KIN B;  4MLK A;  5FP3 A;  1S35 A;  3CX7 B;  3HR0 A;  5JDG A;  5LGT B;  1UGO A;  2BVL A;  3MA9 A;  4ANJ A;  4QXH B;  2LHR A;  3OYX A;  5DAB A;  3ZMU B;  1D1C A;  4Z90 A;  2JQ9 A;  2N9D A;  3ZMV B;  3ABV A;  5LBM A;  4X1Y E;  5HCJ A;  5A1L A;  1WCR A;  5JRC B;  3RX6 A;  1NEN A;  2B1E A;  4KUM B;  4ILA A;  3HI2 A;  2LSK A;  3T1H T;  3Q5W A;  3BK9 A;  4TUY E;  4L5G A;  2XZE A;  3CX6 B;  3ZYK A;  3V5U A;  4DUY T;  4AKG A;  3I9W A;  3F57 A;  2WSS V;  3FZL B;  5FY1 A;  3AXJ A;  4YLH A;  4LFA T;  2W4X A;  5AQK B;  1KFY A;  3FXE B;  2FJE A;  5JR9 A;  1YKH B;  2ZMA A;  3SFD A;  3ZT5 A;  4AKH A;  4DND A;  3EVY A;  5L2L A;  1ZV4 X;  5HYA A;  4KBM B;  2A3D A;  5AQH B;  2YEV C;  2OLT A;  2DWK A;  3AA1 B;  4IDO A;  2X0Y A;  3K3Q C;  5LG3 A;  4HKA A;  5H6Q B;  3AAE B;  2WZH A;  4V1A v;  5JH7 E;  1IBM T;  1EZ3 A;  1W9R A;  3SFE A;  1AJ3 A;  3PTR B;  1IJ5 A;  1Z0P A;  3R84 B;  3ETU A;  2XQ4 A;  1X79 A;  1VRB A;  2Y48 B;  5LGU B;  5FMN A;  2K3W A;  2D2S A;  1J5E T;  2HN2 A;  3H37 A;  2YU1 A;  3QC9 A;  5IHY A;  3NWI A;  1YQ3 A;  2CEA A;  5HEG A;  1LKX A;  2EHO B;  4IST A;  4ZZB A;  3FBZ A;  4K0U A;  3MAC A;  4O2B E;  4EIW A;  1IZN B;  4CZZ B;  3ZKR A;  3Q9D A;  5H6R B;  2N1G A;  4M1P A;  2C5K T;  5C8Y E;  2XM1 A;  1CHU A;  3U3I A;  1HX8 A;  5JDF A;  3H3M A;  4DO0 A;  1CUN A;  2V7M A;  4LF6 T;  4QX8 B;  2WMN A;  4L0R A;  2XQY A;  2IUB A;  5L4H A;  1HS7 A;  4OYK A;  2LSI A;  5JR9 C;  5C2T A;  5HXE A;  2LSY A;  3KFW X;  1I6Z A;  4AQF A;  4AI6 A;  3VR9 A;  4GK5 E;  3EDV A;  5ABF A;  5CJ5 A;  4YHJ A;  4QX7 B;  3HKC E;  4PJN A;  4GKJ T;  5HXS A;  2A2F X;  4EYU A;  1D1A A;  3I0O A;  1G73 A;  2V1D B;  4ZZC A;  5HAX A;  3X1D A;  4PNI A;  5AQO B;  4DV6 T;  1XWM A;  4HFH A;  1WYB A;  5FKY A;  3RPU A;  4PFO A;  2I0M A;  2LHN A;  3MJX A;  3AA7 B;  5C3J A;  3RI5 A;  1HX1 B;  3P7I A;  3N9N A;  4U3C A;  4KX6 A;  4PJJ A;  3P4S A;  2CM0 A;  3HKE E;  5IYZ E;  2XSB A;  5AQL B;  2KND A;  4I43 B;  3RC3 A;  2D9D A;  2KT9 A;  4UEM A;  4LF5 T;  2LJL A;  2VKH A;  4YSZ A;  1WR0 A;  3CVR A;  4IDZ A;  1D0X A;  3ETV A;  2PTF A;  1T72 A;  2WMO A;  2IAK A;  2L9Q A;  2L8K A;  3LFM A;  4JI8 T;  3CKD A;  2BG9 A;  2DCF A;  2XJ7 A;  2IW5 B;  3UQ7 A;  4O4H E;  3FB2 A;  4HEA A;  2YOE A;  5IWA T;  1SUM B;  3FZF B;  3LG7 A;  4GYS A;  4JUY A;  3N2K E;  3AAA B;  3UTK A;  4B3M T;  4AQF C;  3IF8 B;  3TLS A;  4FJO A;  3PUG A;  3AEF A;  2Q9Q D;  4LFB T;  3JC6 C;  3KVA A;  3VKH A;  3R6N A;  2VKO A;  2KIN B;  1NEK A;  4TN7 B;  2BVM A;  2XSA A;  1DU2 A;  2V7L A;  5BR8 T;  4H9P C;  4F8H A;  3NVO A;  3I0Q A;  4EOZ B;  1W0B A;  2WQY A;  3AE4 A;  2XM2 A;  2VQF T;  4MFR A;  3L39 A;  1KF6 A;  3B5M A;  4IDP A;  4F6R C;  5KXJ A;  2NWB A;  3M65 A;  4CI3 B;  1U5P A;  2V26 A;  4ZI7 E;  5LMN T;  5CA0 E;  5FNV E;  4BAY B;  2HPJ A;  3UUX B;  4DR4 T;  2N2N A;  2VVN A;  2HPL A;  2IML A;  2K5B B;  2UU9 T;  3HL6 A;  2ZLY A;  5CGM A;  2KMF A;  3NKZ A;  3KV5 A;  5L3E B;  4DUZ T;  2ES0 A;  3TLV A;  2UUB T;  4UVA B;  2ACZ A;  4DR3 T;  3VHL A;  3AXJ B;  4ZI2 D;  1Y64 B;  3N2O A;  3JCF A;  3Q5X A;  3MXZ A;  2LOP A;  5JR9 B;  1IAP A;  2BG9 C;  2XAF B;  1J1J A;  3RIF A;  4ZHQ E;  4HTE A;  3N9L A;  2Y8D A;  2H88 A;  3EAB A;  1BR0 A;  4JI6 T;  1HF8 A;  2NP9 A;  1M62 A;  3OTO T;  1J5W A;  2VWA A;  1OED A;  2D0T A;  3FZK B;  4NXM T;  4ZS3 A;  4PJM A;  3JAE A;  3PU8 A;  2WCA A;  4A5X A;  3OVU A;  3ANW B;  3VR8 A;  3AED A;  2XAQ B;  3VU7 H;  1YQ4 A;  5L47 A;  4PW8 A;  4LF4 T;  4JI4 T;  2CA5 A;  3ZCJ A;  3J9X 1;  2OA5 A;  4PAG A;  3RLF F;  1KNP A;  2V7I A;  3A8Y C;  2X9Y A;  5ETW A;  2IIU A;  3C98 B;  2NTY A;  5ABG A;  1SA0 E;  5AQM B;  2UXN B;  2BBJ A;  1QSD A;  2LRL A;  4ZI3 D;  5L3G B;  3C64 A;  1XMO T;  4LMJ A;  1WLX A;  2HH7 A;  5LHI B;  1E2A A;  2CHN A;  2MOZ A;  3QK6 A;  3NRY A;  3UT5 E;  4ZOL E;  3UU8 A;  4FI5 A;  2W00 A;  3PUV F;  4P0A A;  4AQG A;  3UUM A;  5JRE A;  2JMK A;  4EGW A;  2CWO A;  4YTM A;  4X1I E;  2QA7 A;  2E9X A;  3T8O A;  3N2G E;  2VK9 A;  4G63 A;  3ONJ A;  3FBL A;  2WAU A;  2Z6E A;  1KNR A;  5FXW A;  5ABF B;  3O1I A;  3O1J A;  4XBF B;  4DV2 T;  3ZMZ B;  2PJQ A;  4YT0 A;  4TWD A;  2X9H A;  3U78 A;  1M7K A;  1I94 T;  2YDQ A;  4PK4 A;  1OED C;  3IHR A;  3I9Y A;  4HWF A;  4HFE A;  2F4V T;  2D0U A;  3QUJ A;  2XQ3 A;  3I1A A;  3CQC B;  4I0U A;  4EAH A;  2VVS A;  2WDQ A;  4X20 E;  5EZY E;  1UX5 A;  4CXX A;  3TLT A;  2WP9 A;  2RA1 A;  3UUB A;  2XQ7 A;  2JQK A;  2FUP A;  2MPK A;  3FHN A;  3UU4 A;  5HXH A;  4AKR B;  3MZK B;  5KX5 E;  3VRB A;  4P1N A;  3QNU A;  2NR4 A;  2XQ6 A;  2CE7 A;  2WWV A;  1NAF A;  2W62 A;  2WB5 A;  3VKG A;  4ZI2 C;  4XAX B;  4KHZ F;  2ODU A;  3LJC A;  5ABE A;  2C5J A;  4TZ4 C;  4BA9 A;  3PUW F;  2KLQ A;  2YDS A;  3ZN1 B;  2DI4 A;  5LHG B;  2DHR A;  1XDO A;  3SS1 A;  3ZYL A;  5L3D B;  2NW8 A;  5JTG A;  2VKD A;  2CCQ A;  4TNW A;  2BG9 B;  3Q2M A;  3OYZ A;  4TV9 E;  3CML A;  3ANW A;  3FXD B;  3KV9 A;  4LF8 T;  1OXZ A;  4GK0 E;  4CI2 B;  2H89 A;  5F3J A;  3RC8 A;  1SHZ C;  4UVC B;  4IIJ E;  4DR7 T;  2E9X C;  3LK2 B;  1ZOY A;  4EXT A;  5L4E A;  4DMV A;  2ODV A;  3PE0 A;  5JDN A;  4TNV A;  3KBU A;  5DQV A;  4UV9 B;  4DR5 T;  4KMC A;  3PUQ A;  4WW0 A;  1FMV A;  3A7M A;  3L3P A;  5LJM A;  4UV8 B;  4HWI B;  2XPK A;  4HFB A;  2QVA A;  3N9Q A;  3BQK A;  1E1H B;  4DR2 T;  3ZST A;  4DV0 T;  5FY7 A;  1V9D A;  4A97 A;  4X64 T;  4DV1 T;  2XUE A;  4O4L E;  1E7P A;  4AKL A;  2WY2 A;  4ZI3 C;  3WI3 A;  3TLU A;  4DMW A;  4BJM A;  3DP7 A;  2XQ9 A;  4MBQ A;  5DJQ C;  4JBW F;  2LSJ A;  3AEE A;  2FJB A;  4YSY A;  4G2A A;  3LDQ B;  4GOU A;  3F31 A;  1W0A A;  2VQE T;  1S94 A;  1D0Z A;  3O9X A;  4X5T A;  3AEG A;  3E0Z A;  2IC6 A;  3MK7 C;  2IC9 A;  2Q9Q B;  2IDO B;  3DTO A;  2XAH B;  4JI5 T;  4IGU A;  2BS2 A;  5LBQ B;  3P4P A;  1MMN A;  3LSV A;  4AKI A;  2BKP A;  4X65 T;  1YXR A;  2W66 A;  4KP3 C;  3P50 A;  1OED B;  1KK7 A;  3Q5D A;  4C90 A;  3E22 E;  5AQG B;  2FJA A;  2LOS A;  3AB3 B;  4WNK A;  5LJN A;  1IJ6 A;  4QXC B;  3L09 A;  1UX4 A;  4DR6 T;  2P9B A;  1UUR A;  3RRW A;  5CA1 E;  3KV6 A;  4L9I A;  1VCT A;  4OX9 T;  5LMU T;  4KI0 F;  2JPF A;  2BS4 A;  4OYJ A;  3UFG A;  2BBH A;  4QH5 A;  4YJ3 E;  4YJ2 E;  2YIN A;  3AAI A;  3RIA A;  1IBL T;  4E7Z A;  2J4G A;  4GYR A;  5CB4 E;  2KWI B;  3V5S A;  2WWU A;  5J0Z A;  3AE1 A;  5AFU L;  4A56 A;  2NW7 A;  3WAJ A;  3RKO A;  4I55 E;  5AQF B;  4H9S E;  1MMD A;  3AE8 A;  2JQQ A;  3KDS E;  4YXD A;  3CPZ A;  3CIR A;  3ZC0 A;  2WU5 A;  4YFS A;  4WZX A;  1B7T A;  4DVD A;  5HEU A;  2G0U A;  1D0Y A;  2J47 A;  2I59 A;  3HKB E;  5M4Y A;  3QB5 K;  4MHC A;  2NTX A;  1R8I A;  4U72 A;  4ILB A;  1NWM X;  3UU6 A;  1ZKE A;  2E9X B;  2CWY A;  5J1G A;  1ZHC A;  4I50 E;  2CXL A;  1YKE B;  4IHJ E;  2XAS B;  4ILC A;  5FVL A;  4JEU B;  1MIV A;  4NXN T;  2BDE A;  2XHE B;  3JAF A;  1N32 T;  5JDM A;  1VCS A;  3IBP A;  5EK4 A;  4AQY T;  5J2U E;  3QOF A;  3M3Z B;  4DV5 T;  4P0B A;  3CQG B;  1XZY A;  4DBR A;  3ZSS A;  1H7C A;  1HR0 T;  4OFZ A;  3SOL A;  2KWH A;  4EYY R;  5EK2 A;  1YW0 A;  2I6H A;  2XQ8 A;  4ADZ A;  2V5D A;  2X0H A;  2X66 A;  1BR2 A;  2WDR A;  5LCY A;  2Q9Q A;  3GWH A;  5FXX A;  1ZP0 A;  4YY3 T;  5HCM A;  1VOM A;  2SPC A;  4B3T T;  4JEH B;  4UVB B;  4N78 D;  4YTN A;  3UU5 A;  2W67 A;  4UF0 A;  3ZYM A;  1W09 A;  4HWH A;  3CK6 A;  5AQJ B;  3RYC E;  4JI1 T;  5LHH B;  4IDN A;  3NZP A;  3TLW A;  4CN4 A;  2JJ9 A;  1Z8U A;  2LLY A;  4EZ4 A;  3E08 A;  4K0K T;  2X9W A;  4J2C A;  4U7I A;  4IL4 A;  3N9P A;  3J7Y q;  4IDQ A;  2M67 A;  4QH4 A;  2JQH A;  2LKH A;  3SWH A;  5LYJ E;  1LRZ A;  5F8P A;  4H9N C;  4U2Z A;  4LMK A;  4WBO A;  3AA6 B;  1MND A;  2YN6 A;  3ZJ2 A;  4H9R C;  4CXW A;  2CLY C;  3AE7 A;  4O2A E;  2UUA T;  2J1D G;  1X9B A;  3LBX A;  5AQQ B;  5GON E;  2V8S V;  1LVF A;  3UFE A;  4Q25 A;  3PJA A;  5ABH A;  3N5L A;  1WYC A;  5KDM C;  2X51 A;  5IUX A;  2XY8 B;  3EI0 A;  2CXF A;  2DL1 A;  4IE6 A;  3NZQ A;  3RGL A;  3RYH E;  2XQA A;  3RIU C;  2VL0 A;  1MMG A;  5JDL A;  3GN5 A;  3QB5 A;  1HNZ T;  3C4Z A;  1HCI A;  2Q9Q C;  4IE0 A;  1HG5 A;  2FBW A;  1UUS A;  3ZC1 A;  2CXD A;  4IE5 A;  5AQT B;  4H9O C;  3DJB A;  5JVD E;  2VUR A;  2UXX B;  2LRK A;  5AQP B;  4NUU A;  5HXC A;  4ASK A;  1BR4 A;  2LEH A;  3P4Q A;  4EB6 E;  2V6X A;  4HN9 A;  2KZ7 B;  3SRZ A;  2MTQ A;  2KSR A;  2WS3 A;  3PUY F;  2DLR A;  1N34 T;  4YTP A;  3F2E A;  3ZJ1 A;  5BMV E;  2H3R A;  3PUR A;  3AE9 A;  4O4J E;  5CFB A;  4DV3 T;  4OHF A;  5AQV B;  4QHO A;  2E5V A;  1L0V A;  3RHW A;  2VKJ A;  3A5X A;  3TKL B;  4H9Q C;  3GA8 A;  4I4T E;  3HA4 A;  4UR9 A;  3K8P C;  4QKN A;  4U2Y A;  4IT4 A;  3AA0 B;  4EED A;  2WBL A;  4KHP T;  2LM9 A;  3O4X E;  5JDH A;  3RKG A;  4LML A;  5L3B B;  4NIQ A;  1U4Q A;  4DR1 T;  2RPA A;  4O4I E;  3NRX A;  5FXV A;  3PUX F;  4QXB B;  5LB7 B;  3WAK A;  2IHR 1;  4TV8 E;  3CX8 B;  1ZEE A;  2QRX A;  3K3N A;  3C4W A;  5LNK A;  3ZN0 B;  2M6I A;  5FVK A;  1KNZ A;  4GKK T;  1WR6 A;  3KBT A;  2UXD T;  2DWG A;  2VL8 A;  1FJG T;  2A72 A;  1XNQ T;  1US7 B;  2YK0 A;  2W2U A;  3JC6 D;  3OPC A;  2ZM8 A;  2HN1 A;  5LOV E;  2Y6X A;  3OBV E;  3HKD E;  4X62 T;  3IEE A;  1SE7 A;  1T7S A;  1LVK A;  4BJN A;  4QH1 A;  2CBJ A;  3JAD A;  4DID B;  3OJA A;  2R6G F;  2JIW A;  4AIU A;  4UXN B;  4HFI A;  2AE9 A;  1N36 T;  1UCU A;  3O1H A;  4DBQ A;  5JDQ A;  1MNE A;  4PFP A;  2BKO A;  2D5U A;  2V6Y A;  3PUA A;  1MMA A;  2OV9 A;  2VB6 A;  3P4W A;  4CN6 A;  2YDR A;  1QLB A;  1WFD A;  3PUS A;  4O8S A;  4ISS A;  1G8X A;  2K24 A;  1FEW A;  3B57 A;  3NBX X;  5F5W A;  2CLY B;  1FMW A;  2LKG A;  1Y01 A;  2CBI A;  5HXR A;  2W63 A;  2BZB A;  5J2T E;  3PUZ F;  4LF9 T;  4UEL A;  2C5I T;  1YD8 G;  5LG4 A;  5AQR B;  3B13 A;  2HHH T;  2ZM2 A;  4HGA A;  4EZH A;  2MBG A;  4CXY A;  1MIW A;  4JI2 T;  4LF7 T;  2CMR A;  5ADX L;  2JMH A;  3ZPO A;  4JYA T;  4COF A;  2DNX A;  2CHO A;  4WYV A;  4HFC A;  2YU2 A;  2BG9 E;  3EUH A;  3MKD A;  4GIW A;  5JRC A;  4PJL A;  2XAG B;  3PV0 F;  3ZT7 A;  3ESL A;  1XDP A;  2X0L B;  1XNR T;  2AXD S;  3ZT6 A;  3RRC A;  1HFA A;  1BR1 A;  2EHO D;  3AE5 A;  4ZEY A;  4JV5 T;  3IA3 A;  4UF0 B;  3LK3 B;  4CI1 B;  2J62 A;  5HWY A;  4IL9 A;  2ZM0 A;  3W15 B;  4ILU A;  5AQU B;  4C91 A;  1FIO A;  2VAS A;  4U31 A;  4AXP A;  3AE2 A;  2B76 A;  4IE7 A;  3ONX A;  4DV7 T;  4U7Y A;  3KV4 A;  3OKQ A;  3ONL C;  3L8R A;  5AQN B;  2WDV A;  1UK5 A;  3PU3 A;  4Z91 A;  1HG2 A;  2K9A A;  3GMI A;  2QYW A;  5DQW A;  3P8C D;  2W61 A;  5LGN B;  2X68 A;  5AQI B;  5LA6 E;  2FJD A;  2WM9 A;  1D1B A;  3ZLI A;  1O3X A;  2LE8 A;  4PK5 A;  3BQL A;  3LK4 2;  4IE4 A;  2E8I A;  3ZMT B;  5KMG P;  4Z8X A;  4OK0 A;  2PG8 A;  3LBX B;  1GQE A;  3P4R A;  5LP6 E;  4JLE A;  3PDY A;  4WBN E;  4HFD A;  2V5C A;  1QUU A;  3RQU A;  3T1Y T;  3AE6 A;  4HFV A;  3UUN A;  4EEB A;  4JI7 T;  3ZEF B;  4IRE A;  5L3C B;  2UXB T;  4HWC A;  1JNZ A;  2EHO A;  2L3L A;  2LM2 A;  2CRB A;  2E2A A;  2A9U A;  2XTL A;  3D0T A;  5HWX A;  3Q5E A;  2QGS A;  4JI0 T;  2M6B A;  2PBI A;  3GN5 B;  4TWF A;  2K48 A;  3AVR A;  5HEJ A;  2KXP B;  3VRA A;  2H7O A;  2W0G A;  2NW9 A;  2PFV A;  4PK6 A;  1T8B A;  3UQ4 A;  2RP4 A;  3FZM B;  1OED E;  2C0S A;  4CQI A;  4X66 T;  4HWD A;  1IBK T;  4YSX A;  4ZS2 A;  2MYS A;  4ZXL A;  3FZH B;  2WU2 A;  3RF1 A;  3CWZ B;  3ZCI A;  5E0O A;  2X9X A;  4ERR A;  3AVS A;  3EHZ A;  3RIU A;  3RYF E;  3N9O A;  2WZI A;  3N9M A;  3K1S A;  4MAL A;  2YKS A;  4H63 H;  3H3A A;  5FY0 A;  5JQG E;  5L3F B;  3RH3 A;  4AIS A;  3C4X A;  4NUV A;  2H7V C;  4TWH A;  1OWA A;  3UUL A;  1WRD A;  4E7S A; 
#chains in the Genus database with same CATH homology
 2L9Q A;  2L8K A;  3LFM A;  4H9O C;  4B6X A;  3DJB A;  5JVD E;  2UXX B;  3CKD A;  3L3P A;  4NUU A;  5HXC A;  5LJM A;  4UIG A;  4UV8 B;  3RYI E;  2DCF A;  1T98 A;  4ASK A;  2IW5 B;  1BR4 A;  4O4H E;  2LT3 A;  2LEH A;  3FB2 A;  4EB6 E;  4HEA A;  3N9Q A;  4HN9 A;  3S4U A;  2KZ7 B;  3BQK A;  3SRZ A;  2MTQ A;  2DLR A;  1E1H B;  5TAO A;  4U74 A;  3F2E A;  5FY7 A;  3ZJ1 A;  5BMV E;  1V9D A;  3LG7 A;  4GYS A;  2H3R A;  2XUE A;  2GK9 A;  3PUR A;  4O4L E;  4JUY A;  4O4J E;  4AKL A;  4OHF A;  3N2K E;  4ZI3 C;  4QHO A;  3WI3 A;  3AAA B;  2E9X D;  3BQI A;  3UTK A;  4DMW A;  2JRK A;  2VKJ A;  2ACX A;  3A5X A;  3C51 A;  3TKL B;  4AQF C;  3IF8 B;  2EHO C;  2X67 A;  4H9Q C;  4BJM A;  3GA8 A;  3CQX C;  2V7K A;  4FJO A;  4I4T E;  3HA4 A;  3DP7 A;  3PUG A;  3K8P C;  4MBQ A;  2Q9Q D;  3JC6 C;  4QKN A;  3KVA A;  5EK3 A;  5FXZ A;  3VKH A;  5DJQ C;  3R6N A;  2LSJ A;  3C50 A;  3AA0 B;  2VKO A;  2WBL A;  2KIN B;  2LM9 A;  3O4X E;  4TN7 B;  2BVM A;  5JDH A;  2V7L A;  4HE8 A;  4H9P C;  4G2A A;  4GOU A;  5L3B B;  3F31 A;  2V7J A;  4XZC A;  1U4Q A;  3I0Q A;  4EOZ B;  1S94 A;  1D0Z A;  5FYM A;  4O4I E;  3NRX A;  5FXV A;  4MFR A;  3O9X A;  4QXB B;  4P09 A;  3E0Z A;  2IC6 A;  3WAK A;  3MK7 C;  1MIY A;  4TV8 E;  4F6R C;  2IC9 A;  3CX8 B;  1ZEE A;  2Q9Q B;  2NWB A;  3M65 A;  4CI3 B;  1U5P A;  4X1K E;  3K3N A;  3DTO A;  2XAH B;  3C4W A;  5LNK A;  3ZN0 B;  4IGU A;  2XAJ B;  2V26 A;  4ZI7 E;  3ZMS B;  5CA0 E;  5FNV E;  1KNZ A;  1HTJ F;  4TX5 A;  5LBQ B;  4BAY B;  1MMN A;  1WR6 A;  3KBT A;  5LXT E;  4AKI A;  3KVB A;  2NOX A;  2DWG A;  2HPJ A;  3UUX B;  2VL8 A;  4QWN B;  2N2N A;  2LSG A;  2A72 A;  2HPL A;  1US7 B;  2YK0 A;  3K3O A;  4H63 V;  3EDU A;  3KIN B;  3JC6 D;  4MLK A;  2K5B B;  2ZM8 A;  4KP3 C;  3HL6 A;  2ZLY A;  5FP3 A;  1KK7 A;  1S35 A;  3CX7 B;  5LOV E;  2Y6X A;  2KMF A;  3HR0 A;  3KV5 A;  5L3E B;  4C90 A;  2ES0 A;  3E22 E;  3OBV E;  5JDG A;  5LGT B;  4UVA B;  3HKD E;  3VHL A;  4ZI2 D;  1Y64 B;  2LOS A;  3AB3 B;  4WNK A;  2BVL A;  3N2O A;  5LJN A;  1IJ6 A;  3IEE A;  4QXC B;  1LVK A;  3MA9 A;  3Q5X A;  4ANJ A;  4QXH B;  3MXZ A;  4BJN A;  2LOP A;  2LHR A;  3L09 A;  3OYX A;  5DAB A;  1UX4 A;  5JR9 B;  2P9B A;  3ZMU B;  1D1C A;  3RRW A;  3KV6 A;  5CA1 E;  1IAP A;  4L9I A;  2N9D A;  3OJA A;  3ZMV B;  5LBM A;  2XAF B;  4X1Y E;  4UXN B;  5A1L A;  1UCU A;  3O1H A;  4DBQ A;  5JDQ A;  1MNE A;  4ZHQ E;  2JPF A;  4HTE A;  4PFP A;  5JRC B;  2D5U A;  3RX6 A;  3PUA A;  1MMA A;  3N9L A;  2Y8D A;  4OYJ A;  2B1E A;  2VB6 A;  4KUM B;  4YJ3 E;  4YJ2 E;  3HI2 A;  2LSK A;  2YIN A;  1BR0 A;  3AAI A;  3Q5W A;  3BK9 A;  3PUS A;  4O8S A;  4ISS A;  1G8X A;  1HF8 A;  1FEW A;  2K24 A;  3B57 A;  3NBX X;  4L5G A;  4TUY E;  4E7Z A;  2CLY B;  1FMW A;  2NP9 A;  4GYR A;  5CB4 E;  2VWA A;  3CX6 B;  2KWI B;  5HXR A;  3V5S A;  2W63 A;  2BZB A;  3ZYK A;  2WWU A;  5J2T E;  3V5U A;  4AKG A;  3I9W A;  2D0T A;  4UEL A;  5AFU L;  3F57 A;  2WSS V;  2C5I T;  4A56 A;  2NW7 A;  1YD8 G;  5LG4 A;  3WAJ A;  5FY1 A;  3RKO A;  4ZS3 A;  4I55 E;  3B13 A;  4PJM A;  2ZM2 A;  4HGA A;  4EZH A;  4YLH A;  3PU8 A;  2MBG A;  4H9S E;  1MMD A;  4CXY A;  1MIW A;  3ANW B;  2JQQ A;  3KDS E;  2CMR A;  3FXE B;  5ADX L;  5JR9 A;  2JMH A;  1YKH B;  2XAQ B;  3CPZ A;  3ZPO A;  2ZMA A;  3ZC0 A;  3VU7 H;  4YFS A;  1B7T A;  4DVD A;  2G0U A;  4PW8 A;  1D0Y A;  2I59 A;  2DNX A;  3HKB E;  5M4Y A;  4AKH A;  4MHC A;  2NTX A;  2YU2 A;  4DND A;  2CA5 A;  3EUH A;  3ZCJ A;  3EVY A;  4U72 A;  5L2L A;  1ZV4 X;  3J9X 1;  1NWM X;  1ZKE A;  2E9X B;  3MKD A;  4GIW A;  2OA5 A;  5HYA A;  4PAG A;  2CWY A;  4KBM B;  5J1G A;  5JRC A;  1ZHC A;  4PJL A;  2A3D A;  2V7I A;  2X9Y A;  4I50 E;  2CXL A;  2XAG B;  1YKE B;  2YEV C;  4IHJ E;  2XAS B;  2DWK A;  4JEU B;  3AA1 B;  5ETW A;  1MIV A;  3ESL A;  3C98 B;  3K3Q C;  4HKA A;  2NTY A;  2BDE A;  1SA0 E;  2XHE B;  2UXN B;  5H6Q B;  2X0L B;  1QSD A;  5JDM A;  3AAE B;  4ZI3 D;  4V1A v;  5L3G B;  5JH7 E;  3C64 A;  3IBP A;  5EK4 A;  1WLX A;  2HH7 A;  1EZ3 A;  5J2U E;  5LHI B;  1AJ3 A;  3RRC A;  3PTR B;  1HFA A;  1IJ5 A;  1BR1 A;  1Z0P A;  2EHO D;  4P0B A;  3CQG B;  3R84 B;  2MOZ A;  3QK6 A;  3NRY A;  3UT5 E;  4ZOL E;  3ETU A;  4UF0 B;  4DBR A;  3LK3 B;  4FI5 A;  4CI1 B;  1X79 A;  1H7C A;  2W00 A;  4P0A A;  5HWY A;  1VRB A;  4AQG A;  2ZM0 A;  3UUM A;  2Y48 B;  3W15 B;  5LGU B;  4ILU A;  4C91 A;  5JRE A;  1FIO A;  2JMK A;  2VAS A;  4AXP A;  4OFZ A;  5FMN A;  4IE7 A;  3SOL A;  2D2S A;  2KWH A;  4EYY R;  5EK2 A;  3ONX A;  2CWO A;  1YW0 A;  3KV4 A;  3OKQ A;  3H37 A;  2YU1 A;  3QC9 A;  4X1I E;  5IHY A;  2QA7 A;  2E9X A;  3T8O A;  3N2G E;  2VK9 A;  2CEA A;  4ADZ A;  3PU3 A;  4G63 A;  2X66 A;  2WAU A;  3FBL A;  1LKX A;  1HG2 A;  2Z6E A;  1BR2 A;  2EHO B;  5LCY A;  4IST A;  2K9A A;  3GMI A;  2Q9Q A;  3GWH A;  5DQW A;  3FBZ A;  3P8C D;  4K0U A;  2W61 A;  3MAC A;  5FXW A;  4O2B E;  2X68 A;  5LGN B;  3O1I A;  4EIW A;  5FXX A;  1IZN B;  3O1J A;  5LA6 E;  4XBF B;  4CZZ B;  2WM9 A;  1D1B A;  3Q9D A;  3ZLI A;  1VOM A;  2SPC A;  3ZMZ B;  1O3X A;  4JEH B;  2LE8 A;  5H6R B;  2PJQ A;  2N1G A;  4M1P A;  4PK5 A;  3BQL A;  2C5K T;  3LK4 2;  4UVB B;  2X9H A;  5C8Y E;  4IE4 A;  4N78 D;  3U78 A;  2E8I A;  4UF0 A;  4PK4 A;  3ZYM A;  3IHR A;  3I9Y A;  3ZMT B;  5KMG P;  4Z8X A;  1HX8 A;  4OK0 A;  2PG8 A;  5JDF A;  3LBX B;  3U3I A;  2D0U A;  3QUJ A;  5LP6 E;  4JLE A;  3I1A A;  3RYC E;  3CQC B;  4DO0 A;  3PDY A;  4E7S A;  5LHH B;  2V7M A;  1CUN A;  4EAH A;  3NZP A;  4WBN E;  4QX8 B;  2JJ9 A;  1QUU A;  5EZY E;  4X20 E;  2WMN A;  4EZ4 A;  1UX5 A;  4CXX A;  3E08 A;  2X9W A;  4L0R A;  4HFV A;  2XQY A;  3UUN A;  1HS7 A;  2RA1 A;  3ZEF B;  4J2C A;  4OYK A;  2LSI A;  3N9P A;  5JR9 C;  3J7Y q;  5HXE A;  2M67 A;  2LSY A;  5L3C B;  3KFW X;  3SWH A;  4AQF A;  3FHN A;  5LYJ E;  5HXH A;  2EHO A;  4AI6 A;  2L3L A;  4AKR B;  1LRZ A;  4GK5 E;  3EDV A;  5F8P A;  3MZK B;  2XTL A;  5KX5 E;  3D0T A;  4H9N C;  5HWX A;  4YHJ A;  2QGS A;  3GN5 B;  2PBI A;  2CE7 A;  4WBO A;  4QX7 B;  3HKC E;  3AA6 B;  2K48 A;  1MND A;  3AVR A;  1NAF A;  4PJN A;  2W62 A;  3ZJ2 A;  2KXP B;  5HXS A;  3VKG A;  2A2F X;  4H9R C;  4CXW A;  4ZI2 C;  4EYU A;  4XAX B;  2H7O A;  2CLY C;  1D1A A;  2ODU A;  3I0O A;  4O2A E;  1G73 A;  2V1D B;  3LJC A;  2C5J A;  2W0G A;  4TZ4 C;  5HAX A;  4BA9 A;  2J1D G;  2NW9 A;  2KLQ A;  4PNI A;  2PFV A;  3ZN1 B;  4PK6 A;  2DI4 A;  5LHG B;  2DHR A;  3LBX A;  3SS1 A;  5GON E;  3ZYL A;  2RP4 A;  1LVF A;  3UFE A;  5L3D B;  2NW8 A;  1WYB A;  3RPU A;  2VKD A;  2C0S A;  4PFO A;  2CCQ A;  4CQI A;  2LHN A;  3MJX A;  3Q2M A;  3AA7 B;  4ZS2 A;  2MYS A;  3OYZ A;  4TV9 E;  3CML A;  3ANW A;  3P7I A;  3N9N A;  3FXD B;  3N5L A;  1WYC A;  5KDM C;  2X51 A;  3KV9 A;  4PJJ A;  2CM0 A;  1OXZ A;  3CWZ B;  4GK0 E;  2CXF A;  3ZCI A;  3HKE E;  2X9X A;  5E0O A;  4CI2 B;  5F3J A;  5IYZ E;  4IE6 A;  3RC8 A;  1SHZ C;  2KND A;  3NZQ A;  4I43 B;  3RYH E;  4ERR A;  3RC3 A;  3AVS A;  4UVC B;  2KT9 A;  4IIJ E;  4UEM A;  2E9X C;  2LJL A;  2VKH A;  3LK2 B;  3RYF E;  3N9O A;  3N9M A;  1MMG A;  5JDL A;  4EXT A;  3GN5 A;  4DMV A;  2ODV A;  3PE0 A;  3C4Z A;  4MAL A;  5JDN A;  3CVR A;  4H63 H;  3KBU A;  3H3A A;  5FY0 A;  4IDZ A;  1D0X A;  5JQG E;  3ETV A;  5DQV A;  1HCI A;  5L3F B;  4UV9 B;  2Q9Q C;  4IE0 A;  1HG5 A;  2WMO A;  3RH3 A;  3ZC1 A;  2CXD A;  3C4X A;  4KMC A;  4NUV A;  2H7V C;  3PUQ A;  3UUL A;  1OWA A;  4WW0 A;  1FMV A;  4IE5 A;  1WRD A;  2IAK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...