4MBQA

Tpr3 of fimv from p. aeruginosa (pao1)
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
49
structure length
49
Chain Sequence
DEAATKLDLARAYIDMGDSEGARDILDEVLAEGNDSQQAEARELLERLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Unknown function
molecule keywords Motility protein FimV
publication title Crystal structure of TPR2 from FimV
rcsb
source organism Pseudomonas aeruginosa
total genus 22
structure length 49
sequence length 49
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2013-08-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.2200 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4mbqA00
4MBQA 4MALA
chains in the Genus database with same CATH superfamily
2XQ9A 5L3CB 3O1IA 2FJAA 1KNRA 2BVMA 2K5BB 4XZCA 1US7B 2X9WA 2J62A 3FHNA 4L5GA 2RA1A 2YEVC 4ILBA 3N9OA 2VKJA 3B13A 5AQKB 4I43B 4U7IA 3VHLA 4ZI2D 4Z8XA 5HEOA 1W0AA 4X1YE 2BKPA 2XAHB 2NWBA 4QKNA 5AQJB 4H9QC 3P4RA 2FJDA 3RF1A 4ISSA 4U74A 4CN1A 1WYBA 4IE0A 5C3JA 4YTPA 3RX6A 2D0UA 2X0YA 2ZM0A 5JR9A 1OWAA 4IDPA 4ZOLE 2KINB 3QUJA 1J5ET 2XY8B 1XMQT 3OJAA 1I6ZA 4MFRA 1X79A 2K48A 5L2LA 3OKQA 3KV9A 3AEBA 3LFMA 4Z90A 3V5UA 2I0MA 4KP3C 4LF5T 1HG2A 3TLTA 1MMAA 1XNQT 3N9MA 3CVRA 3UU6A 2E9XC 4IL4A 3JCFA 3ZT5A 5IYZE 5HEUA 4PK4A 4TX5A 3QB5K 4DV3T 5HEJA 4LFCT 4DVDA 4CQIA 3EDVA 3OVUA 2KWHA 4QX7B 2CXLA 4UV8B 2V5CA 4CI2B 4PW8A 3KINB 3HKBE 3AXJA 4WW0A 3QK6A 2WS3A 2VK9A 3H3MA 4IDOA 4LF7T 2V7IA 1UX5A 4U72A 2Q9QD 3RQWA 3ZLIA 3CMLA 4HN9A 4JI5T 4HFVA 4F6RC 3JADA 2PTFA 3FXEB 2JMKA 1J1JA 2H88A 3JAFA 2WDQA 5EK3A 5L3BB 2M6BA 1MMGA 2W2UA 2V7JA 3QC9A 1JNRA 1UX4A 1WCRA 2HN2A 4X64T 3H37A 2Y6XA 4HWIB 3ZYKA 3GMIA 4KX6A 3PJAJ 4JEUB 4HFIA 4JV5T 2MAWA 4UVCB 4QXHB 4ZXLA 3LBXA 2ES0A 4JI8T 2CXDA 3SRZA 4EZHA 5LYJE 4ZI3D 2A3DA 3U78A 4PJLA 3K3NA 4YY3T 4ANJA 2PBIA 4HFHA 3OTOT 5EZYE 3AE5A 2YU1A 4HWFA 4HFEA 3HKDE 3ZN1B 2BBHA 3PU3A 4KHPT 3LK3B 5HXCA 3OPCA 3VR8A 4Z91A 4UF0B 4AXPA 1T8BA 2OV9A 4DMVA 1OEDC 4PFOA 5KX5E 4TWHA 1R8IA 1KF6A 2WB5A 3PU8A 4HFDA 1O3XA 3WAJA 4DR2T 2XQAA 5HCJA 5LGUB 1FEWA 3EHZA 2CWOA 2DL1A 2NP9A 4WYVA 3AEGA 5L3FB 1FJGT 1IBMT 4QHOA 5JRCB 2Q9QB 2V6XA 2ODVA 3T1YT 3HKEE 2N1GA 2QGSA 5HXHA 4EEBA 3PDYA 3ZKRA 2GK9A 2E8IA 5FKYA 4ILAA 2JQHA 3NRXA 2CXFA 4YHJA 5HXRA 2QRXA 4IE4A 5LB7B 2JIWA 2ZLYA 3IHRA 3CQGB 3IF8B 4LF9T 1QSDA 2VKDA 2VVSA 4QH4A 2N9DA 3IA3A 3UTKA 1U5PA 3J9X1 2WAUA 3CK6A 3ZJ2A 3T1HT 4PJNA 3LG7A 1HF8A 2IC6A 4QH5A 1QUUA 1VOMA 1T72A 1HG5A 2ZM6T 3AE6A 4I50E 5C8YE 1LKXA 1WLXA 2LSGA 4B3MT 3G06A 1HTJF 3PUVF 3LK2B 2A9UA 2CLYB 2UUCT 1OEDB 2WSSV 3SS1A 2DI4A 2BKNA 3C4WA 4QH1A 2UU9T 4HFBA 5CGMA 1IZNB 1YXRA 2V7KA 1D0XA 4CXWA 4MALA 2EHOD 2J1DG 3PUWF 5H6RB 1V9DA 3KV5A 1WFDA 5KMGP 5FVLA 4H63V 2YDSA 2YN6A 2MYSA 2X51A 5CA0E 3EAMA 1BR4A 4ZZCA 2D0TA 2ZMAA 4QX8B 3PUZF 2V7MA 2RPAA 2PJQA 3O4XE 4TWDA 5AQUB 1LVKA 4O4IE 4OYKA 2VL0A 2E2AA 2LSYA 4FI5A 2QA7A 5LA6E 3AVSA 1D0ZA 3P4QA 2IMLA 4H9OC 3K3QC 3RH3A 4GKJT 1IBLT 2UXXB 2FJEA 3UUBA 4AIUA 3OYXA 2WDVA 4OYJA 3PUGA 3X1DA 5FXZA 3KV4A 2JMHA 2J47A 4NXNT 4IDQA 4QXBB 2BKOA 1DU2A 5L3GB 4DR7T 1WR6A 4IDZA 2LRKA 3Q5EA 4TV9E 2DWGA 5LHGB 2LOPA 4LFBT 1D1AA 2WWVA 2HPLA 2KNDA 3TLWA 5LP6E 1FIOA 3I1AA 1T7SA 3RC8A 4TV8E 3RHWA 3VRAA 4K0UA 1VCTA 5ABFA 3IEEA 4IGUA 3UU4A 5AQVB 4OHFA 1MMNA 4A5XA 5EK4A 2XM1A 3ONLC 3RKGA 3CX7B 3B5MA 3N2GE 2D2SA 3NWIA 4ZS3A 4DR6T 3PUAA 4JI0T 4E7ZA 2B1EA 1XZYA 3DTOA 3ZCJA 3RIUA 2Y48B 1WRDA 3RPUA 2YU2A 4ZZBA 4GYSA 3MK7C 1N36T 3AA0B 2XQ7A 4DR4T 3HI2A 3ANWB 4ZI2C 2CCQA 4HEAA 3PUQA 3ZYLA 4FJOA 2X67A 1YQ3A 4OFZA 2JRKA 4CXYA 4DV2T 3TLSA 5TAOA 3ZN0B 2DLRA 4L9IA 5JDLA 2V7LA 3HKCE 2IW5B 5J1GA 4AISA 5HWXA 2NR4A 5FXXA 4EEDA 2A2FX 2R6GF 4DIDB 2W61A 4JI2T 3AEAA 4AQFC 3L8RA 1M7KA 3VKHA 2D9DA 2CHNA 1U4QA 3C50A 1NWMX 4DUZT 4YSYA 1GQEA 3TLUA 4EIWA 5FL1A 3NKZA 3AEDA 4GK0E 4IDNA 1BR1A 4TN7B 1W09A 4L0RA 3KFWX 4DR5T 2VB6A 2KXPB 3ZT6A 2CBIA 3N9NA 5AQIB 2Y8DA 3B57A 3T8OA 5DQWA 4JI7T 3VU7H 3CQCB 4ZEYA 3GWHA 4PK6A 2XPKA 4B3ST 3EI0A 1G8XA 5H6QB 2XQ3A 2W66A 5LG3A 2JQKA 2L9QA 3VR9A 4NIQA 3ZJ1A 4LF8T 3A7MA 4G63A 2LSKA 4UVBB 2V5DA 5LBMA 3AECA 2BG9C 3ZMSB 4X1IE 2Q9QC 4TNWA 4LMKA 1KK7A 2CHOA 3KVBA 3NZPA 5AFUL 4U31A 3UULA 2NOXA 4JEHB 4IE5A 5HAXA 3R84B 2PFVA 5LMUT 4ERRA 2MBGA 5JH7E 2HN1A 3MACA 2UUAT 4CXXA 2BBJA 1Y64B 3HA4A 4CI3B 2NW7A 1LVFA 4H9SE 1HNXT 4KI0F 4P0AA 2K9AA 1ZHCA 2XM2A 4DO0A 5LG4A 2WWUA 4UXNB 1LRZA 4LMLA 2CBJA 2C5IT 2H7OA 2V26A 4ZI3C 3SFEA 4EV6A 4GK5E 3CWZB 4X5TA 3D0TA 2FBWA 4U2ZA 1XMOT 4MHCA 4JI3T 4IIJE 1ZKEA 2HH7A 3UU5A 2WMOA 4PNIA 2BVLA 5J2UE 3ZMVB 2AE9A 4U2YA 1HX8A 3ESLA 2X9HA 3ZMTB 2LSJA 2LHRA 2M67A 5JDHA 2OLTA 3N5LA 3HR0A 2CLYC 2YDQA 3ONXA 3ZPOA 2VQFT 3KBTA 2XSAA 4HE8A 4HTEA 2UUBT 2IC9A 3NBXX 2BS2A 2VKOA 2W67A 1MIYA 2WY2A 3Q9DA 2KWIB 2V8SV 4AQYT 3TKLB 1ZOYA 4UF0A 5AQFB 2IIUA 2WCAA 4O4HE 2E9XA 1Y01A 2BG9B 1W9RA 3EUHA 4XBFB 4CI1B 5LJNA 2UXBT 2XSBA 3V5SA 5L3EB 1G73A 3VKGA 3UUNA 2XTLA 2PG8A 3QB5A 2G0UA 4A97A 1HS7A 4BA9A 2LKGA 3ZSTA 3P7IA 3F57A 1KNPA 5LHIB 4AKLA 4DUYT 4X65T 5JRCA 4I55E 3SFDA 5HWYA 5DJQC 4PK5A 5GONE 3P4WA 3I0QA 3AE2A 1HR0T 1VCSA 4TWFA 1MIVA 4UV9B 1WR0A 5ADXL 2DHRA 3FXDB 4EZ4A 5EK2A 4IHJE 2BS3A 4BAYB 4AI6A 3GN5B 4KBMB 5F8PA 1E2AA 2X66A 1EZ3A 1SUMB 4OK0A 5ETWA 1QLBA 2W63A 3C51A 3KVAA 3BQKA 3SOLA 3CX6B 1H7CA 1N34T 4WNKA 3ETUA 4TZ4C 2JQQA 3P4SA 4UVAB 4IT4A 2EHOC 4HWCA 5AQQB 1MIWA 2P9BA 1IJ6A 3RYCE 4B3TT 3OYZA 4CZZB 4A98A 5AQLB 5AQHB 3I9WA 5DQVA 2HHHT 3QOFA 4WBNE 3F2EA 2WZHA 4HGAA 4H9NC 2H89A 3GA8A 2L8KA 4O8SA 2K24A 1D1CA 1OEDA 4K0KT 3N9PA 3UFEA 5JDMA 3O1JA 3Q5DA 2X68A 3N2KE 1CHUA 4U7YA 2C5KT 2H3RA 4YHHT 3AE4A 5F5WA 2X0HA 3CIRA 2DCFA 4PAGA 1MNEA 4I0UA 1WYCA 4EOZB 4DV7T 2WBLA 2XAJB 4DV0T 2L3LA 3FZMB 3MKDA 1N32T 5FNVE 4EAHA 3ZSSA 3FBLA 2KMFA 5KDMC 4GOUA 2LE8A 3AAAB 3PTRB 1W0BA 2V1DB 5LGNB 3JAEA 2YDRA 2D5UA 4U33A 1XNRT 1OXZA 3KV6A 3ZCIA 4OX9T 2Z6EA 3Q5XA 3A8YC 3NRYA 5JR9C 2YINA 4ZI7E 5FY7A 3PUXF 2VL8A 1BR0A 4EYUA 5LJMA 5F3JA 2XQ4A 2CPTA 2LLYA 2WU2A 5HYAA 5ABHA 1XWMA 5HCMA 2JQ9A 1X9BA 1E1HB 1CUNA 4O2BE 3U3IA 4NUVA 3AB3B 3FBZA 4EB6E 2F4VT 1NENA 2EHOB 5AQOB 3J7Yq 3Q2MA 2V6YB 1SA0E 4MLKA 1D0YA 3JC6D 4B3RT 1E7PA 1UGOA 3M65A 4AKHA 4H9PC 2XJ7A 4O2AE 2CWYA 4O4LE 3E22E 2LM9A 3TLVA 5IWAT 3MJXA 2I59A 5AQNB 4YJ3E 2YK0A 1HX1B 3HL6A 1D1BA 3RGLA 3LK42 3AVRA 3LDQB 2XQ6A 3UUXB 1HNWT 4ILUA 1J5WA 4I4TE 5HEHA 3C64A 1ZV4X 3OBVE 2KT9A 4DNDA 1OEDE 4X1KE 3PUSA 3ANWA 5JVDE 5LCYA 3ABVA 3L09A 5FL0A 1Z0PA 3Q5WA 1I94T 1L0VA 2K3WA 3WI3A 1S94A 1XDOA 1Z8UA 4HWHA 2NTYA 3I0OA 4EYYR 2C0SA 4M1PA 3RYHE 4UR9A 3SWHA 1T98A 2E5VA 2IAKA 4E7SA 3EABA 1KNZA 3C98B 2W0GA 2XUEA 4YSXA 3RI5A 3RIFA 5JR9B 1IAPA 3ZMUB 3P4PA 4AKRB 5LBQB 5JTGA 2W00A 5LOVE 1UUSA 2ZM2A 4ASKA 1ZEEA 3AA6B 5C2TA 4BJMA 4KMCA 2VWAA 3L3PA 4IE7A 4EGWA 2WQYA 4V1Av 4UELA 4ZHQE 2ACZA 3PE0A 4HWDA 2SPCA 3A5XA 3UT5E 2X9XA 1AJ3A 2YOEA 5E0OA 4P1NA 3DP7A 3VRBA 4KUMB 5LGTB 3K8PC 2LM2A 2FUPA 1HFAA 4H9RC 3RIAA 4BJNA 4NPPA 3UU3A 1UCUA 5CFBA 3QNUA 3S4UA 2UXNB 4YLHA 1YKEB 3F31A 2OA5A 2HPJA 3AXJB 3ETVA 3UU8A 3RKOA 4C91A 2AXDS 4TNVA 4PJMA 3AE7A 4J2CA 3UUMA 2E9XD 2BDEA 4MBQA 5IUXA 3E08A 3UQ7A 3RLFF 3BQIA 4JYAT 3N9LA 5FP3A 2QYWA 3R6NA 2IDOB 4P0BA 4IE6A 4AQGA 5HXSA 4YSZA 4GIWA 5AQPB 2KLQA 2WU5A 5CB4E 3BK9A 4AQFA 1YW0A 3AEFA 2MTQA 3LBXB 1MNDA 4YT0A 4DBRA 5FMNA 4H63H 3KBUA 2VKHA 5AQGB 3AA1B 2VURA 5FXWA 2ACXA 2KZ7B 3IBPA 5BR8T 5L3DB 1ZP0A 5LNKA 1MMDA 2WMNA 4JI1T 2W62A 4HKAA 5CJ5A 3NVOA 4GKKT 2KSRA 4CN6A 2JJ9A 3FZLB 5LMNT 1IBKT 5JREA 3MXZA 3ZYMA 1FMWA 2XAFB 4B6XA 4X66T 3EVYA 3RYFE 2H7VC 2LKHA 1YD8G 2DWKA 2E9XB 4NXMT 1N33T 1YKHB 1FMVA 4QXCB 3RYIE 2WP9A 3CKDA 4U3CA 2LOSA 3CPZA 5J2TE 2WM9A 3RC3A 4F8HA 5CA1E 4O4JE 1HNZT 2NW9A 4DR3T 4YJ2E 2BG9A 2Q9QA 3RRCA 2UXCT 5FY1A 2N2NA 2E5LT 3CX8B 4A56A 2XQ5A 3AE1A 5A1LA 4N78D 4KHZF 4QWNB 2WDRA 3AA7B 2M6IA 4AKGA 4PJJA 5FYMA 3MA9A 5FXVA 4ISTA 3C4ZA 1NAFA 2BZBA 5HEGA 4ILCA 1HCIA 4DV6T 4X20E 3RQUA 2XZEA 4JI4T 5JQGE 5AQTB 2W4XA 3CQXC 4YXDA 3I9YA 3GN5A 4YFSA 5LHHB 2LRLA 1M62A 2BS4A 2C5JA 4DV1T 5KXJA 1VRBA 2VASA 4JI6T 2WZIA 4YTNA 2YKSA 4AKIA 4LF4T 3FZHB 5J0ZA 3K1SA 2ODUA 2XQYA 2J4GA 4EXTA 2QVAA 3FZKB 1NEKA 2IHR1 3WAKA 4PFPA 3MZKB 3N9QA 2LHNA 4CN4A 2XQ8A 3RIUC 3FB2A 5JDNA 2CRBA 2IUBA 1YQ4A 2RP4A 1SHZC 2ZM8A 4JBWF 3FZFB 2XHEB 4Q25A 5FVKA 4LF6T 3O9XA 5L4EA 3M3ZB 5JDQA 2LT3A 3AE9A 2MOZA 5ABGA 3DJBA 3ZC1A 3PV0F 1KEYA 3AE3A 2MPKA 2NW8A 3ONJA 3BQLA 2CEAA 2JPFA 5LXTE 2VQET 4XAXB 1BR2A 3AAIA 4NUUA 4G2AA 1XDPA 3E0ZA 4DBQA 5AQRB 3NZQA 3P8CD 3N2OA 4DR1T 3W15B 2LJLA 4JUYA 3UFGA 2BG9E 5DABA 4C90A 4UEMA 2CE7A 4GYRA 1UK5A 2A72A 3P50A 4DV4T 2B76A 1B7TA 4ADZA 4IL9A 3O1HA 3L39A 4ZS2A 5AQMB 5FY0A 4DMWA 1JNZA 5ABFB 3JC6C 5AQSB 1S35A 3AEEA 4TUYE 3PJAA 4COFA 4HFCA 5JDFA 2FJBA 5BMVE 4YTMA 5L4HA 5IHYA 3AE8A 3H3AA 2LSIA 3UQ4A 2CMRA 2CA5A 3KDSE 5M4YA 4WZXA 4UIGA 2X9YA 3PURA 3ZC0A 2XASB 3C4XA 2XAGB 4LMJA 4P09A 3ZEFB 5JDGA 2EHOA 3K3OA 5ABEA 3ZT7A 2LEHA 3RRWA 2V6YA 2VVNA 2DNXA 1SE7A 3EDUA 4LFAT 5HXEA 3LJCA 3LSVA 3PUYF 2XAQB 3ZMZB 2UXDT 1UURA 2X0LB 4IREA 1KFYA 2CM0A 4DV5T 4JLEA 5L47A 4X62T 1IJ5A 3AAEB 2NTXA 2I6HA 4WBOA
chains in the Genus database with same CATH topology
5LHIB 4AKLA 5L3CB 4FI5A 2QA7A 3E08A 5LA6E 3AVSA 3O1IA 2BVMA 2K5BB 4XZCA 5JRCA 1D0ZA 1US7B 2X9WA 4H9OC 3K3QC 4I55E 3FHNA 5HWYA 4L5GA 2RA1A 3BQIA 2YEVC 3RH3A 3N9LA 5FP3A 3N9OA 5DJQC 2VKJA 2UXXB 4PK5A 3B13A 3R6NA 5GONE 4I43B 3OYXA 3I0QA 3VHLA 4P0BA 4ZI2D 4IE6A 4AQGA 1MIVA 4Z8XA 5HXSA 4OYJA 4X1YE 4GIWA 4UV9B 3PUGA 5ADXL 2DHRA 5FXZA 2KLQA 3FXDB 3KV4A 4EZ4A 5EK2A 4IHJE 2JMHA 4BAYB 2XAHB 2NWBA 4QKNA 3GN5B 4AI6A 4QXBB 5L3GB 4H9QC 5CB4E 5AFUL 1WR6A 4IDZA 4TV9E 4KBMB 2DWGA 5LHGB 3BK9A 4ISSA 5F8PA 4AQFA 2LOPA 4U74A 2X66A 1YW0A 1EZ3A 2MTQA 4OK0A 3LBXB 5ETWA 2W63A 1WYBA 1MNDA 3C51A 3KVAA 4IE0A 1D1AA 2HPLA 4DBRA 3BQKA 5FMNA 2KNDA 4H63H 3KBUA 2VKHA 5LP6E 3RX6A 2D0UA 1FIOA 3AA1B 3I1AA 3SOLA 3CX6B 2ZM0A 3RC8A 4TV8E 5FXWA 5JR9A 1H7CA 2ACXA 2KZ7B 3IBPA 1OWAA 5L3DB 4ZOLE 2KINB 3QUJA 4WNKA 5LNKA 3ETUA 4K0UA 4TZ4C 3OJAA 3IEEA 1MMDA 2JQQA 2WMNA 4IGUA 4UVAB 2W62A 4HKAA 2EHOC 4MFRA 4OHFA 1X79A 1MMNA 2JJ9A 1MIWA 2K48A 2P9BA 1IJ6A 3RYCE 5L2LA 3OKQA 3KV9A 5EK4A 3OYZA 4CZZB 3LFMA 3I9WA 5DQVA 4WBNE 5JREA 3F2EA 3MXZA 3ZYMA 4HGAA 3V5UA 3CX7B 3N2GE 2D2SA 1FMWA 1HG2A 4H9NC 2XAFB 3GA8A 2L8KA 4KP3C 4O8SA 1MMAA 4B6XA 4ZS3A 2K24A 3N9MA 3PUAA 3CVRA 3EVYA 3RYFE 4E7ZA 2E9XC 2B1EA 3DTOA 2H7VC 1D1CA 3ZCJA 1YD8G 2DWKA 2E9XB 5IYZE 2Y48B 4PK4A 3N9PA 3UFEA 1YKHB 1FMVA 4QXCB 4TX5A 3RYIE 1WRDA 5JDMA 3RPUA 2YU2A 4GYSA 3MK7C 3O1JA 4DVDA 2X68A 4CQIA 3EDVA 3CKDA 2KWHA 4QX7B 2CXLA 2LOSA 3N2KE 3CPZA 4UV8B 4CI2B 3AA0B 4PW8A 3KINB 3HKBE 3HI2A 5J2TE 2C5KT 3ANWB 2H3RA 2WM9A 3RC3A 4ZI2C 5CA1E 4O4JE 2CCQA 4HEAA 4WW0A 2NW9A 3QK6A 4YJ2E 3PUQA 2DCFA 2Q9QA 1MNEA 2VK9A 4FJOA 4PAGA 3RRCA 3ZYLA 5FY1A 2X67A 1WYCA 2N2NA 4EOZB 3CX8B 4A56A 4OFZA 2JRKA 4CXYA 2V7IA 5A1LA 4N78D 1UX5A 4QWNB 2WBLA 3AA7B 4U72A 5TAOA 2XAJB 2Q9QD 4AKGA 3ZN0B 2DLRA 4L9IA 5JDLA 4PJJA 5FYMA 2V7LA 3HKCE 3ZLIA 2IW5B 2L3LA 5J1GA 3CMLA 3MA9A 4HN9A 5FXVA 4ISTA 3C4ZA 3MKDA 1NAFA 2BZBA 5FNVE 4EAHA 5HWXA 4HFVA 5FXXA 3FBLA 4F6RC 2A2FX 3FXEB 2KMFA 2W61A 2JMKA 5KDMC 4AQFC 1HCIA 4GOUA 4X20E 2LE8A 3AAAB 3PTRB 2V1DB 5LGNB 3VKHA 5EK3A 5JQGE 5L3BB 1U4QA 3C50A 1NWMX 1MMGA 2D5UA 2V7JA 1OXZA 3KV6A 3QC9A 3ZCIA 2Z6EA 3CQXC 3Q5XA 1UX4A 3I9YA 3NRYA 4EIWA 5JR9C 2YINA 3GN5A 3H37A 4YFSA 4ZI7E 5FY7A 5LHHB 2Y6XA 2VL8A 1BR0A 4EYUA 5LJMA 5F3JA 2C5JA 3ZYKA 3GMIA 4JEUB 5HYAA 4GK0E 1BR1A 4UVCB 4QXHB 3LBXA 4TN7B 1VRBA 2VASA 2ES0A 4L0RA 1E1HB 1CUNA 4AKIA 3KFWX 2CXDA 3SRZA 4EZHA 4O2BE 3U3IA 2VB6A 4NUVA 5LYJE 3AB3B 4ZI3D 2A3DA 3FBZA 3U78A 4EB6E 2KXPB 4PJLA 2EHOB 3K3NA 3J7Yq 3Q2MA 2ODUA 4ANJA 2XQYA 3N9NA 2PBIA 5EZYE 2Y8DA 4EXTA 2YU1A 1SA0E 3B57A 3HKDE 1D0YA 3JC6D 4MLKA 3PU3A 3ZN1B 3LK3B 3M65A 3T8OA 3WAKA 5HXCA 4AKHA 5DQWA 4PFPA 4H9PC 3MZKB 4UF0B 3VU7H 3N9QA 4O2AE 3CQCB 2LHNA 3GWHA 4PK6A 4AXPA 2CWYA 3FB2A 4DMVA 4O4LE 3E22E 1G8XA 4PFOA 5H6QB 2LM9A 5JDNA 5KX5E 3MJXA 2I59A 3PU8A 1O3XA 2RP4A 1SHZC 2YK0A 4YJ3E 2L9QA 3WAJA 3ZJ1A 2ZM8A 3HL6A 1D1BA 2XHEB 5LGUB 3LK42 3O9XA 3AVRA 4G63A 1FEWA 2LSKA 4UVBB 5LBMA 3UUXB 2CWOA 2NP9A 5JDQA 3ZMSB 4X1IE 2LT3A 2Q9QC 5L3FB 4ILUA 4QHOA 2MOZA 5JRCB 3DJBA 2Q9QB 1KK7A 4I4TE 2ODVA 3KVBA 3C64A 1ZV4X 3NZPA 3HKEE 2N1GA 3OBVE 2KT9A 2QGSA 3ZC1A 3UULA 5HXHA 4DNDA 2NOXA 3PDYA 4JEHB 4IE5A 5HAXA 3R84B 2PFVA 2NW8A 4ERRA 3BQLA 2GK9A 2CEAA 4X1KE 2MBGA 2JPFA 5JH7E 5LXTE 4XAXB 1BR2A 3MACA 3AAIA 2E8IA 3PUSA 4NUUA 3ANWA 4CXXA 1Y64B 3HA4A 4CI3B 2NW7A 4G2AA 5JVDE 3E0ZA 5LCYA 4DBQA 1LVFA 4H9SE 3NRXA 3L09A 4P0AA 1Z0PA 3Q5WA 2CXFA 3NZQA 3P8CD 4YHJA 2K9AA 3N2OA 3WI3A 1ZHCA 4DO0A 1S94A 5HXRA 3W15B 2LJLA 2NTYA 4IE4A 4JUYA 3I0OA 5LG4A 4EYYR 2WWUA 2C0SA 2ZLYA 4M1PA 3IHRA 3RYHE 3CQGB 3SWHA 5DABA 4C90A 4UEMA 1T98A 3IF8B 4UXNB 2CE7A 4GYRA 1LRZA 2IAKA 2H7OA 2C5IT 1QSDA 4E7SA 1KNZA 3C98B 2W0GA 2A72A 2VKDA 2XUEA 2V26A 1B7TA 4ZI3C 2N9DA 4ADZA 4GK5E 3CWZB 3D0TA 5JR9B 3O1HA 3UTKA 1U5PA 1IAPA 4ZS2A 5FY0A 4DMWA 3ZMUB 4AKRB 3J9X1 3JC6C 3P7IA 5LBQB 2WAUA 3ZJ2A 2W00A 1S35A 5LOVE 4MHCA 3LG7A 4PJNA 1HF8A 4IIJE 2ZM2A 4ASKA 1ZEEA 1ZKEA 2IC6A 3AA6B 4TUYE 4BJMA 2HH7A 4KMCA 2WMOA 2VWAA 5JDFA 5BMVE 4PNIA 1QUUA 3L3PA 4IE7A 1VOMA 5IHYA 2BVLA 5J2UE 1HG5A 3H3AA 2LSIA 3ZMVB 4V1Av 4I50E 1HX8A 2CMRA 3ESLA 2X9HA 2CA5A 3KDSE 3ZMTB 2LSJA 5C8YE 5M4YA 4UELA 4ZHQE 1LKXA 2LHRA 2M67A 1WLXA 2LSGA 4UIGA 5JDHA 2X9YA 1HTJF 3PURA 3N5LA 3PE0A 3HR0A 3ZC0A 2CLYC 3C4XA 2XASB 2SPCA 2XAGB 3A5XA 4P09A 3LK2B 3UT5E 2X9XA 3ONXA 2CLYB 3ZPOA 1AJ3A 3ZEFB 5E0OA 5JDGA 2EHOA 3K3OA 3DP7A 3KBTA 4HE8A 4HTEA 5LGTB 4KUMB 2LEHA 2WSSV 3K8PC 3C4WA 2DI4A 2IC9A 3NBXX 3RRWA 3SS1A 2VKOA 1HFAA 4H9RC 2DNXA 1MIYA 1IZNB 2V7KA 3Q9DA 4BJNA 1D0XA 3EDUA 4CXWA 2KWIB 4MALA 2EHOD 1UCUA 3TKLB 2J1DG 3S4UA 2UXNB 4YLHA 5H6RB 5HXEA 4UF0A 3LJCA 1V9DA 1YKEB 3F31A 2OA5A 3KV5A 2HPJA 5KMGP 2XAQB 3ZMZB 4H63V 3ETVA 4O4HE 2E9XA 2MYSA 2X51A 5CA0E 1BR4A 3RKOA 4C91A 2D0TA 2ZMAA 3EUHA 2X0LB 4QX8B 4XBFB 4CI1B 5LJNA 2V7MA 3V5SA 5L3EB 1G73A 3VKGA 3UUNA 2PJQA 4PJMA 2CM0A 3O4XE 4JLEA 2XTLA 2PG8A 4J2CA 1LVKA 1IJ5A 2G0UA 2E9XD 3UUMA 2BDEA 3AAEB 2NTXA 4O4IE 1HS7A 4MBQA 4OYKA 4BA9A 4WBOA 2LSYA 3F57A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MBQ A;  4MAL A; 
#chains in the Genus database with same CATH topology
 2XQ9 A;  5L3C B;  3O1I A;  2FJA A;  1KNR A;  2BVM A;  2K5B B;  4XZC A;  1US7 B;  2X9W A;  2J62 A;  3FHN A;  4L5G A;  2RA1 A;  2YEV C;  4ILB A;  3N9O A;  2VKJ A;  3B13 A;  5AQK B;  4I43 B;  4U7I A;  3VHL A;  4ZI2 D;  4Z8X A;  5HEO A;  1W0A A;  4X1Y E;  2BKP A;  2XAH B;  2NWB A;  4QKN A;  5AQJ B;  4H9Q C;  3P4R A;  2FJD A;  3RF1 A;  4ISS A;  4U74 A;  4CN1 A;  1WYB A;  4IE0 A;  5C3J A;  4YTP A;  3RX6 A;  2D0U A;  2X0Y A;  2ZM0 A;  5JR9 A;  1OWA A;  4IDP A;  4ZOL E;  2KIN B;  3QUJ A;  1J5E T;  2XY8 B;  1XMQ T;  3OJA A;  1I6Z A;  4MFR A;  1X79 A;  2K48 A;  5L2L A;  3OKQ A;  3KV9 A;  3AEB A;  3LFM A;  4Z90 A;  3V5U A;  2I0M A;  4KP3 C;  4LF5 T;  1HG2 A;  3TLT A;  1MMA A;  1XNQ T;  3N9M A;  3CVR A;  3UU6 A;  2E9X C;  4IL4 A;  3JCF A;  3ZT5 A;  5IYZ E;  5HEU A;  4PK4 A;  4TX5 A;  3QB5 K;  4DV3 T;  5HEJ A;  4LFC T;  4DVD A;  4CQI A;  3EDV A;  3OVU A;  2KWH A;  4QX7 B;  2CXL A;  4UV8 B;  2V5C A;  4CI2 B;  4PW8 A;  3KIN B;  3HKB E;  3AXJ A;  4WW0 A;  3QK6 A;  2WS3 A;  2VK9 A;  3H3M A;  4IDO A;  4LF7 T;  2V7I A;  1UX5 A;  4U72 A;  2Q9Q D;  3RQW A;  3ZLI A;  3CML A;  4HN9 A;  4JI5 T;  4HFV A;  4F6R C;  3JAD A;  2PTF A;  3FXE B;  2JMK A;  1J1J A;  2H88 A;  3JAF A;  2WDQ A;  5EK3 A;  5L3B B;  2M6B A;  1MMG A;  2W2U A;  2V7J A;  3QC9 A;  1JNR A;  1UX4 A;  1WCR A;  2HN2 A;  4X64 T;  3H37 A;  2Y6X A;  4HWI B;  3ZYK A;  3GMI A;  4KX6 A;  3PJA J;  4JEU B;  4HFI A;  4JV5 T;  2MAW A;  4UVC B;  4QXH B;  4ZXL A;  3LBX A;  2ES0 A;  4JI8 T;  2CXD A;  3SRZ A;  4EZH A;  5LYJ E;  4ZI3 D;  2A3D A;  3U78 A;  4PJL A;  3K3N A;  4YY3 T;  4ANJ A;  2PBI A;  4HFH A;  3OTO T;  5EZY E;  3AE5 A;  2YU1 A;  4HWF A;  4HFE A;  3HKD E;  3ZN1 B;  2BBH A;  3PU3 A;  4KHP T;  3LK3 B;  5HXC A;  3OPC A;  3VR8 A;  4Z91 A;  4UF0 B;  4AXP A;  1T8B A;  2OV9 A;  4DMV A;  1OED C;  4PFO A;  5KX5 E;  4TWH A;  1R8I A;  1KF6 A;  2WB5 A;  3PU8 A;  4HFD A;  1O3X A;  3WAJ A;  4DR2 T;  2XQA A;  5HCJ A;  5LGU B;  1FEW A;  3EHZ A;  2CWO A;  2DL1 A;  2NP9 A;  4WYV A;  3AEG A;  5L3F B;  1FJG T;  1IBM T;  4QHO A;  5JRC B;  2Q9Q B;  2V6X A;  2ODV A;  3T1Y T;  3HKE E;  2N1G A;  2QGS A;  5HXH A;  4EEB A;  3PDY A;  3ZKR A;  2GK9 A;  2E8I A;  5FKY A;  4ILA A;  2JQH A;  3NRX A;  2CXF A;  4YHJ A;  5HXR A;  2QRX A;  4IE4 A;  5LB7 B;  2JIW A;  2ZLY A;  3IHR A;  3CQG B;  3IF8 B;  4LF9 T;  1QSD A;  2VKD A;  2VVS A;  4QH4 A;  2N9D A;  3IA3 A;  3UTK A;  1U5P A;  3J9X 1;  2WAU A;  3CK6 A;  3ZJ2 A;  3T1H T;  4PJN A;  3LG7 A;  1HF8 A;  2IC6 A;  4QH5 A;  1QUU A;  1VOM A;  1T72 A;  1HG5 A;  2ZM6 T;  3AE6 A;  4I50 E;  5C8Y E;  1LKX A;  1WLX A;  2LSG A;  4B3M T;  3G06 A;  1HTJ F;  3PUV F;  3LK2 B;  2A9U A;  2CLY B;  2UUC T;  1OED B;  2WSS V;  3SS1 A;  2DI4 A;  2BKN A;  3C4W A;  4QH1 A;  2UU9 T;  4HFB A;  5CGM A;  1IZN B;  1YXR A;  2V7K A;  1D0X A;  4CXW A;  4MAL A;  2EHO D;  2J1D G;  3PUW F;  5H6R B;  1V9D A;  3KV5 A;  1WFD A;  5KMG P;  5FVL A;  4H63 V;  2YDS A;  2YN6 A;  2MYS A;  2X51 A;  5CA0 E;  3EAM A;  1BR4 A;  4ZZC A;  2D0T A;  2ZMA A;  4QX8 B;  3PUZ F;  2V7M A;  2RPA A;  2PJQ A;  3O4X E;  4TWD A;  5AQU B;  1LVK A;  4O4I E;  4OYK A;  2VL0 A;  2E2A A;  2LSY A;  4FI5 A;  2QA7 A;  5LA6 E;  3AVS A;  1D0Z A;  3P4Q A;  2IML A;  4H9O C;  3K3Q C;  3RH3 A;  4GKJ T;  1IBL T;  2UXX B;  2FJE A;  3UUB A;  4AIU A;  3OYX A;  2WDV A;  4OYJ A;  3PUG A;  3X1D A;  5FXZ A;  3KV4 A;  2JMH A;  2J47 A;  4NXN T;  4IDQ A;  4QXB B;  2BKO A;  1DU2 A;  5L3G B;  4DR7 T;  1WR6 A;  4IDZ A;  2LRK A;  3Q5E A;  4TV9 E;  2DWG A;  5LHG B;  2LOP A;  4LFB T;  1D1A A;  2WWV A;  2HPL A;  2KND A;  3TLW A;  5LP6 E;  1FIO A;  3I1A A;  1T7S A;  3RC8 A;  4TV8 E;  3RHW A;  3VRA A;  4K0U A;  1VCT A;  5ABF A;  3IEE A;  4IGU A;  3UU4 A;  5AQV B;  4OHF A;  1MMN A;  4A5X A;  5EK4 A;  2XM1 A;  3ONL C;  3RKG A;  3CX7 B;  3B5M A;  3N2G E;  2D2S A;  3NWI A;  4ZS3 A;  4DR6 T;  3PUA A;  4JI0 T;  4E7Z A;  2B1E A;  1XZY A;  3DTO A;  3ZCJ A;  3RIU A;  2Y48 B;  1WRD A;  3RPU A;  2YU2 A;  4ZZB A;  4GYS A;  3MK7 C;  1N36 T;  3AA0 B;  2XQ7 A;  4DR4 T;  3HI2 A;  3ANW B;  4ZI2 C;  2CCQ A;  4HEA A;  3PUQ A;  3ZYL A;  4FJO A;  2X67 A;  1YQ3 A;  4OFZ A;  2JRK A;  4CXY A;  4DV2 T;  3TLS A;  5TAO A;  3ZN0 B;  2DLR A;  4L9I A;  5JDL A;  2V7L A;  3HKC E;  2IW5 B;  5J1G A;  4AIS A;  5HWX A;  2NR4 A;  5FXX A;  4EED A;  2A2F X;  2R6G F;  4DID B;  2W61 A;  4JI2 T;  3AEA A;  4AQF C;  3L8R A;  1M7K A;  3VKH A;  2D9D A;  2CHN A;  1U4Q A;  3C50 A;  1NWM X;  4DUZ T;  4YSY A;  1GQE A;  3TLU A;  4EIW A;  5FL1 A;  3NKZ A;  3AED A;  4GK0 E;  4IDN A;  1BR1 A;  4TN7 B;  1W09 A;  4L0R A;  3KFW X;  4DR5 T;  2VB6 A;  2KXP B;  3ZT6 A;  2CBI A;  3N9N A;  5AQI B;  2Y8D A;  3B57 A;  3T8O A;  5DQW A;  4JI7 T;  3VU7 H;  3CQC B;  4ZEY A;  3GWH A;  4PK6 A;  2XPK A;  4B3S T;  3EI0 A;  1G8X A;  5H6Q B;  2XQ3 A;  2W66 A;  5LG3 A;  2JQK A;  2L9Q A;  3VR9 A;  4NIQ A;  3ZJ1 A;  4LF8 T;  3A7M A;  4G63 A;  2LSK A;  4UVB B;  2V5D A;  5LBM A;  3AEC A;  2BG9 C;  3ZMS B;  4X1I E;  2Q9Q C;  4TNW A;  4LMK A;  1KK7 A;  2CHO A;  3KVB A;  3NZP A;  5AFU L;  4U31 A;  3UUL A;  2NOX A;  4JEH B;  4IE5 A;  5HAX A;  3R84 B;  2PFV A;  5LMU T;  4ERR A;  2MBG A;  5JH7 E;  2HN1 A;  3MAC A;  2UUA T;  4CXX A;  2BBJ A;  1Y64 B;  3HA4 A;  4CI3 B;  2NW7 A;  1LVF A;  4H9S E;  1HNX T;  4KI0 F;  4P0A A;  2K9A A;  1ZHC A;  2XM2 A;  4DO0 A;  5LG4 A;  2WWU A;  4UXN B;  1LRZ A;  4LML A;  2CBJ A;  2C5I T;  2H7O A;  2V26 A;  4ZI3 C;  3SFE A;  4EV6 A;  4GK5 E;  3CWZ B;  4X5T A;  3D0T A;  2FBW A;  4U2Z A;  1XMO T;  4MHC A;  4JI3 T;  4IIJ E;  1ZKE A;  2HH7 A;  3UU5 A;  2WMO A;  4PNI A;  2BVL A;  5J2U E;  3ZMV B;  2AE9 A;  4U2Y A;  1HX8 A;  3ESL A;  2X9H A;  3ZMT B;  2LSJ A;  2LHR A;  2M67 A;  5JDH A;  2OLT A;  3N5L A;  3HR0 A;  2CLY C;  2YDQ A;  3ONX A;  3ZPO A;  2VQF T;  3KBT A;  2XSA A;  4HE8 A;  4HTE A;  2UUB T;  2IC9 A;  3NBX X;  2BS2 A;  2VKO A;  2W67 A;  1MIY A;  2WY2 A;  3Q9D A;  2KWI B;  2V8S V;  4AQY T;  3TKL B;  1ZOY A;  4UF0 A;  5AQF B;  2IIU A;  2WCA A;  4O4H E;  2E9X A;  1Y01 A;  2BG9 B;  1W9R A;  3EUH A;  4XBF B;  4CI1 B;  5LJN A;  2UXB T;  2XSB A;  3V5S A;  5L3E B;  1G73 A;  3VKG A;  3UUN A;  2XTL A;  2PG8 A;  3QB5 A;  2G0U A;  4A97 A;  1HS7 A;  4BA9 A;  2LKG A;  3ZST A;  3P7I A;  3F57 A;  1KNP A;  5LHI B;  4AKL A;  4DUY T;  4X65 T;  5JRC A;  4I55 E;  3SFD A;  5HWY A;  5DJQ C;  4PK5 A;  5GON E;  3P4W A;  3I0Q A;  3AE2 A;  1HR0 T;  1VCS A;  4TWF A;  1MIV A;  4UV9 B;  1WR0 A;  5ADX L;  2DHR A;  3FXD B;  4EZ4 A;  5EK2 A;  4IHJ E;  2BS3 A;  4BAY B;  4AI6 A;  3GN5 B;  4KBM B;  5F8P A;  1E2A A;  2X66 A;  1EZ3 A;  1SUM B;  4OK0 A;  5ETW A;  1QLB A;  2W63 A;  3C51 A;  3KVA A;  3BQK A;  3SOL A;  3CX6 B;  1H7C A;  1N34 T;  4WNK A;  3ETU A;  4TZ4 C;  2JQQ A;  3P4S A;  4UVA B;  4IT4 A;  2EHO C;  4HWC A;  5AQQ B;  1MIW A;  2P9B A;  1IJ6 A;  3RYC E;  4B3T T;  3OYZ A;  4CZZ B;  4A98 A;  5AQL B;  5AQH B;  3I9W A;  5DQV A;  2HHH T;  3QOF A;  4WBN E;  3F2E A;  2WZH A;  4HGA A;  4H9N C;  2H89 A;  3GA8 A;  2L8K A;  4O8S A;  2K24 A;  1D1C A;  1OED A;  4K0K T;  3N9P A;  3UFE A;  5JDM A;  3O1J A;  3Q5D A;  2X68 A;  3N2K E;  1CHU A;  4U7Y A;  2C5K T;  2H3R A;  4YHH T;  3AE4 A;  5F5W A;  2X0H A;  3CIR A;  2DCF A;  4PAG A;  1MNE A;  4I0U A;  1WYC A;  4EOZ B;  4DV7 T;  2WBL A;  2XAJ B;  4DV0 T;  2L3L A;  3FZM B;  3MKD A;  1N32 T;  5FNV E;  4EAH A;  3ZSS A;  3FBL A;  2KMF A;  5KDM C;  4GOU A;  2LE8 A;  3AAA B;  3PTR B;  1W0B A;  2V1D B;  5LGN B;  3JAE A;  2YDR A;  2D5U A;  4U33 A;  1XNR T;  1OXZ A;  3KV6 A;  3ZCI A;  4OX9 T;  2Z6E A;  3Q5X A;  3A8Y C;  3NRY A;  5JR9 C;  2YIN A;  4ZI7 E;  5FY7 A;  3PUX F;  2VL8 A;  1BR0 A;  4EYU A;  5LJM A;  5F3J A;  2XQ4 A;  2CPT A;  2LLY A;  2WU2 A;  5HYA A;  5ABH A;  1XWM A;  5HCM A;  2JQ9 A;  1X9B A;  1E1H B;  1CUN A;  4O2B E;  3U3I A;  4NUV A;  3AB3 B;  3FBZ A;  4EB6 E;  2F4V T;  1NEN A;  2EHO B;  5AQO B;  3J7Y q;  3Q2M A;  2V6Y B;  1SA0 E;  4MLK A;  1D0Y A;  3JC6 D;  4B3R T;  1E7P A;  1UGO A;  3M65 A;  4AKH A;  4H9P C;  2XJ7 A;  4O2A E;  2CWY A;  4O4L E;  3E22 E;  2LM9 A;  3TLV A;  5IWA T;  3MJX A;  2I59 A;  5AQN B;  4YJ3 E;  2YK0 A;  1HX1 B;  3HL6 A;  1D1B A;  3RGL A;  3LK4 2;  3AVR A;  3LDQ B;  2XQ6 A;  3UUX B;  1HNW T;  4ILU A;  1J5W A;  4I4T E;  5HEH A;  3C64 A;  1ZV4 X;  3OBV E;  2KT9 A;  4DND A;  1OED E;  4X1K E;  3PUS A;  3ANW A;  5JVD E;  5LCY A;  3ABV A;  3L09 A;  5FL0 A;  1Z0P A;  3Q5W A;  1I94 T;  1L0V A;  2K3W A;  3WI3 A;  1S94 A;  1XDO A;  1Z8U A;  4HWH A;  2NTY A;  3I0O A;  4EYY R;  2C0S A;  4M1P A;  3RYH E;  4UR9 A;  3SWH A;  1T98 A;  2E5V A;  2IAK A;  4E7S A;  3EAB A;  1KNZ A;  3C98 B;  2W0G A;  2XUE A;  4YSX A;  3RI5 A;  3RIF A;  5JR9 B;  1IAP A;  3ZMU B;  3P4P A;  4AKR B;  5LBQ B;  5JTG A;  2W00 A;  5LOV E;  1UUS A;  2ZM2 A;  4ASK A;  1ZEE A;  3AA6 B;  5C2T A;  4BJM A;  4KMC A;  2VWA A;  3L3P A;  4IE7 A;  4EGW A;  2WQY A;  4V1A v;  4UEL A;  4ZHQ E;  2ACZ A;  3PE0 A;  4HWD A;  2SPC A;  3A5X A;  3UT5 E;  2X9X A;  1AJ3 A;  2YOE A;  5E0O A;  4P1N A;  3DP7 A;  3VRB A;  4KUM B;  5LGT B;  3K8P C;  2LM2 A;  2FUP A;  1HFA A;  4H9R C;  3RIA A;  4BJN A;  4NPP A;  3UU3 A;  1UCU A;  5CFB A;  3QNU A;  3S4U A;  2UXN B;  4YLH A;  1YKE B;  3F31 A;  2OA5 A;  2HPJ A;  3AXJ B;  3ETV A;  3UU8 A;  3RKO A;  4C91 A;  2AXD S;  4TNV A;  4PJM A;  3AE7 A;  4J2C A;  3UUM A;  2E9X D;  2BDE A;  4MBQ A;  5IUX A;  3E08 A;  3UQ7 A;  3RLF F;  3BQI A;  4JYA T;  3N9L A;  5FP3 A;  2QYW A;  3R6N A;  2IDO B;  4P0B A;  4IE6 A;  4AQG A;  5HXS A;  4YSZ A;  4GIW A;  5AQP B;  2KLQ A;  2WU5 A;  5CB4 E;  3BK9 A;  4AQF A;  1YW0 A;  3AEF A;  2MTQ A;  3LBX B;  1MND A;  4YT0 A;  4DBR A;  5FMN A;  4H63 H;  3KBU A;  2VKH A;  5AQG B;  3AA1 B;  2VUR A;  5FXW A;  2ACX A;  2KZ7 B;  3IBP A;  5BR8 T;  5L3D B;  1ZP0 A;  5LNK A;  1MMD A;  2WMN A;  4JI1 T;  2W62 A;  4HKA A;  5CJ5 A;  3NVO A;  4GKK T;  2KSR A;  4CN6 A;  2JJ9 A;  3FZL B;  5LMN T;  1IBK T;  5JRE A;  3MXZ A;  3ZYM A;  1FMW A;  2XAF B;  4B6X A;  4X66 T;  3EVY A;  3RYF E;  2H7V C;  2LKH A;  1YD8 G;  2DWK A;  2E9X B;  4NXM T;  1N33 T;  1YKH B;  1FMV A;  4QXC B;  3RYI E;  2WP9 A;  3CKD A;  4U3C A;  2LOS A;  3CPZ A;  5J2T E;  2WM9 A;  3RC3 A;  4F8H A;  5CA1 E;  4O4J E;  1HNZ T;  2NW9 A;  4DR3 T;  4YJ2 E;  2BG9 A;  2Q9Q A;  3RRC A;  2UXC T;  5FY1 A;  2N2N A;  2E5L T;  3CX8 B;  4A56 A;  2XQ5 A;  3AE1 A;  5A1L A;  4N78 D;  4KHZ F;  4QWN B;  2WDR A;  3AA7 B;  2M6I A;  4AKG A;  4PJJ A;  5FYM A;  3MA9 A;  5FXV A;  4IST A;  3C4Z A;  1NAF A;  2BZB A;  5HEG A;  4ILC A;  1HCI A;  4DV6 T;  4X20 E;  3RQU A;  2XZE A;  4JI4 T;  5JQG E;  5AQT B;  2W4X A;  3CQX C;  4YXD A;  3I9Y A;  3GN5 A;  4YFS A;  5LHH B;  2LRL A;  1M62 A;  2BS4 A;  2C5J A;  4DV1 T;  5KXJ A;  1VRB A;  2VAS A;  4JI6 T;  2WZI A;  4YTN A;  2YKS A;  4AKI A;  4LF4 T;  3FZH B;  5J0Z A;  3K1S A;  2ODU A;  2XQY A;  2J4G A;  4EXT A;  2QVA A;  3FZK B;  1NEK A;  2IHR 1;  3WAK A;  4PFP A;  3MZK B;  3N9Q A;  2LHN A;  4CN4 A;  2XQ8 A;  3RIU C;  3FB2 A;  5JDN A;  2CRB A;  2IUB A;  1YQ4 A;  2RP4 A;  1SHZ C;  2ZM8 A;  4JBW F;  3FZF B;  2XHE B;  4Q25 A;  5FVK A;  4LF6 T;  3O9X A;  5L4E A;  3M3Z B;  5JDQ A;  2LT3 A;  3AE9 A;  2MOZ A;  5ABG A;  3DJB A;  3ZC1 A;  3PV0 F;  1KEY A;  3AE3 A;  2MPK A;  2NW8 A;  3ONJ A;  3BQL A;  2CEA A;  2JPF A;  5LXT E;  2VQE T;  4XAX B;  1BR2 A;  3AAI A;  4NUU A;  4G2A A;  1XDP A;  3E0Z A;  4DBQ A;  5AQR B;  3NZQ A;  3P8C D;  3N2O A;  4DR1 T;  3W15 B;  2LJL A;  4JUY A;  3UFG A;  2BG9 E;  5DAB A;  4C90 A;  4UEM A;  2CE7 A;  4GYR A;  1UK5 A;  2A72 A;  3P50 A;  4DV4 T;  2B76 A;  1B7T A;  4ADZ A;  4IL9 A;  3O1H A;  3L39 A;  4ZS2 A;  5AQM B;  5FY0 A;  4DMW A;  1JNZ A;  5ABF B;  3JC6 C;  5AQS B;  1S35 A;  3AEE A;  4TUY E;  3PJA A;  4COF A;  4HFC A;  5JDF A;  2FJB A;  5BMV E;  4YTM A;  5L4H A;  5IHY A;  3AE8 A;  3H3A A;  2LSI A;  3UQ4 A;  2CMR A;  2CA5 A;  3KDS E;  5M4Y A;  4WZX A;  4UIG A;  2X9Y A;  3PUR A;  3ZC0 A;  2XAS B;  3C4X A;  2XAG B;  4LMJ A;  4P09 A;  3ZEF B;  5JDG A;  2EHO A;  3K3O A;  5ABE A;  3ZT7 A;  2LEH A;  3RRW A;  2V6Y A;  2VVN A;  2DNX A;  1SE7 A;  3EDU A;  4LFA T;  5HXE A;  3LJC A;  3LSV A;  3PUY F;  2XAQ B;  3ZMZ B;  2UXD T;  1UUR A;  2X0L B;  4IRE A;  1KFY A;  2CM0 A;  4DV5 T;  4JLE A;  5L47 A;  4X62 T;  1IJ5 A;  3AAE B;  2NTX A;  2I6H A;  4WBO A; 
#chains in the Genus database with same CATH homology
 5LHI B;  4AKL A;  5L3C B;  4FI5 A;  2QA7 A;  3E08 A;  5LA6 E;  3AVS A;  3O1I A;  2BVM A;  2K5B B;  4XZC A;  5JRC A;  1D0Z A;  1US7 B;  2X9W A;  4H9O C;  3K3Q C;  4I55 E;  3FHN A;  5HWY A;  4L5G A;  2RA1 A;  3BQI A;  2YEV C;  3RH3 A;  3N9L A;  5FP3 A;  3N9O A;  5DJQ C;  2VKJ A;  2UXX B;  4PK5 A;  3B13 A;  3R6N A;  5GON E;  4I43 B;  3OYX A;  3I0Q A;  3VHL A;  4P0B A;  4ZI2 D;  4IE6 A;  4AQG A;  1MIV A;  4Z8X A;  5HXS A;  4OYJ A;  4X1Y E;  4GIW A;  4UV9 B;  3PUG A;  5ADX L;  2DHR A;  5FXZ A;  2KLQ A;  3FXD B;  3KV4 A;  4EZ4 A;  5EK2 A;  4IHJ E;  2JMH A;  4BAY B;  2XAH B;  2NWB A;  4QKN A;  3GN5 B;  4AI6 A;  4QXB B;  5L3G B;  4H9Q C;  5CB4 E;  5AFU L;  1WR6 A;  4IDZ A;  4TV9 E;  4KBM B;  2DWG A;  5LHG B;  3BK9 A;  4ISS A;  5F8P A;  4AQF A;  2LOP A;  4U74 A;  2X66 A;  1YW0 A;  1EZ3 A;  2MTQ A;  4OK0 A;  3LBX B;  5ETW A;  2W63 A;  1WYB A;  1MND A;  3C51 A;  3KVA A;  4IE0 A;  1D1A A;  2HPL A;  4DBR A;  3BQK A;  5FMN A;  2KND A;  4H63 H;  3KBU A;  2VKH A;  5LP6 E;  3RX6 A;  2D0U A;  1FIO A;  3AA1 B;  3I1A A;  3SOL A;  3CX6 B;  2ZM0 A;  3RC8 A;  4TV8 E;  5FXW A;  5JR9 A;  1H7C A;  2ACX A;  2KZ7 B;  3IBP A;  1OWA A;  5L3D B;  4ZOL E;  2KIN B;  3QUJ A;  4WNK A;  5LNK A;  3ETU A;  4K0U A;  4TZ4 C;  3OJA A;  3IEE A;  1MMD A;  2JQQ A;  2WMN A;  4IGU A;  4UVA B;  2W62 A;  4HKA A;  2EHO C;  4MFR A;  4OHF A;  1X79 A;  1MMN A;  2JJ9 A;  1MIW A;  2K48 A;  2P9B A;  1IJ6 A;  3RYC E;  5L2L A;  3OKQ A;  3KV9 A;  5EK4 A;  3OYZ A;  4CZZ B;  3LFM A;  3I9W A;  5DQV A;  4WBN E;  5JRE A;  3F2E A;  3MXZ A;  3ZYM A;  4HGA A;  3V5U A;  3CX7 B;  3N2G E;  2D2S A;  1FMW A;  1HG2 A;  4H9N C;  2XAF B;  3GA8 A;  2L8K A;  4KP3 C;  4O8S A;  1MMA A;  4B6X A;  4ZS3 A;  2K24 A;  3N9M A;  3PUA A;  3CVR A;  3EVY A;  3RYF E;  4E7Z A;  2E9X C;  2B1E A;  3DTO A;  2H7V C;  1D1C A;  3ZCJ A;  1YD8 G;  2DWK A;  2E9X B;  5IYZ E;  2Y48 B;  4PK4 A;  3N9P A;  3UFE A;  1YKH B;  1FMV A;  4QXC B;  4TX5 A;  3RYI E;  1WRD A;  5JDM A;  3RPU A;  2YU2 A;  4GYS A;  3MK7 C;  3O1J A;  4DVD A;  2X68 A;  4CQI A;  3EDV A;  3CKD A;  2KWH A;  4QX7 B;  2CXL A;  2LOS A;  3N2K E;  3CPZ A;  4UV8 B;  4CI2 B;  3AA0 B;  4PW8 A;  3KIN B;  3HKB E;  3HI2 A;  5J2T E;  2C5K T;  3ANW B;  2H3R A;  2WM9 A;  3RC3 A;  4ZI2 C;  5CA1 E;  4O4J E;  2CCQ A;  4HEA A;  4WW0 A;  2NW9 A;  3QK6 A;  4YJ2 E;  3PUQ A;  2DCF A;  2Q9Q A;  1MNE A;  2VK9 A;  4FJO A;  4PAG A;  3RRC A;  3ZYL A;  5FY1 A;  2X67 A;  1WYC A;  2N2N A;  4EOZ B;  3CX8 B;  4A56 A;  4OFZ A;  2JRK A;  4CXY A;  2V7I A;  5A1L A;  4N78 D;  1UX5 A;  4QWN B;  2WBL A;  3AA7 B;  4U72 A;  5TAO A;  2XAJ B;  2Q9Q D;  4AKG A;  3ZN0 B;  2DLR A;  4L9I A;  5JDL A;  4PJJ A;  5FYM A;  2V7L A;  3HKC E;  3ZLI A;  2IW5 B;  2L3L A;  5J1G A;  3CML A;  3MA9 A;  4HN9 A;  5FXV A;  4IST A;  3C4Z A;  3MKD A;  1NAF A;  2BZB A;  5FNV E;  4EAH A;  5HWX A;  4HFV A;  5FXX A;  3FBL A;  4F6R C;  2A2F X;  3FXE B;  2KMF A;  2W61 A;  2JMK A;  5KDM C;  4AQF C;  1HCI A;  4GOU A;  4X20 E;  2LE8 A;  3AAA B;  3PTR B;  2V1D B;  5LGN B;  3VKH A;  5EK3 A;  5JQG E;  5L3B B;  1U4Q A;  3C50 A;  1NWM X;  1MMG A;  2D5U A;  2V7J A;  1OXZ A;  3KV6 A;  3QC9 A;  3ZCI A;  2Z6E A;  3CQX C;  3Q5X A;  1UX4 A;  3I9Y A;  3NRY A;  4EIW A;  5JR9 C;  2YIN A;  3GN5 A;  3H37 A;  4YFS A;  4ZI7 E;  5FY7 A;  5LHH B;  2Y6X A;  2VL8 A;  1BR0 A;  4EYU A;  5LJM A;  5F3J A;  2C5J A;  3ZYK A;  3GMI A;  4JEU B;  5HYA A;  4GK0 E;  1BR1 A;  4UVC B;  4QXH B;  3LBX A;  4TN7 B;  1VRB A;  2VAS A;  2ES0 A;  4L0R A;  1E1H B;  1CUN A;  4AKI A;  3KFW X;  2CXD A;  3SRZ A;  4EZH A;  4O2B E;  3U3I A;  2VB6 A;  4NUV A;  5LYJ E;  3AB3 B;  4ZI3 D;  2A3D A;  3FBZ A;  3U78 A;  4EB6 E;  2KXP B;  4PJL A;  2EHO B;  3K3N A;  3J7Y q;  3Q2M A;  2ODU A;  4ANJ A;  2XQY A;  3N9N A;  2PBI A;  5EZY E;  2Y8D A;  4EXT A;  2YU1 A;  1SA0 E;  3B57 A;  3HKD E;  1D0Y A;  3JC6 D;  4MLK A;  3PU3 A;  3ZN1 B;  3LK3 B;  3M65 A;  3T8O A;  3WAK A;  5HXC A;  4AKH A;  5DQW A;  4PFP A;  4H9P C;  3MZK B;  4UF0 B;  3VU7 H;  3N9Q A;  4O2A E;  3CQC B;  2LHN A;  3GWH A;  4PK6 A;  4AXP A;  2CWY A;  3FB2 A;  4DMV A;  4O4L E;  3E22 E;  1G8X A;  4PFO A;  5H6Q B;  2LM9 A;  5JDN A;  5KX5 E;  3MJX A;  2I59 A;  3PU8 A;  1O3X A;  2RP4 A;  1SHZ C;  2YK0 A;  4YJ3 E;  2L9Q A;  3WAJ A;  3ZJ1 A;  2ZM8 A;  3HL6 A;  1D1B A;  2XHE B;  5LGU B;  3LK4 2;  3O9X A;  3AVR A;  4G63 A;  1FEW A;  2LSK A;  4UVB B;  5LBM A;  3UUX B;  2CWO A;  2NP9 A;  5JDQ A;  3ZMS B;  4X1I E;  2LT3 A;  2Q9Q C;  5L3F B;  4ILU A;  4QHO A;  2MOZ A;  5JRC B;  3DJB A;  2Q9Q B;  1KK7 A;  4I4T E;  2ODV A;  3KVB A;  3C64 A;  1ZV4 X;  3NZP A;  3HKE E;  2N1G A;  3OBV E;  2KT9 A;  2QGS A;  3ZC1 A;  3UUL A;  5HXH A;  4DND A;  2NOX A;  3PDY A;  4JEH B;  4IE5 A;  5HAX A;  3R84 B;  2PFV A;  2NW8 A;  4ERR A;  3BQL A;  2GK9 A;  2CEA A;  4X1K E;  2MBG A;  2JPF A;  5JH7 E;  5LXT E;  4XAX B;  1BR2 A;  3MAC A;  3AAI A;  2E8I A;  3PUS A;  4NUU A;  3ANW A;  4CXX A;  1Y64 B;  3HA4 A;  4CI3 B;  2NW7 A;  4G2A A;  5JVD E;  3E0Z A;  5LCY A;  4DBQ A;  1LVF A;  4H9S E;  3NRX A;  3L09 A;  4P0A A;  1Z0P A;  3Q5W A;  2CXF A;  3NZQ A;  3P8C D;  4YHJ A;  2K9A A;  3N2O A;  3WI3 A;  1ZHC A;  4DO0 A;  1S94 A;  5HXR A;  3W15 B;  2LJL A;  2NTY A;  4IE4 A;  4JUY A;  3I0O A;  5LG4 A;  4EYY R;  2WWU A;  2C0S A;  2ZLY A;  4M1P A;  3IHR A;  3RYH E;  3CQG B;  3SWH A;  5DAB A;  4C90 A;  4UEM A;  1T98 A;  3IF8 B;  4UXN B;  2CE7 A;  4GYR A;  1LRZ A;  2IAK A;  2H7O A;  2C5I T;  1QSD A;  4E7S A;  1KNZ A;  3C98 B;  2W0G A;  2A72 A;  2VKD A;  2XUE A;  2V26 A;  1B7T A;  4ZI3 C;  2N9D A;  4ADZ A;  4GK5 E;  3CWZ B;  3D0T A;  5JR9 B;  3O1H A;  3UTK A;  1U5P A;  1IAP A;  4ZS2 A;  5FY0 A;  4DMW A;  3ZMU B;  4AKR B;  3J9X 1;  3JC6 C;  3P7I A;  5LBQ B;  2WAU A;  3ZJ2 A;  2W00 A;  1S35 A;  5LOV E;  4MHC A;  3LG7 A;  4PJN A;  1HF8 A;  4IIJ E;  2ZM2 A;  4ASK A;  1ZEE A;  1ZKE A;  2IC6 A;  3AA6 B;  4TUY E;  4BJM A;  2HH7 A;  4KMC A;  2WMO A;  2VWA A;  5JDF A;  5BMV E;  4PNI A;  1QUU A;  3L3P A;  4IE7 A;  1VOM A;  5IHY A;  2BVL A;  5J2U E;  1HG5 A;  3H3A A;  2LSI A;  3ZMV B;  4V1A v;  4I50 E;  1HX8 A;  2CMR A;  3ESL A;  2X9H A;  2CA5 A;  3KDS E;  3ZMT B;  2LSJ A;  5C8Y E;  5M4Y A;  4UEL A;  4ZHQ E;  1LKX A;  2LHR A;  2M67 A;  1WLX A;  2LSG A;  4UIG A;  5JDH A;  2X9Y A;  1HTJ F;  3PUR A;  3N5L A;  3PE0 A;  3HR0 A;  3ZC0 A;  2CLY C;  3C4X A;  2XAS B;  2SPC A;  2XAG B;  3A5X A;  4P09 A;  3LK2 B;  3UT5 E;  2X9X A;  3ONX A;  2CLY B;  3ZPO A;  1AJ3 A;  3ZEF B;  5E0O A;  5JDG A;  2EHO A;  3K3O A;  3DP7 A;  3KBT A;  4HE8 A;  4HTE A;  5LGT B;  4KUM B;  2LEH A;  2WSS V;  3K8P C;  3C4W A;  2DI4 A;  2IC9 A;  3NBX X;  3RRW A;  3SS1 A;  2VKO A;  1HFA A;  4H9R C;  2DNX A;  1MIY A;  1IZN B;  2V7K A;  3Q9D A;  4BJN A;  1D0X A;  3EDU A;  4CXW A;  2KWI B;  4MAL A;  2EHO D;  1UCU A;  3TKL B;  2J1D G;  3S4U A;  2UXN B;  4YLH A;  5H6R B;  5HXE A;  4UF0 A;  3LJC A;  1V9D A;  1YKE B;  3F31 A;  2OA5 A;  3KV5 A;  2HPJ A;  5KMG P;  2XAQ B;  3ZMZ B;  4H63 V;  3ETV A;  4O4H E;  2E9X A;  2MYS A;  2X51 A;  5CA0 E;  1BR4 A;  3RKO A;  4C91 A;  2D0T A;  2ZMA A;  3EUH A;  2X0L B;  4QX8 B;  4XBF B;  4CI1 B;  5LJN A;  2V7M A;  3V5S A;  5L3E B;  1G73 A;  3VKG A;  3UUN A;  2PJQ A;  4PJM A;  2CM0 A;  3O4X E;  4JLE A;  2XTL A;  2PG8 A;  4J2C A;  1LVK A;  1IJ5 A;  2G0U A;  2E9X D;  3UUM A;  2BDE A;  3AAE B;  2NTX A;  4O4I E;  1HS7 A;  4MBQ A;  4OYK A;  4BA9 A;  4WBO A;  2LSY A;  3F57 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...