4H63V

Structure of the schizosaccharomyces pombe mediator head module
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
117
structure length
117
Chain Sequence
SFQRQLVQRTNTLNSSIDNATLTILSRFQDILDIAINEGKDKYTVAPEVYQIECHTVSMVRAVEQLLDVSRQIKSYWLTNSLSTSFPTVDYSEPDLEKVKRTLTKLQNHLLEVSLIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mediator of RNA polymerase II transcription subunit 6
publication title Structure of the Mediator head module.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Transcription
total genus 43
structure length 117
sequence length 117
ec nomenclature
pdb deposition date 2012-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
V PF06179 Med22 Surfeit locus protein 5 subunit 22 of Mediator complex
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1600 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4h63V00
4H63V 3R84B
chains in the Genus database with same CATH superfamily
2DHRA 3EDUA 3I0QA 4JEHB 2CLYC 1U4QA 5LJMA 3AAIA 1O3XA 3ZJ1A 4CXXA 4CN6A 1OXZA 2IC9A 3NKZA 4NXNT 3I9YA 4IE5A 4TWDA 4ZXLA 1VCSA 4HFHA 5L4HA 4O4JE 5IWAT 4BA9A 4GKJT 2Y6XA 3QK6A 3N5LA 1JNRA 3RH3A 4DR7T 4QX7B 1YW0A 2BDEA 3ZYMA 4DO0A 5JDNA 4ILBA 2LSYA 3MXZA 2LSJA 2X9XA 2WQYA 5LOVE 2WBLA 4TZ4C 2BKNA 4ISTA 2M6IA 1NWMX 4H63V 3R84B 1WYBA 2PFVA 4HKAA 4XZCA 1XDOA 4GOUA 2DCFA 2RA1A 4LFCT 4FI5A 4HE8A 4X1YE 4C90A 4GIWA 2E9XA 5AQPB 2A9UA 2CWYA 3ANWB 3AEGA 2XAGB 2KT9A 1CUNA 4TN7B 2KZ7B 2LM9A 3UU4A 2I0MA 5EK3A 1WR0A 2H7VC 1XDPA 4TUYE 2NWBA 3PTRB 5L3BB 1BR2A 5AQOB 2NW9A 2VB6A 4YJ2E 4QH1A 2ACZA 3ZMZB 2C5KT 3IF8B 3C4ZA 4BJMA 3PUGA 5HXRA 2BVMA 3AE6A 1OEDC 1OEDE 4TNVA 2NR4A 4HWDA 1MIVA 3NWIA 5FMNA 1HG5A 4U2YA 2CE7A 2VVNA 2WAUA 5FL0A 4EGWA 3VKHA 2LE8A 4L9IA 4AKRB 5CB4E 3OKQA 4B3MT 3ZMUB 1YD8G 2X9WA 4O2AE 3FHNA 2NW7A 3IHRA 4KMCA 2MYSA 4DR6T 2V1DB 5L3GB 2Q9QB 5KDMC 2V6YA 2YEVC 4IL4A 3M3ZB 5L4EA 5CFBA 2E2AA 4F8HA 3AEDA 4MFRA 5LGTB 5AQRB 3ETVA 3SWHA 4A97A 3AA0B 2IAKA 3LJCA 4IDNA 3L09A 2CCQA 2WB5A 1IZNB 4DUZT 5CA1E 3AVSA 5C3JA 2FUPA 2W62A 2BVLA 5L3EB 1IBMT 2W67A 1G8XA 3O1JA 3UTKA 2V26A 5FXZA 3UFEA 1GQEA 4DBRA 2V7IA 1FMVA 3AAAB 3RRCA 2A3DA 2N9DA 2GK9A 2LRLA 2WU2A 3AAEB 3IA3A 2CWOA 5JTGA 3MKDA 3ZSTA 4B6XA 2C0SA 1MIYA 3B5MA 5AQQB 2YU1A 4IDOA 3FBLA 1V9DA 3RRWA 3CX8B 1LKXA 4ZZCA 5ABHA 3ANWA 2LKGA 4EEDA 4I50E 5H6RB 2NW8A 1KK7A 1KNZA 3CX7B 2VWAA 4TWFA 2VVSA 4UF0A 3RYIE 5DABA 2XQ4A 3UUXB 4JYAT 2AE9A 5JDMA 4OHFA 4DR2T 5H6QB 5FKYA 3UT5E 3HKBE 1ZHCA 1D1BA 3C4WA 1UK5A 4WBNE 1CHUA 1W0BA 2JPFA 4HFBA 1HX8A 1YQ3A 3PJAJ 3OVUA 3LG7A 4NUVA 1IAPA 4NXMT 3ONLC 1ZEEA 5J2UE 4HEAA 5KX5E 4AKHA 2JQKA 3RLFF 5AQSB 4LF5T 4ZI7E 3G06A 5JDGA 4HN9A 2CBJA 2Q9QA 1X9BA 3HKCE 4JEUB 2F4VT 2NTXA 4EYYR 4PK5A 5LYJE 4PAGA 1NEKA 1IJ5A 4U2ZA 2ODUA 3SOLA 3WAKA 4ADZA 3J9X1 4JI5T 4YTPA 5JR9B 3RF1A 4PJJA 4QXBB 3ONJA 4U7YA 4IHJE 4U3CA 4ILCA 2YDSA 2LJLA 3OJAA 4A98A 1ZV4X 3JAFA 5E0OA 5L2LA 2WZIA 3TLVA 3SFEA 3PE0A 2KMFA 1ZKEA 2NOXA 2BG9C 4IREA 3LK2B 3FZHB 5LBMA 1D0XA 3RIUC 4H9PC 3FBZA 3EI0A 1U5PA 2K24A 5FYMA 3FXEB 4J2CA 2BKOA 4AKIA 1FEWA 4IGUA 3EHZA 3NBXX 4ZS2A 2CHNA 4OYKA 4YXDA 3LK42 4AQFC 5LGNB 3S4UA 3E08A 5JH7E 4IL9A 1HS7A 2K3WA 5ABGA 3AXJB 5LMNT 4HWFA 5M4YA 1KFYA 3SRZA 2L9QA 1S35A 4HFIA 4DV2T 3O4XE 4JV5T 4O4IE 1D0ZA 2K5BB 2BBJA 4YSXA 2CMRA 2R6GF 2V8SV 3H3AA 2YK0A 3AB3B 5LG4A 4DVDA 3AE5A 5IUXA 2FJAA 3ZMTB 3UU5A 5FP3A 3RPUA 3UFGA 5BR8T 2C5JA 3LFMA 4X1IE 3Q2MA 3P4RA 1KEYA 2LRKA 2PTFA 2W0GA 2WU5A 5CGMA 2JQ9A 3UU8A 2V5DA 2W66A 3NVOA 1VRBA 2EHOB 4GYRA 2CM0A 2ZM2A 1WCRA 3TLWA 1X79A 4ILUA 3RQWA 1WYCA 2XAJB 3EUHA 1R8IA 3JCFA 1N32T 4KP3C 4KBMB 4UXNB 4PJLA 2JQHA 5EK4A 2V5CA 3QNUA 4GK5E 3Q5DA 3RX6A 3ZKRA 3OYZA 4P09A 4F6RC 2ZM0A 3UUNA 1H7CA 1US7B 3RC3A 5AQIB 4ZZBA 4O4LE 5L47A 2HPJA 3QB5K 4L0RA 1MMNA 2CA5A 2UU9T 1UGOA 4MHCA 1N36T 2D0TA 3AVRA 4LMJA 1T8BA 4H9SE 3OTOT 1I94T 3ZN1B 1LRZA 5JR9A 4U7IA 1WLXA 4C91A 3AEBA 2CLYB 4YHHT 5AQVB 2UUCT 4QWNB 3CPZA 3QB5A 4I55E 3LDQB 2IW5B 2X0LB 4O4HE 4YTMA 1I6ZA 1LVKA 2WS3A 4LMKA 2JIWA 1W9RA 2MBGA 2XSAA 5F8PA 2WP9A 3KFWX 5AQNB 3BQLA 1HF8A 5HEUA 1MMDA 1YKEB 4AKLA 2SPCA 4WBOA 5HWYA 4H9OC 4Z90A 2ZLYA 5ABFA 2W00A 1J1JA 3RYFE 4HFDA 4JI0T 2WY2A 3TLTA 3N9QA 2E5VA 3KDSE 3QUJA 5EK2A 5HXCA 3WAJA 1NAFA 3KBUA 4MLKA 2CXDA 5JRCA 1W09A 2H89A 2WDVA 3HL6A 3LBXB 3QOFA 2XQ8A 5LGUB 2VKOA 4DNDA 2HN2A 4X20E 3CMLA 2V7KA 4YSYA 2D5UA 2D0UA 5FY1A 4X66T 2DI4A 5JQGE 3F31A 4NIQA 3PUZF 1SUMB 4X64T 2BS2A 3E0ZA 4KUMB 3ZYLA 4YLHA 2EHOA 4I0UA 3OYXA 2DNXA 3ZT6A 4WW0A 1L0VA 4EYUA 5FVKA 2XUEA 2XTLA 4UVCB 3U3IA 4HFVA 4K0KT 1OEDB 2KLQA 2I6HA 4BAYB 3SS1A 3V5UA 5C8YE 1HNXT 2E9XD 2IDOB 1KNPA 4TWHA 3RKGA 4YT0A 3TLSA 4TX5A 2XY8B 2QA7A 4GKKT 2XPKA 4L5GA 4G63A 5C2TA 3P4PA 3QC9A 3WI3A 2QVAA 3PUQA 4WNKA 4Z91A 3C98B 3N2KE 5DQVA 3ZCIA 4ZEYA 1FJGT 3T1HT 4LF7T 5JDLA 4AIUA 4LF6T 1UX4A 1XNRT 2X51A 4P0AA 3CVRA 2OA5A 5ETWA 2M6BA 4ZS3A 4AXPA 3EVYA 1HNWT 2QGSA 1E1HB 5AQLB 3ZYKA 3CWZB 2IHR1 5CA0E 4HWHA 3E22E 2VQET 4PNIA 3B57A 1J5WA 1DU2A 1HCIA 3K1SA 2FBWA 1SE7A 4PK4A 4YSZA 5FXWA 1BR0A 3CK6A 4ERRA 4ISSA 2YINA 2LSKA 5FY7A 1AJ3A 4UV8B 4UIGA 4EEBA 2ZM6T 3O1IA 4IDZA 4ZI3C 4N78D 1XMQT 2V7MA 2ES0A 3UUBA 2J47A 3CQGB 2WM9A 3KVAA 4BJNA 5HEOA 3ZMVB 3Q5EA 5HEJA 4LF4T 4A56A 3AE4A 3T8OA 2JJ9A 5LHGB 2H3RA 2X66A 4COFA 1MNDA 2LKHA 1IBLT 4DIDB 3U78A 4AKGA 3LBXA 4P1NA 1WFDA 5GONE 4UELA 2FJDA 4DR5T 3N9NA 2VK9A 3C64A 5JREA 4X1KE 2FJEA 2HPLA 3ESLA 3GN5B 5TAOA 1VCTA 2B1EA 4JI8T 1WRDA 4NUUA 1ZP0A 4HTEA 2BBHA 3RC8A 1HTJF 1M7KA 3L39A 5FXVA 4KI0F 3VU7H 5JR9C 4PW8A 3PURA 2LEHA 2A2FX 3BQKA 3OPCA 3CKDA 5LHIB 3KV5A 3FZLB 5JDFA 2XAQB 2ZM8A 4PJMA 4LF8T 2I59A 5FNVE 2B76A 3LSVA 5AFUL 5ABEA 5AQHB 5DJQC 5LG3A 2WMOA 4H9NC 4YY3T 2OV9A 1UX5A 3J7Yq 3R6NA 2HH7A 5HXHA 2E9XC 3K8PC 4K0UA 4QX8B 3AA7B 2WDQA 3A8YC 1XMOT 1Z8UA 4UR9A 3PUWF 3AEAA 4H9RC 4O8SA 4EAHA 1IBKT 2XM1A 4OX9T 2X0HA 4MBQA 3FZKB 3KINB 2A72A 3KV9A 3L3PA 3N2GE 1T72A 4AQGA 3P4QA 4ZI2D 4YJ3E 3MZKB 2L3LA 3PV0F 4U31A 3NZPA 5LXTE 5HCJA 5HAXA 3LK3B 4DMVA 4V1Av 4EOZB 4WZXA 1B7TA 3MK7C 2LT3A 1HG2A 4JLEA 2Q9QD 3MJXA 2XQYA 2G0UA 3JAEA 2BG9B 2D2SA 2WWVA 3O1HA 4LFBT 3RI5A 1EZ3A 1QUUA 4E7ZA 2WMNA 1QSDA 5LA6E 3JC6D 4A5XA 3AE7A 2CXFA 4PFPA 1HX1B 4I43B 3I1AA 2VKJA 2E8IA 2XQAA 3DJBA 4U74A 5CJ5A 4I4TE 1KNRA 3KVBA 2H88A 3NRXA 5L3CB 2V7LA 4GK0E 3B13A 3UQ4A 1N34T 2XAHB 2D9DA 4CZZB 4DR1T 1UUSA 3UU6A 2CEAA 2W61A 5EZYE 2V6YB 5HCMA 3AE1A 5LCYA 2MPKA 2UXBT 2ODVA 4ILAA 4HGAA 3RGLA 3TLUA 2ACXA 3CQXC 2L8KA 4LMLA 2UXDT 3DP7A 3FXDB 3PUXF 5L3DB 3IBPA 4H63H 4EZ4A 4X65T 5BMVE 4B3RT 1YKHB 3CIRA 3ZC1A 2N2NA 4OYJA 2V6XA 2UUBT 3PJAA 3RIAA 5J1GA 3VR8A 3EAMA 3AECA 4DV6T 5LB7B 2XJ7A 3F57A 3OBVE 4HWIB 2NP9A 2JMKA 3N2OA 4IDQA 3UQ7A 1IJ6A 2DL1A 4DV4T 3I0OA 4JBWF 5AQTB 2UXCT 1LVFA 4ZI3D 4UV9B 5HXSA 1MNEA 3MA9A 5AQGB 3RYHE 2Y8DA 5A1LA 3TKLB 3O9XA 2UXNB 5J2TE 3MACA 2VKHA 3N9LA 3DTOA 2LHNA 3V5SA 4KX6A 2J4GA 3K3QC 5LNKA 3VKGA 1ZOYA 2XQ3A 2CHOA 3T1YT 2X0YA 2M67A 4OK0A 3AXJA 4EV6A 3ZCJA 2QYWA 4PFOA 4ZI2C 2YOEA 4DMWA 1UURA 4CXWA 1Z0PA 1T98A 5HEHA 3F2EA 2X9HA 5AQFB 1VOMA 4IE7A 3ZEFB 1MMGA 3KV6A 3Q5XA 4FJOA 3M65A 4WYVA 2BG9A 4UF0B 4DV3T 4G2AA 3PUYF 5AQMB 3RIUA 4P0BA 2XQ9A 2XZEA 3AE8A 3AEFA 3K3OA 4QHOA 2Q9QC 4JI2T 4CQIA 3FZFB 4QXCB 4AQFA 4IE0A 4AI6A 4JI4T 2KNDA 2K9AA 4JI7T 4JI1T 4QH4A 2E5LT 2VL0A 2PBIA 3AE2A 2N1GA 3JC6C 1M62A 2OLTA 2X68A 5J0ZA 4XBFB 2LSIA 3AE3A 2VURA 2UUAT 2YDQA 3N9PA 2KWHA 2P9BA 2MOZA 3JADA 2UXXB 1D1AA 3ZJ2A 4KHPT 3NZQA 2RPAA 3H3MA 4QKNA 2XSBA 1XNQT 2J62A 3HKDE 5IYZE 2CPTA 2JMHA 2W63A 4IDPA 2JQQA 4X5TA 2WWUA 2CXLA 1G73A 3D0TA 2YDRA 3ETUA 3KV4A 3FZMB 5IHYA 4YFSA 4U33A 2YKSA 2WDRA 2DLRA 5LJNA 4Z8XA 3NRYA 1D1CA 1UCUA 5FY0A 3P8CD 4GYSA 4HFCA 1XZYA 4OFZA 2XASB 4YHJA 5FXXA 3PDYA 4PJNA 4CN4A 4IIJE 4DV5T 4EIWA 1JNZA 4MALA 3Q5WA 4E7SA 1E7PA 3P4SA 1BR1A 3A7MA 4QXHB 4LFAT 4QH5A 3EABA 3ZN0B 4HWCA 1D0YA 5FVLA 5F5WA 5JDHA 1E2AA 3I9WA 3A5XA 5AQUB 2VQFT 3AE9A 2HHHT 2EHOD 2LLYA 2YN6A 1NENA 2ZMAA 3VRBA 2X9YA 4NPPA 4UVAB 4X62T 4DV1T 2FJBA 3GA8A 1OWAA 3RKOA 2CBIA 3AA1B 4EZHA 3C50A 2VL8A 5LHHB 5HYAA 3ZSSA 3RIFA 3PUAA 3ZT7A 3ZC0A 2H7OA 2AXDS 1Y01A 2IMLA 3N9MA 5KXJA 1MIWA 4HFEA 1HFAA 3HI2A 3AA6B 5LP6E 3PU8A 4EXTA 1J5ET 2C5IT 2IUBA 3ZPOA 3IEEA 4IE6A 1MMAA 4PK6A 5KMGP 3VR9A 4KHZF 4DBQA 3RHWA 2XQ5A 3ZLIA 2XQ6A 2WZHA 2LOSA 3VRAA 4JI6T 4TNWA 3GMIA 3PU3A 3RYCE 2YU2A 3Q9DA 2LOPA 3KBTA 4O2BE 2DWGA 2IIUA 2DWKA 4H9QC 3L8RA 4EB6E 3P7IA 3CQCB 2BZBA 4DV7T 1T7SA 1OEDA 3UULA 5ADXL 4M1PA 3C4XA 3C51A 2X67A 1S94A 3ABVA 1FIOA 4XAXB 4U72A 2V7JA 3HR0A 2VASA 5L3FB 3RQUA 2QRXA 2MAWA 2XAFB 4TV9E 1FMWA 4CI3B 5HWXA 1WR6A 1HNZT 4UVBB 2W4XA 3UU3A 2KXPB 2WCAA 4AISA 3BK9A 3X1DA 2BKPA 5LMUT 2LSGA 1BR4A 5AQKB 1W0AA 3P4WA 4ASKA 2Y48B 4CI2B 4UEMA 4CXYA 2J1DG 1QLBA 1SHZC 4B3TT 5JVDE 2K48A 2IC6A 2KWIB 2BG9E 2LM2A 5DQWA 3VHLA 2E9XB 3AEEA 2PG8A 3ZMSB 2BS4A 4JUYA 5HXEA 4CI1B 2BS3A 2JRKA 3SFDA 5F3JA 2W2UA 5ABFB 3K3NA 5AQJB 1HR0T 2CRBA 2RP4A 3GWHA 4DR3T 3HA4A 3CX6B 2WSSV 3ONXA 2EHOC 3PUVF 5JDQA 1YXRA 4ZOLE 2Z6EA 1YQ4A 4ANJA 3ZT5A 3BQIA 3UUMA 5HEGA 2PJQA 5JRCB 3HKEE 2XQ7A 2LHRA 4IE4A 3W15B 3P50A 3N9OA 4DR4T 4IT4A 5LBQB 2KINB 2MTQA 4TV8E 3FB2A 4DUYT 2VKDA 4ZHQE 4AQYT 1SA0E 4B3ST 4DV0T 4CN1A 2NTYA 1KF6A 1Y64B 3GN5A 2KSRA 1N33T 4LF9T 3H37A 2XHEB 3PUSA 1XWMA 4Q25A 2HN1A 2XM2A 5FL1A 4JI3T 3EDVA 4YTNA
chains in the Genus database with same CATH topology
2DHRA 3K3OA 1ZV4X 4QHOA 2Q9QC 3EDUA 3I0QA 5E0OA 4JEHB 2CLYC 4CQIA 1U4QA 4ERRA 5LJMA 4ISSA 4QXCB 4AQFA 2YINA 3AAIA 4IE0A 5L2LA 2LSKA 1O3XA 4AI6A 2KNDA 2K9AA 5FY7A 1AJ3A 4UV8B 3ZJ1A 4CXXA 1OXZA 4UIGA 2IC9A 3O1IA 3PE0A 2KMFA 4IDZA 4ZI3C 4N78D 2PBIA 1ZKEA 2NOXA 2N1GA 3I9YA 3JC6C 2X68A 4IE5A 2LSIA 4XBFB 3LK2B 2V7MA 2ES0A 5LBMA 1D0XA 3N9PA 2KWHA 2P9BA 2MOZA 4H9PC 3FBZA 3CQGB 2UXXB 1U5PA 2K24A 2WM9A 1D1AA 4O4JE 3KVAA 3ZJ2A 5FYMA 4BJNA 3FXEB 4J2CA 3ZMVB 4AKIA 4BA9A 1FEWA 4IGUA 3NZQA 3NBXX 4ZS2A 2Y6XA 4OYKA 3QK6A 4A56A 3LK42 4AQFC 3T8OA 3S4UA 2JJ9A 3N5LA 4QKNA 5LGNB 5LHGB 2H3RA 3E08A 3RH3A 5JH7E 1HS7A 2X66A 1MNDA 4QX7B 1YW0A 3HKDE 5IYZE 3U78A 2BDEA 2JMHA 5M4YA 4AKGA 3LBXA 5GONE 3ZYMA 4DO0A 2W63A 4UELA 5JDNA 3N9NA 2VK9A 3SRZA 2L9QA 3C64A 2JQQA 1S35A 2WWUA 2LSYA 3MXZA 2LSJA 2CXLA 3O4XE 1G73A 5JREA 2X9XA 3D0TA 4O4IE 4X1KE 1D0ZA 5LOVE 2HPLA 3ESLA 3GN5B 2K5BB 2WBLA 3ETUA 3KV4A 5TAOA 4TZ4C 2CMRA 5IHYA 2B1EA 4YFSA 4ISTA 3H3AA 1NWMX 4H63V 2YK0A 3R84B 2DLRA 1WRDA 3AB3B 5LJNA 4Z8XA 4NUUA 1WYBA 2PFVA 4HTEA 4HKAA 4XZCA 5LG4A 3NRYA 3RC8A 1D1CA 1HTJF 1UCUA 4GOUA 2DCFA 5FY0A 5FXVA 3P8CD 4GYSA 3VU7H 2RA1A 5JR9C 4DVDA 4FI5A 4HE8A 4X1YE 4OFZA 4PW8A 2XASB 4C90A 4GIWA 2E9XA 3PURA 4YHJA 5FXXA 2LEHA 3PDYA 2A2FX 4PJNA 4IIJE 3ZMTB 3BQKA 4EIWA 3CKDA 2CWYA 3ANWB 5FP3A 3RPUA 4MALA 3Q5WA 5LHIB 3KV5A 2C5JA 3LFMA 4X1IE 3Q2MA 2XAGB 2KT9A 4E7SA 1CUNA 5JDFA 1BR1A 4TN7B 2XAQB 2KZ7B 2ZM8A 2W0GA 2LM9A 4PJMA 5EK3A 2I59A 5FNVE 5AFUL 4QXHB 1VRBA 2EHOB 2H7VC 4GYRA 5DJQC 4TUYE 2CM0A 3ZN0B 2NWBA 2WMOA 4H9NC 3PTRB 1D0YA 5L3BB 2ZM2A 1BR2A 2NW9A 2VB6A 5JDHA 4YJ2E 1X79A 3I9WA 3A5XA 4ILUA 1UX5A 2C5KT 3ZMZB 3J7Yq 3IF8B 3C4ZA 2HH7A 3R6NA 5HXHA 1WYCA 2XAJB 2EHOD 3EUHA 2E9XC 3K8PC 4K0UA 4BJMA 4QX8B 3AA7B 2ZMAA 3PUGA 2X9YA 4UVAB 5HXRA 4KP3C 2BVMA 4KBMB 4UXNB 4H9RC 4PJLA 4O8SA 4EAHA 5EK4A 3GA8A 4GK5E 1OWAA 3RKOA 3AA1B 4MBQA 3RX6A 4EZHA 3C50A 1MIVA 2VL8A 5LHHB 3OYZA 5HYAA 3KINB 5FMNA 3PUAA 4P09A 4F6RC 1HG5A 2ZM0A 3UUNA 2A72A 1H7CA 3KV9A 3ZC0A 2CE7A 2H7OA 3L3PA 2WAUA 1US7B 3RC3A 3N2GE 4O4LE 3VKHA 2LE8A 3N9MA 4AQGA 1MIWA 4L9IA 2HPJA 4AKRB 4ZI2D 4YJ3E 3OKQA 5CB4E 4L0RA 1MMNA 1HFAA 2CA5A 3ZMUB 3HI2A 1YD8G 2X9WA 4MHCA 3AA6B 4O2AE 5LP6E 2D0TA 3PU8A 3FHNA 3AVRA 2NW7A 3MZKB 2L3LA 3IHRA 4H9SE 4KMCA 2MYSA 3ZN1B 4EXTA 1LRZA 3NZPA 5JR9A 2V1DB 5L3GB 2Q9QB 2C5IT 5KDMC 1WLXA 4C91A 2YEVC 2CLYB 3ZPOA 3IEEA 4IE6A 5LXTE 1MMAA 5HAXA 3LK3B 4PK6A 4DMVA 4V1Av 5KMGP 4EOZB 4DBQA 1B7TA 4QWNB 4MFRA 3ZLIA 3MK7C 3CPZA 2LT3A 1HG2A 2LOSA 4I55E 5LGTB 4JLEA 2IW5B 2Q9QD 3MJXA 2XQYA 2G0UA 3ETVA 3GMIA 3PU3A 3SWHA 2X0LB 3RYCE 2YU2A 3Q9DA 2D2SA 4O4HE 2LOPA 3O1HA 3KBTA 3AA0B 4O2BE 2DWGA 1LVKA 1EZ3A 1QUUA 2IAKA 3LJCA 4E7ZA 2DWKA 3L09A 2CCQA 2WMNA 2MBGA 4H9QC 5F8PA 1IZNB 1QSDA 5LA6E 3JC6D 3KFWX 4EB6E 3P7IA 3CQCB 2BZBA 2CXFA 3BQLA 1HF8A 1MMDA 1YKEB 4AKLA 2SPCA 5CA1E 4PFPA 3AVSA 3UULA 5ADXL 4M1PA 3C4XA 4WBOA 3C51A 5HWYA 2X67A 1S94A 4I43B 3I1AA 1FIOA 2VKJA 2E8IA 2W62A 3DJBA 4H9OC 2ZLYA 4XAXB 4U72A 2V7JA 3HR0A 2VASA 2W00A 2BVLA 4U74A 5L3FB 3RYFE 5L3EB 4I4TE 1G8XA 3KVBA 3NRXA 5L3CB 3O1JA 3UTKA 2V26A 3N9QA 2XAFB 5FXZA 3UFEA 3KDSE 3QUJA 2V7LA 4TV9E 1FMWA 5EK2A 4CI3B 5HWXA 4DBRA 2V7IA 1WR6A 1FMVA 4UVBB 4GK0E 3B13A 3AAAB 2KXPB 2XAHB 5HXCA 3WAJA 4CZZB 3RRCA 1NAFA 3KBUA 4MLKA 2A3DA 2N9DA 2GK9A 2CXDA 2CEAA 3AAEB 2W61A 3BK9A 2CWOA 5JRCA 5EZYE 3MKDA 4B6XA 5LCYA 2C0SA 3HL6A 3LBXB 2LSGA 1MIYA 5LGUB 1BR4A 2VKOA 4DNDA 2ODVA 4X20E 4HGAA 2YU1A 3FBLA 3CMLA 1V9DA 3RRWA 3CX8B 1LKXA 4ASKA 2ACXA 2V7KA 2D5UA 2Y48B 2D0UA 3CQXC 4CI2B 2L8KA 3DP7A 5FY1A 3ANWA 3FXDB 4UEMA 4I50E 2DI4A 5H6RB 5JQGE 4CXYA 5L3DB 2NW8A 2J1DG 1SHZC 3F31A 3IBPA 4H63H 1KK7A 5JVDE 4EZ4A 3E0ZA 1KNZA 5BMVE 3CX7B 4KUMB 2VWAA 3ZYLA 4YLHA 2K48A 2EHOA 2IC6A 2KWIB 3OYXA 4UF0A 1YKHB 2DNXA 5DABA 5DQWA 3RYIE 3VHLA 2E9XB 4WW0A 3ZC1A 2PG8A 3UUXB 3ZMSB 4EYUA 2XUEA 2N2NA 4OYJA 2XTLA 4UVCB 5JDMA 3U3IA 4OHFA 4HFVA 5J1GA 2KLQA 4JUYA 5HXEA 4BAYB 5H6QB 4CI1B 3SS1A 2JRKA 5F3JA 3V5UA 5C8YE 3F57A 3K3NA 3OBVE 3UT5E 2E9XD 3HKBE 2RP4A 1ZHCA 2NP9A 3GWHA 1D1BA 2JMKA 3HA4A 3N2OA 4TX5A 2QA7A 3C4WA 1IJ6A 4WBNE 4L5GA 3CX6B 3I0OA 2WSSV 4G63A 2JPFA 3ONXA 2EHOC 1LVFA 4ZI3D 4UV9B 5HXSA 5JDQA 3QC9A 4ZOLE 1MNEA 3MA9A 3WI3A 3PUQA 2Y8DA 4WNKA 2Z6EA 1HX8A 3C98B 3N2KE 3RYHE 5DQVA 5A1LA 3LG7A 3ZCIA 4NUVA 4ANJA 3TKLB 1IAPA 3O9XA 3BQIA 3UUMA 2PJQA 2UXNB 5JDLA 5JRCB 5J2TE 1UX4A 3MACA 2VKHA 3HKEE 2X51A 1ZEEA 3N9LA 5J2UE 4HEAA 4P0AA 3DTOA 5KX5E 2LHRA 2LHNA 3CVRA 2OA5A 4IE4A 3V5SA 4AKHA 5ETWA 3W15B 3K3QC 4ZI7E 5LNKA 3VKGA 3N9OA 5JDGA 5LBQB 4HN9A 2KINB 4ZS3A 2MTQA 2M67A 2Q9QA 3FB2A 4OK0A 4TV8E 4AXPA 3EVYA 3HKCE 2QGSA 3ZCJA 4JEUB 1E1HB 2NTXA 4EYYR 3ZYKA 3CWZB 4PK5A 4PFOA 4ZI2C 5LYJE 4DMWA 2VKDA 4PAGA 4ZHQE 5CA0E 3E22E 4PNIA 1SA0E 4CXWA 3B57A 1Z0PA 2NTYA 1T98A 1IJ5A 3F2EA 2X9HA 1Y64B 2ODUA 3SOLA 3WAKA 4ADZA 1VOMA 3GN5A 4IE7A 3ZEFB 1HCIA 1MMGA 3KV6A 3J9X1 3Q5XA 4FJOA 3M65A 3H37A 4UF0B 4G2AA 5JR9B 2XHEB 3PUSA 4PJJA 4PK4A 4QXBB 5FXWA 1BR0A 4IHJE 4P0BA 2LJLA 3OJAA 3EDVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4H63 V;  3R84 B; 
#chains in the Genus database with same CATH topology
 2DHR A;  3EDU A;  3I0Q A;  4JEH B;  2CLY C;  1U4Q A;  5LJM A;  3AAI A;  1O3X A;  3ZJ1 A;  4CXX A;  4CN6 A;  1OXZ A;  2IC9 A;  3NKZ A;  4NXN T;  3I9Y A;  4IE5 A;  4TWD A;  4ZXL A;  1VCS A;  4HFH A;  5L4H A;  4O4J E;  5IWA T;  4BA9 A;  4GKJ T;  2Y6X A;  3QK6 A;  3N5L A;  1JNR A;  3RH3 A;  4DR7 T;  4QX7 B;  1YW0 A;  2BDE A;  3ZYM A;  4DO0 A;  5JDN A;  4ILB A;  2LSY A;  3MXZ A;  2LSJ A;  2X9X A;  2WQY A;  5LOV E;  2WBL A;  4TZ4 C;  2BKN A;  4IST A;  2M6I A;  1NWM X;  4H63 V;  3R84 B;  1WYB A;  2PFV A;  4HKA A;  4XZC A;  1XDO A;  4GOU A;  2DCF A;  2RA1 A;  4LFC T;  4FI5 A;  4HE8 A;  4X1Y E;  4C90 A;  4GIW A;  2E9X A;  5AQP B;  2A9U A;  2CWY A;  3ANW B;  3AEG A;  2XAG B;  2KT9 A;  1CUN A;  4TN7 B;  2KZ7 B;  2LM9 A;  3UU4 A;  2I0M A;  5EK3 A;  1WR0 A;  2H7V C;  1XDP A;  4TUY E;  2NWB A;  3PTR B;  5L3B B;  1BR2 A;  5AQO B;  2NW9 A;  2VB6 A;  4YJ2 E;  4QH1 A;  2ACZ A;  3ZMZ B;  2C5K T;  3IF8 B;  3C4Z A;  4BJM A;  3PUG A;  5HXR A;  2BVM A;  3AE6 A;  1OED C;  1OED E;  4TNV A;  2NR4 A;  4HWD A;  1MIV A;  3NWI A;  5FMN A;  1HG5 A;  4U2Y A;  2CE7 A;  2VVN A;  2WAU A;  5FL0 A;  4EGW A;  3VKH A;  2LE8 A;  4L9I A;  4AKR B;  5CB4 E;  3OKQ A;  4B3M T;  3ZMU B;  1YD8 G;  2X9W A;  4O2A E;  3FHN A;  2NW7 A;  3IHR A;  4KMC A;  2MYS A;  4DR6 T;  2V1D B;  5L3G B;  2Q9Q B;  5KDM C;  2V6Y A;  2YEV C;  4IL4 A;  3M3Z B;  5L4E A;  5CFB A;  2E2A A;  4F8H A;  3AED A;  4MFR A;  5LGT B;  5AQR B;  3ETV A;  3SWH A;  4A97 A;  3AA0 B;  2IAK A;  3LJC A;  4IDN A;  3L09 A;  2CCQ A;  2WB5 A;  1IZN B;  4DUZ T;  5CA1 E;  3AVS A;  5C3J A;  2FUP A;  2W62 A;  2BVL A;  5L3E B;  1IBM T;  2W67 A;  1G8X A;  3O1J A;  3UTK A;  2V26 A;  5FXZ A;  3UFE A;  1GQE A;  4DBR A;  2V7I A;  1FMV A;  3AAA B;  3RRC A;  2A3D A;  2N9D A;  2GK9 A;  2LRL A;  2WU2 A;  3AAE B;  3IA3 A;  2CWO A;  5JTG A;  3MKD A;  3ZST A;  4B6X A;  2C0S A;  1MIY A;  3B5M A;  5AQQ B;  2YU1 A;  4IDO A;  3FBL A;  1V9D A;  3RRW A;  3CX8 B;  1LKX A;  4ZZC A;  5ABH A;  3ANW A;  2LKG A;  4EED A;  4I50 E;  5H6R B;  2NW8 A;  1KK7 A;  1KNZ A;  3CX7 B;  2VWA A;  4TWF A;  2VVS A;  4UF0 A;  3RYI E;  5DAB A;  2XQ4 A;  3UUX B;  4JYA T;  2AE9 A;  5JDM A;  4OHF A;  4DR2 T;  5H6Q B;  5FKY A;  3UT5 E;  3HKB E;  1ZHC A;  1D1B A;  3C4W A;  1UK5 A;  4WBN E;  1CHU A;  1W0B A;  2JPF A;  4HFB A;  1HX8 A;  1YQ3 A;  3PJA J;  3OVU A;  3LG7 A;  4NUV A;  1IAP A;  4NXM T;  3ONL C;  1ZEE A;  5J2U E;  4HEA A;  5KX5 E;  4AKH A;  2JQK A;  3RLF F;  5AQS B;  4LF5 T;  4ZI7 E;  3G06 A;  5JDG A;  4HN9 A;  2CBJ A;  2Q9Q A;  1X9B A;  3HKC E;  4JEU B;  2F4V T;  2NTX A;  4EYY R;  4PK5 A;  5LYJ E;  4PAG A;  1NEK A;  1IJ5 A;  4U2Z A;  2ODU A;  3SOL A;  3WAK A;  4ADZ A;  3J9X 1;  4JI5 T;  4YTP A;  5JR9 B;  3RF1 A;  4PJJ A;  4QXB B;  3ONJ A;  4U7Y A;  4IHJ E;  4U3C A;  4ILC A;  2YDS A;  2LJL A;  3OJA A;  4A98 A;  1ZV4 X;  3JAF A;  5E0O A;  5L2L A;  2WZI A;  3TLV A;  3SFE A;  3PE0 A;  2KMF A;  1ZKE A;  2NOX A;  2BG9 C;  4IRE A;  3LK2 B;  3FZH B;  5LBM A;  1D0X A;  3RIU C;  4H9P C;  3FBZ A;  3EI0 A;  1U5P A;  2K24 A;  5FYM A;  3FXE B;  4J2C A;  2BKO A;  4AKI A;  1FEW A;  4IGU A;  3EHZ A;  3NBX X;  4ZS2 A;  2CHN A;  4OYK A;  4YXD A;  3LK4 2;  4AQF C;  5LGN B;  3S4U A;  3E08 A;  5JH7 E;  4IL9 A;  1HS7 A;  2K3W A;  5ABG A;  3AXJ B;  5LMN T;  4HWF A;  5M4Y A;  1KFY A;  3SRZ A;  2L9Q A;  1S35 A;  4HFI A;  4DV2 T;  3O4X E;  4JV5 T;  4O4I E;  1D0Z A;  2K5B B;  2BBJ A;  4YSX A;  2CMR A;  2R6G F;  2V8S V;  3H3A A;  2YK0 A;  3AB3 B;  5LG4 A;  4DVD A;  3AE5 A;  5IUX A;  2FJA A;  3ZMT B;  3UU5 A;  5FP3 A;  3RPU A;  3UFG A;  5BR8 T;  2C5J A;  3LFM A;  4X1I E;  3Q2M A;  3P4R A;  1KEY A;  2LRK A;  2PTF A;  2W0G A;  2WU5 A;  5CGM A;  2JQ9 A;  3UU8 A;  2V5D A;  2W66 A;  3NVO A;  1VRB A;  2EHO B;  4GYR A;  2CM0 A;  2ZM2 A;  1WCR A;  3TLW A;  1X79 A;  4ILU A;  3RQW A;  1WYC A;  2XAJ B;  3EUH A;  1R8I A;  3JCF A;  1N32 T;  4KP3 C;  4KBM B;  4UXN B;  4PJL A;  2JQH A;  5EK4 A;  2V5C A;  3QNU A;  4GK5 E;  3Q5D A;  3RX6 A;  3ZKR A;  3OYZ A;  4P09 A;  4F6R C;  2ZM0 A;  3UUN A;  1H7C A;  1US7 B;  3RC3 A;  5AQI B;  4ZZB A;  4O4L E;  5L47 A;  2HPJ A;  3QB5 K;  4L0R A;  1MMN A;  2CA5 A;  2UU9 T;  1UGO A;  4MHC A;  1N36 T;  2D0T A;  3AVR A;  4LMJ A;  1T8B A;  4H9S E;  3OTO T;  1I94 T;  3ZN1 B;  1LRZ A;  5JR9 A;  4U7I A;  1WLX A;  4C91 A;  3AEB A;  2CLY B;  4YHH T;  5AQV B;  2UUC T;  4QWN B;  3CPZ A;  3QB5 A;  4I55 E;  3LDQ B;  2IW5 B;  2X0L B;  4O4H E;  4YTM A;  1I6Z A;  1LVK A;  2WS3 A;  4LMK A;  2JIW A;  1W9R A;  2MBG A;  2XSA A;  5F8P A;  2WP9 A;  3KFW X;  5AQN B;  3BQL A;  1HF8 A;  5HEU A;  1MMD A;  1YKE B;  4AKL A;  2SPC A;  4WBO A;  5HWY A;  4H9O C;  4Z90 A;  2ZLY A;  5ABF A;  2W00 A;  1J1J A;  3RYF E;  4HFD A;  4JI0 T;  2WY2 A;  3TLT A;  3N9Q A;  2E5V A;  3KDS E;  3QUJ A;  5EK2 A;  5HXC A;  3WAJ A;  1NAF A;  3KBU A;  4MLK A;  2CXD A;  5JRC A;  1W09 A;  2H89 A;  2WDV A;  3HL6 A;  3LBX B;  3QOF A;  2XQ8 A;  5LGU B;  2VKO A;  4DND A;  2HN2 A;  4X20 E;  3CML A;  2V7K A;  4YSY A;  2D5U A;  2D0U A;  5FY1 A;  4X66 T;  2DI4 A;  5JQG E;  3F31 A;  4NIQ A;  3PUZ F;  1SUM B;  4X64 T;  2BS2 A;  3E0Z A;  4KUM B;  3ZYL A;  4YLH A;  2EHO A;  4I0U A;  3OYX A;  2DNX A;  3ZT6 A;  4WW0 A;  1L0V A;  4EYU A;  5FVK A;  2XUE A;  2XTL A;  4UVC B;  3U3I A;  4HFV A;  4K0K T;  1OED B;  2KLQ A;  2I6H A;  4BAY B;  3SS1 A;  3V5U A;  5C8Y E;  1HNX T;  2E9X D;  2IDO B;  1KNP A;  4TWH A;  3RKG A;  4YT0 A;  3TLS A;  4TX5 A;  2XY8 B;  2QA7 A;  4GKK T;  2XPK A;  4L5G A;  4G63 A;  5C2T A;  3P4P A;  3QC9 A;  3WI3 A;  2QVA A;  3PUQ A;  4WNK A;  4Z91 A;  3C98 B;  3N2K E;  5DQV A;  3ZCI A;  4ZEY A;  1FJG T;  3T1H T;  4LF7 T;  5JDL A;  4AIU A;  4LF6 T;  1UX4 A;  1XNR T;  2X51 A;  4P0A A;  3CVR A;  2OA5 A;  5ETW A;  2M6B A;  4ZS3 A;  4AXP A;  3EVY A;  1HNW T;  2QGS A;  1E1H B;  5AQL B;  3ZYK A;  3CWZ B;  2IHR 1;  5CA0 E;  4HWH A;  3E22 E;  2VQE T;  4PNI A;  3B57 A;  1J5W A;  1DU2 A;  1HCI A;  3K1S A;  2FBW A;  1SE7 A;  4PK4 A;  4YSZ A;  5FXW A;  1BR0 A;  3CK6 A;  4ERR A;  4ISS A;  2YIN A;  2LSK A;  5FY7 A;  1AJ3 A;  4UV8 B;  4UIG A;  4EEB A;  2ZM6 T;  3O1I A;  4IDZ A;  4ZI3 C;  4N78 D;  1XMQ T;  2V7M A;  2ES0 A;  3UUB A;  2J47 A;  3CQG B;  2WM9 A;  3KVA A;  4BJN A;  5HEO A;  3ZMV B;  3Q5E A;  5HEJ A;  4LF4 T;  4A56 A;  3AE4 A;  3T8O A;  2JJ9 A;  5LHG B;  2H3R A;  2X66 A;  4COF A;  1MND A;  2LKH A;  1IBL T;  4DID B;  3U78 A;  4AKG A;  3LBX A;  4P1N A;  1WFD A;  5GON E;  4UEL A;  2FJD A;  4DR5 T;  3N9N A;  2VK9 A;  3C64 A;  5JRE A;  4X1K E;  2FJE A;  2HPL A;  3ESL A;  3GN5 B;  5TAO A;  1VCT A;  2B1E A;  4JI8 T;  1WRD A;  4NUU A;  1ZP0 A;  4HTE A;  2BBH A;  3RC8 A;  1HTJ F;  1M7K A;  3L39 A;  5FXV A;  4KI0 F;  3VU7 H;  5JR9 C;  4PW8 A;  3PUR A;  2LEH A;  2A2F X;  3BQK A;  3OPC A;  3CKD A;  5LHI B;  3KV5 A;  3FZL B;  5JDF A;  2XAQ B;  2ZM8 A;  4PJM A;  4LF8 T;  2I59 A;  5FNV E;  2B76 A;  3LSV A;  5AFU L;  5ABE A;  5AQH B;  5DJQ C;  5LG3 A;  2WMO A;  4H9N C;  4YY3 T;  2OV9 A;  1UX5 A;  3J7Y q;  3R6N A;  2HH7 A;  5HXH A;  2E9X C;  3K8P C;  4K0U A;  4QX8 B;  3AA7 B;  2WDQ A;  3A8Y C;  1XMO T;  1Z8U A;  4UR9 A;  3PUW F;  3AEA A;  4H9R C;  4O8S A;  4EAH A;  1IBK T;  2XM1 A;  4OX9 T;  2X0H A;  4MBQ A;  3FZK B;  3KIN B;  2A72 A;  3KV9 A;  3L3P A;  3N2G E;  1T72 A;  4AQG A;  3P4Q A;  4ZI2 D;  4YJ3 E;  3MZK B;  2L3L A;  3PV0 F;  4U31 A;  3NZP A;  5LXT E;  5HCJ A;  5HAX A;  3LK3 B;  4DMV A;  4V1A v;  4EOZ B;  4WZX A;  1B7T A;  3MK7 C;  2LT3 A;  1HG2 A;  4JLE A;  2Q9Q D;  3MJX A;  2XQY A;  2G0U A;  3JAE A;  2BG9 B;  2D2S A;  2WWV A;  3O1H A;  4LFB T;  3RI5 A;  1EZ3 A;  1QUU A;  4E7Z A;  2WMN A;  1QSD A;  5LA6 E;  3JC6 D;  4A5X A;  3AE7 A;  2CXF A;  4PFP A;  1HX1 B;  4I43 B;  3I1A A;  2VKJ A;  2E8I A;  2XQA A;  3DJB A;  4U74 A;  5CJ5 A;  4I4T E;  1KNR A;  3KVB A;  2H88 A;  3NRX A;  5L3C B;  2V7L A;  4GK0 E;  3B13 A;  3UQ4 A;  1N34 T;  2XAH B;  2D9D A;  4CZZ B;  4DR1 T;  1UUS A;  3UU6 A;  2CEA A;  2W61 A;  5EZY E;  2V6Y B;  5HCM A;  3AE1 A;  5LCY A;  2MPK A;  2UXB T;  2ODV A;  4ILA A;  4HGA A;  3RGL A;  3TLU A;  2ACX A;  3CQX C;  2L8K A;  4LML A;  2UXD T;  3DP7 A;  3FXD B;  3PUX F;  5L3D B;  3IBP A;  4H63 H;  4EZ4 A;  4X65 T;  5BMV E;  4B3R T;  1YKH B;  3CIR A;  3ZC1 A;  2N2N A;  4OYJ A;  2V6X A;  2UUB T;  3PJA A;  3RIA A;  5J1G A;  3VR8 A;  3EAM A;  3AEC A;  4DV6 T;  5LB7 B;  2XJ7 A;  3F57 A;  3OBV E;  4HWI B;  2NP9 A;  2JMK A;  3N2O A;  4IDQ A;  3UQ7 A;  1IJ6 A;  2DL1 A;  4DV4 T;  3I0O A;  4JBW F;  5AQT B;  2UXC T;  1LVF A;  4ZI3 D;  4UV9 B;  5HXS A;  1MNE A;  3MA9 A;  5AQG B;  3RYH E;  2Y8D A;  5A1L A;  3TKL B;  3O9X A;  2UXN B;  5J2T E;  3MAC A;  2VKH A;  3N9L A;  3DTO A;  2LHN A;  3V5S A;  4KX6 A;  2J4G A;  3K3Q C;  5LNK A;  3VKG A;  1ZOY A;  2XQ3 A;  2CHO A;  3T1Y T;  2X0Y A;  2M67 A;  4OK0 A;  3AXJ A;  4EV6 A;  3ZCJ A;  2QYW A;  4PFO A;  4ZI2 C;  2YOE A;  4DMW A;  1UUR A;  4CXW A;  1Z0P A;  1T98 A;  5HEH A;  3F2E A;  2X9H A;  5AQF B;  1VOM A;  4IE7 A;  3ZEF B;  1MMG A;  3KV6 A;  3Q5X A;  4FJO A;  3M65 A;  4WYV A;  2BG9 A;  4UF0 B;  4DV3 T;  4G2A A;  3PUY F;  5AQM B;  3RIU A;  4P0B A;  2XQ9 A;  2XZE A;  3AE8 A;  3AEF A;  3K3O A;  4QHO A;  2Q9Q C;  4JI2 T;  4CQI A;  3FZF B;  4QXC B;  4AQF A;  4IE0 A;  4AI6 A;  4JI4 T;  2KND A;  2K9A A;  4JI7 T;  4JI1 T;  4QH4 A;  2E5L T;  2VL0 A;  2PBI A;  3AE2 A;  2N1G A;  3JC6 C;  1M62 A;  2OLT A;  2X68 A;  5J0Z A;  4XBF B;  2LSI A;  3AE3 A;  2VUR A;  2UUA T;  2YDQ A;  3N9P A;  2KWH A;  2P9B A;  2MOZ A;  3JAD A;  2UXX B;  1D1A A;  3ZJ2 A;  4KHP T;  3NZQ A;  2RPA A;  3H3M A;  4QKN A;  2XSB A;  1XNQ T;  2J62 A;  3HKD E;  5IYZ E;  2CPT A;  2JMH A;  2W63 A;  4IDP A;  2JQQ A;  4X5T A;  2WWU A;  2CXL A;  1G73 A;  3D0T A;  2YDR A;  3ETU A;  3KV4 A;  3FZM B;  5IHY A;  4YFS A;  4U33 A;  2YKS A;  2WDR A;  2DLR A;  5LJN A;  4Z8X A;  3NRY A;  1D1C A;  1UCU A;  5FY0 A;  3P8C D;  4GYS A;  4HFC A;  1XZY A;  4OFZ A;  2XAS B;  4YHJ A;  5FXX A;  3PDY A;  4PJN A;  4CN4 A;  4IIJ E;  4DV5 T;  4EIW A;  1JNZ A;  4MAL A;  3Q5W A;  4E7S A;  1E7P A;  3P4S A;  1BR1 A;  3A7M A;  4QXH B;  4LFA T;  4QH5 A;  3EAB A;  3ZN0 B;  4HWC A;  1D0Y A;  5FVL A;  5F5W A;  5JDH A;  1E2A A;  3I9W A;  3A5X A;  5AQU B;  2VQF T;  3AE9 A;  2HHH T;  2EHO D;  2LLY A;  2YN6 A;  1NEN A;  2ZMA A;  3VRB A;  2X9Y A;  4NPP A;  4UVA B;  4X62 T;  4DV1 T;  2FJB A;  3GA8 A;  1OWA A;  3RKO A;  2CBI A;  3AA1 B;  4EZH A;  3C50 A;  2VL8 A;  5LHH B;  5HYA A;  3ZSS A;  3RIF A;  3PUA A;  3ZT7 A;  3ZC0 A;  2H7O A;  2AXD S;  1Y01 A;  2IML A;  3N9M A;  5KXJ A;  1MIW A;  4HFE A;  1HFA A;  3HI2 A;  3AA6 B;  5LP6 E;  3PU8 A;  4EXT A;  1J5E T;  2C5I T;  2IUB A;  3ZPO A;  3IEE A;  4IE6 A;  1MMA A;  4PK6 A;  5KMG P;  3VR9 A;  4KHZ F;  4DBQ A;  3RHW A;  2XQ5 A;  3ZLI A;  2XQ6 A;  2WZH A;  2LOS A;  3VRA A;  4JI6 T;  4TNW A;  3GMI A;  3PU3 A;  3RYC E;  2YU2 A;  3Q9D A;  2LOP A;  3KBT A;  4O2B E;  2DWG A;  2IIU A;  2DWK A;  4H9Q C;  3L8R A;  4EB6 E;  3P7I A;  3CQC B;  2BZB A;  4DV7 T;  1T7S A;  1OED A;  3UUL A;  5ADX L;  4M1P A;  3C4X A;  3C51 A;  2X67 A;  1S94 A;  3ABV A;  1FIO A;  4XAX B;  4U72 A;  2V7J A;  3HR0 A;  2VAS A;  5L3F B;  3RQU A;  2QRX A;  2MAW A;  2XAF B;  4TV9 E;  1FMW A;  4CI3 B;  5HWX A;  1WR6 A;  1HNZ T;  4UVB B;  2W4X A;  3UU3 A;  2KXP B;  2WCA A;  4AIS A;  3BK9 A;  3X1D A;  2BKP A;  5LMU T;  2LSG A;  1BR4 A;  5AQK B;  1W0A A;  3P4W A;  4ASK A;  2Y48 B;  4CI2 B;  4UEM A;  4CXY A;  2J1D G;  1QLB A;  1SHZ C;  4B3T T;  5JVD E;  2K48 A;  2IC6 A;  2KWI B;  2BG9 E;  2LM2 A;  5DQW A;  3VHL A;  2E9X B;  3AEE A;  2PG8 A;  3ZMS B;  2BS4 A;  4JUY A;  5HXE A;  4CI1 B;  2BS3 A;  2JRK A;  3SFD A;  5F3J A;  2W2U A;  5ABF B;  3K3N A;  5AQJ B;  1HR0 T;  2CRB A;  2RP4 A;  3GWH A;  4DR3 T;  3HA4 A;  3CX6 B;  2WSS V;  3ONX A;  2EHO C;  3PUV F;  5JDQ A;  1YXR A;  4ZOL E;  2Z6E A;  1YQ4 A;  4ANJ A;  3ZT5 A;  3BQI A;  3UUM A;  5HEG A;  2PJQ A;  5JRC B;  3HKE E;  2XQ7 A;  2LHR A;  4IE4 A;  3W15 B;  3P50 A;  3N9O A;  4DR4 T;  4IT4 A;  5LBQ B;  2KIN B;  2MTQ A;  4TV8 E;  3FB2 A;  4DUY T;  2VKD A;  4ZHQ E;  4AQY T;  1SA0 E;  4B3S T;  4DV0 T;  4CN1 A;  2NTY A;  1KF6 A;  1Y64 B;  3GN5 A;  2KSR A;  1N33 T;  4LF9 T;  3H37 A;  2XHE B;  3PUS A;  1XWM A;  4Q25 A;  2HN1 A;  2XM2 A;  5FL1 A;  4JI3 T;  3EDV A;  4YTN A; 
#chains in the Genus database with same CATH homology
 2DHR A;  3K3O A;  1ZV4 X;  4QHO A;  2Q9Q C;  3EDU A;  3I0Q A;  5E0O A;  4JEH B;  2CLY C;  4CQI A;  1U4Q A;  4ERR A;  5LJM A;  4ISS A;  4QXC B;  4AQF A;  2YIN A;  3AAI A;  4IE0 A;  5L2L A;  2LSK A;  1O3X A;  4AI6 A;  2KND A;  2K9A A;  5FY7 A;  1AJ3 A;  4UV8 B;  3ZJ1 A;  4CXX A;  1OXZ A;  4UIG A;  2IC9 A;  3O1I A;  3PE0 A;  2KMF A;  4IDZ A;  4ZI3 C;  4N78 D;  2PBI A;  1ZKE A;  2NOX A;  2N1G A;  3I9Y A;  3JC6 C;  2X68 A;  4IE5 A;  2LSI A;  4XBF B;  3LK2 B;  2V7M A;  2ES0 A;  5LBM A;  1D0X A;  3N9P A;  2KWH A;  2P9B A;  2MOZ A;  4H9P C;  3FBZ A;  3CQG B;  2UXX B;  1U5P A;  2K24 A;  2WM9 A;  1D1A A;  4O4J E;  3KVA A;  3ZJ2 A;  5FYM A;  4BJN A;  3FXE B;  4J2C A;  3ZMV B;  4AKI A;  4BA9 A;  1FEW A;  4IGU A;  3NZQ A;  3NBX X;  4ZS2 A;  2Y6X A;  4OYK A;  3QK6 A;  4A56 A;  3LK4 2;  4AQF C;  3T8O A;  3S4U A;  2JJ9 A;  3N5L A;  4QKN A;  5LGN B;  5LHG B;  2H3R A;  3E08 A;  3RH3 A;  5JH7 E;  1HS7 A;  2X66 A;  1MND A;  4QX7 B;  1YW0 A;  3HKD E;  5IYZ E;  3U78 A;  2BDE A;  2JMH A;  5M4Y A;  4AKG A;  3LBX A;  5GON E;  3ZYM A;  4DO0 A;  2W63 A;  4UEL A;  5JDN A;  3N9N A;  2VK9 A;  3SRZ A;  2L9Q A;  3C64 A;  2JQQ A;  1S35 A;  2WWU A;  2LSY A;  3MXZ A;  2LSJ A;  2CXL A;  3O4X E;  1G73 A;  5JRE A;  2X9X A;  3D0T A;  4O4I E;  4X1K E;  1D0Z A;  5LOV E;  2HPL A;  3ESL A;  3GN5 B;  2K5B B;  2WBL A;  3ETU A;  3KV4 A;  5TAO A;  4TZ4 C;  2CMR A;  5IHY A;  2B1E A;  4YFS A;  4IST A;  3H3A A;  1NWM X;  4H63 V;  2YK0 A;  3R84 B;  2DLR A;  1WRD A;  3AB3 B;  5LJN A;  4Z8X A;  4NUU A;  1WYB A;  2PFV A;  4HTE A;  4HKA A;  4XZC A;  5LG4 A;  3NRY A;  3RC8 A;  1D1C A;  1HTJ F;  1UCU A;  4GOU A;  2DCF A;  5FY0 A;  5FXV A;  3P8C D;  4GYS A;  3VU7 H;  2RA1 A;  5JR9 C;  4DVD A;  4FI5 A;  4HE8 A;  4X1Y E;  4OFZ A;  4PW8 A;  2XAS B;  4C90 A;  4GIW A;  2E9X A;  3PUR A;  4YHJ A;  5FXX A;  2LEH A;  3PDY A;  2A2F X;  4PJN A;  4IIJ E;  3ZMT B;  3BQK A;  4EIW A;  3CKD A;  2CWY A;  3ANW B;  5FP3 A;  3RPU A;  4MAL A;  3Q5W A;  5LHI B;  3KV5 A;  2C5J A;  3LFM A;  4X1I E;  3Q2M A;  2XAG B;  2KT9 A;  4E7S A;  1CUN A;  5JDF A;  1BR1 A;  4TN7 B;  2XAQ B;  2KZ7 B;  2ZM8 A;  2W0G A;  2LM9 A;  4PJM A;  5EK3 A;  2I59 A;  5FNV E;  5AFU L;  4QXH B;  1VRB A;  2EHO B;  2H7V C;  4GYR A;  5DJQ C;  4TUY E;  2CM0 A;  3ZN0 B;  2NWB A;  2WMO A;  4H9N C;  3PTR B;  1D0Y A;  5L3B B;  2ZM2 A;  1BR2 A;  2NW9 A;  2VB6 A;  5JDH A;  4YJ2 E;  1X79 A;  3I9W A;  3A5X A;  4ILU A;  1UX5 A;  2C5K T;  3ZMZ B;  3J7Y q;  3IF8 B;  3C4Z A;  2HH7 A;  3R6N A;  5HXH A;  1WYC A;  2XAJ B;  2EHO D;  3EUH A;  2E9X C;  3K8P C;  4K0U A;  4BJM A;  4QX8 B;  3AA7 B;  2ZMA A;  3PUG A;  2X9Y A;  4UVA B;  5HXR A;  4KP3 C;  2BVM A;  4KBM B;  4UXN B;  4H9R C;  4PJL A;  4O8S A;  4EAH A;  5EK4 A;  3GA8 A;  4GK5 E;  1OWA A;  3RKO A;  3AA1 B;  4MBQ A;  3RX6 A;  4EZH A;  3C50 A;  1MIV A;  2VL8 A;  5LHH B;  3OYZ A;  5HYA A;  3KIN B;  5FMN A;  3PUA A;  4P09 A;  4F6R C;  1HG5 A;  2ZM0 A;  3UUN A;  2A72 A;  1H7C A;  3KV9 A;  3ZC0 A;  2CE7 A;  2H7O A;  3L3P A;  2WAU A;  1US7 B;  3RC3 A;  3N2G E;  4O4L E;  3VKH A;  2LE8 A;  3N9M A;  4AQG A;  1MIW A;  4L9I A;  2HPJ A;  4AKR B;  4ZI2 D;  4YJ3 E;  3OKQ A;  5CB4 E;  4L0R A;  1MMN A;  1HFA A;  2CA5 A;  3ZMU B;  3HI2 A;  1YD8 G;  2X9W A;  4MHC A;  3AA6 B;  4O2A E;  5LP6 E;  2D0T A;  3PU8 A;  3FHN A;  3AVR A;  2NW7 A;  3MZK B;  2L3L A;  3IHR A;  4H9S E;  4KMC A;  2MYS A;  3ZN1 B;  4EXT A;  1LRZ A;  3NZP A;  5JR9 A;  2V1D B;  5L3G B;  2Q9Q B;  2C5I T;  5KDM C;  1WLX A;  4C91 A;  2YEV C;  2CLY B;  3ZPO A;  3IEE A;  4IE6 A;  5LXT E;  1MMA A;  5HAX A;  3LK3 B;  4PK6 A;  4DMV A;  4V1A v;  5KMG P;  4EOZ B;  4DBQ A;  1B7T A;  4QWN B;  4MFR A;  3ZLI A;  3MK7 C;  3CPZ A;  2LT3 A;  1HG2 A;  2LOS A;  4I55 E;  5LGT B;  4JLE A;  2IW5 B;  2Q9Q D;  3MJX A;  2XQY A;  2G0U A;  3ETV A;  3GMI A;  3PU3 A;  3SWH A;  2X0L B;  3RYC E;  2YU2 A;  3Q9D A;  2D2S A;  4O4H E;  2LOP A;  3O1H A;  3KBT A;  3AA0 B;  4O2B E;  2DWG A;  1LVK A;  1EZ3 A;  1QUU A;  2IAK A;  3LJC A;  4E7Z A;  2DWK A;  3L09 A;  2CCQ A;  2WMN A;  2MBG A;  4H9Q C;  5F8P A;  1IZN B;  1QSD A;  5LA6 E;  3JC6 D;  3KFW X;  4EB6 E;  3P7I A;  3CQC B;  2BZB A;  2CXF A;  3BQL A;  1HF8 A;  1MMD A;  1YKE B;  4AKL A;  2SPC A;  5CA1 E;  4PFP A;  3AVS A;  3UUL A;  5ADX L;  4M1P A;  3C4X A;  4WBO A;  3C51 A;  5HWY A;  2X67 A;  1S94 A;  4I43 B;  3I1A A;  1FIO A;  2VKJ A;  2E8I A;  2W62 A;  3DJB A;  4H9O C;  2ZLY A;  4XAX B;  4U72 A;  2V7J A;  3HR0 A;  2VAS A;  2W00 A;  2BVL A;  4U74 A;  5L3F B;  3RYF E;  5L3E B;  4I4T E;  1G8X A;  3KVB A;  3NRX A;  5L3C B;  3O1J A;  3UTK A;  2V26 A;  3N9Q A;  2XAF B;  5FXZ A;  3UFE A;  3KDS E;  3QUJ A;  2V7L A;  4TV9 E;  1FMW A;  5EK2 A;  4CI3 B;  5HWX A;  4DBR A;  2V7I A;  1WR6 A;  1FMV A;  4UVB B;  4GK0 E;  3B13 A;  3AAA B;  2KXP B;  2XAH B;  5HXC A;  3WAJ A;  4CZZ B;  3RRC A;  1NAF A;  3KBU A;  4MLK A;  2A3D A;  2N9D A;  2GK9 A;  2CXD A;  2CEA A;  3AAE B;  2W61 A;  3BK9 A;  2CWO A;  5JRC A;  5EZY E;  3MKD A;  4B6X A;  5LCY A;  2C0S A;  3HL6 A;  3LBX B;  2LSG A;  1MIY A;  5LGU B;  1BR4 A;  2VKO A;  4DND A;  2ODV A;  4X20 E;  4HGA A;  2YU1 A;  3FBL A;  3CML A;  1V9D A;  3RRW A;  3CX8 B;  1LKX A;  4ASK A;  2ACX A;  2V7K A;  2D5U A;  2Y48 B;  2D0U A;  3CQX C;  4CI2 B;  2L8K A;  3DP7 A;  5FY1 A;  3ANW A;  3FXD B;  4UEM A;  4I50 E;  2DI4 A;  5H6R B;  5JQG E;  4CXY A;  5L3D B;  2NW8 A;  2J1D G;  1SHZ C;  3F31 A;  3IBP A;  4H63 H;  1KK7 A;  5JVD E;  4EZ4 A;  3E0Z A;  1KNZ A;  5BMV E;  3CX7 B;  4KUM B;  2VWA A;  3ZYL A;  4YLH A;  2K48 A;  2EHO A;  2IC6 A;  2KWI B;  3OYX A;  4UF0 A;  1YKH B;  2DNX A;  5DAB A;  5DQW A;  3RYI E;  3VHL A;  2E9X B;  4WW0 A;  3ZC1 A;  2PG8 A;  3UUX B;  3ZMS B;  4EYU A;  2XUE A;  2N2N A;  4OYJ A;  2XTL A;  4UVC B;  5JDM A;  3U3I A;  4OHF A;  4HFV A;  5J1G A;  2KLQ A;  4JUY A;  5HXE A;  4BAY B;  5H6Q B;  4CI1 B;  3SS1 A;  2JRK A;  5F3J A;  3V5U A;  5C8Y E;  3F57 A;  3K3N A;  3OBV E;  3UT5 E;  2E9X D;  3HKB E;  2RP4 A;  1ZHC A;  2NP9 A;  3GWH A;  1D1B A;  2JMK A;  3HA4 A;  3N2O A;  4TX5 A;  2QA7 A;  3C4W A;  1IJ6 A;  4WBN E;  4L5G A;  3CX6 B;  3I0O A;  2WSS V;  4G63 A;  2JPF A;  3ONX A;  2EHO C;  1LVF A;  4ZI3 D;  4UV9 B;  5HXS A;  5JDQ A;  3QC9 A;  4ZOL E;  1MNE A;  3MA9 A;  3WI3 A;  3PUQ A;  2Y8D A;  4WNK A;  2Z6E A;  1HX8 A;  3C98 B;  3N2K E;  3RYH E;  5DQV A;  5A1L A;  3LG7 A;  3ZCI A;  4NUV A;  4ANJ A;  3TKL B;  1IAP A;  3O9X A;  3BQI A;  3UUM A;  2PJQ A;  2UXN B;  5JDL A;  5JRC B;  5J2T E;  1UX4 A;  3MAC A;  2VKH A;  3HKE E;  2X51 A;  1ZEE A;  3N9L A;  5J2U E;  4HEA A;  4P0A A;  3DTO A;  5KX5 E;  2LHR A;  2LHN A;  3CVR A;  2OA5 A;  4IE4 A;  3V5S A;  4AKH A;  5ETW A;  3W15 B;  3K3Q C;  4ZI7 E;  5LNK A;  3VKG A;  3N9O A;  5JDG A;  5LBQ B;  4HN9 A;  2KIN B;  4ZS3 A;  2MTQ A;  2M67 A;  2Q9Q A;  3FB2 A;  4OK0 A;  4TV8 E;  4AXP A;  3EVY A;  3HKC E;  2QGS A;  3ZCJ A;  4JEU B;  1E1H B;  2NTX A;  4EYY R;  3ZYK A;  3CWZ B;  4PK5 A;  4PFO A;  4ZI2 C;  5LYJ E;  4DMW A;  2VKD A;  4PAG A;  4ZHQ E;  5CA0 E;  3E22 E;  4PNI A;  1SA0 E;  4CXW A;  3B57 A;  1Z0P A;  2NTY A;  1T98 A;  1IJ5 A;  3F2E A;  2X9H A;  1Y64 B;  2ODU A;  3SOL A;  3WAK A;  4ADZ A;  1VOM A;  3GN5 A;  4IE7 A;  3ZEF B;  1HCI A;  1MMG A;  3KV6 A;  3J9X 1;  3Q5X A;  4FJO A;  3M65 A;  3H37 A;  4UF0 B;  4G2A A;  5JR9 B;  2XHE B;  3PUS A;  4PJJ A;  4PK4 A;  4QXB B;  5FXW A;  1BR0 A;  4IHJ E;  4P0B A;  2LJL A;  3OJA A;  3EDV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...