4H63V

Structure of the schizosaccharomyces pombe mediator head module
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
117
structure length
117
Chain Sequence
SFQRQLVQRTNTLNSSIDNATLTILSRFQDILDIAINEGKDKYTVAPEVYQIECHTVSMVRAVEQLLDVSRQIKSYWLTNSLSTSFPTVDYSEPDLEKVKRTLTKLQNHLLEVSLIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mediator of RNA polymerase II transcription subunit 6
publication title Structure of the Mediator head module.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Transcription
total genus 43
structure length 117
sequence length 117
ec nomenclature
pdb deposition date 2012-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
V PF06179 Med22 Surfeit locus protein 5 subunit 22 of Mediator complex
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1600 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4h63V00
4H63V 3R84B
chains in the Genus database with same CATH superfamily
1OXZA 2X0HA 5JDFA 3UU8A 4U3CA 4OYKA 3RH3A 2K24A 3E0ZA 1B7TA 2ODUA 4N78D 4DV5T 2VURA 1FMWA 4H9NC 4TZ4C 2VVSA 3MK7C 2BS2A 4TX5A 2W63A 3CQGB 1S94A 2Q9QB 3PUSA 4YHJA 2WDQA 4ILBA 4UELA 2MBGA 1W0BA 1MNEA 2DWGA 4B3ST 3I0QA 4I0UA 4JUYA 3TKLB 5LJNA 1UCUA 2MYSA 3MXZA 3DTOA 1HTJF 3J7Yq 2BKPA 3N9OA 3SS1A 2XASB 2H7VC 4OX9T 3ABVA 3T1HT 3TLWA 3VRAA 3UFGA 2XSAA 2X9YA 3C4WA 5EK4A 2GK9A 1IBKT 3M65A 2KWHA 4HFEA 4PFPA 3KV5A 4NUUA 1M62A 2PFVA 3LBXB 3RIUA 3UU5A 1HS7A 4PK4A 4AKGA 3Q5EA 4YSXA 2MAWA 3TLTA 3UTKA 1JNZA 4GOUA 4HEAA 5HXHA 3VR8A 1SA0E 2ZM2A 3AEGA 3C4ZA 2VASA 4ZI3D 5LMNT 2LT3A 3OYXA 1U5PA 3BQLA 4DMVA 1FIOA 3NWIA 4PJNA 2KMFA 1T7SA 3AB3B 2HN1A 4CI1B 3TLUA 5JR9A 3O1IA 5JVDE 4LFBT 3HA4A 3AVRA 3ZMZB 4YY3T 4HTEA 3SOLA 1J5WA 3AAIA 4Q25A 4C90A 4NXNT 2KT9A 5LNKA 2XM2A 5JDQA 1D0ZA 1YKHB 3WAKA 4K0KT 5LGTB 1U4QA 3AA0B 2FJAA 4QWNB 3PUAA 2W4XA 1NAFA 4CXYA 1UURA 4PFOA 1VCTA 3Q9DA 4GYSA 1MIYA 4ERRA 4J2CA 2W67A 2FJBA 1EZ3A 3ONLC 1IAPA 5LJMA 1SUMB 2WZHA 3PU8A 3UUNA 2D9DA 2CM0A 3N5LA 3UQ4A 4LMJA 4AXPA 2LRKA 2HPJA 1V9DA 2WWVA 1X79A 5AQUB 2OV9A 1W0AA 2LHNA 2Q9QC 2H89A 3RX6A 5ABFB 5LGUB 4JI0T 1W9RA 2DWKA 2A72A 3NBXX 2ZM6T 4PK6A 2JMKA 1N36T 5F5WA 3ZCIA 2WM9A 4B3TT 3FZMB 5BR8T 4ZZCA 2X66A 2V6YA 5LMUT 2V26A 4LMLA 4QH4A 3V5SA 5L3GB 5HCMA 4EEDA 5JRCB 4QX7B 5KMGP 3UULA 4EIWA 2ZM0A 2PTFA 3CX8B 5EK2A 2V7JA 3JAEA 4JI7T 3ZMTB 2XQ4A 3RRCA 4CZZB 1MMDA 2D0UA 1XMOT 3PUYF 1NENA 2BVMA 3P4WA 3IEEA 2YK0A 4AQFC 3PUGA 3LG7A 4JI8T 2L3LA 2K48A 3QC9A 1NWMX 4NUVA 4CN1A 1E7PA 2DHRA 1VOMA 2XAQB 3AA6B 4TNVA 2BG9C 2HN2A 3B5MA 3PUZF 4JEUB 1CHUA 2VKHA 2I59A 4JI3T 2CXDA 4I43B 4GYRA 2RA1A 2XQ5A 3AE2A 5ABGA 5AQLB 4U72A 2V1DB 2CE7A 5A1LA 5JDLA 2UXBT 4HFHA 4B6XA 5GONE 4KMCA 4JLEA 2CPTA 5DABA 4DV3T 3D0TA 2IAKA 2XY8B 2I0MA 2K9AA 1HCIA 4DO0A 3P4PA 4PAGA 5LGNB 5FNVE 2VKDA 3BK9A 2CHOA 2Q9QA 2B76A 1WLXA 4V1Av 2BBJA 1LVKA 4LFAT 3CX6B 2UUAT 4OFZA 5J0ZA 5L3CB 4H9QC 2QA7A 3RYFE 1UUSA 3AE6A 4FJOA 3A7MA 1YD8G 4CI2B 3RRWA 2XAJB 3AEFA 4COFA 3QUJA 2VQFT 3KVBA 4U7IA 1WFDA 2LSGA 1HX1B 1KNZA 3MJXA 4C91A 2LE8A 2Y48B 3UU6A 2CMRA 2W2UA 4QH5A 2LSIA 5IUXA 4ISTA 4H9RC 3TLSA 5L3EB 3K3OA 2LM9A 2X9WA 3ZT7A 3N9QA 3RYCE 2A9UA 4I55E 4XAXB 2LOPA 5L3FB 1KK7A 4ZS3A 1WR0A 3PJAA 2UXDT 3P4RA 4CQIA 5M4YA 2YOEA 4AQFA 4HGAA 3VKGA 1Z8UA 3IF8B 4OHFA 3LBXA 5LXTE 2UXNB 4TWDA 3PU3A 2R6GF 2WU2A 4LF7T 2X68A 3PTRB 3SFDA 2WDVA 5JQGE 4PJMA 1HNXT 4ZOLE 2V7IA 5JTGA 3WAJA 3N9NA 4FI5A 4YT0A 4DUZT 1HF8A 3ZCJA 3AAAB 3RIAA 3FBLA 4LF9T 4DR7T 3HKDE 2KINB 2CLYC 2XQ6A 3AE4A 3RC8A 1QUUA 4ZI2D 3E08A 2D2SA 2VWAA 2VL0A 5FL0A 4DR6T 4WZXA 4UVCB 4YFSA 4HWIB 2YDSA 4X64T 4HE8A 2CEAA 3SWHA 2ZMAA 1XNQT 4YXDA 1QLBA 2XUEA 3PV0F 3U3IA 4YJ2E 5HEHA 3ANWB 2C5IT 1FEWA 2XPKA 3A5XA 4YTPA 4MLKA 1DU2A 4I4TE 2DI4A 4UV9B 3MZKB 2CBIA 2PG8A 2IHR1 4U74A 4ISSA 5FY7A 3AE7A 2E9XB 1IJ6A 5C3JA 4A97A 1IBMT 1M7KA 2DL1A 3FB2A 3RPUA 5AQTB 2D0TA 2IMLA 4DV4T 2L9QA 4UXNB 1D0XA 3K3NA 2G0UA 2ACXA 2NW8A 3GMIA 5L3BB 5ABFA 2CWOA 3AE5A 1US7B 3RGLA 4YSZA 3C98B 1XDPA 2QYWA 2H88A 4PJJA 4E7SA 2CBJA 1D1AA 4DVDA 4QX8B 2WWUA 3CWZB 3LK42 1O3XA 1KNPA 3EAMA 5HCJA 3N2KE 4ZS2A 5JRCA 4H9OC 3CIRA 3KBUA 5AQIB 1T98A 3MA9A 5AQJB 3CMLA 3I0OA 4ZHQE 3JAFA 4IDZA 4YTMA 1IJ5A 4LMKA 5JDNA 3Q2MA 3UU3A 2NTYA 1XDOA 4QXBB 4HWDA 3U78A 1HX8A 3PDYA 4P0BA 4P1NA 3EI0A 2M6BA 4DBQA 4IDNA 2C5JA 4PJLA 4EGWA 3O1HA 2QRXA 1T72A 2KLQA 3C51A 4YSYA 2L8KA 3EDVA 3FZHB 2XQYA 4JI5T 2V6XA 2WAUA 5LHHB 1VCSA 3NRYA 2HPLA 2LJLA 5FY0A 2WZIA 2H7OA 3LK2B 5AQQB 4A56A 5CGMA 3I9WA 1E2AA 1OEDE 1UX4A 2B1EA 4LF5T 1HNWT 2LHRA 5LG4A 3K1SA 4JYAT 3ZYMA 3KV4A 3OBVE 2RP4A 4XZCA 3N9MA 2W0GA 1OWAA 4KBMB 1XNRT 3N9LA 4L0RA 3PUXF 3EABA 2LOSA 4IT4A 3O9XA 5ADXL 2UUBT 4GKKT 5FP3A 3C64A 2OLTA 3FZFB 3ZKRA 3OJAA 4DV6T 3P4SA 3ZMUB 3QOFA 3LFMA 3NVOA 4UF0B 4ZEYA 1ZOYA 4I50E 3CQXC 3KFWX 5FVLA 4X1KE 3CKDA 2BBHA 1CUNA 3Q5XA 1HNZT 3VKHA 4H63H 3ZC1A 2H3RA 4EZ4A 4DV2T 2E2AA 1YW0A 2KSRA 2E9XC 5HXEA 4UIGA 5LG3A 2CRBA 4O4JE 5DQVA 4KX6A 1Y01A 5FXVA 1MIWA 2WCAA 5L3DB 1J5ET 3UT5E 4BA9A 4H63V 5HEJA 2A3DA 2MPKA 3R84B 4CN4A 5ABEA 3Q5DA 4XBFB 3QNUA 2RPAA 3AEBA 2XSBA 2IUBA 1N34T 4M1PA 2LEHA 5AQHB 4WNKA 4TV9E 2YU2A 2DLRA 3P4QA 5LOVE 2X0YA 3ZYLA 5CFBA 3T8OA 2X67A 4DIDB 1KF6A 3NZQA 3V5UA 1KFYA 4JI1T 3ZC0A 5L2LA 5LB7B 3QK6A 2UXCT 2SPCA 5E0OA 2LKGA 2X9XA 3F31A 5AQKB 4ANJA 2IC9A 4X1YE 1WCRA 1KEYA 3ZLIA 4MBQA 2XQAA 5L4EA 5IHYA 3HL6A 3R6NA 4OK0A 4DV7T 3VHLA 2JQQA 4IDPA 3VU7H 2J4GA 3ZEFB 4L5GA 1VRBA 1N32T 1D1BA 3PE0A 1T8BA 2BG9E 2NOXA 5C8YE 3UUBA 4DV1T 1ZV4X 2WSSV 3PJAJ 2XTLA 3FHNA 1LRZA 4HWHA 4A5XA 4X62T 4GKJT 2DCFA 2VKJA 4EZHA 2AE9A 1JNRA 2XQ9A 4K0UA 3ANWA 1WYBA 2KNDA 2MOZA 2JPFA 4ILAA 2N9DA 1BR4A 3EUHA 3NRXA 1QSDA 5FYMA 2FBWA 3ESLA 1X9BA 2E9XA 4U2ZA 4ZI3C 3AAEB 2Z6EA 3ZSTA 3AVSA 4LF6T 2QGSA 4O2AE 3JC6D 4F8HA 3IA3A 4JI2T 1UX5A 4QHOA 4O4HE 4HKAA 4GK0E 2EHOD 1YQ3A 1HG5A 4O4IE 2FJEA 4DUYT 1YKEB 2D5UA 4QXCB 1L0VA 4AISA 4DR2T 3RIFA 4AQGA 2VKOA 3EHZA 4JEHB 5BMVE 3QB5K 3UFEA 2IC6A 4MHCA 5AQVB 2N1GA 3P50A 1W09A 3RKOA 5AQNB 2JJ9A 3WI3A 3L8RA 2JQKA 2V5DA 2HHHT 3OPCA 5FXWA 3C50A 4IE0A 4CXWA 5FVKA 2IDOB 1GQEA 2FJDA 5CJ5A 4Z91A 2VK9A 3PURA 3CVRA 2WY2A 3LDQB 2CA5A 4ZXLA 1YQ4A 3CQCB 3KV6A 2E8IA 1BR1A 4IE6A 4H9PC 2M67A 4WYVA 2XQ8A 2EHOB 2XM1A 2YKSA 1IBLT 3GWHA 3P8CD 4AKRB 2W61A 1OEDB 3EVYA 4DNDA 3ZYKA 4GK5E 4YTNA 2W62A 5FKYA 4QH1A 2Q9QD 2WMOA 1ZHCA 1D0YA 1Y64B 3GA8A 5FMNA 4AKIA 2LKHA 3L3PA 5J2UE 3KVAA 2Y8DA 3ETVA 2JMHA 3FZKB 5KDMC 4LFCT 3GN5B 2JIWA 5DJQC 2W00A 4DR4T 4B3RT 1MNDA 4AQYT 4KP3C 3FXEB 5LA6E 2P9BA 2WU5A 5LHGB 4IL9A 4EOZB 3RYHE 3Q5WA 5J2TE 2YEVC 2K3WA 2WP9A 4P0AA 4IE5A 5F8PA 5AQFB 4TUYE 5CA0E 3RF1A 4KHZF 3HKEE 4IDQA 1MMGA 2WB5A 4X66T 3E22E 3ZT6A 5AFUL 2PJQA 3AA1B 4DBRA 4EEBA 2JQ9A 2IW5B 1UK5A 4DR5T 4CI3B 4UF0A 3AA7B 2YDQA 2J47A 2FUPA 1Z0PA 3AEEA 5HEUA 5LYJE 4HFIA 4UV8B 4X65T 1WYCA 3X1DA 4NXMT 2DNXA 3CX7B 2E5VA 1MIVA 4U2YA 3EDUA 4KUMB 4IE4A 3ZPOA 5EK3A 1HG2A 4JI4T 3W15B 4GIWA 2J1DG 3KINB 3N2GE 4E7ZA 2F4VT 3UU4A 3ZN0B 1MMNA 2ZM8A 3JCFA 3UQ7A 2UUCT 4MALA 1G8XA 3ZT5A 4ADZA 5HEOA 4LF4T 2AXDS 4KI0F 1FJGT 3DP7A 3I1AA 4WBOA 5IWAT 2ACZA 5HAXA 1WRDA 4YHHT 3AXJB 3HI2A 2BG9B 4EAHA 4DMWA 3LK3B 2XAHB 2J62A 3NKZA 3RLFF 3JC6C 5AQMB 4WW0A 2EHOC 2JQHA 5TAOA 1OEDC 3HR0A 3O4XE 2NWBA 2YN6A 5HXCA 2XHEB 5HXSA 2WQYA 3G06A 4X5TA 5CA1E 4HFDA 2A2FX 1MMAA 5AQPB 2WS3A 4UVAB 3VRBA 3L39A 4IREA 2W66A 2VQET 4ZZBA 4O2BE 3ZJ2A 3H3AA 3KBTA 4U7YA 2HH7A 2VB6A 4QXHB 4AI6A 4DR1T 5FXXA 2OA5A 2LRLA 5JH7E 3MACA 1FMVA 3JADA 2C0SA 2WBLA 4DV0T 4MFRA 2YINA 4IHJE 2V8SV 1G73A 5C2TA 4G2AA 4CXXA 2YDRA 2KZ7B 1ZKEA 3TLVA 2KWIB 2NR4A 1I94T 3UUMA 2XJ7A 4UR9A 1IZNB 3KV9A 2NP9A 4WBNE 3AE3A 1HFAA 4X1IE 2NW7A 5HWXA 2K5BB 2PBIA 2NW9A 3RC3A 3K3QC 4ZI2C 2ZLYA 2BS3A 3ONXA 3PUQA 4HWFA 3PUVF 2CXFA 3CK6A 4PNIA 2NTXA 3A8YC 3QB5A 4ILUA 4IGUA 2UXXB 4ZI7E 5KX5E 3SRZA 3S4UA 2VVNA 1KNRA 4UVBB 4CN6A 2V5CA 4IE7A 5JDHA 1WR6A 5LBMA 5AQOB 3ONJA 4ILCA 5HEGA 5F3JA 3HKCE 4AIUA 4ASKA 4JI6T 4TNWA 1I6ZA 5FY1A 3FBZA 3F2EA 2ES0A 3RQUA 2XAGB 2KXPB 3H3MA 4TWFA 4HFVA 3ZN1B 3MKDA 1XWMA 2MTQA 1NEKA 4PW8A 3RKGA 2N2NA 2EHOA 2QVAA 3OVUA 3ZMVB 1OEDA 2CLYB 3N2OA 4HWCA 3OYZA 4TWHA 2CCQA 4O8SA 2ODVA 3IBPA 5JR9B 5LHIB 3AECA 3UUXB 4X20E 4JBWF 5AQSB 3OKQA 3RHWA 4B3MT 1HR0T 2X0LB 2LSJA 2WDRA 3RYIE 2LSKA 3BQKA 5J1GA 4UEMA 3GN5A 3F57A 2CHNA 1YXRA 5HXRA 4HFBA 3CPZA 4U31A 1SHZC 4AKHA 3L09A 3B13A 2BS4A 3AE1A 4P09A 4Z8XA 3ZJ1A 4IL4A 5EZYE 2LLYA 4AKLA 1D1CA 2E5LT 2YU1A 4EYYR 3AE9A 2BKNA 3ZSSA 5CB4E 4BJMA 5ETWA 2CXLA 2Y6XA 3FXDB 4BJNA 2M6IA 2X9HA 4QKNA 2BVLA 5DQWA 3OTOT 2V7MA 2V7KA 5H6QB 5FXZA 3K8PC 3AE8A 3LSVA 4IIJE 2I6HA 1AJ3A 4EB6E 3KDSE 5JREA 4H9SE 3DJBA 4L9IA 5H6RB 1N33T 1LKXA 4HN9A 3P7IA 2IIUA 2V6YB 3ZMSB 5L47A 3SFEA 5IYZE 4HFCA 4KHPT 5LCYA 3T1YT 5AQRB 5JDGA 3C4XA 2LSYA 3ETUA 4DR3T 2C5KT 5JDMA 3RI5A 1R8IA 5HYAA 3H37A 1LVFA 2XQ3A 1J1JA 2CWYA 5LP6E 1BR0A 3FZLB 1UGOA 1S35A 5ABHA 3N9PA 3IHRA 4EYUA 4F6RC 3O1JA 4PK5A 5KXJA 4TV8E 4O4LE 1ZP0A 3AEDA 3B57A 4OYJA 4YJ3E 3NZPA 2BKOA 3RIUC 1XZYA 5L4HA 2XQ7A 1XMQT 2WMNA 5FL1A 1SE7A 3AXJA 5AQGB 2BG9A 4U33A 4JV5T 4IDOA 3HKBE 2X51A 3LJCA 1E1HB 4G63A 3BQIA 5LBQB 2BZBA 2BDEA 2E9XD 4BAYB 1ZEEA 5HWYA 2XAFB 4LF8T 2V7LA 4EXTA 3AEAA 3VR9A 3M3ZB 4NIQA 4A98A 2LM2A 2XZEA 3PUWF 4Z90A 4TN7B 1BR2A 2VL8A 3J9X1 4YLHA 4EV6A 4NPPA 1H7CA 3RQWA 5JR9C 2UU9T 2JRKA 3I9YA
chains in the Genus database with same CATH topology
1OXZA 5JDFA 3RYFE 4FJOA 4OYKA 4M1PA 2LEHA 3JC6C 4WNKA 4TV9E 2YU2A 1YD8G 2DLRA 4WW0A 5LOVE 3RH3A 2XAJB 3RRWA 2K24A 3E0ZA 4CI2B 1B7TA 2EHOC 2ODUA 4N78D 3QUJA 5TAOA 1FMWA 3ZYLA 3KVBA 4H9NC 4TZ4C 3HR0A 3MK7C 3O4XE 2X67A 3T8OA 2NWBA 3NZQA 5HXCA 2LSGA 2XHEB 4TX5A 5HXSA 1KNZA 2W63A 3MJXA 3V5UA 5CA1E 3CQGB 4C91A 2A2FX 1S94A 1MMAA 2LE8A 2Q9QB 2Y48B 3ZC0A 2CMRA 5L2LA 3QK6A 2SPCA 5E0OA 2X9XA 4UVAB 2LSIA 3F31A 3PUSA 4YHJA 4ISTA 4H9RC 5L3EB 4UELA 3K3OA 2LM9A 4ANJA 2MBGA 2X9WA 2IC9A 4X1YE 1MNEA 3N9QA 4O2BE 3RYCE 3ZJ2A 3ZLIA 2DWGA 3H3AA 3KBTA 3I0QA 4MBQA 2HH7A 4I55E 5IHYA 4JUYA 3TKLB 2VB6A 3HL6A 3R6NA 4QXHB 4AI6A 4OK0A 4XAXB 2LOPA 1UCUA 1KK7A 3VHLA 5L3FB 2MYSA 3MXZA 4ZS3A 5LJNA 2JQQA 3DTOA 1HTJF 4CQIA 5FXXA 2OA5A 5M4YA 3VU7H 5JH7E 3J7Yq 3N9OA 3MACA 1FMVA 4AQFA 2C0SA 4HGAA 3VKGA 2WBLA 3ZEFB 3SS1A 3IF8B 4L5GA 4OHFA 4MFRA 2YINA 1VRBA 4IHJE 1D1BA 2XASB 3LBXA 3PE0A 2H7VC 2UXNB 5LXTE 1G73A 3PU3A 4G2AA 2NOXA 4CXXA 5C8YE 1ZV4X 2WSSV 2KZ7B 1ZKEA 2XTLA 3FHNA 1LRZA 2KWIB 2X68A 3PTRB 2X9YA 3C4WA 3UUMA 5JQGE 2DCFA 5EK4A 2GK9A 4PJMA 2VKJA 4ZOLE 4EZHA 3M65A 2V7IA 2KWHA 4K0UA 3WAJA 3N9NA 4FI5A 3ANWA 4PFPA 3KV5A 1IZNB 4NUUA 1WYBA 1HF8A 3ZCJA 3AAAB 2KNDA 2MOZA 2JPFA 3FBLA 3KV9A 2NP9A 2N9DA 4WBNE 1BR4A 3EUHA 3HKDE 1HFAA 4X1IE 2KINB 2CLYC 2NW7A 2PFVA 3NRXA 3LBXB 3RC8A 5HWXA 2K5BB 1HS7A 1QSDA 2PBIA 2NW9A 3RC3A 3K3QC 1QUUA 4PK4A 4ZI2C 2ZLYA 4AKGA 4ZI2D 3ONXA 3PUQA 5FYMA 3E08A 2CXFA 2D2SA 3ESLA 2VWAA 3UTKA 4PNIA 2NTXA 4GOUA 4HEAA 4UVCB 2E9XA 4YFSA 5HXHA 1SA0E 2ZM2A 4ZI3C 3C4ZA 2VASA 4ILUA 3AAEB 4IGUA 2UXXB 4ZI3D 4ZI7E 2Z6EA 3SRZA 5KX5E 4HE8A 2CEAA 3AVSA 3S4UA 2ZMAA 3SWHA 2XUEA 2XAHB 4UVBB 3U3IA 4YJ2E 2QGSA 4O2AE 2LT3A 2C5IT 3ANWB 3JC6D 3OYXA 4IE7A 1FEWA 1U5PA 5JDHA 1UX5A 1WR6A 3A5XA 4O4HE 3BQLA 4QHOA 5LBMA 4DMVA 4HKAA 1FIOA 4GK0E 2EHOD 4MLKA 5F3JA 4I4TE 4PJNA 3HKCE 2KMFA 4ASKA 1HG5A 3AB3B 4CI1B 4O4IE 2DI4A 5FY1A 4UV9B 3FBZA 3MZKB 3F2EA 2ES0A 5JR9A 3O1IA 5JVDE 2PG8A 3HA4A 3AVRA 1YKEB 2XAGB 2KXPB 3ZMZB 2D5UA 4HTEA 4QXCB 3SOLA 4U74A 4ISSA 3AAIA 5FY7A 4AQGA 2VKOA 4C90A 2E9XB 4JEHB 1IJ6A 5BMVE 4HFVA 2IC6A 2KT9A 3MKDA 4MHCA 3UFEA 3ZN1B 2MTQA 5LNKA 4PW8A 2N1GA 2N2NA 2EHOA 5JDQA 3FB2A 3RPUA 1D0ZA 3RKOA 1YKHB 3ZMVB 2JJ9A 2CLYB 2D0TA 3WAKA 2L9QA 4UXNB 3WI3A 1D0XA 3N2OA 5LGTB 5FXWA 3K3NA 1U4QA 2G0UA 3AA0B 3OYZA 4QWNB 3C50A 2CCQA 4IE0A 2ACXA 3PUAA 4CXWA 4O8SA 2ODVA 1NAFA 2NW8A 3GMIA 3IBPA 5L3BB 5JR9B 2CWOA 4CXYA 5LHIB 1US7B 2VK9A 4PFOA 3PURA 3CVRA 3Q9DA 4GYSA 3UUXB 4X20E 2CA5A 3C98B 1MIYA 4ERRA 3CQCB 3KV6A 3OKQA 2E8IA 4J2CA 4PJJA 1BR1A 4IE6A 2X0LB 4E7SA 1EZ3A 1IAPA 2LSJA 1D1AA 3RYIE 4H9PC 2M67A 5LJMA 4DVDA 3PU8A 3UUNA 2LSKA 4QX8B 2EHOB 3BQKA 2WWUA 3CWZB 5J1GA 2CM0A 3GWHA 3N5LA 3P8CD 4UEMA 3GN5A 3F57A 4AKRB 2W61A 3LK42 1O3XA 4AXPA 3EVYA 4DNDA 5HXRA 2HPJA 1V9DA 3ZYKA 4GK5E 1X79A 3CPZA 2W62A 1SHZC 3N2KE 2LHNA 4ZS2A 4AKHA 5JRCA 2Q9QC 4H9OC 3L09A 3KBUA 3B13A 2Q9QD 2WMOA 3RX6A 1T98A 4P09A 3MA9A 1ZHCA 4Z8XA 3ZJ1A 3CMLA 3I0OA 5LGUB 1D0YA 1Y64B 3GA8A 4ZHQE 5FMNA 5EZYE 4IDZA 4AKIA 2DWKA 2A72A 4AKLA 1IJ5A 1D1CA 5JDNA 3L3PA 3NBXX 3Q2MA 2YU1A 4PK6A 2JMKA 5J2UE 4EYYR 3KVAA 3ZCIA 2WM9A 2NTYA 2Y8DA 4QXBB 5CB4E 4BJMA 5ETWA 2CXLA 3ETVA 2JMHA 3U78A 5KDMC 2X66A 2Y6XA 1HX8A 3FXDB 3PDYA 4BJNA 4P0BA 2V26A 3GN5B 5DJQC 2W00A 1MNDA 4DBQA 3V5SA 2C5JA 2X9HA 4KP3C 5L3GB 4QKNA 2BVLA 5DQWA 4PJLA 3FXEB 5LA6E 2P9BA 3O1HA 2V7MA 2V7KA 5H6QB 5LHGB 5FXZA 5JRCB 2KLQA 3C51A 3K8PC 4QX7B 3RYHE 4EOZB 5KMGP 3UULA 3Q5WA 4EIWA 2L8KA 5J2TE 3EDVA 2YEVC 2ZM0A 3CX8B 2XQYA 5EK2A 4IIJE 4P0AA 4IE5A 2WAUA 5F8PA 5LHHB 2V7JA 3ZMTB 1AJ3A 4EB6E 3KDSE 3NRYA 4TUYE 2HPLA 3RRCA 5CA0E 2LJLA 5FY0A 5JREA 4A56A 2H7OA 3LK2B 4CZZB 1MMDA 3HKEE 2D0UA 1MMGA 4H9SE 3E22E 3I9WA 5AFUL 2PJQA 3DJBA 4L9IA 1UX4A 2B1EA 5H6RB 2LHRA 3AA1B 4DBRA 1LKXA 5LG4A 4HN9A 3P7IA 3ZMSB 2BVMA 3ZYMA 5IYZE 2IW5B 3IEEA 3KV4A 2YK0A 3OBVE 4UF0A 3AA7B 5LCYA 4CI3B 4AQFC 2RP4A 3PUGA 3LG7A 1Z0PA 4XZCA 5JDGA 3C4XA 3N9MA 2W0GA 2LSYA 3ETUA 2L3LA 1OWAA 5LYJE 2K48A 4KBMB 3QC9A 1NWMX 4NUVA 4UV8B 3N9LA 2C5KT 1WYCA 5JDMA 4L0RA 5HYAA 3H37A 1LVFA 2CWYA 2DHRA 5LP6E 2LOSA 2DNXA 3CX7B 1BR0A 1VOMA 2XAQB 3AA6B 3O9XA 1S35A 1MIVA 3N9PA 5ADXL 5FP3A 3C64A 3EDUA 4JEUB 3IHRA 4EYUA 3OJAA 4KUMB 4IE4A 4F6RC 2VKHA 2I59A 3ZPOA 3ZMUB 5EK3A 3O1JA 1HG2A 3LFMA 4PK5A 3W15B 2CXDA 4UF0B 4I43B 4GYRA 4TV8E 2RA1A 4O4LE 4I50E 3CQXC 3KFWX 3B57A 4GIWA 4OYJA 2J1DG 3KINB 4YJ3E 3NZPA 4X1KE 3N2GE 4U72A 3CKDA 4E7ZA 2V1DB 1CUNA 3Q5XA 2CE7A 5A1LA 2WMNA 3VKHA 4H63H 5JDLA 3ZC1A 2H3RA 4EZ4A 1YW0A 3HKBE 2X51A 3LJCA 4B6XA 5GONE 1E1HB 4G63A 2E9XC 3ZN0B 3BQIA 5LBQB 4KMCA 5HXEA 1MMNA 2BZBA 2BDEA 4JLEA 4UIGA 2E9XD 5DABA 3D0TA 2ZM8A 4O4JE 5DQVA 1ZEEA 2IAKA 4BAYB 5HWYA 2XAFB 4MALA 1G8XA 2V7LA 4EXTA 2K9AA 5FXVA 1HCIA 4DO0A 1MIWA 4ADZA 4PAGA 5LGNB 5FNVE 5L3DB 2VKDA 1BR2A 4TN7B 3UT5E 2VL8A 3BK9A 4BA9A 4H63V 3J9X1 4YLHA 2A3DA 2Q9QA 3R84B 1WLXA 4V1Av 1H7CA 3DP7A 3I1AA 4WBOA 5HAXA 1WRDA 4XBFB 1LVKA 5JR9C 3CX6B 3HI2A 2JRKA 4EAHA 4OFZA 4DMWA 3LK3B 5L3CB 4H9QC 3I9YA 2QA7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4H63 V;  3R84 B; 
#chains in the Genus database with same CATH topology
 1OXZ A;  2X0H A;  5JDF A;  3UU8 A;  4U3C A;  4OYK A;  3RH3 A;  2K24 A;  3E0Z A;  1B7T A;  2ODU A;  4N78 D;  4DV5 T;  2VUR A;  1FMW A;  4H9N C;  4TZ4 C;  2VVS A;  3MK7 C;  2BS2 A;  4TX5 A;  2W63 A;  3CQG B;  1S94 A;  2Q9Q B;  3PUS A;  4YHJ A;  2WDQ A;  4ILB A;  4UEL A;  2MBG A;  1W0B A;  1MNE A;  2DWG A;  4B3S T;  3I0Q A;  4I0U A;  4JUY A;  3TKL B;  5LJN A;  1UCU A;  2MYS A;  3MXZ A;  3DTO A;  1HTJ F;  3J7Y q;  2BKP A;  3N9O A;  3SS1 A;  2XAS B;  2H7V C;  4OX9 T;  3ABV A;  3T1H T;  3TLW A;  3VRA A;  3UFG A;  2XSA A;  2X9Y A;  3C4W A;  5EK4 A;  2GK9 A;  1IBK T;  3M65 A;  2KWH A;  4HFE A;  4PFP A;  3KV5 A;  4NUU A;  1M62 A;  2PFV A;  3LBX B;  3RIU A;  3UU5 A;  1HS7 A;  4PK4 A;  4AKG A;  3Q5E A;  4YSX A;  2MAW A;  3TLT A;  3UTK A;  1JNZ A;  4GOU A;  4HEA A;  5HXH A;  3VR8 A;  1SA0 E;  2ZM2 A;  3AEG A;  3C4Z A;  2VAS A;  4ZI3 D;  5LMN T;  2LT3 A;  3OYX A;  1U5P A;  3BQL A;  4DMV A;  1FIO A;  3NWI A;  4PJN A;  2KMF A;  1T7S A;  3AB3 B;  2HN1 A;  4CI1 B;  3TLU A;  5JR9 A;  3O1I A;  5JVD E;  4LFB T;  3HA4 A;  3AVR A;  3ZMZ B;  4YY3 T;  4HTE A;  3SOL A;  1J5W A;  3AAI A;  4Q25 A;  4C90 A;  4NXN T;  2KT9 A;  5LNK A;  2XM2 A;  5JDQ A;  1D0Z A;  1YKH B;  3WAK A;  4K0K T;  5LGT B;  1U4Q A;  3AA0 B;  2FJA A;  4QWN B;  3PUA A;  2W4X A;  1NAF A;  4CXY A;  1UUR A;  4PFO A;  1VCT A;  3Q9D A;  4GYS A;  1MIY A;  4ERR A;  4J2C A;  2W67 A;  2FJB A;  1EZ3 A;  3ONL C;  1IAP A;  5LJM A;  1SUM B;  2WZH A;  3PU8 A;  3UUN A;  2D9D A;  2CM0 A;  3N5L A;  3UQ4 A;  4LMJ A;  4AXP A;  2LRK A;  2HPJ A;  1V9D A;  2WWV A;  1X79 A;  5AQU B;  2OV9 A;  1W0A A;  2LHN A;  2Q9Q C;  2H89 A;  3RX6 A;  5ABF B;  5LGU B;  4JI0 T;  1W9R A;  2DWK A;  2A72 A;  3NBX X;  2ZM6 T;  4PK6 A;  2JMK A;  1N36 T;  5F5W A;  3ZCI A;  2WM9 A;  4B3T T;  3FZM B;  5BR8 T;  4ZZC A;  2X66 A;  2V6Y A;  5LMU T;  2V26 A;  4LML A;  4QH4 A;  3V5S A;  5L3G B;  5HCM A;  4EED A;  5JRC B;  4QX7 B;  5KMG P;  3UUL A;  4EIW A;  2ZM0 A;  2PTF A;  3CX8 B;  5EK2 A;  2V7J A;  3JAE A;  4JI7 T;  3ZMT B;  2XQ4 A;  3RRC A;  4CZZ B;  1MMD A;  2D0U A;  1XMO T;  3PUY F;  1NEN A;  2BVM A;  3P4W A;  3IEE A;  2YK0 A;  4AQF C;  3PUG A;  3LG7 A;  4JI8 T;  2L3L A;  2K48 A;  3QC9 A;  1NWM X;  4NUV A;  4CN1 A;  1E7P A;  2DHR A;  1VOM A;  2XAQ B;  3AA6 B;  4TNV A;  2BG9 C;  2HN2 A;  3B5M A;  3PUZ F;  4JEU B;  1CHU A;  2VKH A;  2I59 A;  4JI3 T;  2CXD A;  4I43 B;  4GYR A;  2RA1 A;  2XQ5 A;  3AE2 A;  5ABG A;  5AQL B;  4U72 A;  2V1D B;  2CE7 A;  5A1L A;  5JDL A;  2UXB T;  4HFH A;  4B6X A;  5GON E;  4KMC A;  4JLE A;  2CPT A;  5DAB A;  4DV3 T;  3D0T A;  2IAK A;  2XY8 B;  2I0M A;  2K9A A;  1HCI A;  4DO0 A;  3P4P A;  4PAG A;  5LGN B;  5FNV E;  2VKD A;  3BK9 A;  2CHO A;  2Q9Q A;  2B76 A;  1WLX A;  4V1A v;  2BBJ A;  1LVK A;  4LFA T;  3CX6 B;  2UUA T;  4OFZ A;  5J0Z A;  5L3C B;  4H9Q C;  2QA7 A;  3RYF E;  1UUS A;  3AE6 A;  4FJO A;  3A7M A;  1YD8 G;  4CI2 B;  3RRW A;  2XAJ B;  3AEF A;  4COF A;  3QUJ A;  2VQF T;  3KVB A;  4U7I A;  1WFD A;  2LSG A;  1HX1 B;  1KNZ A;  3MJX A;  4C91 A;  2LE8 A;  2Y48 B;  3UU6 A;  2CMR A;  2W2U A;  4QH5 A;  2LSI A;  5IUX A;  4IST A;  4H9R C;  3TLS A;  5L3E B;  3K3O A;  2LM9 A;  2X9W A;  3ZT7 A;  3N9Q A;  3RYC E;  2A9U A;  4I55 E;  4XAX B;  2LOP A;  5L3F B;  1KK7 A;  4ZS3 A;  1WR0 A;  3PJA A;  2UXD T;  3P4R A;  4CQI A;  5M4Y A;  2YOE A;  4AQF A;  4HGA A;  3VKG A;  1Z8U A;  3IF8 B;  4OHF A;  3LBX A;  5LXT E;  2UXN B;  4TWD A;  3PU3 A;  2R6G F;  2WU2 A;  4LF7 T;  2X68 A;  3PTR B;  3SFD A;  2WDV A;  5JQG E;  4PJM A;  1HNX T;  4ZOL E;  2V7I A;  5JTG A;  3WAJ A;  3N9N A;  4FI5 A;  4YT0 A;  4DUZ T;  1HF8 A;  3ZCJ A;  3AAA B;  3RIA A;  3FBL A;  4LF9 T;  4DR7 T;  3HKD E;  2KIN B;  2CLY C;  2XQ6 A;  3AE4 A;  3RC8 A;  1QUU A;  4ZI2 D;  3E08 A;  2D2S A;  2VWA A;  2VL0 A;  5FL0 A;  4DR6 T;  4WZX A;  4UVC B;  4YFS A;  4HWI B;  2YDS A;  4X64 T;  4HE8 A;  2CEA A;  3SWH A;  2ZMA A;  1XNQ T;  4YXD A;  1QLB A;  2XUE A;  3PV0 F;  3U3I A;  4YJ2 E;  5HEH A;  3ANW B;  2C5I T;  1FEW A;  2XPK A;  3A5X A;  4YTP A;  4MLK A;  1DU2 A;  4I4T E;  2DI4 A;  4UV9 B;  3MZK B;  2CBI A;  2PG8 A;  2IHR 1;  4U74 A;  4ISS A;  5FY7 A;  3AE7 A;  2E9X B;  1IJ6 A;  5C3J A;  4A97 A;  1IBM T;  1M7K A;  2DL1 A;  3FB2 A;  3RPU A;  5AQT B;  2D0T A;  2IML A;  4DV4 T;  2L9Q A;  4UXN B;  1D0X A;  3K3N A;  2G0U A;  2ACX A;  2NW8 A;  3GMI A;  5L3B B;  5ABF A;  2CWO A;  3AE5 A;  1US7 B;  3RGL A;  4YSZ A;  3C98 B;  1XDP A;  2QYW A;  2H88 A;  4PJJ A;  4E7S A;  2CBJ A;  1D1A A;  4DVD A;  4QX8 B;  2WWU A;  3CWZ B;  3LK4 2;  1O3X A;  1KNP A;  3EAM A;  5HCJ A;  3N2K E;  4ZS2 A;  5JRC A;  4H9O C;  3CIR A;  3KBU A;  5AQI B;  1T98 A;  3MA9 A;  5AQJ B;  3CML A;  3I0O A;  4ZHQ E;  3JAF A;  4IDZ A;  4YTM A;  1IJ5 A;  4LMK A;  5JDN A;  3Q2M A;  3UU3 A;  2NTY A;  1XDO A;  4QXB B;  4HWD A;  3U78 A;  1HX8 A;  3PDY A;  4P0B A;  4P1N A;  3EI0 A;  2M6B A;  4DBQ A;  4IDN A;  2C5J A;  4PJL A;  4EGW A;  3O1H A;  2QRX A;  1T72 A;  2KLQ A;  3C51 A;  4YSY A;  2L8K A;  3EDV A;  3FZH B;  2XQY A;  4JI5 T;  2V6X A;  2WAU A;  5LHH B;  1VCS A;  3NRY A;  2HPL A;  2LJL A;  5FY0 A;  2WZI A;  2H7O A;  3LK2 B;  5AQQ B;  4A56 A;  5CGM A;  3I9W A;  1E2A A;  1OED E;  1UX4 A;  2B1E A;  4LF5 T;  1HNW T;  2LHR A;  5LG4 A;  3K1S A;  4JYA T;  3ZYM A;  3KV4 A;  3OBV E;  2RP4 A;  4XZC A;  3N9M A;  2W0G A;  1OWA A;  4KBM B;  1XNR T;  3N9L A;  4L0R A;  3PUX F;  3EAB A;  2LOS A;  4IT4 A;  3O9X A;  5ADX L;  2UUB T;  4GKK T;  5FP3 A;  3C64 A;  2OLT A;  3FZF B;  3ZKR A;  3OJA A;  4DV6 T;  3P4S A;  3ZMU B;  3QOF A;  3LFM A;  3NVO A;  4UF0 B;  4ZEY A;  1ZOY A;  4I50 E;  3CQX C;  3KFW X;  5FVL A;  4X1K E;  3CKD A;  2BBH A;  1CUN A;  3Q5X A;  1HNZ T;  3VKH A;  4H63 H;  3ZC1 A;  2H3R A;  4EZ4 A;  4DV2 T;  2E2A A;  1YW0 A;  2KSR A;  2E9X C;  5HXE A;  4UIG A;  5LG3 A;  2CRB A;  4O4J E;  5DQV A;  4KX6 A;  1Y01 A;  5FXV A;  1MIW A;  2WCA A;  5L3D B;  1J5E T;  3UT5 E;  4BA9 A;  4H63 V;  5HEJ A;  2A3D A;  2MPK A;  3R84 B;  4CN4 A;  5ABE A;  3Q5D A;  4XBF B;  3QNU A;  2RPA A;  3AEB A;  2XSB A;  2IUB A;  1N34 T;  4M1P A;  2LEH A;  5AQH B;  4WNK A;  4TV9 E;  2YU2 A;  2DLR A;  3P4Q A;  5LOV E;  2X0Y A;  3ZYL A;  5CFB A;  3T8O A;  2X67 A;  4DID B;  1KF6 A;  3NZQ A;  3V5U A;  1KFY A;  4JI1 T;  3ZC0 A;  5L2L A;  5LB7 B;  3QK6 A;  2UXC T;  2SPC A;  5E0O A;  2LKG A;  2X9X A;  3F31 A;  5AQK B;  4ANJ A;  2IC9 A;  4X1Y E;  1WCR A;  1KEY A;  3ZLI A;  4MBQ A;  2XQA A;  5L4E A;  5IHY A;  3HL6 A;  3R6N A;  4OK0 A;  4DV7 T;  3VHL A;  2JQQ A;  4IDP A;  3VU7 H;  2J4G A;  3ZEF B;  4L5G A;  1VRB A;  1N32 T;  1D1B A;  3PE0 A;  1T8B A;  2BG9 E;  2NOX A;  5C8Y E;  3UUB A;  4DV1 T;  1ZV4 X;  2WSS V;  3PJA J;  2XTL A;  3FHN A;  1LRZ A;  4HWH A;  4A5X A;  4X62 T;  4GKJ T;  2DCF A;  2VKJ A;  4EZH A;  2AE9 A;  1JNR A;  2XQ9 A;  4K0U A;  3ANW A;  1WYB A;  2KND A;  2MOZ A;  2JPF A;  4ILA A;  2N9D A;  1BR4 A;  3EUH A;  3NRX A;  1QSD A;  5FYM A;  2FBW A;  3ESL A;  1X9B A;  2E9X A;  4U2Z A;  4ZI3 C;  3AAE B;  2Z6E A;  3ZST A;  3AVS A;  4LF6 T;  2QGS A;  4O2A E;  3JC6 D;  4F8H A;  3IA3 A;  4JI2 T;  1UX5 A;  4QHO A;  4O4H E;  4HKA A;  4GK0 E;  2EHO D;  1YQ3 A;  1HG5 A;  4O4I E;  2FJE A;  4DUY T;  1YKE B;  2D5U A;  4QXC B;  1L0V A;  4AIS A;  4DR2 T;  3RIF A;  4AQG A;  2VKO A;  3EHZ A;  4JEH B;  5BMV E;  3QB5 K;  3UFE A;  2IC6 A;  4MHC A;  5AQV B;  2N1G A;  3P50 A;  1W09 A;  3RKO A;  5AQN B;  2JJ9 A;  3WI3 A;  3L8R A;  2JQK A;  2V5D A;  2HHH T;  3OPC A;  5FXW A;  3C50 A;  4IE0 A;  4CXW A;  5FVK A;  2IDO B;  1GQE A;  2FJD A;  5CJ5 A;  4Z91 A;  2VK9 A;  3PUR A;  3CVR A;  2WY2 A;  3LDQ B;  2CA5 A;  4ZXL A;  1YQ4 A;  3CQC B;  3KV6 A;  2E8I A;  1BR1 A;  4IE6 A;  4H9P C;  2M67 A;  4WYV A;  2XQ8 A;  2EHO B;  2XM1 A;  2YKS A;  1IBL T;  3GWH A;  3P8C D;  4AKR B;  2W61 A;  1OED B;  3EVY A;  4DND A;  3ZYK A;  4GK5 E;  4YTN A;  2W62 A;  5FKY A;  4QH1 A;  2Q9Q D;  2WMO A;  1ZHC A;  1D0Y A;  1Y64 B;  3GA8 A;  5FMN A;  4AKI A;  2LKH A;  3L3P A;  5J2U E;  3KVA A;  2Y8D A;  3ETV A;  2JMH A;  3FZK B;  5KDM C;  4LFC T;  3GN5 B;  2JIW A;  5DJQ C;  2W00 A;  4DR4 T;  4B3R T;  1MND A;  4AQY T;  4KP3 C;  3FXE B;  5LA6 E;  2P9B A;  2WU5 A;  5LHG B;  4IL9 A;  4EOZ B;  3RYH E;  3Q5W A;  5J2T E;  2YEV C;  2K3W A;  2WP9 A;  4P0A A;  4IE5 A;  5F8P A;  5AQF B;  4TUY E;  5CA0 E;  3RF1 A;  4KHZ F;  3HKE E;  4IDQ A;  1MMG A;  2WB5 A;  4X66 T;  3E22 E;  3ZT6 A;  5AFU L;  2PJQ A;  3AA1 B;  4DBR A;  4EEB A;  2JQ9 A;  2IW5 B;  1UK5 A;  4DR5 T;  4CI3 B;  4UF0 A;  3AA7 B;  2YDQ A;  2J47 A;  2FUP A;  1Z0P A;  3AEE A;  5HEU A;  5LYJ E;  4HFI A;  4UV8 B;  4X65 T;  1WYC A;  3X1D A;  4NXM T;  2DNX A;  3CX7 B;  2E5V A;  1MIV A;  4U2Y A;  3EDU A;  4KUM B;  4IE4 A;  3ZPO A;  5EK3 A;  1HG2 A;  4JI4 T;  3W15 B;  4GIW A;  2J1D G;  3KIN B;  3N2G E;  4E7Z A;  2F4V T;  3UU4 A;  3ZN0 B;  1MMN A;  2ZM8 A;  3JCF A;  3UQ7 A;  2UUC T;  4MAL A;  1G8X A;  3ZT5 A;  4ADZ A;  5HEO A;  4LF4 T;  2AXD S;  4KI0 F;  1FJG T;  3DP7 A;  3I1A A;  4WBO A;  5IWA T;  2ACZ A;  5HAX A;  1WRD A;  4YHH T;  3AXJ B;  3HI2 A;  2BG9 B;  4EAH A;  4DMW A;  3LK3 B;  2XAH B;  2J62 A;  3NKZ A;  3RLF F;  3JC6 C;  5AQM B;  4WW0 A;  2EHO C;  2JQH A;  5TAO A;  1OED C;  3HR0 A;  3O4X E;  2NWB A;  2YN6 A;  5HXC A;  2XHE B;  5HXS A;  2WQY A;  3G06 A;  4X5T A;  5CA1 E;  4HFD A;  2A2F X;  1MMA A;  5AQP B;  2WS3 A;  4UVA B;  3VRB A;  3L39 A;  4IRE A;  2W66 A;  2VQE T;  4ZZB A;  4O2B E;  3ZJ2 A;  3H3A A;  3KBT A;  4U7Y A;  2HH7 A;  2VB6 A;  4QXH B;  4AI6 A;  4DR1 T;  5FXX A;  2OA5 A;  2LRL A;  5JH7 E;  3MAC A;  1FMV A;  3JAD A;  2C0S A;  2WBL A;  4DV0 T;  4MFR A;  2YIN A;  4IHJ E;  2V8S V;  1G73 A;  5C2T A;  4G2A A;  4CXX A;  2YDR A;  2KZ7 B;  1ZKE A;  3TLV A;  2KWI B;  2NR4 A;  1I94 T;  3UUM A;  2XJ7 A;  4UR9 A;  1IZN B;  3KV9 A;  2NP9 A;  4WBN E;  3AE3 A;  1HFA A;  4X1I E;  2NW7 A;  5HWX A;  2K5B B;  2PBI A;  2NW9 A;  3RC3 A;  3K3Q C;  4ZI2 C;  2ZLY A;  2BS3 A;  3ONX A;  3PUQ A;  4HWF A;  3PUV F;  2CXF A;  3CK6 A;  4PNI A;  2NTX A;  3A8Y C;  3QB5 A;  4ILU A;  4IGU A;  2UXX B;  4ZI7 E;  5KX5 E;  3SRZ A;  3S4U A;  2VVN A;  1KNR A;  4UVB B;  4CN6 A;  2V5C A;  4IE7 A;  5JDH A;  1WR6 A;  5LBM A;  5AQO B;  3ONJ A;  4ILC A;  5HEG A;  5F3J A;  3HKC E;  4AIU A;  4ASK A;  4JI6 T;  4TNW A;  1I6Z A;  5FY1 A;  3FBZ A;  3F2E A;  2ES0 A;  3RQU A;  2XAG B;  2KXP B;  3H3M A;  4TWF A;  4HFV A;  3ZN1 B;  3MKD A;  1XWM A;  2MTQ A;  1NEK A;  4PW8 A;  3RKG A;  2N2N A;  2EHO A;  2QVA A;  3OVU A;  3ZMV B;  1OED A;  2CLY B;  3N2O A;  4HWC A;  3OYZ A;  4TWH A;  2CCQ A;  4O8S A;  2ODV A;  3IBP A;  5JR9 B;  5LHI B;  3AEC A;  3UUX B;  4X20 E;  4JBW F;  5AQS B;  3OKQ A;  3RHW A;  4B3M T;  1HR0 T;  2X0L B;  2LSJ A;  2WDR A;  3RYI E;  2LSK A;  3BQK A;  5J1G A;  4UEM A;  3GN5 A;  3F57 A;  2CHN A;  1YXR A;  5HXR A;  4HFB A;  3CPZ A;  4U31 A;  1SHZ C;  4AKH A;  3L09 A;  3B13 A;  2BS4 A;  3AE1 A;  4P09 A;  4Z8X A;  3ZJ1 A;  4IL4 A;  5EZY E;  2LLY A;  4AKL A;  1D1C A;  2E5L T;  2YU1 A;  4EYY R;  3AE9 A;  2BKN A;  3ZSS A;  5CB4 E;  4BJM A;  5ETW A;  2CXL A;  2Y6X A;  3FXD B;  4BJN A;  2M6I A;  2X9H A;  4QKN A;  2BVL A;  5DQW A;  3OTO T;  2V7M A;  2V7K A;  5H6Q B;  5FXZ A;  3K8P C;  3AE8 A;  3LSV A;  4IIJ E;  2I6H A;  1AJ3 A;  4EB6 E;  3KDS E;  5JRE A;  4H9S E;  3DJB A;  4L9I A;  5H6R B;  1N33 T;  1LKX A;  4HN9 A;  3P7I A;  2IIU A;  2V6Y B;  3ZMS B;  5L47 A;  3SFE A;  5IYZ E;  4HFC A;  4KHP T;  5LCY A;  3T1Y T;  5AQR B;  5JDG A;  3C4X A;  2LSY A;  3ETU A;  4DR3 T;  2C5K T;  5JDM A;  3RI5 A;  1R8I A;  5HYA A;  3H37 A;  1LVF A;  2XQ3 A;  1J1J A;  2CWY A;  5LP6 E;  1BR0 A;  3FZL B;  1UGO A;  1S35 A;  5ABH A;  3N9P A;  3IHR A;  4EYU A;  4F6R C;  3O1J A;  4PK5 A;  5KXJ A;  4TV8 E;  4O4L E;  1ZP0 A;  3AED A;  3B57 A;  4OYJ A;  4YJ3 E;  3NZP A;  2BKO A;  3RIU C;  1XZY A;  5L4H A;  2XQ7 A;  1XMQ T;  2WMN A;  5FL1 A;  1SE7 A;  3AXJ A;  5AQG B;  2BG9 A;  4U33 A;  4JV5 T;  4IDO A;  3HKB E;  2X51 A;  3LJC A;  1E1H B;  4G63 A;  3BQI A;  5LBQ B;  2BZB A;  2BDE A;  2E9X D;  4BAY B;  1ZEE A;  5HWY A;  2XAF B;  4LF8 T;  2V7L A;  4EXT A;  3AEA A;  3VR9 A;  3M3Z B;  4NIQ A;  4A98 A;  2LM2 A;  2XZE A;  3PUW F;  4Z90 A;  4TN7 B;  1BR2 A;  2VL8 A;  3J9X 1;  4YLH A;  4EV6 A;  4NPP A;  1H7C A;  3RQW A;  5JR9 C;  2UU9 T;  2JRK A;  3I9Y A; 
#chains in the Genus database with same CATH homology
 1OXZ A;  5JDF A;  3RYF E;  4FJO A;  4OYK A;  4M1P A;  2LEH A;  3JC6 C;  4WNK A;  4TV9 E;  2YU2 A;  1YD8 G;  2DLR A;  4WW0 A;  5LOV E;  3RH3 A;  2XAJ B;  3RRW A;  2K24 A;  3E0Z A;  4CI2 B;  1B7T A;  2EHO C;  2ODU A;  4N78 D;  3QUJ A;  5TAO A;  1FMW A;  3ZYL A;  3KVB A;  4H9N C;  4TZ4 C;  3HR0 A;  3MK7 C;  3O4X E;  2X67 A;  3T8O A;  2NWB A;  3NZQ A;  5HXC A;  2LSG A;  2XHE B;  4TX5 A;  5HXS A;  1KNZ A;  2W63 A;  3MJX A;  3V5U A;  5CA1 E;  3CQG B;  4C91 A;  2A2F X;  1S94 A;  1MMA A;  2LE8 A;  2Q9Q B;  2Y48 B;  3ZC0 A;  2CMR A;  5L2L A;  3QK6 A;  2SPC A;  5E0O A;  2X9X A;  4UVA B;  2LSI A;  3F31 A;  3PUS A;  4YHJ A;  4IST A;  4H9R C;  5L3E B;  4UEL A;  3K3O A;  2LM9 A;  4ANJ A;  2MBG A;  2X9W A;  2IC9 A;  4X1Y E;  1MNE A;  3N9Q A;  4O2B E;  3RYC E;  3ZJ2 A;  3ZLI A;  2DWG A;  3H3A A;  3KBT A;  3I0Q A;  4MBQ A;  2HH7 A;  4I55 E;  5IHY A;  4JUY A;  3TKL B;  2VB6 A;  3HL6 A;  3R6N A;  4QXH B;  4AI6 A;  4OK0 A;  4XAX B;  2LOP A;  1UCU A;  1KK7 A;  3VHL A;  5L3F B;  2MYS A;  3MXZ A;  4ZS3 A;  5LJN A;  2JQQ A;  3DTO A;  1HTJ F;  4CQI A;  5FXX A;  2OA5 A;  5M4Y A;  3VU7 H;  5JH7 E;  3J7Y q;  3N9O A;  3MAC A;  1FMV A;  4AQF A;  2C0S A;  4HGA A;  3VKG A;  2WBL A;  3ZEF B;  3SS1 A;  3IF8 B;  4L5G A;  4OHF A;  4MFR A;  2YIN A;  1VRB A;  4IHJ E;  1D1B A;  2XAS B;  3LBX A;  3PE0 A;  2H7V C;  2UXN B;  5LXT E;  1G73 A;  3PU3 A;  4G2A A;  2NOX A;  4CXX A;  5C8Y E;  1ZV4 X;  2WSS V;  2KZ7 B;  1ZKE A;  2XTL A;  3FHN A;  1LRZ A;  2KWI B;  2X68 A;  3PTR B;  2X9Y A;  3C4W A;  3UUM A;  5JQG E;  2DCF A;  5EK4 A;  2GK9 A;  4PJM A;  2VKJ A;  4ZOL E;  4EZH A;  3M65 A;  2V7I A;  2KWH A;  4K0U A;  3WAJ A;  3N9N A;  4FI5 A;  3ANW A;  4PFP A;  3KV5 A;  1IZN B;  4NUU A;  1WYB A;  1HF8 A;  3ZCJ A;  3AAA B;  2KND A;  2MOZ A;  2JPF A;  3FBL A;  3KV9 A;  2NP9 A;  2N9D A;  4WBN E;  1BR4 A;  3EUH A;  3HKD E;  1HFA A;  4X1I E;  2KIN B;  2CLY C;  2NW7 A;  2PFV A;  3NRX A;  3LBX B;  3RC8 A;  5HWX A;  2K5B B;  1HS7 A;  1QSD A;  2PBI A;  2NW9 A;  3RC3 A;  3K3Q C;  1QUU A;  4PK4 A;  4ZI2 C;  2ZLY A;  4AKG A;  4ZI2 D;  3ONX A;  3PUQ A;  5FYM A;  3E08 A;  2CXF A;  2D2S A;  3ESL A;  2VWA A;  3UTK A;  4PNI A;  2NTX A;  4GOU A;  4HEA A;  4UVC B;  2E9X A;  4YFS A;  5HXH A;  1SA0 E;  2ZM2 A;  4ZI3 C;  3C4Z A;  2VAS A;  4ILU A;  3AAE B;  4IGU A;  2UXX B;  4ZI3 D;  4ZI7 E;  2Z6E A;  3SRZ A;  5KX5 E;  4HE8 A;  2CEA A;  3AVS A;  3S4U A;  2ZMA A;  3SWH A;  2XUE A;  2XAH B;  4UVB B;  3U3I A;  4YJ2 E;  2QGS A;  4O2A E;  2LT3 A;  2C5I T;  3ANW B;  3JC6 D;  3OYX A;  4IE7 A;  1FEW A;  1U5P A;  5JDH A;  1UX5 A;  1WR6 A;  3A5X A;  4O4H E;  3BQL A;  4QHO A;  5LBM A;  4DMV A;  4HKA A;  1FIO A;  4GK0 E;  2EHO D;  4MLK A;  5F3J A;  4I4T E;  4PJN A;  3HKC E;  2KMF A;  4ASK A;  1HG5 A;  3AB3 B;  4CI1 B;  4O4I E;  2DI4 A;  5FY1 A;  4UV9 B;  3FBZ A;  3MZK B;  3F2E A;  2ES0 A;  5JR9 A;  3O1I A;  5JVD E;  2PG8 A;  3HA4 A;  3AVR A;  1YKE B;  2XAG B;  2KXP B;  3ZMZ B;  2D5U A;  4HTE A;  4QXC B;  3SOL A;  4U74 A;  4ISS A;  3AAI A;  5FY7 A;  4AQG A;  2VKO A;  4C90 A;  2E9X B;  4JEH B;  1IJ6 A;  5BMV E;  4HFV A;  2IC6 A;  2KT9 A;  3MKD A;  4MHC A;  3UFE A;  3ZN1 B;  2MTQ A;  5LNK A;  4PW8 A;  2N1G A;  2N2N A;  2EHO A;  5JDQ A;  3FB2 A;  3RPU A;  1D0Z A;  3RKO A;  1YKH B;  3ZMV B;  2JJ9 A;  2CLY B;  2D0T A;  3WAK A;  2L9Q A;  4UXN B;  3WI3 A;  1D0X A;  3N2O A;  5LGT B;  5FXW A;  3K3N A;  1U4Q A;  2G0U A;  3AA0 B;  3OYZ A;  4QWN B;  3C50 A;  2CCQ A;  4IE0 A;  2ACX A;  3PUA A;  4CXW A;  4O8S A;  2ODV A;  1NAF A;  2NW8 A;  3GMI A;  3IBP A;  5L3B B;  5JR9 B;  2CWO A;  4CXY A;  5LHI B;  1US7 B;  2VK9 A;  4PFO A;  3PUR A;  3CVR A;  3Q9D A;  4GYS A;  3UUX B;  4X20 E;  2CA5 A;  3C98 B;  1MIY A;  4ERR A;  3CQC B;  3KV6 A;  3OKQ A;  2E8I A;  4J2C A;  4PJJ A;  1BR1 A;  4IE6 A;  2X0L B;  4E7S A;  1EZ3 A;  1IAP A;  2LSJ A;  1D1A A;  3RYI E;  4H9P C;  2M67 A;  5LJM A;  4DVD A;  3PU8 A;  3UUN A;  2LSK A;  4QX8 B;  2EHO B;  3BQK A;  2WWU A;  3CWZ B;  5J1G A;  2CM0 A;  3GWH A;  3N5L A;  3P8C D;  4UEM A;  3GN5 A;  3F57 A;  4AKR B;  2W61 A;  3LK4 2;  1O3X A;  4AXP A;  3EVY A;  4DND A;  5HXR A;  2HPJ A;  1V9D A;  3ZYK A;  4GK5 E;  1X79 A;  3CPZ A;  2W62 A;  1SHZ C;  3N2K E;  2LHN A;  4ZS2 A;  4AKH A;  5JRC A;  2Q9Q C;  4H9O C;  3L09 A;  3KBU A;  3B13 A;  2Q9Q D;  2WMO A;  3RX6 A;  1T98 A;  4P09 A;  3MA9 A;  1ZHC A;  4Z8X A;  3ZJ1 A;  3CML A;  3I0O A;  5LGU B;  1D0Y A;  1Y64 B;  3GA8 A;  4ZHQ E;  5FMN A;  5EZY E;  4IDZ A;  4AKI A;  2DWK A;  2A72 A;  4AKL A;  1IJ5 A;  1D1C A;  5JDN A;  3L3P A;  3NBX X;  3Q2M A;  2YU1 A;  4PK6 A;  2JMK A;  5J2U E;  4EYY R;  3KVA A;  3ZCI A;  2WM9 A;  2NTY A;  2Y8D A;  4QXB B;  5CB4 E;  4BJM A;  5ETW A;  2CXL A;  3ETV A;  2JMH A;  3U78 A;  5KDM C;  2X66 A;  2Y6X A;  1HX8 A;  3FXD B;  3PDY A;  4BJN A;  4P0B A;  2V26 A;  3GN5 B;  5DJQ C;  2W00 A;  1MND A;  4DBQ A;  3V5S A;  2C5J A;  2X9H A;  4KP3 C;  5L3G B;  4QKN A;  2BVL A;  5DQW A;  4PJL A;  3FXE B;  5LA6 E;  2P9B A;  3O1H A;  2V7M A;  2V7K A;  5H6Q B;  5LHG B;  5FXZ A;  5JRC B;  2KLQ A;  3C51 A;  3K8P C;  4QX7 B;  3RYH E;  4EOZ B;  5KMG P;  3UUL A;  3Q5W A;  4EIW A;  2L8K A;  5J2T E;  3EDV A;  2YEV C;  2ZM0 A;  3CX8 B;  2XQY A;  5EK2 A;  4IIJ E;  4P0A A;  4IE5 A;  2WAU A;  5F8P A;  5LHH B;  2V7J A;  3ZMT B;  1AJ3 A;  4EB6 E;  3KDS E;  3NRY A;  4TUY E;  2HPL A;  3RRC A;  5CA0 E;  2LJL A;  5FY0 A;  5JRE A;  4A56 A;  2H7O A;  3LK2 B;  4CZZ B;  1MMD A;  3HKE E;  2D0U A;  1MMG A;  4H9S E;  3E22 E;  3I9W A;  5AFU L;  2PJQ A;  3DJB A;  4L9I A;  1UX4 A;  2B1E A;  5H6R B;  2LHR A;  3AA1 B;  4DBR A;  1LKX A;  5LG4 A;  4HN9 A;  3P7I A;  3ZMS B;  2BVM A;  3ZYM A;  5IYZ E;  2IW5 B;  3IEE A;  3KV4 A;  2YK0 A;  3OBV E;  4UF0 A;  3AA7 B;  5LCY A;  4CI3 B;  4AQF C;  2RP4 A;  3PUG A;  3LG7 A;  1Z0P A;  4XZC A;  5JDG A;  3C4X A;  3N9M A;  2W0G A;  2LSY A;  3ETU A;  2L3L A;  1OWA A;  5LYJ E;  2K48 A;  4KBM B;  3QC9 A;  1NWM X;  4NUV A;  4UV8 B;  3N9L A;  2C5K T;  1WYC A;  5JDM A;  4L0R A;  5HYA A;  3H37 A;  1LVF A;  2CWY A;  2DHR A;  5LP6 E;  2LOS A;  2DNX A;  3CX7 B;  1BR0 A;  1VOM A;  2XAQ B;  3AA6 B;  3O9X A;  1S35 A;  1MIV A;  3N9P A;  5ADX L;  5FP3 A;  3C64 A;  3EDU A;  4JEU B;  3IHR A;  4EYU A;  3OJA A;  4KUM B;  4IE4 A;  4F6R C;  2VKH A;  2I59 A;  3ZPO A;  3ZMU B;  5EK3 A;  3O1J A;  1HG2 A;  3LFM A;  4PK5 A;  3W15 B;  2CXD A;  4UF0 B;  4I43 B;  4GYR A;  4TV8 E;  2RA1 A;  4O4L E;  4I50 E;  3CQX C;  3KFW X;  3B57 A;  4GIW A;  4OYJ A;  2J1D G;  3KIN B;  4YJ3 E;  3NZP A;  4X1K E;  3N2G E;  4U72 A;  3CKD A;  4E7Z A;  2V1D B;  1CUN A;  3Q5X A;  2CE7 A;  5A1L A;  2WMN A;  3VKH A;  4H63 H;  5JDL A;  3ZC1 A;  2H3R A;  4EZ4 A;  1YW0 A;  3HKB E;  2X51 A;  3LJC A;  4B6X A;  5GON E;  1E1H B;  4G63 A;  2E9X C;  3ZN0 B;  3BQI A;  5LBQ B;  4KMC A;  5HXE A;  1MMN A;  2BZB A;  2BDE A;  4JLE A;  4UIG A;  2E9X D;  5DAB A;  3D0T A;  2ZM8 A;  4O4J E;  5DQV A;  1ZEE A;  2IAK A;  4BAY B;  5HWY A;  2XAF B;  4MAL A;  1G8X A;  2V7L A;  4EXT A;  2K9A A;  5FXV A;  1HCI A;  4DO0 A;  1MIW A;  4ADZ A;  4PAG A;  5LGN B;  5FNV E;  5L3D B;  2VKD A;  1BR2 A;  4TN7 B;  3UT5 E;  2VL8 A;  3BK9 A;  4BA9 A;  4H63 V;  3J9X 1;  4YLH A;  2A3D A;  2Q9Q A;  3R84 B;  1WLX A;  4V1A v;  1H7C A;  3DP7 A;  3I1A A;  4WBO A;  5HAX A;  1WRD A;  4XBF B;  1LVK A;  5JR9 C;  3CX6 B;  3HI2 A;  2JRK A;  4EAH A;  4OFZ A;  4DMW A;  3LK3 B;  5L3C B;  4H9Q C;  3I9Y A;  2QA7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...