4H63V

Structure of the schizosaccharomyces pombe mediator head module
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
117
structure length
117
Chain Sequence
SFQRQLVQRTNTLNSSIDNATLTILSRFQDILDIAINEGKDKYTVAPEVYQIECHTVSMVRAVEQLLDVSRQIKSYWLTNSLSTSFPTVDYSEPDLEKVKRTLTKLQNHLLEVSLIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the Mediator head module.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Transcription
molecule keywords Mediator of RNA polymerase II transcription subunit 6
total genus 43
structure length 117
sequence length 117
ec nomenclature
pdb deposition date 2012-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
V PF06179 Med22 Surfeit locus protein 5 subunit 22 of Mediator complex
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1600 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4h63V00
4H63V 3R84B
chains in the Genus database with same CATH superfamily
4ZS2A 3J9X1 5FKYA 3ZMVB 5M4YA 3ZCIA 3AEFA 2ZM0A 2WS3A 4HE8A 4HWHA 1YQ4A 2PFVA 2XSBA 4O4HE 4H9PC 3Q2MA 3HA4A 3PUYF 4NUVA 3DTOA 3U78A 4PFOA 1E2AA 3ETVA 4EGWA 5LGUB 1OEDC 2HPLA 2K3WA 3KBTA 5LMNT 3P4QA 3M3ZB 3ONLC 2E9XC 4PJLA 3O1JA 2XAQB 3N2OA 3NRXA 2UXNB 5LBMA 1IBLT 5TAOA 2ODUA 1VCTA 2HN1A 2I6HA 2IC6A 4B3RT 2XQ9A 3UFGA 3P4SA 3OJAA 4UR9A 2VQFT 3N9OA 3LJCA 2NW8A 3NWIA 1YKHB 4GK5E 2RA1A 4QHOA 3LFMA 4CI3B 4DBQA 5HEGA 2BS4A 2N1GA 2QRXA 2YDSA 3P4RA 1IJ6A 2YDRA 2NTXA 3LK3B 4EV6A 4ILUA 5LXTE 1N33T 1E1HB 2X9HA 3NVOA 3FBZA 3ANWA 3C51A 4CN4A 4CZZB 1ZHCA 4YHJA 2DHRA 2KWIB 1IJ5A 2MAWA 1JNRA 3N5LA 3CX7B 1HG5A 4UVAB 2VKJA 4C90A 1HR0T 4B3MT 1XNQT 4FI5A 5HEUA 2CXLA 4I55E 3SFDA 4LFCT 3AE8A 3EVYA 5KDMC 4B6XA 1S94A 3ABVA 3FB2A 3ZMZB 3WAKA 2JRKA 4CN6A 4EYYR 5HWXA 4LFBT 2W67A 3GMIA 3UU5A 3EHZA 3FXEB 3RGLA 4B3TT 1MMAA 4ZI3C 3HR0A 3CK6A 4IT4A 3S4UA 5C2TA 2LM9A 2SPCA 3C98B 4PJJA 5CB4E 3TLUA 5ADXL 1D1CA 4I43B 3JADA 2NWBA 3IF8B 4LF6T 4YSYA 4AKRB 5CJ5A 2IUBA 1QSDA 3ZKRA 5CA0E 3HKCE 3N9MA 4UXNB 4I4TE 4ASKA 4EAHA 4Z90A 2W62A 5FNVE 4C91A 2XAHB 5L47A 3NRYA 4WW0A 2RPAA 5J1GA 2X0HA 4HWCA 4JBWF 5HXCA 5JR9A 5HCMA 2BBHA 3HI2A 3IEEA 4LMKA 4V1Av 2K5BB 3B57A 3UULA 2A2FX 4EOZB 3EDVA 5JDLA 1YD8G 2VL8A 4CXWA 5AQUB 2HN2A 1J5ET 3PUZF 4O8SA 2AE9A 1XMOT 4KI0F 4EIWA 4Z91A 5KMGP 4EZ4A 4QXBB 1NWMX 4GKKT 5AQTB 2CA5A 4X66T 4HFIA 3MA9A 3BK9A 3ZT7A 4AKIA 5JVDE 4DO0A 2EHOC 4ZI2C 2QVAA 2H89A 3P50A 2BG9B 1U4QA 2IAKA 3RI5A 2UUAT 4CI2B 3C4XA 4H9OC 2PTFA 3PUSA 3KV5A 4OYKA 2LEHA 2BDEA 1VOMA 3AE9A 3AEEA 5ABGA 3LDQB 2UU9T 2JQQA 2VASA 2DL1A 2VVNA 4O4LE 3CQGB 2LSGA 4A5XA 1WYCA 2J1DG 4DR5T 4JI0T 4AI6A 3SRZA 2XPKA 5FY7A 5L2LA 3KVAA 3PV0F 4DR4T 3R6NA 2BG9C 4DV4T 2XM1A 3Q9DA 2BG9E 2X51A 3LK42 4JEHB 4UV9B 1CUNA 3G06A 2YEVC 4K0UA 5AQOB 3EI0A 4UVCB 3GN5B 5LG4A 5J2UE 1IAPA 4OYJA 2CE7A 5HXEA 2CMRA 3C64A 3AEBA 4EEDA 1XWMA 4DR1T 4JEUB 4ZZBA 2IDOB 2V7LA 2V7MA 3ZJ2A 5JDGA 1Z8UA 2LRKA 2Q9QB 2BKOA 2CEAA 4BAYB 3C4WA 3UU3A 4YT0A 2LSKA 2LHRA 2HHHT 3I9YA 1D0ZA 1GQEA 4LF5T 1VCSA 3UUNA 1HG2A 4PAGA 3RIUA 4IDNA 4HWDA 2BVLA 4OK0A 4Z8XA 2W61A 4L5GA 1J5WA 3PE0A 3ZC0A 4DR2T 1XDPA 2KINB 3N2KE 1L0VA 2VURA 3RC8A 2Y48B 2VKDA 3DP7A 3M65A 1MMGA 2JMKA 1MNEA 4I0UA 3TLWA 3UUXB 3EUHA 2JQKA 3E22E 3AXJA 1D1AA 1E7PA 2WU5A 2V6YA 1OEDA 2EHOB 4LF7T 5LJMA 2L9QA 4X20E 2QGSA 3CQXC 2CBJA 4PNIA 3GWHA 1UK5A 4X62T 3UU6A 5JTGA 4H9RC 3VRBA 3RQUA 3T1YT 2YKSA 4AQYT 4LFAT 4H9NC 2XASB 2D5UA 3AVSA 2V5DA 3P4WA 1H7CA 4U7IA 3UTKA 5LMUT 2E8IA 2CCQA 3L3PA 4AQGA 1KFYA 1NEKA 1Y64B 2VL0A 4E7SA 2IIUA 1Y01A 4IREA 5LHGB 1U5PA 5ETWA 4GYRA 4K0KT 2W66A 3AE4A 3A7MA 3BQKA 4JYAT 2FJAA 3MKDA 3BQIA 4U33A 1LVFA 1D0XA 3O9XA 2KNDA 2YU1A 4ADZA 5FMNA 2VQET 4HKAA 4EXTA 5AQNB 4UVBB 2V26A 2UXCT 2M6IA 3T1HT 1YW0A 4HFHA 1WR6A 2Q9QC 4QX7B 2G0UA 4JI3T 4HEAA 5GONE 3W15B 1G73A 3QB5A 3FBLA 3HKBE 3FHNA 4HFCA 3ANWB 3PJAA 4O4JE 5JRCB 4X1KE 1D0YA 1BR2A 1O3XA 1XZYA 4COFA 1HNXT 3PUVF 1T8BA 4HFBA 5L3GB 2KT9A 2WWVA 5FYMA 2WMOA 4KBMB 4FJOA 5IHYA 4EZHA 2K24A 1ZKEA 2W2UA 5LBQB 3RHWA 1US7B 3PJAJ 2VWAA 5EK3A 2X66A 3RRCA 2XQ8A 4WBOA 5C8YE 4KP3C 3RYIE 5HEJA 5LB7B 5L4HA 3CIRA 2WP9A 2J47A 4MFRA 3V5UA 3ZPOA 2LE8A 1WLXA 2NR4A 4UEMA 3RYFE 4IHJE 5HWYA 4DV6T 2ACZA 2UUCT 4QH4A 4IL9A 2IC9A 5AFUL 5ABFA 5JH7E 4OX9T 2E9XA 2B1EA 1I94T 4DVDA 4EEBA 3Q5EA 4UF0A 1T7SA 3P7IA 3AAEB 3K3NA 3ONJA 4TN7B 4IE7A 4L9IA 3O1IA 5A1LA 4ZOLE 4HFDA 5JDHA 2WQYA 4X64T 2LRLA 4U74A 4YTNA 2WY2A 2CLYB 2LSJA 5FXWA 2MOZA 3CVRA 4ERRA 3EAMA 4H9SE 1HNZT 5LHHB 3KINB 3QNUA 3N9NA 1SA0E 3B5MA 5JDMA 3ZT5A 4DUYT 2XHEB 4ISSA 4AQFA 4DNDA 2NTYA 4H63V 4KX6A 3KDSE 2MPKA 4EB6E 5CGMA 2FBWA 3UQ7A 4DV5T 4MLKA 4PJMA 3Q5XA 5LNKA 3QK6A 1FJGT 1ZEEA 2OLTA 3OPCA 1BR0A 4LMJA 3HKDE 4PW8A 2WZHA 4U31A 3ZJ1A 3ZEFB 2CLYC 2KMFA 2BG9A 2X67A 3I0OA 5L3DB 5LYJE 4JI6T 2JQ9A 5CFBA 4DR6T 3H3MA 1UCUA 2W0GA 3AE7A 4U2YA 5ABEA 4DV7T 4YXDA 1LKXA 4IE0A 3AVRA 3RKGA 5LJNA 2DNXA 3ZYMA 5LHIB 2F4VT 2LSYA 2BS3A 3UU8A 3CMLA 1KK7A 3SS1A 1WYBA 4CXXA 2MYSA 4DMWA 3LBXB 2WM9A 2DWKA 1W0BA 3AE5A 3QOFA 4ZHQE 2E9XD 3Q5DA 4QWNB 4NXMT 2OV9A 4U2ZA 2M67A 2WDQA 2XQ7A 4TWFA 5AQPB 5FP3A 4BA9A 3CPZA 4WBNE 3K1SA 3UFEA 5HXSA 3PUGA 2QYWA 4ILAA 5E0OA 4YJ2E 1LVKA 2YOEA 2CBIA 2V7IA 4IDPA 3T8OA 5JR9C 3RPUA 4IE5A 2Z6EA 3AA1B 2P9BA 3MZKB 3U3IA 5IYZE 1UUSA 4QXHB 2N2NA 3AECA 3IHRA 4L0RA 2A72A 4DMVA 1SHZC 2JQHA 2LSIA 3RX6A 5JREA 2ODVA 1UURA 3H37A 1KNZA 4ILCA 4TV9E 1AJ3A 3OYZA 5JDNA 4LMLA 5LGNB 2B76A 4U72A 4AKLA 3OKQA 2YU2A 4TV8E 3HKEE 2VB6A 4AXPA 2NW9A 2E5LT 3K3OA 3JC6C 3I0QA 5KX5E 3Q5WA 4BJNA 4WYVA 1T72A 3AEGA 2V6YB 4NUUA 3AEDA 4WNKA 2QA7A 4P09A 1Z0PA 4TNWA 4BJMA 3AA6B 5HXHA 5AQIB 3R84B 2HPJA 1KNPA 3ZSSA 2X0YA 3FXDB 5FY0A 4NPPA 1WFDA 2X0LB 2XY8B 3ESLA 3FZMB 2XQAA 3B13A 3UUMA 3D0TA 3AEAA 1HF8A 2L8KA 3IA3A 3RC3A 5LG3A 4DUZT 2H3RA 3TLSA 3J7Yq 4LF4T 1NENA 3E0ZA 3SOLA 2VVSA 2JIWA 5AQGB 4QX8B 5FY1A 4AKHA 1LRZA 2XQ6A 2WAUA 2IMLA 2V8SV 2KSRA 2V7KA 5EK2A 1IBMT 4UV8B 2LM2A 4HTEA 3VHLA 5J0ZA 4QXCB 3KV9A 2Y8DA 3NZQA 2YK0A 5FL0A 5JR9B 5L3CB 2W4XA 5HEOA 4AIUA 4MBQA 4JV5T 1FMWA 2K9AA 5DABA 2WWUA 4GYSA 3ZCJA 5LGTB 2ZM2A 3AE3A 3ETUA 3QB5K 4PFPA 4F6RC 2XQYA 2WU2A 3SWHA 2NW7A 1QUUA 5LA6E 4JI2T 4GKJT 1HNWT 3WI3A 3N9QA 1HX8A 2W63A 4B3ST 5F3JA 2C0SA 2E2AA 5JRCA 2D2SA 2FJEA 3P4PA 3F57A 2V7JA 2Q9QD 3L39A 3AAAB 5HCJA 1IZNB 3CWZB 3N9PA 3VR8A 3CQCB 3AE2A 3NZPA 3ZMTB 2VKOA 3BQLA 4HGAA 3ZYLA 4H9QC 3RQWA 2A3DA 2KLQA 2KWHA 2K48A 2ACXA 4IGUA 4UIGA 2AXDS 2PJQA 3RYCE 4X5TA 3LK2B 3CX6B 1NAFA 4E7ZA 3OTOT 3L8RA 3JAEA 4A97A 3O1HA 3KVBA 2M6BA 2CXFA 1MIYA 4XBFB 2WB5A 4QH5A 1OWAA 3JCFA 4XZCA 5F5WA 5L3EB 2D9DA 4JI4T 1IBKT 4H63H 2D0TA 3RYHE 2CM0A 2NP9A 5JDFA 2BZBA 4AQFC 5KXJA 4P1NA 1S35A 4PK5A 4UF0B 2OA5A 5BR8T 1XNRT 5HYAA 3ZMUB 1MIWA 1W09A 2XAJB 3PUXF 1UX5A 1JNZA 1OXZA 2XSAA 1J1JA 2BVMA 2FJDA 2Q9QA 2LJLA 4XAXB 5FXZA 4ZS3A 3K8PC 2CRBA 3GA8A 3ZT6A 4AKGA 3JAFA 2XQ5A 4YTMA 4YTPA 3AE1A 4U3CA 2EHOD 4ZXLA 5LCYA 2XAFB 3DJBA 5EZYE 4KMCA 5FXVA 4MALA 4ZI7E 5AQFB 1HTJF 3A8YC 2UXDT 4A98A 4N78D 2NOXA 3PU8A 3A5XA 4JUYA 5L3FB 3F2EA 3AB3B 4PK4A 5DJQC 3IBPA 1YXRA 3I9WA 1XDOA 3KBUA 2ZM8A 4WZXA 3NBXX 2XZEA 5C3JA 2ZM6T 2LLYA 3LG7A 3CKDA 5AQHB 5FL1A 2LKHA 1FEWA 4UELA 4IDOA 3CX8B 2DCFA 2ES0A 2L3LA 3PUAA 1M7KA 2H7VC 4HWFA 1XMQT 1HS7A 3RF1A 3PURA 5JQGE 1KF6A 2V5CA 4G63A 4YJ3E 1HX1B 5AQKB 1ZP0A 1N36T 4MHCA 1T98A 2BKPA 1YQ3A 2C5JA 4O2BE 3VKHA 4I50E 4DV0T 5AQRB 2WBLA 3EDUA 4OHFA 2N9DA 3L09A 1X9BA 2VKHA 4Q25A 3F31A 3OBVE 1KNRA 2H88A 4CXYA 1B7TA 4IL4A 4IIJE 4HFVA 5FXXA 1V9DA 2E5VA 5HXRA 4P0AA 3ZN1B 2UXXB 4ZEYA 3AXJB 2X68A 1OEDE 4YFSA 1BR1A 3RIUC 3ZYKA 4DR7T 2EHOA 3LSVA 2WDRA 4JI1T 4IE4A 2LOSA 3PUWF 4GIWA 2BS2A 1M62A 2LOPA 4PK6A 5AQQB 5LOVE 5J2TE 1N32T 4JI7T 2CWYA 4KHZF 5AQJB 2XUEA 3RH3A 3KV4A 3UU4A 3ZLIA 4CN1A 4KUMB 2J62A 1CHUA 2UUBT 2UXBT 4O2AE 1MNDA 3OYXA 1MMNA 2LKGA 2C5KT 3PTRB 4IDZA 5FVKA 4LF8T 3TLVA 1W9RA 2KXPB 3I1AA 4YLHA 5H6QB 2I0MA 4X1YE 1BR4A 3MXZA 2CXDA 4ILBA 4DIDB 4JI5T 5HEHA 4G2AA 1WRDA 3AA0B 3RRWA 5IWAT 3FZLB 3C4ZA 3KFWX 1I6ZA 3E08A 2XQ3A 4OFZA 4YSXA 1DU2A 2JJ9A 1VRBA 2JPFA 2RP4A 3P8CD 1W0AA 2CWOA 2IHR1 3EABA 3N2GE 5FVLA 1EZ3A 4TX5A 4DR3T 5F8PA 4JI8T 4TUYE 2W00A 2ZMAA 2IW5B 4ZI2D 3K3QC 4TWDA 1KEYA 1WR0A 2BBJA 1QLBA 2XQ4A 2MTQA 2X9WA 2XM2A 3FZKB 3RKOA 4AISA 4CQIA 4ZI3D 5ABHA 4YY3T 2X9YA 3AE6A 4ANJA 4EYUA 1SUMB 2Y6XA 4NXNT 3NKZA 2V6XA 2HH7A 4JLEA 2DLRA 4TNVA 1FMVA 2LT3A 4IDQA 3OVUA 2H7OA 5HAXA 2WMNA 2VK9A 2V1DB 2YDQA 5AQSB 4GK0E 3TKLB 3TLTA 3ZN0B 5CA1E 1R8IA 2XAGB 2LHNA 3O4XE 5BMVE 2CHNA 4YSZA 3VRAA 2J4GA 4GOUA 3FZHB 2A9UA 2BKNA 3UQ4A 1N34T 4U7YA 2GK9A 1WCRA 3H3AA 3ZMSB 3VU7H 2I59A 3UT5E 2XTLA 4HN9A 2WCAA 5AQMB 5L3BB 4YHHT 4F8HA 4PJNA 4IE6A 2C5IT 3RLFF 3VKGA 2XJ7A 2FUPA 3PUQA 5ABFB 3ZSTA 1ZOYA 2WDVA 4QKNA 2E9XB 2KZ7B 4ISTA 2CPTA 2DWGA 4HFEA 3X1DA 3GN5A 4QH1A 4ZZCA 3V5SA 3N9LA 4HWIB 4CI1B 5L4EA 3MK7C 4NIQA 2YN6A 3AAIA 3MJXA 3ONXA 3ZC1A 4KHPT 3WAJA 2D0UA 5IUXA 2PG8A 2R6GF 3C50A 1UGOA 3AA7B 1ZV4X 2WZIA 3LBXA 3SFEA 3KV6A 4A56A 2MBGA 1HCIA 2PBIA 3QUJA 4X1IE 5AQVB 4DV1T 2ZLYA 3MACA 3UUBA 4M1PA 4P0BA 4TZ4C 4O4IE 3RIAA 5LP6E 4DV2T 4LF9T 3VR9A 5JDQA 4TWHA 4DBRA 2X9XA 1D1BA 1HFAA 5EK4A 1MIVA 1YKEB 4X65T 5DQWA 1FIOA 1SE7A 2JMHA 3HL6A 1X79A 2FJBA 4J2CA 2DI4A 1MMDA 2CHOA 3PU3A 2WSSV 1OEDB 5AQLB 3JC6D 3QC9A 3RIFA 5DQVA 5H6RB 2YINA 1G8XA 3FZFB 4DV3T 3PDYA 1UX4A
chains in the Genus database with same CATH topology
4ZS2A 3J9X1 3ZMVB 5M4YA 3ZCIA 2ZM0A 4O4HE 4HE8A 2PFVA 3U78A 4H9PC 3Q2MA 3HA4A 4NUVA 3DTOA 4PFOA 3ETVA 5LGUB 2HPLA 3KBTA 4PJLA 2E9XC 3O1JA 2XAQB 3N2OA 3NRXA 2UXNB 5LBMA 5TAOA 2ODUA 2IC6A 3OJAA 3N9OA 3LJCA 2NW8A 4QHOA 1YKHB 4GK5E 2RA1A 4CI3B 3LFMA 4DBQA 2N1GA 1IJ6A 5LXTE 2NTXA 3LK3B 4ILUA 1E1HB 2X9HA 3FBZA 3ANWA 3C51A 4CZZB 1ZHCA 4YHJA 2DHRA 2KWIB 1IJ5A 3N5LA 3CX7B 1HG5A 4UVAB 2VKJA 4C90A 4FI5A 2CXLA 4I55E 3EVYA 5KDMC 4B6XA 1S94A 3FB2A 4EYYR 3ZMZB 3WAKA 2JRKA 5HWXA 3GMIA 3FXEB 1MMAA 4ZI3C 3HR0A 3S4UA 2LM9A 2SPCA 3C98B 4PJJA 5CB4E 5ADXL 1D1CA 4I43B 2NWBA 3IF8B 4AKRB 1QSDA 5CA0E 3HKCE 3N9MA 4UXNB 4I4TE 4ASKA 4EAHA 2W62A 5FNVE 4C91A 2XAHB 3NRYA 4WW0A 5J1GA 5HXCA 5JR9A 3HI2A 3IEEA 5JDLA 4V1Av 2K5BB 3B57A 3UULA 2A2FX 4EOZB 3EDVA 1YD8G 2VL8A 4CXWA 4O8SA 4EIWA 5KMGP 4EZ4A 4QXBB 1NWMX 2CA5A 3MA9A 3BK9A 4AKIA 5JVDE 4DO0A 2EHOC 4ZI2C 2IAKA 1U4QA 4CI2B 3C4XA 4H9OC 3PUSA 3KV5A 4OYKA 2LEHA 2BDEA 1VOMA 2JQQA 2VASA 4O4LE 3CQGB 2LSGA 4AI6A 1WYCA 2J1DG 3SRZA 5FY7A 5L2LA 3KVAA 3R6NA 3Q9DA 2X51A 4JEHB 3LK42 4UV9B 1CUNA 4K0UA 2YEVC 4UVCB 3GN5B 5LG4A 5J2UE 1IAPA 4OYJA 2CE7A 5HXEA 2CMRA 3C64A 4JEUB 2V7MA 2V7LA 5JDGA 3ZJ2A 2Q9QB 2CEAA 4BAYB 3C4WA 2LSKA 2LHRA 3I9YA 1D0ZA 3UUNA 1HG2A 4PAGA 2BVLA 4OK0A 4Z8XA 2W61A 4L5GA 3PE0A 3ZC0A 3N2KE 2KINB 3RC8A 2Y48B 2VKDA 3DP7A 3M65A 1MMGA 2JMKA 1MNEA 3UUXB 3EUHA 3E22E 1D1AA 2EHOB 5LJMA 2L9QA 4X20E 2QGSA 3CQXC 4PNIA 3GWHA 4H9RC 4H9NC 2XASB 2D5UA 3AVSA 1H7CA 3UTKA 2E8IA 2CCQA 3L3PA 4AQGA 1Y64B 4E7SA 5LHGB 1U5PA 5ETWA 4GYRA 3BQKA 3O9XA 3MKDA 3BQIA 1LVFA 1D0XA 2KNDA 2YU1A 4ADZA 5FMNA 4HKAA 4EXTA 4UVBB 2V26A 1YW0A 1WR6A 2Q9QC 4QX7B 2G0UA 4HEAA 5GONE 3W15B 1G73A 3FBLA 3HKBE 3FHNA 3ANWB 5JRCB 4O4JE 4X1KE 1D0YA 1BR2A 1O3XA 5L3GB 2KT9A 5FYMA 2WMOA 4KBMB 4FJOA 5IHYA 4EZHA 2K24A 1ZKEA 5LBQB 3RRCA 1US7B 5EK3A 2VWAA 2X66A 4WBOA 5C8YE 4KP3C 3RYIE 3ZPOA 4MFRA 3V5UA 2LE8A 1WLXA 3RYFE 4UEMA 4IHJE 5HWYA 2IC9A 5AFUL 5JH7E 2E9XA 2B1EA 4DVDA 4UF0A 3P7IA 3AAEB 3K3NA 4TN7B 4IE7A 4L9IA 3O1IA 5A1LA 4ZOLE 5JDHA 4U74A 2CLYB 2LSJA 5FXWA 2MOZA 3CVRA 4ERRA 4H9SE 5LHHB 3KINB 3N9NA 1SA0E 5JDMA 2XHEB 4ISSA 4AQFA 4DNDA 2NTYA 4H63V 4EB6E 3KDSE 4MLKA 4PJMA 3Q5XA 5LNKA 3QK6A 1ZEEA 1BR0A 4PW8A 3HKDE 3ZEFB 3ZJ1A 5L3DB 2CLYC 2KMFA 2X67A 3I0OA 5LYJE 1UCUA 2W0GA 1LKXA 4IE0A 3AVRA 5LJNA 2DNXA 3ZYMA 5LHIB 2LSYA 3CMLA 1KK7A 3SS1A 1WYBA 4CXXA 2MYSA 4DMWA 3LBXB 2WM9A 2DWKA 4ZHQE 2E9XD 4QWNB 4WBNE 2M67A 5FP3A 4BA9A 5HXSA 3CPZA 3UFEA 3PUGA 5E0OA 4YJ2E 1LVKA 5JR9C 2V7IA 3T8OA 3RPUA 4IE5A 2Z6EA 3AA1B 2P9BA 3MZKB 3U3IA 5IYZE 4QXHB 2N2NA 4L0RA 3IHRA 5JREA 2A72A 4DMVA 1SHZC 2LSIA 3RX6A 2ODVA 3H37A 1KNZA 4TV9E 1AJ3A 3OYZA 5JDNA 5LGNB 4U72A 4AKLA 3OKQA 2YU2A 4TV8E 3HKEE 2VB6A 4AXPA 2NW9A 3K3OA 3JC6C 3I0QA 5KX5E 3Q5WA 4BJNA 4NUUA 4WNKA 2QA7A 4P09A 1Z0PA 4BJMA 5HXHA 3AA6B 3R84B 2HPJA 3FXDB 5FY0A 2X0LB 3ESLA 3UUMA 3B13A 3D0TA 1HF8A 2L8KA 3RC3A 2H3RA 3J7Yq 3E0ZA 3SOLA 5FY1A 4QX8B 1LRZA 2WAUA 5EK2A 2V7KA 4UV8B 4HTEA 3VHLA 4QXCB 3KV9A 2Y8DA 3NZQA 2YK0A 5JR9B 5L3CB 4MBQA 1FMWA 2K9AA 5DABA 2WWUA 4GYSA 3ZCJA 5LGTB 2ZM2A 4PFPA 3ETUA 4F6RC 2XQYA 3SWHA 2NW7A 1QUUA 5LA6E 3WI3A 3N9QA 1HX8A 2W63A 5F3JA 2C0SA 5JRCA 2D2SA 3F57A 2V7JA 2Q9QD 3AAAB 1IZNB 3CWZB 3N9PA 3ZMTB 3CQCB 4AKHA 3NZPA 2VKOA 3BQLA 4HGAA 3ZYLA 4H9QC 2A3DA 2KLQA 2KWHA 2K48A 2ACXA 4IGUA 4UIGA 2PJQA 3RYCE 3LK2B 3CX6B 1NAFA 4E7ZA 4XBFB 3O1HA 3KVBA 2CXFA 1MIYA 1OWAA 4XZCA 5L3EB 4H63H 2D0TA 3RYHE 2CM0A 2NP9A 5JDFA 2BZBA 4AQFC 1S35A 4PK5A 4UF0B 2OA5A 5HYAA 3ZMUB 1MIWA 2XAJB 1UX5A 1OXZA 2BVMA 2Q9QA 2LJLA 4XAXB 5FXZA 4ZS3A 3K8PC 3GA8A 4AKGA 5LCYA 2EHOD 2XAFB 3DJBA 5EZYE 4KMCA 5FXVA 4MALA 4ZI7E 1HTJF 4N78D 2NOXA 3PU8A 3A5XA 4JUYA 5L3FB 3F2EA 3AB3B 4PK4A 5DJQC 3IBPA 3I9WA 3KBUA 2ZM8A 3NBXX 3LG7A 3CKDA 1FEWA 4UELA 3CX8B 2ES0A 2DCFA 2L3LA 3PUAA 2H7VC 3PURA 5JQGE 4G63A 4YJ3E 4MHCA 1T98A 2C5JA 4O2BE 3VKHA 4I50E 2WBLA 3EDUA 4OHFA 2N9DA 3L09A 2VKHA 3F31A 3OBVE 4CXYA 1B7TA 4IIJE 4HFVA 5FXXA 1V9DA 5HXRA 4P0AA 3ZN1B 2UXXB 2X68A 4YFSA 1BR1A 3ZYKA 2EHOA 4IE4A 2LOSA 4GIWA 4PK6A 2LOPA 5LOVE 5J2TE 2CWYA 2XUEA 3RH3A 3KV4A 3ZLIA 4KUMB 4O2AE 1MNDA 3OYXA 1MMNA 3PTRB 2C5KT 4IDZA 2KXPB 3I1AA 4YLHA 5H6QB 4X1YE 1BR4A 3MXZA 2CXDA 4G2AA 1WRDA 3AA0B 3RRWA 3C4ZA 3KFWX 3E08A 4OFZA 2JJ9A 1VRBA 2JPFA 2RP4A 3P8CD 2CWOA 3N2GE 1EZ3A 4TX5A 5F8PA 4TUYE 2W00A 2ZMAA 2IW5B 4ZI2D 3K3QC 1HS7A 2MTQA 2X9WA 3RKOA 4CQIA 4ZI3D 2X9YA 4ANJA 4EYUA 2Y6XA 2HH7A 4JLEA 2DLRA 1FMVA 2LT3A 2H7OA 5HAXA 2WMNA 2VK9A 2V1DB 4GK0E 3TKLB 3ZN0B 5CA1E 2XAGB 2LHNA 3O4XE 5BMVE 4GOUA 2GK9A 3H3AA 3ZMSB 3VU7H 2I59A 3UT5E 2XTLA 4HN9A 5L3BB 4PJNA 4IE6A 2C5IT 3VKGA 3PUQA 4QKNA 2E9XB 2KZ7B 4ISTA 2DWGA 3GN5A 3V5SA 3N9LA 4CI1B 3MK7C 3AAIA 3MJXA 3ONXA 3ZC1A 3WAJA 2D0UA 2PG8A 3LBXA 3C50A 3AA7B 1ZV4X 4A56A 3KV6A 2MBGA 1HCIA 2PBIA 3QUJA 4X1IE 2ZLYA 3MACA 4M1PA 4P0BA 4TZ4C 4O4IE 5LP6E 5JDQA 4DBRA 2X9XA 1D1BA 1HFAA 5EK4A 1MIVA 1YKEB 5DQWA 1FIOA 2JMHA 3HL6A 1X79A 4J2CA 2DI4A 1MMDA 3PU3A 2WSSV 3JC6D 3QC9A 5DQVA 5H6RB 2YINA 1G8XA 3PDYA 1UX4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4H63 V;  3R84 B; 
#chains in the Genus database with same CATH topology
 4ZS2 A;  3J9X 1;  5FKY A;  3ZMV B;  5M4Y A;  3ZCI A;  3AEF A;  2ZM0 A;  2WS3 A;  4HE8 A;  4HWH A;  1YQ4 A;  2PFV A;  2XSB A;  4O4H E;  4H9P C;  3Q2M A;  3HA4 A;  3PUY F;  4NUV A;  3DTO A;  3U78 A;  4PFO A;  1E2A A;  3ETV A;  4EGW A;  5LGU B;  1OED C;  2HPL A;  2K3W A;  3KBT A;  5LMN T;  3P4Q A;  3M3Z B;  3ONL C;  2E9X C;  4PJL A;  3O1J A;  2XAQ B;  3N2O A;  3NRX A;  2UXN B;  5LBM A;  1IBL T;  5TAO A;  2ODU A;  1VCT A;  2HN1 A;  2I6H A;  2IC6 A;  4B3R T;  2XQ9 A;  3UFG A;  3P4S A;  3OJA A;  4UR9 A;  2VQF T;  3N9O A;  3LJC A;  2NW8 A;  3NWI A;  1YKH B;  4GK5 E;  2RA1 A;  4QHO A;  3LFM A;  4CI3 B;  4DBQ A;  5HEG A;  2BS4 A;  2N1G A;  2QRX A;  2YDS A;  3P4R A;  1IJ6 A;  2YDR A;  2NTX A;  3LK3 B;  4EV6 A;  4ILU A;  5LXT E;  1N33 T;  1E1H B;  2X9H A;  3NVO A;  3FBZ A;  3ANW A;  3C51 A;  4CN4 A;  4CZZ B;  1ZHC A;  4YHJ A;  2DHR A;  2KWI B;  1IJ5 A;  2MAW A;  1JNR A;  3N5L A;  3CX7 B;  1HG5 A;  4UVA B;  2VKJ A;  4C90 A;  1HR0 T;  4B3M T;  1XNQ T;  4FI5 A;  5HEU A;  2CXL A;  4I55 E;  3SFD A;  4LFC T;  3AE8 A;  3EVY A;  5KDM C;  4B6X A;  1S94 A;  3ABV A;  3FB2 A;  3ZMZ B;  3WAK A;  2JRK A;  4CN6 A;  4EYY R;  5HWX A;  4LFB T;  2W67 A;  3GMI A;  3UU5 A;  3EHZ A;  3FXE B;  3RGL A;  4B3T T;  1MMA A;  4ZI3 C;  3HR0 A;  3CK6 A;  4IT4 A;  3S4U A;  5C2T A;  2LM9 A;  2SPC A;  3C98 B;  4PJJ A;  5CB4 E;  3TLU A;  5ADX L;  1D1C A;  4I43 B;  3JAD A;  2NWB A;  3IF8 B;  4LF6 T;  4YSY A;  4AKR B;  5CJ5 A;  2IUB A;  1QSD A;  3ZKR A;  5CA0 E;  3HKC E;  3N9M A;  4UXN B;  4I4T E;  4ASK A;  4EAH A;  4Z90 A;  2W62 A;  5FNV E;  4C91 A;  2XAH B;  5L47 A;  3NRY A;  4WW0 A;  2RPA A;  5J1G A;  2X0H A;  4HWC A;  4JBW F;  5HXC A;  5JR9 A;  5HCM A;  2BBH A;  3HI2 A;  3IEE A;  4LMK A;  4V1A v;  2K5B B;  3B57 A;  3UUL A;  2A2F X;  4EOZ B;  3EDV A;  5JDL A;  1YD8 G;  2VL8 A;  4CXW A;  5AQU B;  2HN2 A;  1J5E T;  3PUZ F;  4O8S A;  2AE9 A;  1XMO T;  4KI0 F;  4EIW A;  4Z91 A;  5KMG P;  4EZ4 A;  4QXB B;  1NWM X;  4GKK T;  5AQT B;  2CA5 A;  4X66 T;  4HFI A;  3MA9 A;  3BK9 A;  3ZT7 A;  4AKI A;  5JVD E;  4DO0 A;  2EHO C;  4ZI2 C;  2QVA A;  2H89 A;  3P50 A;  2BG9 B;  1U4Q A;  2IAK A;  3RI5 A;  2UUA T;  4CI2 B;  3C4X A;  4H9O C;  2PTF A;  3PUS A;  3KV5 A;  4OYK A;  2LEH A;  2BDE A;  1VOM A;  3AE9 A;  3AEE A;  5ABG A;  3LDQ B;  2UU9 T;  2JQQ A;  2VAS A;  2DL1 A;  2VVN A;  4O4L E;  3CQG B;  2LSG A;  4A5X A;  1WYC A;  2J1D G;  4DR5 T;  4JI0 T;  4AI6 A;  3SRZ A;  2XPK A;  5FY7 A;  5L2L A;  3KVA A;  3PV0 F;  4DR4 T;  3R6N A;  2BG9 C;  4DV4 T;  2XM1 A;  3Q9D A;  2BG9 E;  2X51 A;  3LK4 2;  4JEH B;  4UV9 B;  1CUN A;  3G06 A;  2YEV C;  4K0U A;  5AQO B;  3EI0 A;  4UVC B;  3GN5 B;  5LG4 A;  5J2U E;  1IAP A;  4OYJ A;  2CE7 A;  5HXE A;  2CMR A;  3C64 A;  3AEB A;  4EED A;  1XWM A;  4DR1 T;  4JEU B;  4ZZB A;  2IDO B;  2V7L A;  2V7M A;  3ZJ2 A;  5JDG A;  1Z8U A;  2LRK A;  2Q9Q B;  2BKO A;  2CEA A;  4BAY B;  3C4W A;  3UU3 A;  4YT0 A;  2LSK A;  2LHR A;  2HHH T;  3I9Y A;  1D0Z A;  1GQE A;  4LF5 T;  1VCS A;  3UUN A;  1HG2 A;  4PAG A;  3RIU A;  4IDN A;  4HWD A;  2BVL A;  4OK0 A;  4Z8X A;  2W61 A;  4L5G A;  1J5W A;  3PE0 A;  3ZC0 A;  4DR2 T;  1XDP A;  2KIN B;  3N2K E;  1L0V A;  2VUR A;  3RC8 A;  2Y48 B;  2VKD A;  3DP7 A;  3M65 A;  1MMG A;  2JMK A;  1MNE A;  4I0U A;  3TLW A;  3UUX B;  3EUH A;  2JQK A;  3E22 E;  3AXJ A;  1D1A A;  1E7P A;  2WU5 A;  2V6Y A;  1OED A;  2EHO B;  4LF7 T;  5LJM A;  2L9Q A;  4X20 E;  2QGS A;  3CQX C;  2CBJ A;  4PNI A;  3GWH A;  1UK5 A;  4X62 T;  3UU6 A;  5JTG A;  4H9R C;  3VRB A;  3RQU A;  3T1Y T;  2YKS A;  4AQY T;  4LFA T;  4H9N C;  2XAS B;  2D5U A;  3AVS A;  2V5D A;  3P4W A;  1H7C A;  4U7I A;  3UTK A;  5LMU T;  2E8I A;  2CCQ A;  3L3P A;  4AQG A;  1KFY A;  1NEK A;  1Y64 B;  2VL0 A;  4E7S A;  2IIU A;  1Y01 A;  4IRE A;  5LHG B;  1U5P A;  5ETW A;  4GYR A;  4K0K T;  2W66 A;  3AE4 A;  3A7M A;  3BQK A;  4JYA T;  2FJA A;  3MKD A;  3BQI A;  4U33 A;  1LVF A;  1D0X A;  3O9X A;  2KND A;  2YU1 A;  4ADZ A;  5FMN A;  2VQE T;  4HKA A;  4EXT A;  5AQN B;  4UVB B;  2V26 A;  2UXC T;  2M6I A;  3T1H T;  1YW0 A;  4HFH A;  1WR6 A;  2Q9Q C;  4QX7 B;  2G0U A;  4JI3 T;  4HEA A;  5GON E;  3W15 B;  1G73 A;  3QB5 A;  3FBL A;  3HKB E;  3FHN A;  4HFC A;  3ANW B;  3PJA A;  4O4J E;  5JRC B;  4X1K E;  1D0Y A;  1BR2 A;  1O3X A;  1XZY A;  4COF A;  1HNX T;  3PUV F;  1T8B A;  4HFB A;  5L3G B;  2KT9 A;  2WWV A;  5FYM A;  2WMO A;  4KBM B;  4FJO A;  5IHY A;  4EZH A;  2K24 A;  1ZKE A;  2W2U A;  5LBQ B;  3RHW A;  1US7 B;  3PJA J;  2VWA A;  5EK3 A;  2X66 A;  3RRC A;  2XQ8 A;  4WBO A;  5C8Y E;  4KP3 C;  3RYI E;  5HEJ A;  5LB7 B;  5L4H A;  3CIR A;  2WP9 A;  2J47 A;  4MFR A;  3V5U A;  3ZPO A;  2LE8 A;  1WLX A;  2NR4 A;  4UEM A;  3RYF E;  4IHJ E;  5HWY A;  4DV6 T;  2ACZ A;  2UUC T;  4QH4 A;  4IL9 A;  2IC9 A;  5AFU L;  5ABF A;  5JH7 E;  4OX9 T;  2E9X A;  2B1E A;  1I94 T;  4DVD A;  4EEB A;  3Q5E A;  4UF0 A;  1T7S A;  3P7I A;  3AAE B;  3K3N A;  3ONJ A;  4TN7 B;  4IE7 A;  4L9I A;  3O1I A;  5A1L A;  4ZOL E;  4HFD A;  5JDH A;  2WQY A;  4X64 T;  2LRL A;  4U74 A;  4YTN A;  2WY2 A;  2CLY B;  2LSJ A;  5FXW A;  2MOZ A;  3CVR A;  4ERR A;  3EAM A;  4H9S E;  1HNZ T;  5LHH B;  3KIN B;  3QNU A;  3N9N A;  1SA0 E;  3B5M A;  5JDM A;  3ZT5 A;  4DUY T;  2XHE B;  4ISS A;  4AQF A;  4DND A;  2NTY A;  4H63 V;  4KX6 A;  3KDS E;  2MPK A;  4EB6 E;  5CGM A;  2FBW A;  3UQ7 A;  4DV5 T;  4MLK A;  4PJM A;  3Q5X A;  5LNK A;  3QK6 A;  1FJG T;  1ZEE A;  2OLT A;  3OPC A;  1BR0 A;  4LMJ A;  3HKD E;  4PW8 A;  2WZH A;  4U31 A;  3ZJ1 A;  3ZEF B;  2CLY C;  2KMF A;  2BG9 A;  2X67 A;  3I0O A;  5L3D B;  5LYJ E;  4JI6 T;  2JQ9 A;  5CFB A;  4DR6 T;  3H3M A;  1UCU A;  2W0G A;  3AE7 A;  4U2Y A;  5ABE A;  4DV7 T;  4YXD A;  1LKX A;  4IE0 A;  3AVR A;  3RKG A;  5LJN A;  2DNX A;  3ZYM A;  5LHI B;  2F4V T;  2LSY A;  2BS3 A;  3UU8 A;  3CML A;  1KK7 A;  3SS1 A;  1WYB A;  4CXX A;  2MYS A;  4DMW A;  3LBX B;  2WM9 A;  2DWK A;  1W0B A;  3AE5 A;  3QOF A;  4ZHQ E;  2E9X D;  3Q5D A;  4QWN B;  4NXM T;  2OV9 A;  4U2Z A;  2M67 A;  2WDQ A;  2XQ7 A;  4TWF A;  5AQP B;  5FP3 A;  4BA9 A;  3CPZ A;  4WBN E;  3K1S A;  3UFE A;  5HXS A;  3PUG A;  2QYW A;  4ILA A;  5E0O A;  4YJ2 E;  1LVK A;  2YOE A;  2CBI A;  2V7I A;  4IDP A;  3T8O A;  5JR9 C;  3RPU A;  4IE5 A;  2Z6E A;  3AA1 B;  2P9B A;  3MZK B;  3U3I A;  5IYZ E;  1UUS A;  4QXH B;  2N2N A;  3AEC A;  3IHR A;  4L0R A;  2A72 A;  4DMV A;  1SHZ C;  2JQH A;  2LSI A;  3RX6 A;  5JRE A;  2ODV A;  1UUR A;  3H37 A;  1KNZ A;  4ILC A;  4TV9 E;  1AJ3 A;  3OYZ A;  5JDN A;  4LML A;  5LGN B;  2B76 A;  4U72 A;  4AKL A;  3OKQ A;  2YU2 A;  4TV8 E;  3HKE E;  2VB6 A;  4AXP A;  2NW9 A;  2E5L T;  3K3O A;  3JC6 C;  3I0Q A;  5KX5 E;  3Q5W A;  4BJN A;  4WYV A;  1T72 A;  3AEG A;  2V6Y B;  4NUU A;  3AED A;  4WNK A;  2QA7 A;  4P09 A;  1Z0P A;  4TNW A;  4BJM A;  3AA6 B;  5HXH A;  5AQI B;  3R84 B;  2HPJ A;  1KNP A;  3ZSS A;  2X0Y A;  3FXD B;  5FY0 A;  4NPP A;  1WFD A;  2X0L B;  2XY8 B;  3ESL A;  3FZM B;  2XQA A;  3B13 A;  3UUM A;  3D0T A;  3AEA A;  1HF8 A;  2L8K A;  3IA3 A;  3RC3 A;  5LG3 A;  4DUZ T;  2H3R A;  3TLS A;  3J7Y q;  4LF4 T;  1NEN A;  3E0Z A;  3SOL A;  2VVS A;  2JIW A;  5AQG B;  4QX8 B;  5FY1 A;  4AKH A;  1LRZ A;  2XQ6 A;  2WAU A;  2IML A;  2V8S V;  2KSR A;  2V7K A;  5EK2 A;  1IBM T;  4UV8 B;  2LM2 A;  4HTE A;  3VHL A;  5J0Z A;  4QXC B;  3KV9 A;  2Y8D A;  3NZQ A;  2YK0 A;  5FL0 A;  5JR9 B;  5L3C B;  2W4X A;  5HEO A;  4AIU A;  4MBQ A;  4JV5 T;  1FMW A;  2K9A A;  5DAB A;  2WWU A;  4GYS A;  3ZCJ A;  5LGT B;  2ZM2 A;  3AE3 A;  3ETU A;  3QB5 K;  4PFP A;  4F6R C;  2XQY A;  2WU2 A;  3SWH A;  2NW7 A;  1QUU A;  5LA6 E;  4JI2 T;  4GKJ T;  1HNW T;  3WI3 A;  3N9Q A;  1HX8 A;  2W63 A;  4B3S T;  5F3J A;  2C0S A;  2E2A A;  5JRC A;  2D2S A;  2FJE A;  3P4P A;  3F57 A;  2V7J A;  2Q9Q D;  3L39 A;  3AAA B;  5HCJ A;  1IZN B;  3CWZ B;  3N9P A;  3VR8 A;  3CQC B;  3AE2 A;  3NZP A;  3ZMT B;  2VKO A;  3BQL A;  4HGA A;  3ZYL A;  4H9Q C;  3RQW A;  2A3D A;  2KLQ A;  2KWH A;  2K48 A;  2ACX A;  4IGU A;  4UIG A;  2AXD S;  2PJQ A;  3RYC E;  4X5T A;  3LK2 B;  3CX6 B;  1NAF A;  4E7Z A;  3OTO T;  3L8R A;  3JAE A;  4A97 A;  3O1H A;  3KVB A;  2M6B A;  2CXF A;  1MIY A;  4XBF B;  2WB5 A;  4QH5 A;  1OWA A;  3JCF A;  4XZC A;  5F5W A;  5L3E B;  2D9D A;  4JI4 T;  1IBK T;  4H63 H;  2D0T A;  3RYH E;  2CM0 A;  2NP9 A;  5JDF A;  2BZB A;  4AQF C;  5KXJ A;  4P1N A;  1S35 A;  4PK5 A;  4UF0 B;  2OA5 A;  5BR8 T;  1XNR T;  5HYA A;  3ZMU B;  1MIW A;  1W09 A;  2XAJ B;  3PUX F;  1UX5 A;  1JNZ A;  1OXZ A;  2XSA A;  1J1J A;  2BVM A;  2FJD A;  2Q9Q A;  2LJL A;  4XAX B;  5FXZ A;  4ZS3 A;  3K8P C;  2CRB A;  3GA8 A;  3ZT6 A;  4AKG A;  3JAF A;  2XQ5 A;  4YTM A;  4YTP A;  3AE1 A;  4U3C A;  2EHO D;  4ZXL A;  5LCY A;  2XAF B;  3DJB A;  5EZY E;  4KMC A;  5FXV A;  4MAL A;  4ZI7 E;  5AQF B;  1HTJ F;  3A8Y C;  2UXD T;  4A98 A;  4N78 D;  2NOX A;  3PU8 A;  3A5X A;  4JUY A;  5L3F B;  3F2E A;  3AB3 B;  4PK4 A;  5DJQ C;  3IBP A;  1YXR A;  3I9W A;  1XDO A;  3KBU A;  2ZM8 A;  4WZX A;  3NBX X;  2XZE A;  5C3J A;  2ZM6 T;  2LLY A;  3LG7 A;  3CKD A;  5AQH B;  5FL1 A;  2LKH A;  1FEW A;  4UEL A;  4IDO A;  3CX8 B;  2DCF A;  2ES0 A;  2L3L A;  3PUA A;  1M7K A;  2H7V C;  4HWF A;  1XMQ T;  1HS7 A;  3RF1 A;  3PUR A;  5JQG E;  1KF6 A;  2V5C A;  4G63 A;  4YJ3 E;  1HX1 B;  5AQK B;  1ZP0 A;  1N36 T;  4MHC A;  1T98 A;  2BKP A;  1YQ3 A;  2C5J A;  4O2B E;  3VKH A;  4I50 E;  4DV0 T;  5AQR B;  2WBL A;  3EDU A;  4OHF A;  2N9D A;  3L09 A;  1X9B A;  2VKH A;  4Q25 A;  3F31 A;  3OBV E;  1KNR A;  2H88 A;  4CXY A;  1B7T A;  4IL4 A;  4IIJ E;  4HFV A;  5FXX A;  1V9D A;  2E5V A;  5HXR A;  4P0A A;  3ZN1 B;  2UXX B;  4ZEY A;  3AXJ B;  2X68 A;  1OED E;  4YFS A;  1BR1 A;  3RIU C;  3ZYK A;  4DR7 T;  2EHO A;  3LSV A;  2WDR A;  4JI1 T;  4IE4 A;  2LOS A;  3PUW F;  4GIW A;  2BS2 A;  1M62 A;  2LOP A;  4PK6 A;  5AQQ B;  5LOV E;  5J2T E;  1N32 T;  4JI7 T;  2CWY A;  4KHZ F;  5AQJ B;  2XUE A;  3RH3 A;  3KV4 A;  3UU4 A;  3ZLI A;  4CN1 A;  4KUM B;  2J62 A;  1CHU A;  2UUB T;  2UXB T;  4O2A E;  1MND A;  3OYX A;  1MMN A;  2LKG A;  2C5K T;  3PTR B;  4IDZ A;  5FVK A;  4LF8 T;  3TLV A;  1W9R A;  2KXP B;  3I1A A;  4YLH A;  5H6Q B;  2I0M A;  4X1Y E;  1BR4 A;  3MXZ A;  2CXD A;  4ILB A;  4DID B;  4JI5 T;  5HEH A;  4G2A A;  1WRD A;  3AA0 B;  3RRW A;  5IWA T;  3FZL B;  3C4Z A;  3KFW X;  1I6Z A;  3E08 A;  2XQ3 A;  4OFZ A;  4YSX A;  1DU2 A;  2JJ9 A;  1VRB A;  2JPF A;  2RP4 A;  3P8C D;  1W0A A;  2CWO A;  2IHR 1;  3EAB A;  3N2G E;  5FVL A;  1EZ3 A;  4TX5 A;  4DR3 T;  5F8P A;  4JI8 T;  4TUY E;  2W00 A;  2ZMA A;  2IW5 B;  4ZI2 D;  3K3Q C;  4TWD A;  1KEY A;  1WR0 A;  2BBJ A;  1QLB A;  2XQ4 A;  2MTQ A;  2X9W A;  2XM2 A;  3FZK B;  3RKO A;  4AIS A;  4CQI A;  4ZI3 D;  5ABH A;  4YY3 T;  2X9Y A;  3AE6 A;  4ANJ A;  4EYU A;  1SUM B;  2Y6X A;  4NXN T;  3NKZ A;  2V6X A;  2HH7 A;  4JLE A;  2DLR A;  4TNV A;  1FMV A;  2LT3 A;  4IDQ A;  3OVU A;  2H7O A;  5HAX A;  2WMN A;  2VK9 A;  2V1D B;  2YDQ A;  5AQS B;  4GK0 E;  3TKL B;  3TLT A;  3ZN0 B;  5CA1 E;  1R8I A;  2XAG B;  2LHN A;  3O4X E;  5BMV E;  2CHN A;  4YSZ A;  3VRA A;  2J4G A;  4GOU A;  3FZH B;  2A9U A;  2BKN A;  3UQ4 A;  1N34 T;  4U7Y A;  2GK9 A;  1WCR A;  3H3A A;  3ZMS B;  3VU7 H;  2I59 A;  3UT5 E;  2XTL A;  4HN9 A;  2WCA A;  5AQM B;  5L3B B;  4YHH T;  4F8H A;  4PJN A;  4IE6 A;  2C5I T;  3RLF F;  3VKG A;  2XJ7 A;  2FUP A;  3PUQ A;  5ABF B;  3ZST A;  1ZOY A;  2WDV A;  4QKN A;  2E9X B;  2KZ7 B;  4IST A;  2CPT A;  2DWG A;  4HFE A;  3X1D A;  3GN5 A;  4QH1 A;  4ZZC A;  3V5S A;  3N9L A;  4HWI B;  4CI1 B;  5L4E A;  3MK7 C;  4NIQ A;  2YN6 A;  3AAI A;  3MJX A;  3ONX A;  3ZC1 A;  4KHP T;  3WAJ A;  2D0U A;  5IUX A;  2PG8 A;  2R6G F;  3C50 A;  1UGO A;  3AA7 B;  1ZV4 X;  2WZI A;  3LBX A;  3SFE A;  3KV6 A;  4A56 A;  2MBG A;  1HCI A;  2PBI A;  3QUJ A;  4X1I E;  5AQV B;  4DV1 T;  2ZLY A;  3MAC A;  3UUB A;  4M1P A;  4P0B A;  4TZ4 C;  4O4I E;  3RIA A;  5LP6 E;  4DV2 T;  4LF9 T;  3VR9 A;  5JDQ A;  4TWH A;  4DBR A;  2X9X A;  1D1B A;  1HFA A;  5EK4 A;  1MIV A;  1YKE B;  4X65 T;  5DQW A;  1FIO A;  1SE7 A;  2JMH A;  3HL6 A;  1X79 A;  2FJB A;  4J2C A;  2DI4 A;  1MMD A;  2CHO A;  3PU3 A;  2WSS V;  1OED B;  5AQL B;  3JC6 D;  3QC9 A;  3RIF A;  5DQV A;  5H6R B;  2YIN A;  1G8X A;  3FZF B;  4DV3 T;  3PDY A;  1UX4 A; 
#chains in the Genus database with same CATH homology
 4ZS2 A;  3J9X 1;  3ZMV B;  5M4Y A;  3ZCI A;  2ZM0 A;  4O4H E;  4HE8 A;  2PFV A;  3U78 A;  4H9P C;  3Q2M A;  3HA4 A;  4NUV A;  3DTO A;  4PFO A;  3ETV A;  5LGU B;  2HPL A;  3KBT A;  4PJL A;  2E9X C;  3O1J A;  2XAQ B;  3N2O A;  3NRX A;  2UXN B;  5LBM A;  5TAO A;  2ODU A;  2IC6 A;  3OJA A;  3N9O A;  3LJC A;  2NW8 A;  4QHO A;  1YKH B;  4GK5 E;  2RA1 A;  4CI3 B;  3LFM A;  4DBQ A;  2N1G A;  1IJ6 A;  5LXT E;  2NTX A;  3LK3 B;  4ILU A;  1E1H B;  2X9H A;  3FBZ A;  3ANW A;  3C51 A;  4CZZ B;  1ZHC A;  4YHJ A;  2DHR A;  2KWI B;  1IJ5 A;  3N5L A;  3CX7 B;  1HG5 A;  4UVA B;  2VKJ A;  4C90 A;  4FI5 A;  2CXL A;  4I55 E;  3EVY A;  5KDM C;  4B6X A;  1S94 A;  3FB2 A;  4EYY R;  3ZMZ B;  3WAK A;  2JRK A;  5HWX A;  3GMI A;  3FXE B;  1MMA A;  4ZI3 C;  3HR0 A;  3S4U A;  2LM9 A;  2SPC A;  3C98 B;  4PJJ A;  5CB4 E;  5ADX L;  1D1C A;  4I43 B;  2NWB A;  3IF8 B;  4AKR B;  1QSD A;  5CA0 E;  3HKC E;  3N9M A;  4UXN B;  4I4T E;  4ASK A;  4EAH A;  2W62 A;  5FNV E;  4C91 A;  2XAH B;  3NRY A;  4WW0 A;  5J1G A;  5HXC A;  5JR9 A;  3HI2 A;  3IEE A;  5JDL A;  4V1A v;  2K5B B;  3B57 A;  3UUL A;  2A2F X;  4EOZ B;  3EDV A;  1YD8 G;  2VL8 A;  4CXW A;  4O8S A;  4EIW A;  5KMG P;  4EZ4 A;  4QXB B;  1NWM X;  2CA5 A;  3MA9 A;  3BK9 A;  4AKI A;  5JVD E;  4DO0 A;  2EHO C;  4ZI2 C;  2IAK A;  1U4Q A;  4CI2 B;  3C4X A;  4H9O C;  3PUS A;  3KV5 A;  4OYK A;  2LEH A;  2BDE A;  1VOM A;  2JQQ A;  2VAS A;  4O4L E;  3CQG B;  2LSG A;  4AI6 A;  1WYC A;  2J1D G;  3SRZ A;  5FY7 A;  5L2L A;  3KVA A;  3R6N A;  3Q9D A;  2X51 A;  4JEH B;  3LK4 2;  4UV9 B;  1CUN A;  4K0U A;  2YEV C;  4UVC B;  3GN5 B;  5LG4 A;  5J2U E;  1IAP A;  4OYJ A;  2CE7 A;  5HXE A;  2CMR A;  3C64 A;  4JEU B;  2V7M A;  2V7L A;  5JDG A;  3ZJ2 A;  2Q9Q B;  2CEA A;  4BAY B;  3C4W A;  2LSK A;  2LHR A;  3I9Y A;  1D0Z A;  3UUN A;  1HG2 A;  4PAG A;  2BVL A;  4OK0 A;  4Z8X A;  2W61 A;  4L5G A;  3PE0 A;  3ZC0 A;  3N2K E;  2KIN B;  3RC8 A;  2Y48 B;  2VKD A;  3DP7 A;  3M65 A;  1MMG A;  2JMK A;  1MNE A;  3UUX B;  3EUH A;  3E22 E;  1D1A A;  2EHO B;  5LJM A;  2L9Q A;  4X20 E;  2QGS A;  3CQX C;  4PNI A;  3GWH A;  4H9R C;  4H9N C;  2XAS B;  2D5U A;  3AVS A;  1H7C A;  3UTK A;  2E8I A;  2CCQ A;  3L3P A;  4AQG A;  1Y64 B;  4E7S A;  5LHG B;  1U5P A;  5ETW A;  4GYR A;  3BQK A;  3O9X A;  3MKD A;  3BQI A;  1LVF A;  1D0X A;  2KND A;  2YU1 A;  4ADZ A;  5FMN A;  4HKA A;  4EXT A;  4UVB B;  2V26 A;  1YW0 A;  1WR6 A;  2Q9Q C;  4QX7 B;  2G0U A;  4HEA A;  5GON E;  3W15 B;  1G73 A;  3FBL A;  3HKB E;  3FHN A;  3ANW B;  5JRC B;  4O4J E;  4X1K E;  1D0Y A;  1BR2 A;  1O3X A;  5L3G B;  2KT9 A;  5FYM A;  2WMO A;  4KBM B;  4FJO A;  5IHY A;  4EZH A;  2K24 A;  1ZKE A;  5LBQ B;  3RRC A;  1US7 B;  5EK3 A;  2VWA A;  2X66 A;  4WBO A;  5C8Y E;  4KP3 C;  3RYI E;  3ZPO A;  4MFR A;  3V5U A;  2LE8 A;  1WLX A;  3RYF E;  4UEM A;  4IHJ E;  5HWY A;  2IC9 A;  5AFU L;  5JH7 E;  2E9X A;  2B1E A;  4DVD A;  4UF0 A;  3P7I A;  3AAE B;  3K3N A;  4TN7 B;  4IE7 A;  4L9I A;  3O1I A;  5A1L A;  4ZOL E;  5JDH A;  4U74 A;  2CLY B;  2LSJ A;  5FXW A;  2MOZ A;  3CVR A;  4ERR A;  4H9S E;  5LHH B;  3KIN B;  3N9N A;  1SA0 E;  5JDM A;  2XHE B;  4ISS A;  4AQF A;  4DND A;  2NTY A;  4H63 V;  4EB6 E;  3KDS E;  4MLK A;  4PJM A;  3Q5X A;  5LNK A;  3QK6 A;  1ZEE A;  1BR0 A;  4PW8 A;  3HKD E;  3ZEF B;  3ZJ1 A;  5L3D B;  2CLY C;  2KMF A;  2X67 A;  3I0O A;  5LYJ E;  1UCU A;  2W0G A;  1LKX A;  4IE0 A;  3AVR A;  5LJN A;  2DNX A;  3ZYM A;  5LHI B;  2LSY A;  3CML A;  1KK7 A;  3SS1 A;  1WYB A;  4CXX A;  2MYS A;  4DMW A;  3LBX B;  2WM9 A;  2DWK A;  4ZHQ E;  2E9X D;  4QWN B;  4WBN E;  2M67 A;  5FP3 A;  4BA9 A;  5HXS A;  3CPZ A;  3UFE A;  3PUG A;  5E0O A;  4YJ2 E;  1LVK A;  5JR9 C;  2V7I A;  3T8O A;  3RPU A;  4IE5 A;  2Z6E A;  3AA1 B;  2P9B A;  3MZK B;  3U3I A;  5IYZ E;  4QXH B;  2N2N A;  4L0R A;  3IHR A;  5JRE A;  2A72 A;  4DMV A;  1SHZ C;  2LSI A;  3RX6 A;  2ODV A;  3H37 A;  1KNZ A;  4TV9 E;  1AJ3 A;  3OYZ A;  5JDN A;  5LGN B;  4U72 A;  4AKL A;  3OKQ A;  2YU2 A;  4TV8 E;  3HKE E;  2VB6 A;  4AXP A;  2NW9 A;  3K3O A;  3JC6 C;  3I0Q A;  5KX5 E;  3Q5W A;  4BJN A;  4NUU A;  4WNK A;  2QA7 A;  4P09 A;  1Z0P A;  4BJM A;  5HXH A;  3AA6 B;  3R84 B;  2HPJ A;  3FXD B;  5FY0 A;  2X0L B;  3ESL A;  3UUM A;  3B13 A;  3D0T A;  1HF8 A;  2L8K A;  3RC3 A;  2H3R A;  3J7Y q;  3E0Z A;  3SOL A;  5FY1 A;  4QX8 B;  1LRZ A;  2WAU A;  5EK2 A;  2V7K A;  4UV8 B;  4HTE A;  3VHL A;  4QXC B;  3KV9 A;  2Y8D A;  3NZQ A;  2YK0 A;  5JR9 B;  5L3C B;  4MBQ A;  1FMW A;  2K9A A;  5DAB A;  2WWU A;  4GYS A;  3ZCJ A;  5LGT B;  2ZM2 A;  4PFP A;  3ETU A;  4F6R C;  2XQY A;  3SWH A;  2NW7 A;  1QUU A;  5LA6 E;  3WI3 A;  3N9Q A;  1HX8 A;  2W63 A;  5F3J A;  2C0S A;  5JRC A;  2D2S A;  3F57 A;  2V7J A;  2Q9Q D;  3AAA B;  1IZN B;  3CWZ B;  3N9P A;  3ZMT B;  3CQC B;  4AKH A;  3NZP A;  2VKO A;  3BQL A;  4HGA A;  3ZYL A;  4H9Q C;  2A3D A;  2KLQ A;  2KWH A;  2K48 A;  2ACX A;  4IGU A;  4UIG A;  2PJQ A;  3RYC E;  3LK2 B;  3CX6 B;  1NAF A;  4E7Z A;  4XBF B;  3O1H A;  3KVB A;  2CXF A;  1MIY A;  1OWA A;  4XZC A;  5L3E B;  4H63 H;  2D0T A;  3RYH E;  2CM0 A;  2NP9 A;  5JDF A;  2BZB A;  4AQF C;  1S35 A;  4PK5 A;  4UF0 B;  2OA5 A;  5HYA A;  3ZMU B;  1MIW A;  2XAJ B;  1UX5 A;  1OXZ A;  2BVM A;  2Q9Q A;  2LJL A;  4XAX B;  5FXZ A;  4ZS3 A;  3K8P C;  3GA8 A;  4AKG A;  5LCY A;  2EHO D;  2XAF B;  3DJB A;  5EZY E;  4KMC A;  5FXV A;  4MAL A;  4ZI7 E;  1HTJ F;  4N78 D;  2NOX A;  3PU8 A;  3A5X A;  4JUY A;  5L3F B;  3F2E A;  3AB3 B;  4PK4 A;  5DJQ C;  3IBP A;  3I9W A;  3KBU A;  2ZM8 A;  3NBX X;  3LG7 A;  3CKD A;  1FEW A;  4UEL A;  3CX8 B;  2ES0 A;  2DCF A;  2L3L A;  3PUA A;  2H7V C;  3PUR A;  5JQG E;  4G63 A;  4YJ3 E;  4MHC A;  1T98 A;  2C5J A;  4O2B E;  3VKH A;  4I50 E;  2WBL A;  3EDU A;  4OHF A;  2N9D A;  3L09 A;  2VKH A;  3F31 A;  3OBV E;  4CXY A;  1B7T A;  4IIJ E;  4HFV A;  5FXX A;  1V9D A;  5HXR A;  4P0A A;  3ZN1 B;  2UXX B;  2X68 A;  4YFS A;  1BR1 A;  3ZYK A;  2EHO A;  4IE4 A;  2LOS A;  4GIW A;  4PK6 A;  2LOP A;  5LOV E;  5J2T E;  2CWY A;  2XUE A;  3RH3 A;  3KV4 A;  3ZLI A;  4KUM B;  4O2A E;  1MND A;  3OYX A;  1MMN A;  3PTR B;  2C5K T;  4IDZ A;  2KXP B;  3I1A A;  4YLH A;  5H6Q B;  4X1Y E;  1BR4 A;  3MXZ A;  2CXD A;  4G2A A;  1WRD A;  3AA0 B;  3RRW A;  3C4Z A;  3KFW X;  3E08 A;  4OFZ A;  2JJ9 A;  1VRB A;  2JPF A;  2RP4 A;  3P8C D;  2CWO A;  3N2G E;  1EZ3 A;  4TX5 A;  5F8P A;  4TUY E;  2W00 A;  2ZMA A;  2IW5 B;  4ZI2 D;  3K3Q C;  1HS7 A;  2MTQ A;  2X9W A;  3RKO A;  4CQI A;  4ZI3 D;  2X9Y A;  4ANJ A;  4EYU A;  2Y6X A;  2HH7 A;  4JLE A;  2DLR A;  1FMV A;  2LT3 A;  2H7O A;  5HAX A;  2WMN A;  2VK9 A;  2V1D B;  4GK0 E;  3TKL B;  3ZN0 B;  5CA1 E;  2XAG B;  2LHN A;  3O4X E;  5BMV E;  4GOU A;  2GK9 A;  3H3A A;  3ZMS B;  3VU7 H;  2I59 A;  3UT5 E;  2XTL A;  4HN9 A;  5L3B B;  4PJN A;  4IE6 A;  2C5I T;  3VKG A;  3PUQ A;  4QKN A;  2E9X B;  2KZ7 B;  4IST A;  2DWG A;  3GN5 A;  3V5S A;  3N9L A;  4CI1 B;  3MK7 C;  3AAI A;  3MJX A;  3ONX A;  3ZC1 A;  3WAJ A;  2D0U A;  2PG8 A;  3LBX A;  3C50 A;  3AA7 B;  1ZV4 X;  4A56 A;  3KV6 A;  2MBG A;  1HCI A;  2PBI A;  3QUJ A;  4X1I E;  2ZLY A;  3MAC A;  4M1P A;  4P0B A;  4TZ4 C;  4O4I E;  5LP6 E;  5JDQ A;  4DBR A;  2X9X A;  1D1B A;  1HFA A;  5EK4 A;  1MIV A;  1YKE B;  5DQW A;  1FIO A;  2JMH A;  3HL6 A;  1X79 A;  4J2C A;  2DI4 A;  1MMD A;  3PU3 A;  2WSS V;  3JC6 D;  3QC9 A;  5DQV A;  5H6R B;  2YIN A;  1G8X A;  3PDY A;  1UX4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...