4H63V

Structure of the schizosaccharomyces pombe mediator head module
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
117
structure length
117
Chain Sequence
b'SFQRQLVQRTNTLNSSIDNATLTILSRFQDILDIAINEGKDKYTVAPEVYQIECHTVSMVRAVEQLLDVSRQIKSYWLTNSLSTSFPTVDYSEPDLEKVKRTLTKLQNHLLEVSLIE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mediator of RNA polymerase II transcription subunit 6
publication title Structure of the Mediator head module.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Transcription
total genus 43
structure length 117
sequence length 117
ec nomenclature
pdb deposition date 2012-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
V PF06179 Med22 Surfeit locus protein 5 subunit 22 of Mediator complex
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1600 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4h63V00
4H63V 3R84B
chains in the Genus database with same CATH superfamily
1J5ET 3OTOT 5E0OA 2AE9A 1G73A 3UFEA 3ONXA 3PV0F 2BDEA 2LOPA 2VL0A 5AQJB 3H3MA 1G8XA 1BR1A 5LB7B 2ZM8A 4OYKA 1QUUA 4AKIA 4GIWA 3KINB 1W0AA 2DWGA 1KFYA 2I59A 2WBLA 4AISA 1XWMA 4MALA 4HEAA 3P50A 5FNVE 2XSBA 4TUYE 4QH4A 4ISTA 3K8PC 4B3MT 3OPCA 5JR9A 3ETUA 4WZXA 5FY0A 2MOZA 4DO0A 3AXJA 2HN1A 4LF7T 3GMIA 3KBTA 1HG2A 2BKNA 5HWXA 2IDOB 3PTRB 4UV8B 1UK5A 3ZT7A 3ZMSB 4QXCB 3DP7A 5JR9C 3N2GE 3K1SA 1Z8UA 1JNRA 3Q9DA 4O4IE 3N9LA 1YXRA 2J1DG 2B1EA 5ABFA 3EUHA 2CBJA 4YJ3E 5FL1A 2XQ3A 2VASA 3G06A 1IJ6A 3PUGA 1HFAA 5L3BB 3AA0B 1HG5A 1W0BA 2BBJA 3O1IA 4HWFA 2ODUA 3E22E 1WR0A 4X1IE 3O1JA 5LJNA 3FBLA 4QXBB 4IDQA 4OX9T 4JI2T 4DV4T 3AE2A 2N1GA 3JC6C 1MMDA 3PUZF 3SS1A 2F4VT 1JNZA 2VB6A 4X1KE 1I94T 4IGUA 2C0SA 3NBXX 4WBOA 1D0YA 3NVOA 3GN5B 5HEUA 2UUAT 5EK4A 1UX5A 2NOXA 2V5CA 2XQYA 5GONE 3BQKA 3AA1B 5AQLB 3L09A 4EEDA 4BAYB 4LMJA 2JJ9A 4B3RT 4JI5T 2XUEA 3Q2MA 1WCRA 1R8IA 2JIWA 3T1HT 3M3ZB 3LFMA 2XY8B 3UU5A 4JI7T 1CHUA 1KEYA 4U2YA 5LG4A 2VWAA 3P4QA 2WWUA 2K5BB 4H9PC 2WDQA 2H89A 4M1PA 2BS2A 3KDSE 4UXNB 2YU2A 2HH7A 2JPFA 5KMGP 4O4LE 2VURA 4AKLA 2UXCT 3RYIE 2VKOA 3N9OA 4U7YA 2DHRA 2RP4A 4DR3T 1GQEA 3RRWA 4I50E 2XQ7A 1T98A 5HCJA 4P0BA 5IUXA 4UF0B 2ZMAA 5AQNB 3L8RA 4QX8B 1XDOA 3HKDE 4DV1T 3LK3B 2R6GF 3RQWA 3N5LA 2YDQA 5F8PA 1BR0A 4IDNA 2BG9B 2V5DA 4QWNB 2WM9A 4YTPA 5LNKA 2XQAA 2DL1A 3A7MA 5J1GA 5KXJA 1MNDA 5HXSA 2W00A 2N9DA 4B6XA 5HXCA 2DI4A 3AAAB 5AQFB 2XQ9A 4U3CA 2AXDS 3OBVE 1YQ3A 2VL8A 4CN4A 5FVKA 3RYCE 3J9X1 1ZOYA 3LBXB 4JEUB 5CB4E 4O2BE 3FBZA 4DV6T 2JQQA 4DR6T 2LT3A 2J62A 2WZIA 5FXWA 4X66T 2WMNA 2WMOA 5JH7E 3H37A 2K24A 1OEDE 4L9IA 5CA1E 1WLXA 2LHNA 4TNWA 3CQXC 2XSAA 3UT5E 3A5XA 4H63H 4MHCA 4UVCB 2NTXA 4JV5T 4DV7T 4G2AA 3UULA 2M6BA 1M7KA 3ZC1A 4IL9A 1WYBA 2VKDA 2UXNB 5L3GB 1WYCA 2A3DA 3I1AA 3QB5K 3ANWB 4QHOA 5IHYA 4ANJA 2FBWA 3C64A 2UXDT 2P9BA 2KNDA 4UEMA 4IL4A 2IC9A 2E5LT 4WNKA 2FJBA 3B57A 3JCFA 2KT9A 1UCUA 4LF4T 2H88A 3KBUA 3NRYA 3R84B 4AIUA 2WAUA 3LSVA 4KI0F 2BG9C 2WZHA 2WDRA 4P1NA 5HCMA 1LKXA 2V1DB 4HFEA 4PK5A 3V5UA 2KWIB 3RF1A 5F3JA 2JRKA 5FKYA 1ZV4X 2A72A 3ZYLA 3FZHB 1AJ3A 3ABVA 5AQGB 4E7SA 3ZJ2A 4NPPA 2OA5A 4U72A 4JUYA 2XM2A 1HX8A 3ETVA 3NZQA 3RIAA 4DMVA 3ZMVB 2IUBA 2V8SV 2PG8A 4HFHA 2BBHA 3EVYA 2V7MA 5JTGA 5IYZE 4EXTA 2WB5A 4NUUA 1YQ4A 5DABA 3IA3A 4TWHA 3RYFE 2UUBT 4HFIA 2DLRA 3C4WA 2J47A 1XMQT 5AQUB 4JLEA 2ZM6T 3RX6A 4AKRB 4LFCT 4QKNA 5AQQB 3PURA 2WSSV 1UGOA 4JBWF 5JR9B 4K0UA 2W4XA 2DWKA 3GA8A 2BKOA 1IBKT 3AXJB 5HEHA 1E7PA 3AEDA 2X9XA 1DU2A 3CQCB 5AQSB 1T8BA 2V6XA 3EAMA 2GK9A 2KWHA 1V9DA 3NKZA 4IE6A 4L0RA 1YKHB 2I6HA 2HHHT 2X51A 2V7IA 3IEEA 1W9RA 2LHRA 3OKQA 3CK6A 3QNUA 2FJDA 1US7B 2BVMA 2XJ7A 2XQ8A 2QVAA 2WU5A 4HFBA 2YDRA 2X0LB 2LOSA 5ABFB 2W2UA 4CI3B 1XNQT 3MACA 5LJMA 2KINB 2D2SA 5F5WA 4DIDB 1LVFA 4IT4A 4ZI3D 5LMUT 3A8YC 1OWAA 4X20E 3C51A 4COFA 3RH3A 4Z91A 5LHHB 3P4PA 4KP3C 2E9XD 2WP9A 4PAGA 4H9RC 4A97A 3AE6A 3PE0A 2LKHA 4KMCA 2L3LA 4GOUA 3ZMUB 4QH5A 2JMHA 3PUXF 1IBMT 3PDYA 3VR8A 4X62T 3ZMZB 5EK3A 5FP3A 2HPLA 1MMNA 4ILUA 1E2AA 3QK6A 3NZPA 4GK0E 4P09A 3AEGA 2LRLA 1VCTA 3P4RA 3CWZB 2MBGA 5KX5E 4PJJA 5DQVA 2LSJA 4YSZA 4H9SE 4XAXB 3JAEA 4YFSA 2XAHB 4ADZA 5LGTB 3RC8A 4U33A 4A98A 4H63V 1D1CA 1X79A 2DNXA 2X9WA 3MZKB 3RLFF 3AE4A 3DJBA 2LSIA 4AQGA 4DUZT 3CX6B 3ESLA 5FXVA 2A9UA 2C5KT 3RPUA 4BJNA 4IREA 5EZYE 4A56A 4CQIA 3C4XA 4DVDA 3F2EA 2D0UA 3T1YT 2FJEA 4QXHB 4X5TA 1M62A 3PU3A 4IE4A 5ADXL 3UFGA 3AB3B 3AE7A 4HWDA 3CKDA 3ZN1B 3OVUA 2KZ7B 2MTQA 1HS7A 4DNDA 4YY3T 5FVLA 2CCQA 3QUJA 4HE8A 2RPAA 3VU7H 1WFDA 4BA9A 3ONJA 3RQUA 4KHZF 2YK0A 3FHNA 2D0TA 3I9YA 3FZKB 3RIFA 3I0QA 3NWIA 5LCYA 4F6RC 3ZCIA 3PUYF 1MNEA 1FMVA 4DR2T 2IMLA 2Y48B 1ZKEA 4ZHQE 1NWMX 1UUSA 3N9PA 4X1YE 3IF8B 1HCIA 2YKSA 3N9QA 5JDGA 3AE8A 2L8KA 4UELA 4EV6A 2JMKA 4YSXA 4LF6T 5CFBA 4DR7T 2CEAA 4F8HA 3UU8A 1IAPA 5H6QB 5AQKB 1YD8G 3K3NA 5FMNA 3Q5WA 2YEVC 3UU4A 4O4JE 5HXEA 3AE3A 2WQYA 2CA5A 2HN2A 3I9WA 1WRDA 4DUYT 3O4XE 1MMAA 4ZI7E 5CJ5A 2LRKA 2K3WA 3X1DA 5KDMC 3CPZA 3VKGA 2CHOA 2OV9A 1X9BA 2Y6XA 4H9NC 3UUXB 3AEAA 1O3XA 1N33T 2MYSA 4UR9A 2SPCA 2XQ4A 1HX1B 1KK7A 4JI1T 2LLYA 1MIWA 3FZMB 2N2NA 2ES0A 2BS3A 2W63A 2FUPA 1IZNB 4YTMA 5AQOB 4GK5E 3EDVA 4JI6T 2E9XA 3OJAA 3AVSA 4ZXLA 2V7JA 4QH1A 2NTYA 3AE1A 2CWYA 2CXDA 4AXPA 5JRCA 3B13A 4HFVA 1J5WA 3UQ4A 3AA6B 2E5VA 5CGMA 2K48A 1QLBA 1U4QA 4ZI3C 2PBIA 4O2AE 4HFCA 5HEJA 4LFBT 5JREA 3BK9A 4CZZB 4C90A 4OYJA 2D9DA 2E9XC 4LMLA 5LHIB 2NW7A 2C5IT 3HL6A 2QRXA 4DR5T 2IHR1 3VRAA 4AI6A 4EZ4A 3PU8A 3AVRA 5EK2A 1D1AA 1D1BA 3QB5A 4EYYR 2CLYC 2JQHA 3PUVF 4B3ST 3VR9A 3MKDA 4I4TE 1ZHCA 2KXPB 3NRXA 3V5SA 1VRBA 2XQ6A 2FJAA 3KVAA 2D5UA 1T7SA 1MIVA 2YU1A 2X68A 5JDFA 3J7Yq 4ZZBA 4U2ZA 3T8OA 5L3EB 2ZM2A 4K0KT 4TV8E 5HWYA 1B7TA 2VQET 2EHOD 4BJMA 2YN6A 1Y64B 3SWHA 1D0XA 3LK42 4XZCA 3UU6A 2J4GA 2Y8DA 3AEBA 1HTJF 5DJQC 1KF6A 2BKPA 3E0ZA 4HFDA 2W61A 4H9QC 4ERRA 5LHGB 4DMWA 4DV5T 2RA1A 2CXLA 5DQWA 3PJAJ 4YT0A 3KV4A 5ABEA 4GKKT 1BR4A 3TLSA 5LG3A 1T72A 5L4EA 4V1Av 5AQMB 3RRCA 3TKLB 2WU2A 2XPKA 3EDUA 3ZT5A 3OYXA 1SUMB 4PK6A 3RGLA 4KBMB 3HI2A 4AKHA 4I55E 4U7IA 5AQTB 2CRBA 2BS4A 3ZN0B 5H6RB 5ABGA 4PJNA 3C98B 4I43B 4IDZA 3LBXA 4PK4A 3ZYMA 2YDSA 2CE7A 2YOEA 5FY7A 4ASKA 3P4SA 4YJ2E 4PFPA 3TLTA 5LP6E 5CA0E 1ZP0A 5C2TA 4Q25A 1SA0E 3L39A 4EIWA 1YKEB 5IWAT 4WW0A 3QOFA 4CI2B 4PFOA 5AQRB 3RIUA 3FXDB 3RHWA 5FL0A 2Q9QA 1H7CA 2VKJA 3CX8B 3BQLA 4HKAA 4LF5T 3B5MA 1IBLT 3CX7B 4IE5A 5FXXA 4EZHA 2BVLA 3UUBA 2YINA 5LMNT 3ZSTA 2XZEA 1CUNA 2XTLA 3WI3A 3N9NA 2W62A 2X67A 4MBQA 1HNWT 2H7OA 2G0UA 1WR6A 5FYMA 2VVNA 3ZKRA 2V6YA 2UU9T 5AQIB 3E08A 3PUSA 4N78D 1E1HB 2CHNA 2X0HA 2XAGB 3Q5XA 1L0VA 5C3JA 3CQGB 1MMGA 2XASB 3UUMA 2NR4A 3D0TA 3VHLA 1N34T 3IHRA 5HXRA 3AEEA 3N9MA 1S94A 4QX7B 2EHOA 5M4YA 3RKGA 2B76A 3MJXA 4JYAT 4DV2T 4UV9B 3ZJ1A 2X66A 5L3FB 4CN6A 3C50A 4GYSA 4JI8T 5L2LA 1IJ5A 5HAXA 2X9YA 2LM2A 3ZT6A 2W67A 3KVBA 4UIGA 5TAOA 2XAQB 2EHOC 3Q5DA 1S35A 4CI1B 4ZZCA 2QGSA 2WWVA 3U3IA 5J2UE 2KLQA 3CMLA 4TX5A 3AE5A 1QSDA 1FMWA 3EI0A 1ZEEA 2CBIA 2BG9E 5FY1A 4ILBA 2HPJA 4KHPT 2VQFT 4YTNA 3SFDA 4C91A 3F31A 1OEDA 3K3OA 4U74A 2ACXA 3RYHE 5FXZA 3K3QC 3M65A 3FZFB 1I6ZA 5L4HA 2QA7A 3HKEE 3KV9A 1U5PA 1Y01A 3ONLC 5LBMA 1SHZC 2XQ5A 4ZS2A 5JDMA 4AKGA 3F57A 3AEFA 3TLVA 3TLWA 4KUMB 2M67A 3L3PA 4JI3T 3P4WA 1Z0PA 1OEDC 2E9XB 4PW8A 4DBQA 4GKJT 3ZYKA 4EOZB 4TN7B 5JRCB 2LEHA 4YHHT 4JI0T 2LKGA 5JVDE 5LBQB 4ZI2D 2ODVA 4HGAA 4EEBA 3VRBA 2L9QA 4FJOA 2CLYB 2LSYA 3WAKA 4H9OC 3FZLB 2CM0A 4ZS3A 5LA6E 3IBPA 2JQKA 3BQIA 1KNPA 2V26A 3WAJA 3EABA 2VK9A 3LG7A 2C5JA 2XAFB 2QYWA 4PJLA 3AAEB 3P8CD 4B3TT 2M6IA 2LSKA 4MFRA 4TV9E 1HF8A 3AECA 5HEGA 3H3AA 3LK2B 3ZSSA 2JQ9A 2Z6EA 2VKHA 4YLHA 3UU3A 4JEHB 3PUWF 2A2FX 5JDLA 4EGWA 2LE8A 4LF8T 1N32T 2CWOA 3LDQB 4Z8XA 4FI5A 4X65T 4LMKA 2ZM0A 3MXZA 3HR0A 1FIOA 1HNZT 4PJMA 5C8YE 5LXTE 2KSRA 2X0YA 3EHZA 1SE7A 3AE9A 3N2OA 1UX4A 2XAJB 4AQFA 2V7KA 4L5GA 2IAKA 4KX6A 2IIUA 3PJAA 3JAFA 2Q9QD 5BMVE 4UVAB 5JDQA 2KMFA 3S4UA 5L3DB 4JI4T 2PFVA 4LFAT 4TZ4C 3UUNA 3LJCA 1N36T 2LJLA 4XBFB 4Z90A 1FJGT 4NXNT 5J0ZA 3SRZA 2I0MA 2XHEB 1VOMA 4AQFC 4O8SA 4IDPA 3GN5A 2XM1A 1XMOT 5AQHB 4J2CA 4CXXA 4GYRA 4EB6E 3HKBE 4DBRA 4NUVA 2ACZA 3DTOA 5HEOA 3KV6A 2CMRA 3AA7B 5BR8T 2NW9A 4P0AA 3HA4A 5L3CB 2IW5B 1KNZA 4TWDA 4HTEA 5AFUL 2K9AA 2MPKA 2NP9A 4TWFA 5ETWA 3R6NA 2VVSA 3ZLIA 1XNRT 5AQVB 3OYZA 2MAWA 4OK0A 3KFWX 1NAFA 2NWBA 4DV0T 4YSYA 2UXBT 4IIJE 4DR1T 3QC9A 3C4ZA 4NXMT 2UUCT 3MA9A 2X9HA 3UTKA 2V7LA 1KNRA 1VCSA 4IE0A 3N2KE 4HWHA 4EAHA 4UF0A 2Q9QB 3PUQA 3W15B 4ILAA 3SFEA 4LF9T 3KV5A 3ZMTB 4IE7A 1YW0A 2CXFA 3Q5EA 5JDHA 2BG9A 5HYAA 2NW8A 4ILCA 4A5XA 3SOLA 1BR2A 4UVBB 4WYVA 1HNXT 4ZI2C 4E7ZA 1NEKA 2PJQA 5L47A 3CIRA 3O1HA 3RI5A 1D0ZA 4WBNE 2LSGA 4HN9A 3RKOA 4ISSA 2V6YB 3HKCE 2W0GA 2IC6A 3AAIA 2ZLYA 3GWHA 2W66A 5HXHA 4OFZA 3PUAA 1W09A 5ABHA 5A1LA 4U31A 1XDPA 2WCAA 4HWIB 2OLTA 5JQGE 3JC6D 3P7IA 4IHJE 4AQYT 3RC3A 4X64T 4IDOA 1NENA 2WS3A 4OHFA 2WDVA 5LOVE 3JADA 2EHOB 1XZYA 2UXXB 3TLUA 4NIQA 2PTFA 5LGNB 3I0OA 1FEWA 1MIYA 2E2AA 3MK7C 1LRZA 2LM9A 3FXEB 1LVKA 4G63A 4O4HE 4CXYA 3VKHA 2CPTA 1EZ3A 3ZC0A 2E8IA 5AQPB 3ZCJA 3ZPOA 3UQ7A 5J2TE 5LGUB 2WY2A 4PNIA 1UURA 2H3RA 4YXDA 4YHJA 4CN1A 3ANWA 2BZBA 4ZEYA 3RIUC 4ZOLE 3ZEFB 2DCFA 2Q9QC 5LYJE 4DR4T 4EYUA 1J1JA 4HWCA 4DV3T 4MLKA 3U78A 3FB2A 1OXZA 1HR0T 5JDNA 4CXWA 1OEDB 3CVRA 4TNVA 4I0UA 2H7VC 3O9XA
chains in the Genus database with same CATH topology
1UCUA 4CZZB 4PW8A 5E0OA 4C90A 4DBQA 3KBUA 1G73A 3NRYA 4OYJA 3ZYKA 3R84B 3UFEA 3ONXA 2E9XC 4EOZB 4TN7B 5LHIB 5JRCB 2NW7A 2WAUA 2LEHA 2BDEA 2C5IT 2LOPA 3HL6A 5JVDE 5LBQB 4ZI2D 2ODVA 4HGAA 1G8XA 1BR1A 1LKXA 2V1DB 2ZM8A 4PK5A 3V5UA 4AI6A 2KWIB 5F3JA 2JRKA 4EZ4A 2L9QA 1ZV4X 2A72A 4FJOA 4OYKA 1QUUA 2CLYB 3PU8A 2LSYA 3ZYLA 3WAKA 4AKIA 4GIWA 3KINB 3AVRA 5EK2A 1D1AA 1D1BA 4H9OC 1AJ3A 4EYYR 4E7SA 2CM0A 4ZS3A 5LA6E 3IBPA 2CLYC 3ZJ2A 2DWGA 3BQIA 2I59A 2WBLA 2OA5A 4U72A 2V26A 3WAJA 3MKDA 4I4TE 1ZHCA 4JUYA 1HX8A 3ETVA 2KXPB 3NZQA 3NRXA 2VK9A 3V5SA 4DMVA 1VRBA 2C5JA 2XAFB 3LG7A 3ZMVB 4PJLA 3AAEB 4MALA 4HEAA 2PG8A 3P8CD 3KVAA 3EVYA 5FNVE 2D5UA 2LSKA 2YU1A 1MIVA 4TUYE 4ISTA 3K8PC 2V7MA 5IYZE 2X68A 4MFRA 4TV9E 5JDFA 1HF8A 4EXTA 5JR9A 3J7Yq 4NUUA 3ETUA 5DABA 3RYFE 3H3AA 3LK2B 3T8OA 2Z6EA 5FY0A 2MOZA 5L3EB 2ZM2A 4DO0A 2VKHA 4YLHA 4JEHB 2DLRA 3C4WA 4TV8E 2A2FX 5JDLA 5HWYA 4JLEA 1B7TA 3RX6A 4AKRB 3GMIA 3KBTA 2LE8A 4QKNA 1HG2A 2EHOD 4BJMA 3PURA 5HWXA 2WSSV 1Y64B 2CWOA 3SWHA 4Z8XA 4FI5A 5JR9B 3PTRB 1D0XA 4K0UA 2ZM0A 4UV8B 3LK42 4XZCA 3MXZA 3HR0A 1FIOA 3ZMSB 2DWKA 3GA8A 4QXCB 2Y8DA 4PJMA 3DP7A 1HTJF 5C8YE 5LXTE 5JR9C 3N2GE 5DJQC 2X9XA 3Q9DA 3N2OA 1UX4A 4O4IE 3CQCB 3N9LA 2J1DG 3E0ZA 2XAJB 2B1EA 2W61A 4H9QC 4AQFA 2V7KA 4L5GA 2GK9A 2IAKA 2KWHA 1V9DA 3EUHA 4IE6A 4L0RA 4ERRA 5LHGB 1YKHB 4YJ3E 2X51A 2V7IA 4DMWA 3IEEA 2RA1A 2CXLA 2Q9QD 5DQWA 5BMVE 4UVAB 5JDQA 2KMFA 2LHRA 3OKQA 3KV4A 2VASA 1US7B 2BVMA 3S4UA 1IJ6A 3PUGA 1BR4A 1HFAA 5L3DB 2PFVA 4TZ4C 5L3BB 3UUNA 3AA0B 1HG5A 3LJCA 3O1IA 2ODUA 3E22E 2X0LB 4X1IE 2LJLA 4XBFB 2LOSA 4V1Av 3RRCA 4CI3B 3TKLB 3MACA 3SRZA 5LJMA 2KINB 2D2SA 2XHEB 1VOMA 3EDUA 1LVFA 3O1JA 5LJNA 3FBLA 3OYXA 4AQFC 4O8SA 4PK6A 4QXBB 4ZI3D 4KBMB 3HI2A 1OWAA 4X20E 4AKHA 3GN5A 4I55E 3C51A 4J2CA 4CXXA 3ZN0B 4GYRA 5H6RB 3HKBE 3RH3A 4EB6E 4DBRA 5LHHB 4NUVA 4PJNA 2N1GA 3C98B 4KP3C 3JC6C 4IDZA 4I43B 2E9XD 3LBXA 1MMDA 3DTOA 4PAGA 4H9RC 4PK4A 3ZYMA 3PE0A 3SS1A 2CE7A 4KMCA 3KV6A 2L3LA 4GOUA 3ZMUB 2VB6A 4X1KE 2CMRA 3AA7B 4IGUA 2C0SA 2JMHA 5FY7A 4ASKA 3PDYA 3ZMZB 5EK3A 3NBXX 4WBOA 1D0YA 5FP3A 2NW9A 4P0AA 3GN5B 3HA4A 2HPLA 1MMNA 4ILUA 5L3CB 2IW5B 5EK4A 3QK6A 3NZPA 4GK0E 4P09A 1KNZA 1UX5A 2NOXA 4HTEA 5AFUL 4YJ2E 4PFPA 2XQYA 5GONE 3CWZB 2MBGA 3BQKA 2K9AA 5KX5E 5LP6E 3AA1B 4PJJA 5DQVA 2LSJA 5CA0E 2NP9A 4H9SE 5ETWA 3R6NA 3L09A 4BAYB 4XAXB 1SA0E 2JJ9A 2XAHB 4YFSA 2XUEA 3Q2MA 4ADZA 5LGTB 3ZLIA 4EIWA 3RC8A 1YKEB 4H63V 1D1CA 1X79A 2DNXA 2X9WA 4WW0A 3LFMA 3MZKB 3OYZA 4CI2B 4PFOA 5LG4A 3DJBA 3FXDB 4OK0A 3KFWX 2LSIA 2VWAA 4AQGA 1NAFA 2NWBA 1H7CA 2Q9QA 2WWUA 2VKJA 3CX6B 4IIJE 2K5BB 3QC9A 3CX8B 3BQLA 4H9PC 3ESLA 5FXVA 4HKAA 3C4ZA 2C5KT 3RPUA 4BJNA 5EZYE 4A56A 4CQIA 3CX7B 4IE5A 3C4XA 3MA9A 4M1PA 2X9HA 5FXXA 3UTKA 3F2EA 4DVDA 4EZHA 2D0UA 2V7LA 3KDSE 2BVLA 4UXNB 2YU2A 4QXHB 2HH7A 3PU3A 4IE0A 2JPFA 5KMGP 4IE4A 5ADXL 2YINA 3N2KE 3AB3B 4UF0A 4EAHA 2Q9QB 3PUQA 3CKDA 4O4LE 3ZN1B 4AKLA 3W15B 1CUNA 3RYIE 2VKOA 3N9OA 2DHRA 2XTLA 2KZ7B 2MTQA 3KV5A 3WI3A 2RP4A 1HS7A 4DNDA 3N9NA 2CCQA 3QUJA 4HE8A 2W62A 3VU7H 2X67A 4BA9A 4MBQA 3ZMTB 2H7OA 4IE7A 2G0UA 1WR6A 2YK0A 5FYMA 3RRWA 4I50E 3FHNA 1YW0A 2CXFA 1T98A 2D0TA 3I9YA 5JDHA 4P0BA 5HYAA 2NW8A 4UF0B 3I0QA 3E08A 3PUSA 4N78D 5LCYA 3ZCIA 3SOLA 4F6RC 1BR2A 1E1HB 1MNEA 2ZMAA 4UVBB 2XAGB 1FMVA 3Q5XA 2Y48B 4QX8B 1ZKEA 3HKDE 4ZI2C 4E7ZA 4ZHQE 2PJQA 3CQGB 3O1HA 1NWMX 1MMGA 2XASB 3LK3B 1D0ZA 4WBNE 2LSGA 3N9PA 4HN9A 4X1YE 3RKOA 3N5LA 3UUMA 3IF8B 1HCIA 5F8PA 3N9QA 4ISSA 5JDGA 1BR0A 3D0TA 4QWNB 2WM9A 3HKCE 2W0GA 2IC6A 2L8KA 3AAIA 3VHLA 5LNKA 4UELA 2JMKA 2ZLYA 3IHRA 5HXRA 3GWHA 5J1GA 3N9MA 5HXHA 1MNDA 1S94A 4OFZA 4QX7B 5HXSA 3PUAA 2W00A 2N9DA 2EHOA 4B6XA 5M4YA 5HXCA 2DI4A 3AAAB 5A1LA 3MJXA 2CEAA 3OBVE 1IAPA 2VL8A 4UV9B 5H6QB 3ZJ1A 5JQGE 2X66A 1YD8G 5L3FB 3RYCE 3JC6D 3K3NA 5FMNA 3J9X1 3P7IA 4IHJE 3LBXB 4JEUB 5CB4E 3Q5WA 3C50A 4O2BE 3RC3A 2YEVC 4GYSA 3FBZA 4OHFA 2JQQA 5L2LA 4O4JE 1IJ5A 5HXEA 5HAXA 5LOVE 2X9YA 2LT3A 2EHOB 5FXWA 2CA5A 2WMNA 3I9WA 2UXXB 2WMOA 5JH7E 1WRDA 3H37A 3KVBA 4UIGA 5TAOA 2XAQB 1MMAA 3O4XE 4ZI7E 2EHOC 3I0OA 5LGNB 1FEWA 1S35A 5KDMC 1MIYA 2K24A 3MK7C 3CPZA 4CI1B 1LRZA 3VKGA 2LM9A 4L9IA 3FXEB 1LVKA 2QGSA 4G63A 5CA1E 4O4HE 1WLXA 2LHNA 3U3IA 4CXYA 3VKHA 5J2UE 2KLQA 1EZ3A 3CMLA 4TX5A 2Y6XA 3CQXC 3ZC0A 1QSDA 2E8IA 4H9NC 3ZCJA 3UUXB 3ZPOA 1FMWA 1O3XA 5LGUB 3UT5E 5J2TE 1ZEEA 3A5XA 4H63H 4MHCA 4UVCB 4PNIA 2H3RA 2MYSA 2SPCA 2NTXA 4YHJA 5FY1A 3ANWA 2BZBA 2HPJA 4G2AA 3UULA 1KK7A 4C91A 3F31A 3ZC1A 1MIWA 3K3OA 4U74A 2ACXA 2ES0A 2N2NA 2W63A 1WYBA 4ZOLE 5FXZA 3RYHE 3ZEFB 1IZNB 4GK5E 3K3QC 2DCFA 5JREA 2Q9QC 2VKDA 5LYJE 3M65A 2UXNB 4EYUA 5L3GB 1WYCA 2A3DA 3EDVA 2E9XA 3OJAA 3AVSA 2QA7A 3HKEE 3KV9A 2V7JA 1U5PA 4MLKA 2NTYA 2CWYA 3I1AA 5LBMA 1SHZC 3U78A 3FB2A 4ZS2A 5JDMA 2CXDA 4AXPA 4AKGA 5JRCA 3ANWB 4QHOA 1OXZA 3F57A 5IHYA 4ANJA 3B13A 4HFVA 5JDNA 3AA6B 4KUMB 4CXWA 2M67A 3C64A 3L3PA 2K48A 2P9BA 2KNDA 3CVRA 4UEMA 1Z0PA 2IC9A 1U4QA 2H7VC 2PBIA 4ZI3C 4O2AE 3O9XA 4WNKA 3B57A 2E9XB 2KT9A 3BK9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4H63 V;  3R84 B; 
#chains in the Genus database with same CATH topology
 1J5E T;  3OTO T;  5E0O A;  2AE9 A;  1G73 A;  3UFE A;  3ONX A;  3PV0 F;  2BDE A;  2LOP A;  2VL0 A;  5AQJ B;  3H3M A;  1G8X A;  1BR1 A;  5LB7 B;  2ZM8 A;  4OYK A;  1QUU A;  4AKI A;  4GIW A;  3KIN B;  1W0A A;  2DWG A;  1KFY A;  2I59 A;  2WBL A;  4AIS A;  1XWM A;  4MAL A;  4HEA A;  3P50 A;  5FNV E;  2XSB A;  4TUY E;  4QH4 A;  4IST A;  3K8P C;  4B3M T;  3OPC A;  5JR9 A;  3ETU A;  4WZX A;  5FY0 A;  2MOZ A;  4DO0 A;  3AXJ A;  2HN1 A;  4LF7 T;  3GMI A;  3KBT A;  1HG2 A;  2BKN A;  5HWX A;  2IDO B;  3PTR B;  4UV8 B;  1UK5 A;  3ZT7 A;  3ZMS B;  4QXC B;  3DP7 A;  5JR9 C;  3N2G E;  3K1S A;  1Z8U A;  1JNR A;  3Q9D A;  4O4I E;  3N9L A;  1YXR A;  2J1D G;  2B1E A;  5ABF A;  3EUH A;  2CBJ A;  4YJ3 E;  5FL1 A;  2XQ3 A;  2VAS A;  3G06 A;  1IJ6 A;  3PUG A;  1HFA A;  5L3B B;  3AA0 B;  1HG5 A;  1W0B A;  2BBJ A;  3O1I A;  4HWF A;  2ODU A;  3E22 E;  1WR0 A;  4X1I E;  3O1J A;  5LJN A;  3FBL A;  4QXB B;  4IDQ A;  4OX9 T;  4JI2 T;  4DV4 T;  3AE2 A;  2N1G A;  3JC6 C;  1MMD A;  3PUZ F;  3SS1 A;  2F4V T;  1JNZ A;  2VB6 A;  4X1K E;  1I94 T;  4IGU A;  2C0S A;  3NBX X;  4WBO A;  1D0Y A;  3NVO A;  3GN5 B;  5HEU A;  2UUA T;  5EK4 A;  1UX5 A;  2NOX A;  2V5C A;  2XQY A;  5GON E;  3BQK A;  3AA1 B;  5AQL B;  3L09 A;  4EED A;  4BAY B;  4LMJ A;  2JJ9 A;  4B3R T;  4JI5 T;  2XUE A;  3Q2M A;  1WCR A;  1R8I A;  2JIW A;  3T1H T;  3M3Z B;  3LFM A;  2XY8 B;  3UU5 A;  4JI7 T;  1CHU A;  1KEY A;  4U2Y A;  5LG4 A;  2VWA A;  3P4Q A;  2WWU A;  2K5B B;  4H9P C;  2WDQ A;  2H89 A;  4M1P A;  2BS2 A;  3KDS E;  4UXN B;  2YU2 A;  2HH7 A;  2JPF A;  5KMG P;  4O4L E;  2VUR A;  4AKL A;  2UXC T;  3RYI E;  2VKO A;  3N9O A;  4U7Y A;  2DHR A;  2RP4 A;  4DR3 T;  1GQE A;  3RRW A;  4I50 E;  2XQ7 A;  1T98 A;  5HCJ A;  4P0B A;  5IUX A;  4UF0 B;  2ZMA A;  5AQN B;  3L8R A;  4QX8 B;  1XDO A;  3HKD E;  4DV1 T;  3LK3 B;  2R6G F;  3RQW A;  3N5L A;  2YDQ A;  5F8P A;  1BR0 A;  4IDN A;  2BG9 B;  2V5D A;  4QWN B;  2WM9 A;  4YTP A;  5LNK A;  2XQA A;  2DL1 A;  3A7M A;  5J1G A;  5KXJ A;  1MND A;  5HXS A;  2W00 A;  2N9D A;  4B6X A;  5HXC A;  2DI4 A;  3AAA B;  5AQF B;  2XQ9 A;  4U3C A;  2AXD S;  3OBV E;  1YQ3 A;  2VL8 A;  4CN4 A;  5FVK A;  3RYC E;  3J9X 1;  1ZOY A;  3LBX B;  4JEU B;  5CB4 E;  4O2B E;  3FBZ A;  4DV6 T;  2JQQ A;  4DR6 T;  2LT3 A;  2J62 A;  2WZI A;  5FXW A;  4X66 T;  2WMN A;  2WMO A;  5JH7 E;  3H37 A;  2K24 A;  1OED E;  4L9I A;  5CA1 E;  1WLX A;  2LHN A;  4TNW A;  3CQX C;  2XSA A;  3UT5 E;  3A5X A;  4H63 H;  4MHC A;  4UVC B;  2NTX A;  4JV5 T;  4DV7 T;  4G2A A;  3UUL A;  2M6B A;  1M7K A;  3ZC1 A;  4IL9 A;  1WYB A;  2VKD A;  2UXN B;  5L3G B;  1WYC A;  2A3D A;  3I1A A;  3QB5 K;  3ANW B;  4QHO A;  5IHY A;  4ANJ A;  2FBW A;  3C64 A;  2UXD T;  2P9B A;  2KND A;  4UEM A;  4IL4 A;  2IC9 A;  2E5L T;  4WNK A;  2FJB A;  3B57 A;  3JCF A;  2KT9 A;  1UCU A;  4LF4 T;  2H88 A;  3KBU A;  3NRY A;  3R84 B;  4AIU A;  2WAU A;  3LSV A;  4KI0 F;  2BG9 C;  2WZH A;  2WDR A;  4P1N A;  5HCM A;  1LKX A;  2V1D B;  4HFE A;  4PK5 A;  3V5U A;  2KWI B;  3RF1 A;  5F3J A;  2JRK A;  5FKY A;  1ZV4 X;  2A72 A;  3ZYL A;  3FZH B;  1AJ3 A;  3ABV A;  5AQG B;  4E7S A;  3ZJ2 A;  4NPP A;  2OA5 A;  4U72 A;  4JUY A;  2XM2 A;  1HX8 A;  3ETV A;  3NZQ A;  3RIA A;  4DMV A;  3ZMV B;  2IUB A;  2V8S V;  2PG8 A;  4HFH A;  2BBH A;  3EVY A;  2V7M A;  5JTG A;  5IYZ E;  4EXT A;  2WB5 A;  4NUU A;  1YQ4 A;  5DAB A;  3IA3 A;  4TWH A;  3RYF E;  2UUB T;  4HFI A;  2DLR A;  3C4W A;  2J47 A;  1XMQ T;  5AQU B;  4JLE A;  2ZM6 T;  3RX6 A;  4AKR B;  4LFC T;  4QKN A;  5AQQ B;  3PUR A;  2WSS V;  1UGO A;  4JBW F;  5JR9 B;  4K0U A;  2W4X A;  2DWK A;  3GA8 A;  2BKO A;  1IBK T;  3AXJ B;  5HEH A;  1E7P A;  3AED A;  2X9X A;  1DU2 A;  3CQC B;  5AQS B;  1T8B A;  2V6X A;  3EAM A;  2GK9 A;  2KWH A;  1V9D A;  3NKZ A;  4IE6 A;  4L0R A;  1YKH B;  2I6H A;  2HHH T;  2X51 A;  2V7I A;  3IEE A;  1W9R A;  2LHR A;  3OKQ A;  3CK6 A;  3QNU A;  2FJD A;  1US7 B;  2BVM A;  2XJ7 A;  2XQ8 A;  2QVA A;  2WU5 A;  4HFB A;  2YDR A;  2X0L B;  2LOS A;  5ABF B;  2W2U A;  4CI3 B;  1XNQ T;  3MAC A;  5LJM A;  2KIN B;  2D2S A;  5F5W A;  4DID B;  1LVF A;  4IT4 A;  4ZI3 D;  5LMU T;  3A8Y C;  1OWA A;  4X20 E;  3C51 A;  4COF A;  3RH3 A;  4Z91 A;  5LHH B;  3P4P A;  4KP3 C;  2E9X D;  2WP9 A;  4PAG A;  4H9R C;  4A97 A;  3AE6 A;  3PE0 A;  2LKH A;  4KMC A;  2L3L A;  4GOU A;  3ZMU B;  4QH5 A;  2JMH A;  3PUX F;  1IBM T;  3PDY A;  3VR8 A;  4X62 T;  3ZMZ B;  5EK3 A;  5FP3 A;  2HPL A;  1MMN A;  4ILU A;  1E2A A;  3QK6 A;  3NZP A;  4GK0 E;  4P09 A;  3AEG A;  2LRL A;  1VCT A;  3P4R A;  3CWZ B;  2MBG A;  5KX5 E;  4PJJ A;  5DQV A;  2LSJ A;  4YSZ A;  4H9S E;  4XAX B;  3JAE A;  4YFS A;  2XAH B;  4ADZ A;  5LGT B;  3RC8 A;  4U33 A;  4A98 A;  4H63 V;  1D1C A;  1X79 A;  2DNX A;  2X9W A;  3MZK B;  3RLF F;  3AE4 A;  3DJB A;  2LSI A;  4AQG A;  4DUZ T;  3CX6 B;  3ESL A;  5FXV A;  2A9U A;  2C5K T;  3RPU A;  4BJN A;  4IRE A;  5EZY E;  4A56 A;  4CQI A;  3C4X A;  4DVD A;  3F2E A;  2D0U A;  3T1Y T;  2FJE A;  4QXH B;  4X5T A;  1M62 A;  3PU3 A;  4IE4 A;  5ADX L;  3UFG A;  3AB3 B;  3AE7 A;  4HWD A;  3CKD A;  3ZN1 B;  3OVU A;  2KZ7 B;  2MTQ A;  1HS7 A;  4DND A;  4YY3 T;  5FVL A;  2CCQ A;  3QUJ A;  4HE8 A;  2RPA A;  3VU7 H;  1WFD A;  4BA9 A;  3ONJ A;  3RQU A;  4KHZ F;  2YK0 A;  3FHN A;  2D0T A;  3I9Y A;  3FZK B;  3RIF A;  3I0Q A;  3NWI A;  5LCY A;  4F6R C;  3ZCI A;  3PUY F;  1MNE A;  1FMV A;  4DR2 T;  2IML A;  2Y48 B;  1ZKE A;  4ZHQ E;  1NWM X;  1UUS A;  3N9P A;  4X1Y E;  3IF8 B;  1HCI A;  2YKS A;  3N9Q A;  5JDG A;  3AE8 A;  2L8K A;  4UEL A;  4EV6 A;  2JMK A;  4YSX A;  4LF6 T;  5CFB A;  4DR7 T;  2CEA A;  4F8H A;  3UU8 A;  1IAP A;  5H6Q B;  5AQK B;  1YD8 G;  3K3N A;  5FMN A;  3Q5W A;  2YEV C;  3UU4 A;  4O4J E;  5HXE A;  3AE3 A;  2WQY A;  2CA5 A;  2HN2 A;  3I9W A;  1WRD A;  4DUY T;  3O4X E;  1MMA A;  4ZI7 E;  5CJ5 A;  2LRK A;  2K3W A;  3X1D A;  5KDM C;  3CPZ A;  3VKG A;  2CHO A;  2OV9 A;  1X9B A;  2Y6X A;  4H9N C;  3UUX B;  3AEA A;  1O3X A;  1N33 T;  2MYS A;  4UR9 A;  2SPC A;  2XQ4 A;  1HX1 B;  1KK7 A;  4JI1 T;  2LLY A;  1MIW A;  3FZM B;  2N2N A;  2ES0 A;  2BS3 A;  2W63 A;  2FUP A;  1IZN B;  4YTM A;  5AQO B;  4GK5 E;  3EDV A;  4JI6 T;  2E9X A;  3OJA A;  3AVS A;  4ZXL A;  2V7J A;  4QH1 A;  2NTY A;  3AE1 A;  2CWY A;  2CXD A;  4AXP A;  5JRC A;  3B13 A;  4HFV A;  1J5W A;  3UQ4 A;  3AA6 B;  2E5V A;  5CGM A;  2K48 A;  1QLB A;  1U4Q A;  4ZI3 C;  2PBI A;  4O2A E;  4HFC A;  5HEJ A;  4LFB T;  5JRE A;  3BK9 A;  4CZZ B;  4C90 A;  4OYJ A;  2D9D A;  2E9X C;  4LML A;  5LHI B;  2NW7 A;  2C5I T;  3HL6 A;  2QRX A;  4DR5 T;  2IHR 1;  3VRA A;  4AI6 A;  4EZ4 A;  3PU8 A;  3AVR A;  5EK2 A;  1D1A A;  1D1B A;  3QB5 A;  4EYY R;  2CLY C;  2JQH A;  3PUV F;  4B3S T;  3VR9 A;  3MKD A;  4I4T E;  1ZHC A;  2KXP B;  3NRX A;  3V5S A;  1VRB A;  2XQ6 A;  2FJA A;  3KVA A;  2D5U A;  1T7S A;  1MIV A;  2YU1 A;  2X68 A;  5JDF A;  3J7Y q;  4ZZB A;  4U2Z A;  3T8O A;  5L3E B;  2ZM2 A;  4K0K T;  4TV8 E;  5HWY A;  1B7T A;  2VQE T;  2EHO D;  4BJM A;  2YN6 A;  1Y64 B;  3SWH A;  1D0X A;  3LK4 2;  4XZC A;  3UU6 A;  2J4G A;  2Y8D A;  3AEB A;  1HTJ F;  5DJQ C;  1KF6 A;  2BKP A;  3E0Z A;  4HFD A;  2W61 A;  4H9Q C;  4ERR A;  5LHG B;  4DMW A;  4DV5 T;  2RA1 A;  2CXL A;  5DQW A;  3PJA J;  4YT0 A;  3KV4 A;  5ABE A;  4GKK T;  1BR4 A;  3TLS A;  5LG3 A;  1T72 A;  5L4E A;  4V1A v;  5AQM B;  3RRC A;  3TKL B;  2WU2 A;  2XPK A;  3EDU A;  3ZT5 A;  3OYX A;  1SUM B;  4PK6 A;  3RGL A;  4KBM B;  3HI2 A;  4AKH A;  4I55 E;  4U7I A;  5AQT B;  2CRB A;  2BS4 A;  3ZN0 B;  5H6R B;  5ABG A;  4PJN A;  3C98 B;  4I43 B;  4IDZ A;  3LBX A;  4PK4 A;  3ZYM A;  2YDS A;  2CE7 A;  2YOE A;  5FY7 A;  4ASK A;  3P4S A;  4YJ2 E;  4PFP A;  3TLT A;  5LP6 E;  5CA0 E;  1ZP0 A;  5C2T A;  4Q25 A;  1SA0 E;  3L39 A;  4EIW A;  1YKE B;  5IWA T;  4WW0 A;  3QOF A;  4CI2 B;  4PFO A;  5AQR B;  3RIU A;  3FXD B;  3RHW A;  5FL0 A;  2Q9Q A;  1H7C A;  2VKJ A;  3CX8 B;  3BQL A;  4HKA A;  4LF5 T;  3B5M A;  1IBL T;  3CX7 B;  4IE5 A;  5FXX A;  4EZH A;  2BVL A;  3UUB A;  2YIN A;  5LMN T;  3ZST A;  2XZE A;  1CUN A;  2XTL A;  3WI3 A;  3N9N A;  2W62 A;  2X67 A;  4MBQ A;  1HNW T;  2H7O A;  2G0U A;  1WR6 A;  5FYM A;  2VVN A;  3ZKR A;  2V6Y A;  2UU9 T;  5AQI B;  3E08 A;  3PUS A;  4N78 D;  1E1H B;  2CHN A;  2X0H A;  2XAG B;  3Q5X A;  1L0V A;  5C3J A;  3CQG B;  1MMG A;  2XAS B;  3UUM A;  2NR4 A;  3D0T A;  3VHL A;  1N34 T;  3IHR A;  5HXR A;  3AEE A;  3N9M A;  1S94 A;  4QX7 B;  2EHO A;  5M4Y A;  3RKG A;  2B76 A;  3MJX A;  4JYA T;  4DV2 T;  4UV9 B;  3ZJ1 A;  2X66 A;  5L3F B;  4CN6 A;  3C50 A;  4GYS A;  4JI8 T;  5L2L A;  1IJ5 A;  5HAX A;  2X9Y A;  2LM2 A;  3ZT6 A;  2W67 A;  3KVB A;  4UIG A;  5TAO A;  2XAQ B;  2EHO C;  3Q5D A;  1S35 A;  4CI1 B;  4ZZC A;  2QGS A;  2WWV A;  3U3I A;  5J2U E;  2KLQ A;  3CML A;  4TX5 A;  3AE5 A;  1QSD A;  1FMW A;  3EI0 A;  1ZEE A;  2CBI A;  2BG9 E;  5FY1 A;  4ILB A;  2HPJ A;  4KHP T;  2VQF T;  4YTN A;  3SFD A;  4C91 A;  3F31 A;  1OED A;  3K3O A;  4U74 A;  2ACX A;  3RYH E;  5FXZ A;  3K3Q C;  3M65 A;  3FZF B;  1I6Z A;  5L4H A;  2QA7 A;  3HKE E;  3KV9 A;  1U5P A;  1Y01 A;  3ONL C;  5LBM A;  1SHZ C;  2XQ5 A;  4ZS2 A;  5JDM A;  4AKG A;  3F57 A;  3AEF A;  3TLV A;  3TLW A;  4KUM B;  2M67 A;  3L3P A;  4JI3 T;  3P4W A;  1Z0P A;  1OED C;  2E9X B;  4PW8 A;  4DBQ A;  4GKJ T;  3ZYK A;  4EOZ B;  4TN7 B;  5JRC B;  2LEH A;  4YHH T;  4JI0 T;  2LKG A;  5JVD E;  5LBQ B;  4ZI2 D;  2ODV A;  4HGA A;  4EEB A;  3VRB A;  2L9Q A;  4FJO A;  2CLY B;  2LSY A;  3WAK A;  4H9O C;  3FZL B;  2CM0 A;  4ZS3 A;  5LA6 E;  3IBP A;  2JQK A;  3BQI A;  1KNP A;  2V26 A;  3WAJ A;  3EAB A;  2VK9 A;  3LG7 A;  2C5J A;  2XAF B;  2QYW A;  4PJL A;  3AAE B;  3P8C D;  4B3T T;  2M6I A;  2LSK A;  4MFR A;  4TV9 E;  1HF8 A;  3AEC A;  5HEG A;  3H3A A;  3LK2 B;  3ZSS A;  2JQ9 A;  2Z6E A;  2VKH A;  4YLH A;  3UU3 A;  4JEH B;  3PUW F;  2A2F X;  5JDL A;  4EGW A;  2LE8 A;  4LF8 T;  1N32 T;  2CWO A;  3LDQ B;  4Z8X A;  4FI5 A;  4X65 T;  4LMK A;  2ZM0 A;  3MXZ A;  3HR0 A;  1FIO A;  1HNZ T;  4PJM A;  5C8Y E;  5LXT E;  2KSR A;  2X0Y A;  3EHZ A;  1SE7 A;  3AE9 A;  3N2O A;  1UX4 A;  2XAJ B;  4AQF A;  2V7K A;  4L5G A;  2IAK A;  4KX6 A;  2IIU A;  3PJA A;  3JAF A;  2Q9Q D;  5BMV E;  4UVA B;  5JDQ A;  2KMF A;  3S4U A;  5L3D B;  4JI4 T;  2PFV A;  4LFA T;  4TZ4 C;  3UUN A;  3LJC A;  1N36 T;  2LJL A;  4XBF B;  4Z90 A;  1FJG T;  4NXN T;  5J0Z A;  3SRZ A;  2I0M A;  2XHE B;  1VOM A;  4AQF C;  4O8S A;  4IDP A;  3GN5 A;  2XM1 A;  1XMO T;  5AQH B;  4J2C A;  4CXX A;  4GYR A;  4EB6 E;  3HKB E;  4DBR A;  4NUV A;  2ACZ A;  3DTO A;  5HEO A;  3KV6 A;  2CMR A;  3AA7 B;  5BR8 T;  2NW9 A;  4P0A A;  3HA4 A;  5L3C B;  2IW5 B;  1KNZ A;  4TWD A;  4HTE A;  5AFU L;  2K9A A;  2MPK A;  2NP9 A;  4TWF A;  5ETW A;  3R6N A;  2VVS A;  3ZLI A;  1XNR T;  5AQV B;  3OYZ A;  2MAW A;  4OK0 A;  3KFW X;  1NAF A;  2NWB A;  4DV0 T;  4YSY A;  2UXB T;  4IIJ E;  4DR1 T;  3QC9 A;  3C4Z A;  4NXM T;  2UUC T;  3MA9 A;  2X9H A;  3UTK A;  2V7L A;  1KNR A;  1VCS A;  4IE0 A;  3N2K E;  4HWH A;  4EAH A;  4UF0 A;  2Q9Q B;  3PUQ A;  3W15 B;  4ILA A;  3SFE A;  4LF9 T;  3KV5 A;  3ZMT B;  4IE7 A;  1YW0 A;  2CXF A;  3Q5E A;  5JDH A;  2BG9 A;  5HYA A;  2NW8 A;  4ILC A;  4A5X A;  3SOL A;  1BR2 A;  4UVB B;  4WYV A;  1HNX T;  4ZI2 C;  4E7Z A;  1NEK A;  2PJQ A;  5L47 A;  3CIR A;  3O1H A;  3RI5 A;  1D0Z A;  4WBN E;  2LSG A;  4HN9 A;  3RKO A;  4ISS A;  2V6Y B;  3HKC E;  2W0G A;  2IC6 A;  3AAI A;  2ZLY A;  3GWH A;  2W66 A;  5HXH A;  4OFZ A;  3PUA A;  1W09 A;  5ABH A;  5A1L A;  4U31 A;  1XDP A;  2WCA A;  4HWI B;  2OLT A;  5JQG E;  3JC6 D;  3P7I A;  4IHJ E;  4AQY T;  3RC3 A;  4X64 T;  4IDO A;  1NEN A;  2WS3 A;  4OHF A;  2WDV A;  5LOV E;  3JAD A;  2EHO B;  1XZY A;  2UXX B;  3TLU A;  4NIQ A;  2PTF A;  5LGN B;  3I0O A;  1FEW A;  1MIY A;  2E2A A;  3MK7 C;  1LRZ A;  2LM9 A;  3FXE B;  1LVK A;  4G63 A;  4O4H E;  4CXY A;  3VKH A;  2CPT A;  1EZ3 A;  3ZC0 A;  2E8I A;  5AQP B;  3ZCJ A;  3ZPO A;  3UQ7 A;  5J2T E;  5LGU B;  2WY2 A;  4PNI A;  1UUR A;  2H3R A;  4YXD A;  4YHJ A;  4CN1 A;  3ANW A;  2BZB A;  4ZEY A;  3RIU C;  4ZOL E;  3ZEF B;  2DCF A;  2Q9Q C;  5LYJ E;  4DR4 T;  4EYU A;  1J1J A;  4HWC A;  4DV3 T;  4MLK A;  3U78 A;  3FB2 A;  1OXZ A;  1HR0 T;  5JDN A;  4CXW A;  1OED B;  3CVR A;  4TNV A;  4I0U A;  2H7V C;  3O9X A; 
#chains in the Genus database with same CATH homology
 1UCU A;  4CZZ B;  4PW8 A;  5E0O A;  4C90 A;  4DBQ A;  3KBU A;  1G73 A;  3NRY A;  4OYJ A;  3ZYK A;  3R84 B;  3UFE A;  3ONX A;  2E9X C;  4EOZ B;  4TN7 B;  5LHI B;  5JRC B;  2NW7 A;  2WAU A;  2LEH A;  2BDE A;  2C5I T;  2LOP A;  3HL6 A;  5JVD E;  5LBQ B;  4ZI2 D;  2ODV A;  4HGA A;  1G8X A;  1BR1 A;  1LKX A;  2V1D B;  2ZM8 A;  4PK5 A;  3V5U A;  4AI6 A;  2KWI B;  5F3J A;  2JRK A;  4EZ4 A;  2L9Q A;  1ZV4 X;  2A72 A;  4FJO A;  4OYK A;  1QUU A;  2CLY B;  3PU8 A;  2LSY A;  3ZYL A;  3WAK A;  4AKI A;  4GIW A;  3KIN B;  3AVR A;  5EK2 A;  1D1A A;  1D1B A;  4H9O C;  1AJ3 A;  4EYY R;  4E7S A;  2CM0 A;  4ZS3 A;  5LA6 E;  3IBP A;  2CLY C;  3ZJ2 A;  2DWG A;  3BQI A;  2I59 A;  2WBL A;  2OA5 A;  4U72 A;  2V26 A;  3WAJ A;  3MKD A;  4I4T E;  1ZHC A;  4JUY A;  1HX8 A;  3ETV A;  2KXP B;  3NZQ A;  3NRX A;  2VK9 A;  3V5S A;  4DMV A;  1VRB A;  2C5J A;  2XAF B;  3LG7 A;  3ZMV B;  4PJL A;  3AAE B;  4MAL A;  4HEA A;  2PG8 A;  3P8C D;  3KVA A;  3EVY A;  5FNV E;  2D5U A;  2LSK A;  2YU1 A;  1MIV A;  4TUY E;  4IST A;  3K8P C;  2V7M A;  5IYZ E;  2X68 A;  4MFR A;  4TV9 E;  5JDF A;  1HF8 A;  4EXT A;  5JR9 A;  3J7Y q;  4NUU A;  3ETU A;  5DAB A;  3RYF E;  3H3A A;  3LK2 B;  3T8O A;  2Z6E A;  5FY0 A;  2MOZ A;  5L3E B;  2ZM2 A;  4DO0 A;  2VKH A;  4YLH A;  4JEH B;  2DLR A;  3C4W A;  4TV8 E;  2A2F X;  5JDL A;  5HWY A;  4JLE A;  1B7T A;  3RX6 A;  4AKR B;  3GMI A;  3KBT A;  2LE8 A;  4QKN A;  1HG2 A;  2EHO D;  4BJM A;  3PUR A;  5HWX A;  2WSS V;  1Y64 B;  2CWO A;  3SWH A;  4Z8X A;  4FI5 A;  5JR9 B;  3PTR B;  1D0X A;  4K0U A;  2ZM0 A;  4UV8 B;  3LK4 2;  4XZC A;  3MXZ A;  3HR0 A;  1FIO A;  3ZMS B;  2DWK A;  3GA8 A;  4QXC B;  2Y8D A;  4PJM A;  3DP7 A;  1HTJ F;  5C8Y E;  5LXT E;  5JR9 C;  3N2G E;  5DJQ C;  2X9X A;  3Q9D A;  3N2O A;  1UX4 A;  4O4I E;  3CQC B;  3N9L A;  2J1D G;  3E0Z A;  2XAJ B;  2B1E A;  2W61 A;  4H9Q C;  4AQF A;  2V7K A;  4L5G A;  2GK9 A;  2IAK A;  2KWH A;  1V9D A;  3EUH A;  4IE6 A;  4L0R A;  4ERR A;  5LHG B;  1YKH B;  4YJ3 E;  2X51 A;  2V7I A;  4DMW A;  3IEE A;  2RA1 A;  2CXL A;  2Q9Q D;  5DQW A;  5BMV E;  4UVA B;  5JDQ A;  2KMF A;  2LHR A;  3OKQ A;  3KV4 A;  2VAS A;  1US7 B;  2BVM A;  3S4U A;  1IJ6 A;  3PUG A;  1BR4 A;  1HFA A;  5L3D B;  2PFV A;  4TZ4 C;  5L3B B;  3UUN A;  3AA0 B;  1HG5 A;  3LJC A;  3O1I A;  2ODU A;  3E22 E;  2X0L B;  4X1I E;  2LJL A;  4XBF B;  2LOS A;  4V1A v;  3RRC A;  4CI3 B;  3TKL B;  3MAC A;  3SRZ A;  5LJM A;  2KIN B;  2D2S A;  2XHE B;  1VOM A;  3EDU A;  1LVF A;  3O1J A;  5LJN A;  3FBL A;  3OYX A;  4AQF C;  4O8S A;  4PK6 A;  4QXB B;  4ZI3 D;  4KBM B;  3HI2 A;  1OWA A;  4X20 E;  4AKH A;  3GN5 A;  4I55 E;  3C51 A;  4J2C A;  4CXX A;  3ZN0 B;  4GYR A;  5H6R B;  3HKB E;  3RH3 A;  4EB6 E;  4DBR A;  5LHH B;  4NUV A;  4PJN A;  2N1G A;  3C98 B;  4KP3 C;  3JC6 C;  4IDZ A;  4I43 B;  2E9X D;  3LBX A;  1MMD A;  3DTO A;  4PAG A;  4H9R C;  4PK4 A;  3ZYM A;  3PE0 A;  3SS1 A;  2CE7 A;  4KMC A;  3KV6 A;  2L3L A;  4GOU A;  3ZMU B;  2VB6 A;  4X1K E;  2CMR A;  3AA7 B;  4IGU A;  2C0S A;  2JMH A;  5FY7 A;  4ASK A;  3PDY A;  3ZMZ B;  5EK3 A;  3NBX X;  4WBO A;  1D0Y A;  5FP3 A;  2NW9 A;  4P0A A;  3GN5 B;  3HA4 A;  2HPL A;  1MMN A;  4ILU A;  5L3C B;  2IW5 B;  5EK4 A;  3QK6 A;  3NZP A;  4GK0 E;  4P09 A;  1KNZ A;  1UX5 A;  2NOX A;  4HTE A;  5AFU L;  4YJ2 E;  4PFP A;  2XQY A;  5GON E;  3CWZ B;  2MBG A;  3BQK A;  2K9A A;  5KX5 E;  5LP6 E;  3AA1 B;  4PJJ A;  5DQV A;  2LSJ A;  5CA0 E;  2NP9 A;  4H9S E;  5ETW A;  3R6N A;  3L09 A;  4BAY B;  4XAX B;  1SA0 E;  2JJ9 A;  2XAH B;  4YFS A;  2XUE A;  3Q2M A;  4ADZ A;  5LGT B;  3ZLI A;  4EIW A;  3RC8 A;  1YKE B;  4H63 V;  1D1C A;  1X79 A;  2DNX A;  2X9W A;  4WW0 A;  3LFM A;  3MZK B;  3OYZ A;  4CI2 B;  4PFO A;  5LG4 A;  3DJB A;  3FXD B;  4OK0 A;  3KFW X;  2LSI A;  2VWA A;  4AQG A;  1NAF A;  2NWB A;  1H7C A;  2Q9Q A;  2WWU A;  2VKJ A;  3CX6 B;  4IIJ E;  2K5B B;  3QC9 A;  3CX8 B;  3BQL A;  4H9P C;  3ESL A;  5FXV A;  4HKA A;  3C4Z A;  2C5K T;  3RPU A;  4BJN A;  5EZY E;  4A56 A;  4CQI A;  3CX7 B;  4IE5 A;  3C4X A;  3MA9 A;  4M1P A;  2X9H A;  5FXX A;  3UTK A;  3F2E A;  4DVD A;  4EZH A;  2D0U A;  2V7L A;  3KDS E;  2BVL A;  4UXN B;  2YU2 A;  4QXH B;  2HH7 A;  3PU3 A;  4IE0 A;  2JPF A;  5KMG P;  4IE4 A;  5ADX L;  2YIN A;  3N2K E;  3AB3 B;  4UF0 A;  4EAH A;  2Q9Q B;  3PUQ A;  3CKD A;  4O4L E;  3ZN1 B;  4AKL A;  3W15 B;  1CUN A;  3RYI E;  2VKO A;  3N9O A;  2DHR A;  2XTL A;  2KZ7 B;  2MTQ A;  3KV5 A;  3WI3 A;  2RP4 A;  1HS7 A;  4DND A;  3N9N A;  2CCQ A;  3QUJ A;  4HE8 A;  2W62 A;  3VU7 H;  2X67 A;  4BA9 A;  4MBQ A;  3ZMT B;  2H7O A;  4IE7 A;  2G0U A;  1WR6 A;  2YK0 A;  5FYM A;  3RRW A;  4I50 E;  3FHN A;  1YW0 A;  2CXF A;  1T98 A;  2D0T A;  3I9Y A;  5JDH A;  4P0B A;  5HYA A;  2NW8 A;  4UF0 B;  3I0Q A;  3E08 A;  3PUS A;  4N78 D;  5LCY A;  3ZCI A;  3SOL A;  4F6R C;  1BR2 A;  1E1H B;  1MNE A;  2ZMA A;  4UVB B;  2XAG B;  1FMV A;  3Q5X A;  2Y48 B;  4QX8 B;  1ZKE A;  3HKD E;  4ZI2 C;  4E7Z A;  4ZHQ E;  2PJQ A;  3CQG B;  3O1H A;  1NWM X;  1MMG A;  2XAS B;  3LK3 B;  1D0Z A;  4WBN E;  2LSG A;  3N9P A;  4HN9 A;  4X1Y E;  3RKO A;  3N5L A;  3UUM A;  3IF8 B;  1HCI A;  5F8P A;  3N9Q A;  4ISS A;  5JDG A;  1BR0 A;  3D0T A;  4QWN B;  2WM9 A;  3HKC E;  2W0G A;  2IC6 A;  2L8K A;  3AAI A;  3VHL A;  5LNK A;  4UEL A;  2JMK A;  2ZLY A;  3IHR A;  5HXR A;  3GWH A;  5J1G A;  3N9M A;  5HXH A;  1MND A;  1S94 A;  4OFZ A;  4QX7 B;  5HXS A;  3PUA A;  2W00 A;  2N9D A;  2EHO A;  4B6X A;  5M4Y A;  5HXC A;  2DI4 A;  3AAA B;  5A1L A;  3MJX A;  2CEA A;  3OBV E;  1IAP A;  2VL8 A;  4UV9 B;  5H6Q B;  3ZJ1 A;  5JQG E;  2X66 A;  1YD8 G;  5L3F B;  3RYC E;  3JC6 D;  3K3N A;  5FMN A;  3J9X 1;  3P7I A;  4IHJ E;  3LBX B;  4JEU B;  5CB4 E;  3Q5W A;  3C50 A;  4O2B E;  3RC3 A;  2YEV C;  4GYS A;  3FBZ A;  4OHF A;  2JQQ A;  5L2L A;  4O4J E;  1IJ5 A;  5HXE A;  5HAX A;  5LOV E;  2X9Y A;  2LT3 A;  2EHO B;  5FXW A;  2CA5 A;  2WMN A;  3I9W A;  2UXX B;  2WMO A;  5JH7 E;  1WRD A;  3H37 A;  3KVB A;  4UIG A;  5TAO A;  2XAQ B;  1MMA A;  3O4X E;  4ZI7 E;  2EHO C;  3I0O A;  5LGN B;  1FEW A;  1S35 A;  5KDM C;  1MIY A;  2K24 A;  3MK7 C;  3CPZ A;  4CI1 B;  1LRZ A;  3VKG A;  2LM9 A;  4L9I A;  3FXE B;  1LVK A;  2QGS A;  4G63 A;  5CA1 E;  4O4H E;  1WLX A;  2LHN A;  3U3I A;  4CXY A;  3VKH A;  5J2U E;  2KLQ A;  1EZ3 A;  3CML A;  4TX5 A;  2Y6X A;  3CQX C;  3ZC0 A;  1QSD A;  2E8I A;  4H9N C;  3ZCJ A;  3UUX B;  3ZPO A;  1FMW A;  1O3X A;  5LGU B;  3UT5 E;  5J2T E;  1ZEE A;  3A5X A;  4H63 H;  4MHC A;  4UVC B;  4PNI A;  2H3R A;  2MYS A;  2SPC A;  2NTX A;  4YHJ A;  5FY1 A;  3ANW A;  2BZB A;  2HPJ A;  4G2A A;  3UUL A;  1KK7 A;  4C91 A;  3F31 A;  3ZC1 A;  1MIW A;  3K3O A;  4U74 A;  2ACX A;  2ES0 A;  2N2N A;  2W63 A;  1WYB A;  4ZOL E;  5FXZ A;  3RYH E;  3ZEF B;  1IZN B;  4GK5 E;  3K3Q C;  2DCF A;  5JRE A;  2Q9Q C;  2VKD A;  5LYJ E;  3M65 A;  2UXN B;  4EYU A;  5L3G B;  1WYC A;  2A3D A;  3EDV A;  2E9X A;  3OJA A;  3AVS A;  2QA7 A;  3HKE E;  3KV9 A;  2V7J A;  1U5P A;  4MLK A;  2NTY A;  2CWY A;  3I1A A;  5LBM A;  1SHZ C;  3U78 A;  3FB2 A;  4ZS2 A;  5JDM A;  2CXD A;  4AXP A;  4AKG A;  5JRC A;  3ANW B;  4QHO A;  1OXZ A;  3F57 A;  5IHY A;  4ANJ A;  3B13 A;  4HFV A;  5JDN A;  3AA6 B;  4KUM B;  4CXW A;  2M67 A;  3C64 A;  3L3P A;  2K48 A;  2P9B A;  2KND A;  3CVR A;  4UEM A;  1Z0P A;  2IC9 A;  1U4Q A;  2H7V C;  2PBI A;  4ZI3 C;  4O2A E;  3O9X A;  4WNK A;  3B57 A;  2E9X B;  2KT9 A;  3BK9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...