4H63V

Structure of the schizosaccharomyces pombe mediator head module
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
117
structure length
117
Chain Sequence
SFQRQLVQRTNTLNSSIDNATLTILSRFQDILDIAINEGKDKYTVAPEVYQIECHTVSMVRAVEQLLDVSRQIKSYWLTNSLSTSFPTVDYSEPDLEKVKRTLTKLQNHLLEVSLIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Mediator of RNA polymerase II transcription subunit 6
publication title Structure of the Mediator head module.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
total genus 43
structure length 117
sequence length 117
ec nomenclature
pdb deposition date 2012-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
V PF06179 Med22 Surfeit locus protein 5 subunit 22 of Mediator complex
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1600 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4h63V00
4H63V 3R84B
chains in the Genus database with same CATH superfamily
2BS3A 1FMWA 5CA1E 4NXNT 2VQFT 3UU3A 3I0OA 5J1GA 3E08A 3OTOT 3RYIE 4ADZA 4DV6T 5E0OA 5HWXA 5ABHA 2H89A 3OBVE 5AQUB 1YQ3A 4U3CA 5HEJA 2X9XA 4TWDA 3VRAA 5JDGA 2BS4A 1HNXT 4L0RA 2BKNA 2VL0A 5HAXA 2XQ9A 5AQJB 4LF5T 4TX5A 3FHNA 1ZEEA 5CA0E 2BKPA 4UR9A 3A8YC 2DHRA 2XM1A 3A5XA 2E9XA 1YKHB 2VASA 2JQQA 2W66A 4HWHA 1O3XA 1SUMB 4A56A 2M6IA 3L3PA 4P0BA 1MMGA 4JI5T 2QVAA 3Q9DA 5M4YA 4TN7B 4NUVA 1WRDA 5FY7A 2I59A 3MKDA 3SS1A 2LM9A 3C64A 3K3OA 2NW9A 4DBQA 4Z90A 2Q9QB 2WWUA 2CLYB 4TV8E 1E2AA 4B3RT 2VB6A 3AE7A 5HXHA 4EGWA 3KBUA 2PTFA 4QXHB 1JNRA 5JR9B 4B3TT 1OWAA 4FI5A 2K3WA 2XZEA 1QLBA 4DV5T 4GK0E 2NTXA 3C4ZA 4QX8B 4NPPA 2C5KT 2YU2A 4UELA 2Y8DA 2NTYA 2WZIA 2XQ6A 3VR8A 3J9X1 1BR4A 3ZN1B 3ETUA 1DU2A 2W63A 1U4QA 4I4TE 2IUBA 2CRBA 1HF8A 3ZMZB 2CLYC 3CX7B 4O4LE 1HG2A 4X66T 1XMQT 1E1HB 5AQGB 4TNVA 3SWHA 5JR9C 4HWIB 3EAMA 5L4HA 4WYVA 5LXTE 4LMKA 3ZYKA 1MIVA 5C3JA 2E9XD 1M62A 4LFAT 3I0QA 1QUUA 5L3CB 2CMRA 3PU3A 2IHR1 4KMCA 1XMOT 4H9QC 4CI2B 4AKIA 3S4UA 3PUQA 4UF0B 5AQSB 4H9NC 3ZSSA 4YTMA 3VHLA 3JAFA 3BK9A 5CJ5A 1UX5A 2V7JA 5FNVE 1X79A 4HWDA 2CBJA 4P1NA 3ZEFB 3LBXA 4UEMA 3RI5A 3AVSA 3UU4A 4H63V 4AKHA 3RYHE 4LF8T 4JEUB 2BBHA 4JI3T 3CWZB 5EZYE 3FZFB 1WYBA 5H6RB 4EOZB 4JBWF 4UXNB 4EYUA 3ESLA 2WAUA 4CXYA 3PUVF 4DR4T 3O1IA 3KV6A 2ODVA 4DV4T 2LRLA 2N1GA 5LNKA 4HFBA 3RYCE 2P9BA 3N9OA 1UGOA 5JQGE 1XDOA 2X0YA 3PURA 4CQIA 2YDSA 3P7IA 3NRYA 3EVYA 3RLFF 2LSYA 4XBFB 3ONLC 2YKSA 1J5ET 4EV6A 3N9PA 2UXXB 4IHJE 3U3IA 5LP6E 4JI4T 3FB2A 3AEGA 2FBWA 4U2YA 3PUAA 2KLQA 3EHZA 4JLEA 5C8YE 3AEFA 3ZYMA 3CK6A 4IE0A 1Z0PA 3P4SA 4H9OC 2QA7A 1KK7A 4NUUA 4DV2T 1D0XA 2VKDA 4AXPA 2RP4A 5LHGB 4LF7T 2W2UA 4DMVA 3GA8A 4OFZA 1OEDB 3WAJA 3KVBA 3UUNA 4U31A 2V5CA 3HI2A 2HHHT 4IIJE 3F57A 2EHOA 5AQVB 2JQHA 5JDMA 4H9PC 4CXXA 4AIUA 4PFPA 4DR7T 3IA3A 4DMWA 4AQGA 4KX6A 2XQ5A 4DV7T 2K24A 2XHEB 3PUYF 2ZM6T 1IJ6A 2UUBT 3AXJA 4X5TA 2K9AA 4L9IA 1OEDC 2VWAA 3EUHA 4LFCT 4ISTA 3ZN0B 3KVAA 2BVMA 5FVLA 4IDQA 3C4WA 5GONE 4DR5T 3MACA 1KEYA 3JCFA 3QB5A 3KDSE 2JRKA 3ZT7A 5L3BB 4PJLA 2SPCA 3AE4A 4M1PA 2WM9A 2F4VT 4UVCB 5FY0A 4QXBB 4ZOLE 4IE4A 2DWGA 3NKZA 2ACXA 5H6QB 4AQFA 3RYFE 1ZOYA 4TZ4C 4IL4A 1T8BA 1UX4A 3ZC1A 5FXWA 4IREA 4DR3T 2E2AA 2D5UA 5LBMA 2DI4A 4TWHA 5FYMA 4GYSA 3AE1A 1SE7A 2QYWA 3CKDA 2EHOD 2K48A 1Y01A 2KMFA 2E5VA 2A2FX 4X1YE 2KXPB 4OX9T 5JRCA 5L3EB 4GK5E 4DO0A 4HKAA 3RRCA 5ADXL 1W9RA 4U2ZA 4DV1T 5ETWA 4B3MT 4AQYT 4PW8A 3OYXA 4F8HA 5AQPB 3RIFA 5JREA 4U74A 3UQ7A 1KF6A 2Y6XA 2XSBA 3ZPOA 2VL8A 4KI0F 2YEVC 2DLRA 3CVRA 3UULA 1D0ZA 4COFA 1NENA 3T1HT 4XAXB 2BKOA 3TLWA 4DR6T 2D0TA 4JUYA 3HR0A 5HXRA 2X9HA 1HX1B 1V9DA 4U7YA 4HWFA 4B6XA 2DWKA 3HKBE 4E7SA 1H7CA 3KINB 4YJ2E 3OYZA 4MBQA 4QX7B 1IBMT 4JI2T 2CXLA 4ZI3D 3M3ZB 4EEBA 4JEHB 4PK5A 2B76A 2KT9A 4YT0A 5AFUL 1G73A 3RRWA 1HNWT 2LOPA 1VCTA 4E7ZA 4YJ3E 5FXVA 4YTNA 5JDHA 4JI6T 2V6YB 4YSYA 2XAFB 5LGTB 5FXZA 3UQ4A 2BG9B 2MPKA 1L0VA 3K3NA 4H9RC 1S94A 2LSIA 3TLSA 2ZLYA 2LHRA 4BJNA 2CM0A 4A97A 1KNRA 3AE2A 2NWBA 3NWIA 2CEAA 3Q5DA 1W0BA 4GOUA 3JC6D 2WMNA 4O4HE 3IEEA 4HGAA 4DIDB 3AVRA 4UVAB 4JI1T 2WB5A 4DR2T 3AE3A 2MYSA 3GN5B 4F6RC 5EK3A 2XASB 4PFOA 2E5LT 5FL1A 2BG9C 4IE5A 3O4XE 2XQ8A 4C91A 3LG7A 4ILBA 4OYKA 1ZV4X 1CUNA 2FJAA 2QGSA 2QRXA 3N9LA 4HFEA 2XPKA 3TLVA 4ZI2D 3HL6A 2B1EA 4IE6A 4WZXA 4HN9A 2IW5B 3O1JA 2NW7A 3RIUC 3SFEA 3Q5EA 3ZT6A 3FBLA 2Q9QC 1ZKEA 4B3ST 3KFWX 3P4QA 4FJOA 2W0GA 4CI1B 1T7SA 4JI0T 3UU6A 4YHJA 4CN1A 1EZ3A 5HXCA 4YFSA 3ZCIA 1QSDA 3P50A 2W4XA 2LOSA 3AE9A 4QXCB 5JR9A 1YD8G 3ONJA 2I6HA 1SA0E 2JIWA 2LJLA 2VKHA 2W62A 5FP3A 5LJMA 1WYCA 3UFGA 4EIWA 2IC6A 4X62T 3LBXB 4QKNA 2M6BA 4EAHA 3RC8A 4KHPT 3AEAA 4DR1T 2ZM0A 2DNXA 4G63A 1XNRT 4GIWA 4CN4A 5AQKB 1N33T 2CHNA 3IHRA 3PTRB 3UU8A 2WBLA 5CFBA 2XUEA 4ZZBA 2WDRA 3AA6B 1XNQT 5AQLB 4AI6A 1W0AA 3PUSA 4DV0T 3DJBA 2XAQB 4GKJT 2PBIA 3CQGB 4ZS2A 3T1YT 2UXDT 3AB3B 3QB5K 3P4WA 2LHNA 1Z8UA 3ZC0A 3MZKB 3QC9A 2CPTA 2Z6EA 3N5LA 2OA5A 2WDQA 2MAWA 2LSJA 2UXNB 2CBIA 2JPFA 1MNEA 3AE6A 2CWYA 2WY2A 4H63H 2IDOB 4O2AE 5BMVE 4JV5T 3J7Yq 3CPZA 1UCUA 3P8CD 4ZXLA 3W15B 4I0UA 2CXDA 2ODUA 5HEGA 3VRBA 5FXXA 5LOVE 2W67A 5HYAA 4LF9T 3ZJ2A 4UV9B 5IWAT 1LVKA 2YDRA 2X9YA 5AQMB 3PUXF 5ABFA 3ZCJA 5IYZE 3NRXA 3B13A 2FJDA 4WNKA 2A9UA 3PJAJ 2V5DA 1MNDA 3SOLA 3U78A 3ZT5A 4K0UA 3FXEB 3FZMB 2Y48B 3TLUA 1FMVA 2WMOA 5JDQA 4NXMT 2J4GA 3FZKB 4HE8A 2IMLA 4KBMB 4GYRA 1UURA 2AE9A 3V5SA 2XAHB 4X1IE 3B57A 5DABA 1Y64B 3AA7B 2D0UA 3Q5WA 4YTPA 4X64T 1UK5A 2IC9A 2V7IA 3H3MA 2H3RA 4ASKA 4A98A 4DNDA 2V8SV 2C5IT 4EEDA 4KP3C 1IZNB 3FZHB 3AAIA 4ZS3A 3LK2B 3RGLA 4TWFA 5LB7B 2LT3A 2N2NA 2DCFA 5C2TA 3AA1B 3RQWA 2X0HA 3PJAA 5IUXA 1HTJF 2XQAA 4MHCA 2X0LB 5HEHA 5FKYA 2JMKA 4MLKA 1HFAA 3RIAA 4ERRA 4ILCA 4CXWA 5DQWA 2XQ4A 2ZMAA 1G8XA 1FEWA 3PUZF 3O9XA 3ANWA 3OKQA 5ABEA 4L5GA 1D0YA 2H88A 2L3LA 2X51A 4HWCA 4IDPA 4BJMA 5AQTB 3AEBA 5KDMC 5LA6E 2WSSV 5LG3A 5HXSA 2BVLA 2MOZA 2A72A 3AA0B 1VCSA 4PJMA 1BR2A 3KBTA 2N9DA 2NOXA 3ZMSB 3MJXA 3EABA 3AE8A 3RX6A 2BS2A 3RF1A 2VKOA 4JI7T 3N2OA 1I94T 1HX8A 3R84B 1MMNA 3GWHA 4IT4A 5AQFB 4HFCA 3QK6A 3RKGA 2XJ7A 5L47A 2X67A 4PJJA 4QWNB 2D2SA 2V26A 2MTQA 3C51A 2MBGA 3UUXB 2M67A 3ZYLA 1UUSA 3PUWF 2BZBA 3X1DA 4I50E 2YU1A 4K0KT 4DUZT 2V7LA 3RH3A 4MFRA 2NR4A 3C4XA 4CI3B 4IL9A 3CX8B 3QNUA 4X65T 4EYYR 1WCRA 2LRKA 4WW0A 1XDPA 5KXJA 1ZHCA 2KNDA 4DUYT 4HTEA 2LSKA 1US7B 4AKRB 4U33A 3JC6C 3L39A 3Q5XA 1IBKT 4HFDA 3FXDB 3V5UA 2E8IA 2V7KA 1IJ5A 2YOEA 4OHFA 3ZLIA 5JDFA 2HN2A 3LSVA 4PJNA 3NBXX 2VURA 4AKLA 3JAEA 3ZJ1A 5LJNA 4CZZB 5CGMA 1D1CA 3VKHA 5JDNA 5LMUT 3NZQA 3E0ZA 2XY8B 2FJEA 2E9XB 5AQNB 5KX5E 2LSGA 4ZI2C 3GMIA 4XZCA 1OXZA 2LLYA 3HKCE 1U5PA 2R6GF 4Z8XA 1HS7A 2WZHA 2KWIB 2OV9A 2FUPA 3G06A 3ONXA 1XZYA 2UXCT 5JH7E 2HN1A 2L8KA 5CB4E 4HEAA 3QOFA 3ZMTB 3T8OA 3QUJA 5LGUB 2CWOA 1OEDE 2E9XC 3D0TA 3DTOA 3DP7A 4QH5A 1NAFA 3VKGA 3LFMA 5AQHB 3MA9A 1BR0A 4JI8T 4PK6A 3WAKA 4X1KE 3OJAA 4P0AA 3B5MA 3CMLA 1HNZT 4YHHT 4P09A 1T72A 2UUCT 2ES0A 5LHIB 3AEDA 2UXBT 3C98B 2OLTA 2XTLA 2V6YA 4JYAT 4HFVA 2J47A 1VRBA 2BG9A 2V7MA 4BA9A 4IDZA 4AISA 2VVNA 1N34T 3ZMUB 3FBZA 3PDYA 2LKHA 5ABGA 5HCMA 3TKLB 1MIYA 5DQVA 3R6NA 4U72A 3LDQB 3UTKA 1W09A 5KMGP 5L4EA 5F8PA 3RIUA 2LE8A 2HPLA 2PJQA 2V1DB 5L3GB 2Q9QA 3GN5A 4LMJA 3I9YA 4MALA 2VK9A 3E22E 3O1HA 3H37A 3M65A 3ZKRA 4QH4A 1T98A 2XSAA 4U7IA 2XAGB 5AQOB 3ETVA 2W61A 4O4JE 5EK2A 2J1DG 3BQLA 3LJCA 2A3DA 2CA5A 3LK42 2GK9A 2L9QA 2WS3A 4HFHA 2PFVA 1D1AA 1WR0A 3PUGA 4BAYB 4O4IE 3CQXC 5AQQB 5LBQB 4J2CA 2XQYA 3EDVA 3WI3A 1JNZA 1WFDA 3ZMVB 5AQRB 5FL0A 3N2KE 4PAGA 4YY3T 1HG5A 1I6ZA 5EK4A 3RPUA 2WP9A 5LHHB 4YLHA 3L09A 3N9QA 5JDLA 1R8IA 3P4PA 3OPCA 2XM2A 5HEOA 2UU9T 4LFBT 1SHZC 2IIUA 2XQ7A 2I0MA 2WU5A 3RC3A 2VVSA 4X20E 1HR0T 3NVOA 4QH1A 1KNZA 4G2AA 1D1BA 3TLTA 4N78D 2KZ7B 4UF0A 4IE7A 3I9WA 5ABFB 4EB6E 3HKEE 3UT5E 2Q9QD 3Q2MA 3PE0A 1M7KA 2CHOA 3ABVA 4I55E 5FMNA 2XAJB 4ZHQE 2AXDS 1N32T 4DBRA 5HXEA 1NEKA 2KWHA 1MIWA 2IAKA 2YINA 2XQ3A 5LYJE 3N9NA 2RPAA 5AQIB 2J62A 3I1AA 4LF4T 2BG9E 5HEUA 3ZSTA 4LMLA 1VOMA 5JVDE 5J2TE 5A1LA 1CHUA 2EHOB 3UUMA 2ZM2A 2KINB 3F31A 2WWVA 4UIGA 1ZP0A 1LRZA 4O2BE 2BBJA 2CE7A 3BQKA 3C50A 4OYJA 3HA4A 3N2GE 5IHYA 2D9DA 1BR1A 2DL1A 4Z91A 3N9MA 3EI0A 5LMNT 4ANJA 2NP9A 2LKGA 3AXJB 5L2LA 4V1Av 1E7PA 1J5WA 4KHZF 3AAEB 4EXTA 4GKKT 3RQUA 5J0ZA 1MMDA 2EHOC 3ANWB 1KNPA 3SFDA 5FY1A 2X66A 3SRZA 4UV8B 2K5BB 3BQIA 4O8SA 3MK7C 1HCIA 5LCYA 3IF8B 4Q25A 3VU7H 5L3FB 5JTGA 1LVFA 1N36T 4HFIA 3AECA 4ILAA 4KUMB 3AAAB 4A5XA 3RHWA 1OEDA 2V6XA 3K3QC 3PU8A 4YXDA 5LG4A 4AKGA 2H7VC 4YSZA 1FIOA 1YQ4A 4IDOA 3IBPA 5F3JA 2HPJA 4WBNE 5DJQC 5FVKA 4TNWA 5HWYA 4I43B 2YN6A 4DV3T 1FJGT 2KSRA 1KFYA 4UVBB 3A7MA 1YKEB 3VR9A 3L8RA 4LF6T 5JRCB 2H7OA 4DVDA 3CX6B 4AQFC 2ZM8A 1B7TA 2YK0A 3OVUA 1MMAA 4EZHA 2WU2A 4IDNA 3RKOA 4OK0A 4EZ4A 1WLXA 2YDQA 4CN6A 4ZI3C 2WQYA 1S35A 1X9BA 5BR8T 1LKXA 2WDVA 3EDUA 4ZEYA 4IGUA 4H9SE 4QHOA 1NWMX 4YSXA 2BDEA 3AE5A 4ISSA 2JQKA 2JQ9A 4C90A 3UFEA 5J2UE 3AEEA 3KV5A 2NW8A 1XWMA 3H3AA 3NZPA 5L3DB 4NIQA 3LK3B 4PK4A 3CIRA 2G0UA 1AJ3A 3UU5A 2CCQA 3P4RA 2X68A 4ILUA 3PV0F 1YW0A 1YXRA 3UUBA 3CQCB 3K1SA 2RA1A 1J1JA 3FZLB 2FJBA 2LEHA 2HH7A 2UUAT 2ACZA 3MXZA 5TAOA 2JJ9A 3KV9A 2LM2A 5HCJA 1WR6A 4ZZCA 1GQEA 3F2EA 2JMHA 2WCAA 4WBOA 4TUYE 4PNIA 2X9WA 2W00A 3K8PC 3KV4A 2PG8A 1IBLT 3JADA 2CXFA 3HKDE 2C0SA 5LGNB 2VQET 1IAPA 2C5JA 5F5WA 4TV9E 4ZI7E 2VKJA
chains in the Genus database with same CATH topology
2ODUA 1FMWA 2BVMA 5FXXA 5CA1E 5KMGP 3C4WA 5F8PA 5GONE 2LE8A 2HPLA 3MACA 2PJQA 5LOVE 2V1DB 5L3GB 2Q9QA 3GN5A 5HYAA 3I9YA 4MALA 3KDSE 2JRKA 2VK9A 3E22E 3I0OA 3ZJ2A 5J1GA 3E08A 5L3BB 3O1HA 4PJLA 4UV9B 3H37A 1LVKA 3RYIE 2SPCA 3M65A 2X9YA 4ADZA 1T98A 5E0OA 4M1PA 2WM9A 5HWXA 2XAGB 4UVCB 3ZCJA 3OBVE 3ETVA 5IYZE 2W61A 3NRXA 4O4JE 5FY0A 5EK2A 3B13A 2J1DG 3BQLA 4QXBB 3LJCA 4ZOLE 4WNKA 4IE4A 2X9XA 2A3DA 1MNDA 2CA5A 2DWGA 3LK42 2ACXA 3SOLA 3U78A 5JDGA 2GK9A 5H6QB 4AQFA 2L9QA 3RYFE 4TZ4C 4K0UA 3FXEB 4L0RA 2Y48B 2PFVA 1FMVA 5HAXA 1D1AA 1UX4A 3ZC1A 2WMOA 5FXWA 4TX5A 5JDQA 3PUGA 3FHNA 4BAYB 4HE8A 1ZEEA 5CA0E 4O4IE 3CQXC 4KBMB 2D5UA 4GYRA 5LBMA 2DI4A 5LBQB 2DHRA 3V5SA 4J2CA 2XQYA 3A5XA 5FYMA 2XAHB 3EDVA 4GYSA 4X1IE 3WI3A 3B57A 5DABA 2E9XA 1YKHB 2VASA 2JQQA 3ZMVB 1Y64B 3AA7B 3CKDA 3N2KE 4PAGA 2EHOD 1HG5A 2D0UA 2K48A 3Q5WA 2KMFA 1O3XA 4A56A 5EK4A 3L3PA 3RPUA 4P0BA 1MMGA 2IC9A 2V7IA 5LHHB 2A2FX 2H3RA 4X1YE 4YLHA 4ASKA 2KXPB 3L09A 5JRCA 3N9QA 5L3EB 3Q9DA 5JDLA 4GK5E 4DO0A 4DNDA 4HKAA 2C5IT 3RRCA 4KP3C 5M4YA 4TN7B 4NUVA 1WRDA 1IZNB 5FY7A 2I59A 3AAIA 3MKDA 4ZS3A 5ADXL 3LK2B 1SHZC 3SS1A 2LM9A 3C64A 3K3OA 5ETWA 2NW9A 2LT3A 4DBQA 2N2NA 2DCFA 4PW8A 3OYXA 3RC3A 2Q9QB 2WWUA 4X20E 3AA1B 1HTJF 2CLYB 4TV8E 5JREA 2VB6A 4MHCA 4G2AA 1KNZA 2X0LB 5HXHA 4U74A 1D1BA 2Y6XA 4N78D 3KBUA 4QXHB 2JMKA 5JR9B 2KZ7B 4UF0A 2VL8A 4IE7A 3ZPOA 3I9WA 4MLKA 1HFAA 1OWAA 4FI5A 2YEVC 4EB6E 3HKEE 3UT5E 4GK0E 2DLRA 3CVRA 2NTXA 4ERRA 3UULA 1D0ZA 2Q9QD 3C4ZA 3Q2MA 4QX8B 3PE0A 4CXWA 5DQWA 2C5KT 2YU2A 4UELA 2Y8DA 2NTYA 4XAXB 2ZMAA 3J9X1 1BR4A 1G8XA 4I55E 1FEWA 5FMNA 3O9XA 2D0TA 3ZN1B 3ETUA 3ANWA 3OKQA 4JUYA 2XAJB 3HR0A 5HXRA 4ZHQE 2W63A 1U4QA 1D0YA 4L5GA 4I4TE 2L3LA 2X9HA 4DBRA 2X51A 4ZI7E 4BJMA 5KDMC 1V9DA 1HF8A 2WSSV 5LA6E 5HXEA 3ZMZB 2CLYC 4B6XA 2DWKA 3CX7B 3HKBE 4O4LE 4E7SA 5HXSA 1H7CA 1HG2A 3KINB 4YJ2E 3OYZA 2BVLA 2KWHA 1MIWA 2IAKA 1E1HB 2YINA 2MOZA 4MBQA 4QX7B 5LYJE 2A72A 3N9NA 3AA0B 4PJMA 3SWHA 5JR9C 1BR2A 2CXLA 3KBTA 2N9DA 4ZI3D 5LXTE 2NOXA 3ZYKA 3I1AA 4JEHB 3ZMSB 3MJXA 4PK5A 1MIVA 2KT9A 3RX6A 5AFUL 1G73A 3RRWA 1VOMA 2LOPA 2VKOA 5JVDE 4E7ZA 3N2OA 4YJ3E 5J2TE 5FXVA 5A1LA 1HX8A 3R84B 1MMNA 2E9XD 2EHOB 3GWHA 5JDHA 2XAFB 3QK6A 5LGTB 3UUMA 2ZM2A 2X67A 2KINB 4PJJA 4QWNB 3F31A 5FXZA 4UIGA 1LRZA 2D2SA 3I0QA 2V26A 2MTQA 3C51A 2MBGA 3UUXB 1QUUA 3K3NA 4O2BE 3C50A 2CE7A 3BQKA 4H9RC 4OYJA 2M67A 5L3CB 3HA4A 1S94A 2LSIA 3N2GE 5IHYA 2CMRA 3PU3A 3ZYLA 2ZLYA 2LHRA 4KMCA 1BR1A 3N9MA 2BZBA 4I50E 4H9QC 4ANJA 4CI2B 2NP9A 2YU1A 4AKIA 4BJNA 3S4UA 2CM0A 3PUQA 4UF0B 2NWBA 4H9NC 2CEAA 2V7LA 4GOUA 3VHLA 5L2LA 3RH3A 4MFRA 3BK9A 3C4XA 1UX5A 2V7JA 3JC6D 4V1Av 2WMNA 1X79A 4O4HE 3IEEA 5FNVE 4CI3B 3CX8B 3AAEB 4EXTA 4HGAA 4EYYR 3AVRA 3ZEFB 4UVAB 3LBXA 4UEMA 1MMDA 2EHOC 4WW0A 3ANWB 1ZHCA 3AVSA 2MYSA 3GN5B 5FY1A 2X66A 5EK3A 4F6RC 2XASB 2KNDA 4PFOA 3SRZA 4H63V 4HTEA 4UV8B 2LSKA 3RYHE 4AKHA 1US7B 2K5BB 3BQIA 4O8SA 4IE5A 4AKRB 3O4XE 3MK7C 4JEUB 4C91A 3JC6C 1HCIA 3LG7A 3CWZB 5EZYE 5LCYA 4OYKA 3IF8B 3Q5XA 1ZV4X 1WYBA 1CUNA 3VU7H 5H6RB 3FXDB 2QGSA 3V5UA 5L3FB 4EOZB 2E8IA 1LVFA 2V7KA 1IJ5A 3N9LA 4UXNB 4OHFA 4EYUA 3ZLIA 5JDFA 3ESLA 2WAUA 3AAAB 4KUMB 4CXYA 3O1IA 3KV6A 4ZI2D 3HL6A 2B1EA 4PJNA 2ODVA 4IE6A 3K3QC 3PU8A 3NBXX 4HN9A 2N1GA 5LNKA 4AKLA 3ZJ1A 5LG4A 2IW5B 5LJNA 3O1JA 2NW7A 3RYCE 4AKGA 2P9BA 2H7VC 4CZZB 3FBLA 3N9OA 1D1CA 5JQGE 2Q9QC 3VKHA 1FIOA 1ZKEA 3PURA 5JDNA 3KFWX 4CQIA 3NZQA 3E0ZA 3P7IA 3NRYA 3EVYA 3IBPA 2HPJA 4FJOA 2W0GA 4WBNE 5F3JA 5DJQC 4CI1B 2LSYA 2E9XB 5KX5E 2LSGA 5HWYA 4XBFB 4I43B 4ZI2C 4YHJA 1EZ3A 5HXCA 4YFSA 3ZCIA 1QSDA 4UVBB 3N9PA 2LOSA 3GMIA 1YKEB 2UXXB 4IHJE 4XZCA 3U3IA 5JRCB 2H7OA 4QXCB 5JR9A 5LP6E 3FB2A 4DVDA 1OXZA 3CX6B 1YD8G 3HKCE 2ZM8A 1B7TA 1U5PA 2YK0A 3PUAA 4AQFC 1SA0E 2KLQA 4Z8XA 2LJLA 2VKHA 1MMAA 2W62A 4JLEA 4EZHA 5C8YE 5FP3A 1HS7A 5LJMA 1WYCA 2KWIB 4EIWA 2IC6A 4OK0A 3RKOA 3ZYMA 4EZ4A 1WLXA 3ONXA 3LBXB 4QKNA 4IE0A 1Z0PA 5JH7E 4ZI3C 4H9OC 4EAHA 1S35A 2QA7A 3RC8A 2L8KA 1LKXA 5CB4E 4HEAA 3ZMTB 1KK7A 3T8OA 3QUJA 3EDUA 5LGUB 2CWOA 2ZM0A 4IGUA 4H9SE 2DNXA 4G63A 4NUUA 4QHOA 2E9XC 1NWMX 3D0TA 3DTOA 3DP7A 2BDEA 4ISSA 4GIWA 1D0XA 1NAFA 3VKGA 4C90A 3LFMA 2VKDA 3UFEA 3IHRA 3PTRB 4AXPA 5J2UE 3MA9A 2WBLA 1BR0A 3KV5A 2RP4A 2XUEA 2NW8A 5LHGB 4PK6A 3WAKA 4X1KE 3H3AA 3NZPA 5L3DB 3AA6B 3OJAA 4P0AA 4DMVA 3LK3B 3GA8A 4PK4A 4OFZA 3CMLA 4AI6A 2G0UA 4P09A 1AJ3A 3WAJA 3KVBA 3PUSA 2CCQA 3UUNA 3DJBA 2XAQB 2ES0A 2X68A 3HI2A 4ILUA 2PBIA 4IIJE 5LHIB 3C98B 3F57A 1YW0A 2EHOA 3CQGB 4ZS2A 2XTLA 3AB3B 3CQCB 2RA1A 5JDMA 2LHNA 4HFVA 4H9PC 3ZC0A 4CXXA 1VRBA 3MZKB 2LEHA 2HH7A 4PFPA 2V7MA 4BA9A 3QC9A 4IDZA 3MXZA 2Z6EA 5TAOA 2JJ9A 4DMWA 4AQGA 3KV9A 2OA5A 3N5LA 2LSJA 1WR6A 3ZMUB 2UXNB 3F2EA 2K24A 2JMHA 2XHEB 3FBZA 2JPFA 4WBOA 1MNEA 3PDYA 4TUYE 4PNIA 1IJ6A 2CWYA 2X9WA 2W00A 4H63H 4O2AE 3K8PC 3TKLB 3KV4A 5BMVE 3J7Yq 2PG8A 3CPZA 2K9AA 4L9IA 1MIYA 2CXFA 3HKDE 1UCUA 5DQVA 2C0SA 3R6NA 3P8CD 2VWAA 3EUHA 5LGNB 4U72A 4ISTA 1IAPA 2C5JA 3W15B 4TV9E 3ZN0B 2CXDA 3UTKA 3KVAA 2VKJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4H63 V;  3R84 B; 
#chains in the Genus database with same CATH topology
 2BS3 A;  1FMW A;  5CA1 E;  4NXN T;  2VQF T;  3UU3 A;  3I0O A;  5J1G A;  3E08 A;  3OTO T;  3RYI E;  4ADZ A;  4DV6 T;  5E0O A;  5HWX A;  5ABH A;  2H89 A;  3OBV E;  5AQU B;  1YQ3 A;  4U3C A;  5HEJ A;  2X9X A;  4TWD A;  3VRA A;  5JDG A;  2BS4 A;  1HNX T;  4L0R A;  2BKN A;  2VL0 A;  5HAX A;  2XQ9 A;  5AQJ B;  4LF5 T;  4TX5 A;  3FHN A;  1ZEE A;  5CA0 E;  2BKP A;  4UR9 A;  3A8Y C;  2DHR A;  2XM1 A;  3A5X A;  2E9X A;  1YKH B;  2VAS A;  2JQQ A;  2W66 A;  4HWH A;  1O3X A;  1SUM B;  4A56 A;  2M6I A;  3L3P A;  4P0B A;  1MMG A;  4JI5 T;  2QVA A;  3Q9D A;  5M4Y A;  4TN7 B;  4NUV A;  1WRD A;  5FY7 A;  2I59 A;  3MKD A;  3SS1 A;  2LM9 A;  3C64 A;  3K3O A;  2NW9 A;  4DBQ A;  4Z90 A;  2Q9Q B;  2WWU A;  2CLY B;  4TV8 E;  1E2A A;  4B3R T;  2VB6 A;  3AE7 A;  5HXH A;  4EGW A;  3KBU A;  2PTF A;  4QXH B;  1JNR A;  5JR9 B;  4B3T T;  1OWA A;  4FI5 A;  2K3W A;  2XZE A;  1QLB A;  4DV5 T;  4GK0 E;  2NTX A;  3C4Z A;  4QX8 B;  4NPP A;  2C5K T;  2YU2 A;  4UEL A;  2Y8D A;  2NTY A;  2WZI A;  2XQ6 A;  3VR8 A;  3J9X 1;  1BR4 A;  3ZN1 B;  3ETU A;  1DU2 A;  2W63 A;  1U4Q A;  4I4T E;  2IUB A;  2CRB A;  1HF8 A;  3ZMZ B;  2CLY C;  3CX7 B;  4O4L E;  1HG2 A;  4X66 T;  1XMQ T;  1E1H B;  5AQG B;  4TNV A;  3SWH A;  5JR9 C;  4HWI B;  3EAM A;  5L4H A;  4WYV A;  5LXT E;  4LMK A;  3ZYK A;  1MIV A;  5C3J A;  2E9X D;  1M62 A;  4LFA T;  3I0Q A;  1QUU A;  5L3C B;  2CMR A;  3PU3 A;  2IHR 1;  4KMC A;  1XMO T;  4H9Q C;  4CI2 B;  4AKI A;  3S4U A;  3PUQ A;  4UF0 B;  5AQS B;  4H9N C;  3ZSS A;  4YTM A;  3VHL A;  3JAF A;  3BK9 A;  5CJ5 A;  1UX5 A;  2V7J A;  5FNV E;  1X79 A;  4HWD A;  2CBJ A;  4P1N A;  3ZEF B;  3LBX A;  4UEM A;  3RI5 A;  3AVS A;  3UU4 A;  4H63 V;  4AKH A;  3RYH E;  4LF8 T;  4JEU B;  2BBH A;  4JI3 T;  3CWZ B;  5EZY E;  3FZF B;  1WYB A;  5H6R B;  4EOZ B;  4JBW F;  4UXN B;  4EYU A;  3ESL A;  2WAU A;  4CXY A;  3PUV F;  4DR4 T;  3O1I A;  3KV6 A;  2ODV A;  4DV4 T;  2LRL A;  2N1G A;  5LNK A;  4HFB A;  3RYC E;  2P9B A;  3N9O A;  1UGO A;  5JQG E;  1XDO A;  2X0Y A;  3PUR A;  4CQI A;  2YDS A;  3P7I A;  3NRY A;  3EVY A;  3RLF F;  2LSY A;  4XBF B;  3ONL C;  2YKS A;  1J5E T;  4EV6 A;  3N9P A;  2UXX B;  4IHJ E;  3U3I A;  5LP6 E;  4JI4 T;  3FB2 A;  3AEG A;  2FBW A;  4U2Y A;  3PUA A;  2KLQ A;  3EHZ A;  4JLE A;  5C8Y E;  3AEF A;  3ZYM A;  3CK6 A;  4IE0 A;  1Z0P A;  3P4S A;  4H9O C;  2QA7 A;  1KK7 A;  4NUU A;  4DV2 T;  1D0X A;  2VKD A;  4AXP A;  2RP4 A;  5LHG B;  4LF7 T;  2W2U A;  4DMV A;  3GA8 A;  4OFZ A;  1OED B;  3WAJ A;  3KVB A;  3UUN A;  4U31 A;  2V5C A;  3HI2 A;  2HHH T;  4IIJ E;  3F57 A;  2EHO A;  5AQV B;  2JQH A;  5JDM A;  4H9P C;  4CXX A;  4AIU A;  4PFP A;  4DR7 T;  3IA3 A;  4DMW A;  4AQG A;  4KX6 A;  2XQ5 A;  4DV7 T;  2K24 A;  2XHE B;  3PUY F;  2ZM6 T;  1IJ6 A;  2UUB T;  3AXJ A;  4X5T A;  2K9A A;  4L9I A;  1OED C;  2VWA A;  3EUH A;  4LFC T;  4IST A;  3ZN0 B;  3KVA A;  2BVM A;  5FVL A;  4IDQ A;  3C4W A;  5GON E;  4DR5 T;  3MAC A;  1KEY A;  3JCF A;  3QB5 A;  3KDS E;  2JRK A;  3ZT7 A;  5L3B B;  4PJL A;  2SPC A;  3AE4 A;  4M1P A;  2WM9 A;  2F4V T;  4UVC B;  5FY0 A;  4QXB B;  4ZOL E;  4IE4 A;  2DWG A;  3NKZ A;  2ACX A;  5H6Q B;  4AQF A;  3RYF E;  1ZOY A;  4TZ4 C;  4IL4 A;  1T8B A;  1UX4 A;  3ZC1 A;  5FXW A;  4IRE A;  4DR3 T;  2E2A A;  2D5U A;  5LBM A;  2DI4 A;  4TWH A;  5FYM A;  4GYS A;  3AE1 A;  1SE7 A;  2QYW A;  3CKD A;  2EHO D;  2K48 A;  1Y01 A;  2KMF A;  2E5V A;  2A2F X;  4X1Y E;  2KXP B;  4OX9 T;  5JRC A;  5L3E B;  4GK5 E;  4DO0 A;  4HKA A;  3RRC A;  5ADX L;  1W9R A;  4U2Z A;  4DV1 T;  5ETW A;  4B3M T;  4AQY T;  4PW8 A;  3OYX A;  4F8H A;  5AQP B;  3RIF A;  5JRE A;  4U74 A;  3UQ7 A;  1KF6 A;  2Y6X A;  2XSB A;  3ZPO A;  2VL8 A;  4KI0 F;  2YEV C;  2DLR A;  3CVR A;  3UUL A;  1D0Z A;  4COF A;  1NEN A;  3T1H T;  4XAX B;  2BKO A;  3TLW A;  4DR6 T;  2D0T A;  4JUY A;  3HR0 A;  5HXR A;  2X9H A;  1HX1 B;  1V9D A;  4U7Y A;  4HWF A;  4B6X A;  2DWK A;  3HKB E;  4E7S A;  1H7C A;  3KIN B;  4YJ2 E;  3OYZ A;  4MBQ A;  4QX7 B;  1IBM T;  4JI2 T;  2CXL A;  4ZI3 D;  3M3Z B;  4EEB A;  4JEH B;  4PK5 A;  2B76 A;  2KT9 A;  4YT0 A;  5AFU L;  1G73 A;  3RRW A;  1HNW T;  2LOP A;  1VCT A;  4E7Z A;  4YJ3 E;  5FXV A;  4YTN A;  5JDH A;  4JI6 T;  2V6Y B;  4YSY A;  2XAF B;  5LGT B;  5FXZ A;  3UQ4 A;  2BG9 B;  2MPK A;  1L0V A;  3K3N A;  4H9R C;  1S94 A;  2LSI A;  3TLS A;  2ZLY A;  2LHR A;  4BJN A;  2CM0 A;  4A97 A;  1KNR A;  3AE2 A;  2NWB A;  3NWI A;  2CEA A;  3Q5D A;  1W0B A;  4GOU A;  3JC6 D;  2WMN A;  4O4H E;  3IEE A;  4HGA A;  4DID B;  3AVR A;  4UVA B;  4JI1 T;  2WB5 A;  4DR2 T;  3AE3 A;  2MYS A;  3GN5 B;  4F6R C;  5EK3 A;  2XAS B;  4PFO A;  2E5L T;  5FL1 A;  2BG9 C;  4IE5 A;  3O4X E;  2XQ8 A;  4C91 A;  3LG7 A;  4ILB A;  4OYK A;  1ZV4 X;  1CUN A;  2FJA A;  2QGS A;  2QRX A;  3N9L A;  4HFE A;  2XPK A;  3TLV A;  4ZI2 D;  3HL6 A;  2B1E A;  4IE6 A;  4WZX A;  4HN9 A;  2IW5 B;  3O1J A;  2NW7 A;  3RIU C;  3SFE A;  3Q5E A;  3ZT6 A;  3FBL A;  2Q9Q C;  1ZKE A;  4B3S T;  3KFW X;  3P4Q A;  4FJO A;  2W0G A;  4CI1 B;  1T7S A;  4JI0 T;  3UU6 A;  4YHJ A;  4CN1 A;  1EZ3 A;  5HXC A;  4YFS A;  3ZCI A;  1QSD A;  3P50 A;  2W4X A;  2LOS A;  3AE9 A;  4QXC B;  5JR9 A;  1YD8 G;  3ONJ A;  2I6H A;  1SA0 E;  2JIW A;  2LJL A;  2VKH A;  2W62 A;  5FP3 A;  5LJM A;  1WYC A;  3UFG A;  4EIW A;  2IC6 A;  4X62 T;  3LBX B;  4QKN A;  2M6B A;  4EAH A;  3RC8 A;  4KHP T;  3AEA A;  4DR1 T;  2ZM0 A;  2DNX A;  4G63 A;  1XNR T;  4GIW A;  4CN4 A;  5AQK B;  1N33 T;  2CHN A;  3IHR A;  3PTR B;  3UU8 A;  2WBL A;  5CFB A;  2XUE A;  4ZZB A;  2WDR A;  3AA6 B;  1XNQ T;  5AQL B;  4AI6 A;  1W0A A;  3PUS A;  4DV0 T;  3DJB A;  2XAQ B;  4GKJ T;  2PBI A;  3CQG B;  4ZS2 A;  3T1Y T;  2UXD T;  3AB3 B;  3QB5 K;  3P4W A;  2LHN A;  1Z8U A;  3ZC0 A;  3MZK B;  3QC9 A;  2CPT A;  2Z6E A;  3N5L A;  2OA5 A;  2WDQ A;  2MAW A;  2LSJ A;  2UXN B;  2CBI A;  2JPF A;  1MNE A;  3AE6 A;  2CWY A;  2WY2 A;  4H63 H;  2IDO B;  4O2A E;  5BMV E;  4JV5 T;  3J7Y q;  3CPZ A;  1UCU A;  3P8C D;  4ZXL A;  3W15 B;  4I0U A;  2CXD A;  2ODU A;  5HEG A;  3VRB A;  5FXX A;  5LOV E;  2W67 A;  5HYA A;  4LF9 T;  3ZJ2 A;  4UV9 B;  5IWA T;  1LVK A;  2YDR A;  2X9Y A;  5AQM B;  3PUX F;  5ABF A;  3ZCJ A;  5IYZ E;  3NRX A;  3B13 A;  2FJD A;  4WNK A;  2A9U A;  3PJA J;  2V5D A;  1MND A;  3SOL A;  3U78 A;  3ZT5 A;  4K0U A;  3FXE B;  3FZM B;  2Y48 B;  3TLU A;  1FMV A;  2WMO A;  5JDQ A;  4NXM T;  2J4G A;  3FZK B;  4HE8 A;  2IML A;  4KBM B;  4GYR A;  1UUR A;  2AE9 A;  3V5S A;  2XAH B;  4X1I E;  3B57 A;  5DAB A;  1Y64 B;  3AA7 B;  2D0U A;  3Q5W A;  4YTP A;  4X64 T;  1UK5 A;  2IC9 A;  2V7I A;  3H3M A;  2H3R A;  4ASK A;  4A98 A;  4DND A;  2V8S V;  2C5I T;  4EED A;  4KP3 C;  1IZN B;  3FZH B;  3AAI A;  4ZS3 A;  3LK2 B;  3RGL A;  4TWF A;  5LB7 B;  2LT3 A;  2N2N A;  2DCF A;  5C2T A;  3AA1 B;  3RQW A;  2X0H A;  3PJA A;  5IUX A;  1HTJ F;  2XQA A;  4MHC A;  2X0L B;  5HEH A;  5FKY A;  2JMK A;  4MLK A;  1HFA A;  3RIA A;  4ERR A;  4ILC A;  4CXW A;  5DQW A;  2XQ4 A;  2ZMA A;  1G8X A;  1FEW A;  3PUZ F;  3O9X A;  3ANW A;  3OKQ A;  5ABE A;  4L5G A;  1D0Y A;  2H88 A;  2L3L A;  2X51 A;  4HWC A;  4IDP A;  4BJM A;  5AQT B;  3AEB A;  5KDM C;  5LA6 E;  2WSS V;  5LG3 A;  5HXS A;  2BVL A;  2MOZ A;  2A72 A;  3AA0 B;  1VCS A;  4PJM A;  1BR2 A;  3KBT A;  2N9D A;  2NOX A;  3ZMS B;  3MJX A;  3EAB A;  3AE8 A;  3RX6 A;  2BS2 A;  3RF1 A;  2VKO A;  4JI7 T;  3N2O A;  1I94 T;  1HX8 A;  3R84 B;  1MMN A;  3GWH A;  4IT4 A;  5AQF B;  4HFC A;  3QK6 A;  3RKG A;  2XJ7 A;  5L47 A;  2X67 A;  4PJJ A;  4QWN B;  2D2S A;  2V26 A;  2MTQ A;  3C51 A;  2MBG A;  3UUX B;  2M67 A;  3ZYL A;  1UUS A;  3PUW F;  2BZB A;  3X1D A;  4I50 E;  2YU1 A;  4K0K T;  4DUZ T;  2V7L A;  3RH3 A;  4MFR A;  2NR4 A;  3C4X A;  4CI3 B;  4IL9 A;  3CX8 B;  3QNU A;  4X65 T;  4EYY R;  1WCR A;  2LRK A;  4WW0 A;  1XDP A;  5KXJ A;  1ZHC A;  2KND A;  4DUY T;  4HTE A;  2LSK A;  1US7 B;  4AKR B;  4U33 A;  3JC6 C;  3L39 A;  3Q5X A;  1IBK T;  4HFD A;  3FXD B;  3V5U A;  2E8I A;  2V7K A;  1IJ5 A;  2YOE A;  4OHF A;  3ZLI A;  5JDF A;  2HN2 A;  3LSV A;  4PJN A;  3NBX X;  2VUR A;  4AKL A;  3JAE A;  3ZJ1 A;  5LJN A;  4CZZ B;  5CGM A;  1D1C A;  3VKH A;  5JDN A;  5LMU T;  3NZQ A;  3E0Z A;  2XY8 B;  2FJE A;  2E9X B;  5AQN B;  5KX5 E;  2LSG A;  4ZI2 C;  3GMI A;  4XZC A;  1OXZ A;  2LLY A;  3HKC E;  1U5P A;  2R6G F;  4Z8X A;  1HS7 A;  2WZH A;  2KWI B;  2OV9 A;  2FUP A;  3G06 A;  3ONX A;  1XZY A;  2UXC T;  5JH7 E;  2HN1 A;  2L8K A;  5CB4 E;  4HEA A;  3QOF A;  3ZMT B;  3T8O A;  3QUJ A;  5LGU B;  2CWO A;  1OED E;  2E9X C;  3D0T A;  3DTO A;  3DP7 A;  4QH5 A;  1NAF A;  3VKG A;  3LFM A;  5AQH B;  3MA9 A;  1BR0 A;  4JI8 T;  4PK6 A;  3WAK A;  4X1K E;  3OJA A;  4P0A A;  3B5M A;  3CML A;  1HNZ T;  4YHH T;  4P09 A;  1T72 A;  2UUC T;  2ES0 A;  5LHI B;  3AED A;  2UXB T;  3C98 B;  2OLT A;  2XTL A;  2V6Y A;  4JYA T;  4HFV A;  2J47 A;  1VRB A;  2BG9 A;  2V7M A;  4BA9 A;  4IDZ A;  4AIS A;  2VVN A;  1N34 T;  3ZMU B;  3FBZ A;  3PDY A;  2LKH A;  5ABG A;  5HCM A;  3TKL B;  1MIY A;  5DQV A;  3R6N A;  4U72 A;  3LDQ B;  3UTK A;  1W09 A;  5KMG P;  5L4E A;  5F8P A;  3RIU A;  2LE8 A;  2HPL A;  2PJQ A;  2V1D B;  5L3G B;  2Q9Q A;  3GN5 A;  4LMJ A;  3I9Y A;  4MAL A;  2VK9 A;  3E22 E;  3O1H A;  3H37 A;  3M65 A;  3ZKR A;  4QH4 A;  1T98 A;  2XSA A;  4U7I A;  2XAG B;  5AQO B;  3ETV A;  2W61 A;  4O4J E;  5EK2 A;  2J1D G;  3BQL A;  3LJC A;  2A3D A;  2CA5 A;  3LK4 2;  2GK9 A;  2L9Q A;  2WS3 A;  4HFH A;  2PFV A;  1D1A A;  1WR0 A;  3PUG A;  4BAY B;  4O4I E;  3CQX C;  5AQQ B;  5LBQ B;  4J2C A;  2XQY A;  3EDV A;  3WI3 A;  1JNZ A;  1WFD A;  3ZMV B;  5AQR B;  5FL0 A;  3N2K E;  4PAG A;  4YY3 T;  1HG5 A;  1I6Z A;  5EK4 A;  3RPU A;  2WP9 A;  5LHH B;  4YLH A;  3L09 A;  3N9Q A;  5JDL A;  1R8I A;  3P4P A;  3OPC A;  2XM2 A;  5HEO A;  2UU9 T;  4LFB T;  1SHZ C;  2IIU A;  2XQ7 A;  2I0M A;  2WU5 A;  3RC3 A;  2VVS A;  4X20 E;  1HR0 T;  3NVO A;  4QH1 A;  1KNZ A;  4G2A A;  1D1B A;  3TLT A;  4N78 D;  2KZ7 B;  4UF0 A;  4IE7 A;  3I9W A;  5ABF B;  4EB6 E;  3HKE E;  3UT5 E;  2Q9Q D;  3Q2M A;  3PE0 A;  1M7K A;  2CHO A;  3ABV A;  4I55 E;  5FMN A;  2XAJ B;  4ZHQ E;  2AXD S;  1N32 T;  4DBR A;  5HXE A;  1NEK A;  2KWH A;  1MIW A;  2IAK A;  2YIN A;  2XQ3 A;  5LYJ E;  3N9N A;  2RPA A;  5AQI B;  2J62 A;  3I1A A;  4LF4 T;  2BG9 E;  5HEU A;  3ZST A;  4LML A;  1VOM A;  5JVD E;  5J2T E;  5A1L A;  1CHU A;  2EHO B;  3UUM A;  2ZM2 A;  2KIN B;  3F31 A;  2WWV A;  4UIG A;  1ZP0 A;  1LRZ A;  4O2B E;  2BBJ A;  2CE7 A;  3BQK A;  3C50 A;  4OYJ A;  3HA4 A;  3N2G E;  5IHY A;  2D9D A;  1BR1 A;  2DL1 A;  4Z91 A;  3N9M A;  3EI0 A;  5LMN T;  4ANJ A;  2NP9 A;  2LKG A;  3AXJ B;  5L2L A;  4V1A v;  1E7P A;  1J5W A;  4KHZ F;  3AAE B;  4EXT A;  4GKK T;  3RQU A;  5J0Z A;  1MMD A;  2EHO C;  3ANW B;  1KNP A;  3SFD A;  5FY1 A;  2X66 A;  3SRZ A;  4UV8 B;  2K5B B;  3BQI A;  4O8S A;  3MK7 C;  1HCI A;  5LCY A;  3IF8 B;  4Q25 A;  3VU7 H;  5L3F B;  5JTG A;  1LVF A;  1N36 T;  4HFI A;  3AEC A;  4ILA A;  4KUM B;  3AAA B;  4A5X A;  3RHW A;  1OED A;  2V6X A;  3K3Q C;  3PU8 A;  4YXD A;  5LG4 A;  4AKG A;  2H7V C;  4YSZ A;  1FIO A;  1YQ4 A;  4IDO A;  3IBP A;  5F3J A;  2HPJ A;  4WBN E;  5DJQ C;  5FVK A;  4TNW A;  5HWY A;  4I43 B;  2YN6 A;  4DV3 T;  1FJG T;  2KSR A;  1KFY A;  4UVB B;  3A7M A;  1YKE B;  3VR9 A;  3L8R A;  4LF6 T;  5JRC B;  2H7O A;  4DVD A;  3CX6 B;  4AQF C;  2ZM8 A;  1B7T A;  2YK0 A;  3OVU A;  1MMA A;  4EZH A;  2WU2 A;  4IDN A;  3RKO A;  4OK0 A;  4EZ4 A;  1WLX A;  2YDQ A;  4CN6 A;  4ZI3 C;  2WQY A;  1S35 A;  1X9B A;  5BR8 T;  1LKX A;  2WDV A;  3EDU A;  4ZEY A;  4IGU A;  4H9S E;  4QHO A;  1NWM X;  4YSX A;  2BDE A;  3AE5 A;  4ISS A;  2JQK A;  2JQ9 A;  4C90 A;  3UFE A;  5J2U E;  3AEE A;  3KV5 A;  2NW8 A;  1XWM A;  3H3A A;  3NZP A;  5L3D B;  4NIQ A;  3LK3 B;  4PK4 A;  3CIR A;  2G0U A;  1AJ3 A;  3UU5 A;  2CCQ A;  3P4R A;  2X68 A;  4ILU A;  3PV0 F;  1YW0 A;  1YXR A;  3UUB A;  3CQC B;  3K1S A;  2RA1 A;  1J1J A;  3FZL B;  2FJB A;  2LEH A;  2HH7 A;  2UUA T;  2ACZ A;  3MXZ A;  5TAO A;  2JJ9 A;  3KV9 A;  2LM2 A;  5HCJ A;  1WR6 A;  4ZZC A;  1GQE A;  3F2E A;  2JMH A;  2WCA A;  4WBO A;  4TUY E;  4PNI A;  2X9W A;  2W00 A;  3K8P C;  3KV4 A;  2PG8 A;  1IBL T;  3JAD A;  2CXF A;  3HKD E;  2C0S A;  5LGN B;  2VQE T;  1IAP A;  2C5J A;  5F5W A;  4TV9 E;  4ZI7 E;  2VKJ A; 
#chains in the Genus database with same CATH homology
 2ODU A;  1FMW A;  2BVM A;  5FXX A;  5CA1 E;  5KMG P;  3C4W A;  5F8P A;  5GON E;  2LE8 A;  2HPL A;  3MAC A;  2PJQ A;  5LOV E;  2V1D B;  5L3G B;  2Q9Q A;  3GN5 A;  5HYA A;  3I9Y A;  4MAL A;  3KDS E;  2JRK A;  2VK9 A;  3E22 E;  3I0O A;  3ZJ2 A;  5J1G A;  3E08 A;  5L3B B;  3O1H A;  4PJL A;  4UV9 B;  3H37 A;  1LVK A;  3RYI E;  2SPC A;  3M65 A;  2X9Y A;  4ADZ A;  1T98 A;  5E0O A;  4M1P A;  2WM9 A;  5HWX A;  2XAG B;  4UVC B;  3ZCJ A;  3OBV E;  3ETV A;  5IYZ E;  2W61 A;  3NRX A;  4O4J E;  5FY0 A;  5EK2 A;  3B13 A;  2J1D G;  3BQL A;  4QXB B;  3LJC A;  4ZOL E;  4WNK A;  4IE4 A;  2X9X A;  2A3D A;  1MND A;  2CA5 A;  2DWG A;  3LK4 2;  2ACX A;  3SOL A;  3U78 A;  5JDG A;  2GK9 A;  5H6Q B;  4AQF A;  2L9Q A;  3RYF E;  4TZ4 C;  4K0U A;  3FXE B;  4L0R A;  2Y48 B;  2PFV A;  1FMV A;  5HAX A;  1D1A A;  1UX4 A;  3ZC1 A;  2WMO A;  5FXW A;  4TX5 A;  5JDQ A;  3PUG A;  3FHN A;  4BAY B;  4HE8 A;  1ZEE A;  5CA0 E;  4O4I E;  3CQX C;  4KBM B;  2D5U A;  4GYR A;  5LBM A;  2DI4 A;  5LBQ B;  2DHR A;  3V5S A;  4J2C A;  2XQY A;  3A5X A;  5FYM A;  2XAH B;  3EDV A;  4GYS A;  4X1I E;  3WI3 A;  3B57 A;  5DAB A;  2E9X A;  1YKH B;  2VAS A;  2JQQ A;  3ZMV B;  1Y64 B;  3AA7 B;  3CKD A;  3N2K E;  4PAG A;  2EHO D;  1HG5 A;  2D0U A;  2K48 A;  3Q5W A;  2KMF A;  1O3X A;  4A56 A;  5EK4 A;  3L3P A;  3RPU A;  4P0B A;  1MMG A;  2IC9 A;  2V7I A;  5LHH B;  2A2F X;  2H3R A;  4X1Y E;  4YLH A;  4ASK A;  2KXP B;  3L09 A;  5JRC A;  3N9Q A;  5L3E B;  3Q9D A;  5JDL A;  4GK5 E;  4DO0 A;  4DND A;  4HKA A;  2C5I T;  3RRC A;  4KP3 C;  5M4Y A;  4TN7 B;  4NUV A;  1WRD A;  1IZN B;  5FY7 A;  2I59 A;  3AAI A;  3MKD A;  4ZS3 A;  5ADX L;  3LK2 B;  1SHZ C;  3SS1 A;  2LM9 A;  3C64 A;  3K3O A;  5ETW A;  2NW9 A;  2LT3 A;  4DBQ A;  2N2N A;  2DCF A;  4PW8 A;  3OYX A;  3RC3 A;  2Q9Q B;  2WWU A;  4X20 E;  3AA1 B;  1HTJ F;  2CLY B;  4TV8 E;  5JRE A;  2VB6 A;  4MHC A;  4G2A A;  1KNZ A;  2X0L B;  5HXH A;  4U74 A;  1D1B A;  2Y6X A;  4N78 D;  3KBU A;  4QXH B;  2JMK A;  5JR9 B;  2KZ7 B;  4UF0 A;  2VL8 A;  4IE7 A;  3ZPO A;  3I9W A;  4MLK A;  1HFA A;  1OWA A;  4FI5 A;  2YEV C;  4EB6 E;  3HKE E;  3UT5 E;  4GK0 E;  2DLR A;  3CVR A;  2NTX A;  4ERR A;  3UUL A;  1D0Z A;  2Q9Q D;  3C4Z A;  3Q2M A;  4QX8 B;  3PE0 A;  4CXW A;  5DQW A;  2C5K T;  2YU2 A;  4UEL A;  2Y8D A;  2NTY A;  4XAX B;  2ZMA A;  3J9X 1;  1BR4 A;  1G8X A;  4I55 E;  1FEW A;  5FMN A;  3O9X A;  2D0T A;  3ZN1 B;  3ETU A;  3ANW A;  3OKQ A;  4JUY A;  2XAJ B;  3HR0 A;  5HXR A;  4ZHQ E;  2W63 A;  1U4Q A;  1D0Y A;  4L5G A;  4I4T E;  2L3L A;  2X9H A;  4DBR A;  2X51 A;  4ZI7 E;  4BJM A;  5KDM C;  1V9D A;  1HF8 A;  2WSS V;  5LA6 E;  5HXE A;  3ZMZ B;  2CLY C;  4B6X A;  2DWK A;  3CX7 B;  3HKB E;  4O4L E;  4E7S A;  5HXS A;  1H7C A;  1HG2 A;  3KIN B;  4YJ2 E;  3OYZ A;  2BVL A;  2KWH A;  1MIW A;  2IAK A;  1E1H B;  2YIN A;  2MOZ A;  4MBQ A;  4QX7 B;  5LYJ E;  2A72 A;  3N9N A;  3AA0 B;  4PJM A;  3SWH A;  5JR9 C;  1BR2 A;  2CXL A;  3KBT A;  2N9D A;  4ZI3 D;  5LXT E;  2NOX A;  3ZYK A;  3I1A A;  4JEH B;  3ZMS B;  3MJX A;  4PK5 A;  1MIV A;  2KT9 A;  3RX6 A;  5AFU L;  1G73 A;  3RRW A;  1VOM A;  2LOP A;  2VKO A;  5JVD E;  4E7Z A;  3N2O A;  4YJ3 E;  5J2T E;  5FXV A;  5A1L A;  1HX8 A;  3R84 B;  1MMN A;  2E9X D;  2EHO B;  3GWH A;  5JDH A;  2XAF B;  3QK6 A;  5LGT B;  3UUM A;  2ZM2 A;  2X67 A;  2KIN B;  4PJJ A;  4QWN B;  3F31 A;  5FXZ A;  4UIG A;  1LRZ A;  2D2S A;  3I0Q A;  2V26 A;  2MTQ A;  3C51 A;  2MBG A;  3UUX B;  1QUU A;  3K3N A;  4O2B E;  3C50 A;  2CE7 A;  3BQK A;  4H9R C;  4OYJ A;  2M67 A;  5L3C B;  3HA4 A;  1S94 A;  2LSI A;  3N2G E;  5IHY A;  2CMR A;  3PU3 A;  3ZYL A;  2ZLY A;  2LHR A;  4KMC A;  1BR1 A;  3N9M A;  2BZB A;  4I50 E;  4H9Q C;  4ANJ A;  4CI2 B;  2NP9 A;  2YU1 A;  4AKI A;  4BJN A;  3S4U A;  2CM0 A;  3PUQ A;  4UF0 B;  2NWB A;  4H9N C;  2CEA A;  2V7L A;  4GOU A;  3VHL A;  5L2L A;  3RH3 A;  4MFR A;  3BK9 A;  3C4X A;  1UX5 A;  2V7J A;  3JC6 D;  4V1A v;  2WMN A;  1X79 A;  4O4H E;  3IEE A;  5FNV E;  4CI3 B;  3CX8 B;  3AAE B;  4EXT A;  4HGA A;  4EYY R;  3AVR A;  3ZEF B;  4UVA B;  3LBX A;  4UEM A;  1MMD A;  2EHO C;  4WW0 A;  3ANW B;  1ZHC A;  3AVS A;  2MYS A;  3GN5 B;  5FY1 A;  2X66 A;  5EK3 A;  4F6R C;  2XAS B;  2KND A;  4PFO A;  3SRZ A;  4H63 V;  4HTE A;  4UV8 B;  2LSK A;  3RYH E;  4AKH A;  1US7 B;  2K5B B;  3BQI A;  4O8S A;  4IE5 A;  4AKR B;  3O4X E;  3MK7 C;  4JEU B;  4C91 A;  3JC6 C;  1HCI A;  3LG7 A;  3CWZ B;  5EZY E;  5LCY A;  4OYK A;  3IF8 B;  3Q5X A;  1ZV4 X;  1WYB A;  1CUN A;  3VU7 H;  5H6R B;  3FXD B;  2QGS A;  3V5U A;  5L3F B;  4EOZ B;  2E8I A;  1LVF A;  2V7K A;  1IJ5 A;  3N9L A;  4UXN B;  4OHF A;  4EYU A;  3ZLI A;  5JDF A;  3ESL A;  2WAU A;  3AAA B;  4KUM B;  4CXY A;  3O1I A;  3KV6 A;  4ZI2 D;  3HL6 A;  2B1E A;  4PJN A;  2ODV A;  4IE6 A;  3K3Q C;  3PU8 A;  3NBX X;  4HN9 A;  2N1G A;  5LNK A;  4AKL A;  3ZJ1 A;  5LG4 A;  2IW5 B;  5LJN A;  3O1J A;  2NW7 A;  3RYC E;  4AKG A;  2P9B A;  2H7V C;  4CZZ B;  3FBL A;  3N9O A;  1D1C A;  5JQG E;  2Q9Q C;  3VKH A;  1FIO A;  1ZKE A;  3PUR A;  5JDN A;  3KFW X;  4CQI A;  3NZQ A;  3E0Z A;  3P7I A;  3NRY A;  3EVY A;  3IBP A;  2HPJ A;  4FJO A;  2W0G A;  4WBN E;  5F3J A;  5DJQ C;  4CI1 B;  2LSY A;  2E9X B;  5KX5 E;  2LSG A;  5HWY A;  4XBF B;  4I43 B;  4ZI2 C;  4YHJ A;  1EZ3 A;  5HXC A;  4YFS A;  3ZCI A;  1QSD A;  4UVB B;  3N9P A;  2LOS A;  3GMI A;  1YKE B;  2UXX B;  4IHJ E;  4XZC A;  3U3I A;  5JRC B;  2H7O A;  4QXC B;  5JR9 A;  5LP6 E;  3FB2 A;  4DVD A;  1OXZ A;  3CX6 B;  1YD8 G;  3HKC E;  2ZM8 A;  1B7T A;  1U5P A;  2YK0 A;  3PUA A;  4AQF C;  1SA0 E;  2KLQ A;  4Z8X A;  2LJL A;  2VKH A;  1MMA A;  2W62 A;  4JLE A;  4EZH A;  5C8Y E;  5FP3 A;  1HS7 A;  5LJM A;  1WYC A;  2KWI B;  4EIW A;  2IC6 A;  4OK0 A;  3RKO A;  3ZYM A;  4EZ4 A;  1WLX A;  3ONX A;  3LBX B;  4QKN A;  4IE0 A;  1Z0P A;  5JH7 E;  4ZI3 C;  4H9O C;  4EAH A;  1S35 A;  2QA7 A;  3RC8 A;  2L8K A;  1LKX A;  5CB4 E;  4HEA A;  3ZMT B;  1KK7 A;  3T8O A;  3QUJ A;  3EDU A;  5LGU B;  2CWO A;  2ZM0 A;  4IGU A;  4H9S E;  2DNX A;  4G63 A;  4NUU A;  4QHO A;  2E9X C;  1NWM X;  3D0T A;  3DTO A;  3DP7 A;  2BDE A;  4ISS A;  4GIW A;  1D0X A;  1NAF A;  3VKG A;  4C90 A;  3LFM A;  2VKD A;  3UFE A;  3IHR A;  3PTR B;  4AXP A;  5J2U E;  3MA9 A;  2WBL A;  1BR0 A;  3KV5 A;  2RP4 A;  2XUE A;  2NW8 A;  5LHG B;  4PK6 A;  3WAK A;  4X1K E;  3H3A A;  3NZP A;  5L3D B;  3AA6 B;  3OJA A;  4P0A A;  4DMV A;  3LK3 B;  3GA8 A;  4PK4 A;  4OFZ A;  3CML A;  4AI6 A;  2G0U A;  4P09 A;  1AJ3 A;  3WAJ A;  3KVB A;  3PUS A;  2CCQ A;  3UUN A;  3DJB A;  2XAQ B;  2ES0 A;  2X68 A;  3HI2 A;  4ILU A;  2PBI A;  4IIJ E;  5LHI B;  3C98 B;  3F57 A;  1YW0 A;  2EHO A;  3CQG B;  4ZS2 A;  2XTL A;  3AB3 B;  3CQC B;  2RA1 A;  5JDM A;  2LHN A;  4HFV A;  4H9P C;  3ZC0 A;  4CXX A;  1VRB A;  3MZK B;  2LEH A;  2HH7 A;  4PFP A;  2V7M A;  4BA9 A;  3QC9 A;  4IDZ A;  3MXZ A;  2Z6E A;  5TAO A;  2JJ9 A;  4DMW A;  4AQG A;  3KV9 A;  2OA5 A;  3N5L A;  2LSJ A;  1WR6 A;  3ZMU B;  2UXN B;  3F2E A;  2K24 A;  2JMH A;  2XHE B;  3FBZ A;  2JPF A;  4WBO A;  1MNE A;  3PDY A;  4TUY E;  4PNI A;  1IJ6 A;  2CWY A;  2X9W A;  2W00 A;  4H63 H;  4O2A E;  3K8P C;  3TKL B;  3KV4 A;  5BMV E;  3J7Y q;  2PG8 A;  3CPZ A;  2K9A A;  4L9I A;  1MIY A;  2CXF A;  3HKD E;  1UCU A;  5DQV A;  2C0S A;  3R6N A;  3P8C D;  2VWA A;  3EUH A;  5LGN B;  4U72 A;  4IST A;  1IAP A;  2C5J A;  3W15 B;  4TV9 E;  3ZN0 B;  2CXD A;  3UTK A;  3KVA A;  2VKJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...