2LOSA

Backbone structure of human membrane protein tmem14c
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
112
structure length
112
Chain Sequence
b'MQDTSSVVPLHWFGFGYAALVASGGIIGYVKAGSVPSLAAGLLFGSLAGLGAYQLSQDPRNVWVFLATSGTLAGIMGMRFYHSGKFMPAGLIAGASLLMVAKVGVSMFNRPH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transmembrane protein 14C
publication title Facile backbone structure determination of human membrane proteins by NMR spectroscopy.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Membrane protein
total genus 29
structure length 112
sequence length 112
ec nomenclature
pdb deposition date 2012-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03647 Tmemb_14 Transmembrane proteins 14C
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1140 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2losA00
2LOSA 2LOPA
chains in the Genus database with same CATH superfamily
1FMVA 4EEBA 4DV4T 3PDYA 4HFBA 4F8HA 4HFIA 5C8YE 3CVRA 1IZNB 3AEBA 2C5KT 2WAUA 4Q25A 2QA7A 3FXDB 4LF6T 5BMVE 3UULA 3RLFF 4ILAA 4DVDA 5J1GA 3CPZA 4U72A 2HHHT 3C4XA 4KMCA 5KDMC 2Q9QC 2W67A 3ABVA 5C3JA 3IEEA 2WZHA 2X0LB 2YK0A 3AE8A 4DR4T 3C4WA 2YINA 2EHOC 3U3IA 1LVKA 4X20E 5CJ5A 2X51A 4QX7B 3UQ7A 3TLWA 3AE2A 2HH7A 2E9XC 5JH7E 3OTOT 4BA9A 2XQ3A 2CHNA 4WW0A 1M62A 3CQCB 5AQNB 2BVMA 2QGSA 1HFAA 1R8IA 1J5ET 3FZLB 4ZOLE 1I6ZA 4GK0E 2WBLA 4KUMB 1NEKA 2XQ7A 1EZ3A 2WDRA 2ZM8A 3FZFB 3IBPA 3JAFA 2XM2A 2CPTA 3OKQA 5LGUB 2KT9A 3NVOA 4P0AA 5JRCB 4G2AA 3V5SA 1WYBA 2XQ9A 2R6GF 4YJ3E 3ONLC 2JJ9A 2W61A 4KI0F 2ZM0A 5AQGB 3O9XA 3KV4A 1G8XA 4LMLA 3SRZA 2E5VA 4HE8A 4ZI2D 5CGMA 3UU5A 2X0YA 2NW9A 1CHUA 3C50A 2QRXA 3DP7A 3NKZA 4AQGA 2J1DG 5DABA 2JMHA 4WNKA 1HX8A 3QOFA 1XDOA 3UUMA 2VKJA 3NRXA 5JDMA 5DQWA 5FL0A 2OV9A 4QH1A 5LBMA 1WFDA 3ZYMA 2WU2A 5ABFB 3AA6B 2VK9A 3E22E 2IW5B 4IDOA 5JTGA 2IMLA 4JEUB 3HL6A 2YDQA 1KNRA 3RH3A 3RYCE 4LF7T 4PFPA 4TZ4C 5AQSB 4JI6T 1VOMA 4B3RT 4CXWA 1N34T 3P50A 3RX6A 5LXTE 2QYWA 2RPAA 2V8SV 5L2LA 4DV1T 3UT5E 4U74A 2JQHA 4HFVA 5AQMB 2NOXA 5CA0E 2IIUA 3TLUA 1J5WA 3OBVE 3K3QC 3J7Yq 2MAWA 5LBQB 4PAGA 1AJ3A 2CE7A 3FZKB 1WCRA 2Q9QD 3AE9A 4UIGA 5EK4A 5ETWA 4ERRA 3C64A 2CEAA 4CQIA 2L8KA 3HKEE 5CA1E 2EHOD 4LFAT 2XJ7A 1IJ5A 4H9SE 4HKAA 2XASB 4IE0A 4EZ4A 2M6BA 3HKDE 3QC9A 2E9XD 4EZHA 3UQ4A 2X66A 4LF8T 4H9NC 3EI0A 4GYRA 3N9QA 3ZSSA 3W15B 5HXHA 2JQKA 4O4HE 4X66T 1Z8UA 5LGNB 2BKOA 2I0MA 4LMKA 2AXDS 5J2TE 3BK9A 4AQFC 4LF9T 4CI1B 3MKDA 5JDFA 2W66A 4AISA 1UURA 2CXLA 2J62A 4ZZCA 2XTLA 3N2GE 3PUVF 1E7PA 4DV0T 2VURA 5LNKA 3ZKRA 2ODUA 2Y48B 3B57A 2XQ4A 2VB6A 3F57A 3TKLB 2A3DA 3RC8A 2VVSA 3P8CD 3PJAA 1FEWA 2JIWA 2W62A 3RYIE 2KMFA 5FKYA 2LJLA 5HEGA 3N9MA 4DV5T 3RGLA 3BQLA 2KXPB 4XAXB 3ZMUB 2K9AA 2K5BB 5FNVE 3P4PA 2XHEB 3UTKA 3K1SA 3AEAA 3CX6B 2LRLA 2UXDT 2H88A 2FJDA 2ACXA 4EGWA 1D0YA 1IBLT 3Q2MA 2NTXA 3ETUA 4CXXA 4XBFB 3AAEB 4IDZA 4U2ZA 1U5PA 4LMJA 1O3XA 3KVBA 4U7IA 1E2AA 2IDOB 2E9XB 3VRAA 3ZCJA 3UU4A 4WYVA 2CWYA 2CXFA 4MFRA 4K0UA 5HAXA 3LK42 5J0ZA 3C51A 2B76A 2SPCA 3Q5XA 3H37A 5AQUB 3KV5A 5L47A 1MIWA 4H9QC 5DQVA 2V7IA 4OFZA 3Q5WA 3AE5A 2CA5A 2KSRA 2XSAA 5JR9A 4B3ST 2A2FX 5FXVA 5BR8T 2LSKA 1W0BA 4ANJA 3PUGA 2MBGA 1Y64B 2CWOA 3PUAA 5LP6E 2FBWA 4DBQA 4AKLA 2NW8A 5IWAT 1OWAA 5M4YA 4G63A 2WDVA 5JDNA 4PW8A 5FXXA 4TUYE 3C4ZA 3NZPA 2XQ6A 3CQXC 4LFCT 3LBXB 3EDVA 2CHOA 4JI1T 3ZMVB 4YTPA 3O1JA 4OHFA 2X9XA 3IF8B 4TNWA 3RYFE 3PU8A 3M3ZB 2A72A 4P1NA 5HEOA 4IDNA 2X68A 4FJOA 3PU3A 3QK6A 4DMWA 4ZS2A 2W4XA 3P4WA 3J9X1 3UUXB 2IHR1 1KFYA 4MALA 2CCQA 3EUHA 1T7SA 3MJXA 2WCAA 2WP9A 4P09A 4UV9B 4UXNB 5AFUL 5L4EA 3ZT7A 1JNZA 2BZBA 4I4TE 2YU2A 2YN6A 3ZN0B 2X0HA 3A7MA 5JDLA 3RQWA 5HXEA 2PG8A 2XAQB 3U78A 2FUPA 1WRDA 3GA8A 2FJEA 2XQAA 5EZYE 5HXCA 3PUSA 2BG9E 2LSGA 1D1BA 3OYZA 4NUVA 2IC9A 4O4LE 4ISSA 4HWIB 4QX8B 4IHJE 4EOZB 3F2EA 5JR9B 3ZJ1A 5AQKB 2ZLYA 2YDSA 2VQET 4YFSA 1NWMX 2BDEA 5AQHB 4AKGA 3CQGB 5HXRA 2XPKA 1NAFA 1M7KA 4IE5A 2BG9A 2YDRA 4ZI7E 3M65A 3ANWB 4Z8XA 3OJAA 3RI5A 3NWIA 4GK5E 5E0OA 1LRZA 3RC3A 1UK5A 3HA4A 2V6YA 2JQ9A 3AEEA 5LJNA 2CRBA 4DV7T 3PTRB 2PTFA 3H3MA 3N9NA 4A97A 2LSJA 2BBJA 2V7MA 2WMOA 4HWCA 5LA6E 3PUXF 4AQYT 1WR0A 4DMVA 1CUNA 3CX7B 4PJMA 5AQTB 1JNRA 4YTMA 3FZMB 4MLKA 4HWFA 3A8YC 5LMNT 2VQFT 4IDPA 4KP3C 4QXBB 3KDSE 3RIAA 3JADA 5FYMA 4UR9A 2DL1A 1B7TA 4IL4A 2WDQA 5JQGE 1IAPA 4FI5A 2N9DA 4UF0A 4EYUA 4DR7T 3SS1A 5JDGA 5LHHB 2D0UA 4HFEA 2VL8A 5FY7A 4ZI3D 5F3JA 3EAMA 2LLYA 4X65T 1HX1B 4QH4A 1W0AA 3MACA 5LGTB 4JI2T 1HTJF 3UUNA 5AQVB 1G73A 3P4RA 2X9HA 1HNWT 4KHZF 2UXXB 5AQQB 2KLQA 5L3GB 5HEJA 3NRYA 5IUXA 3K3NA 4U31A 5FMNA 4C91A 2RP4A 2L9QA 3AE6A 3OVUA 1OEDE 2WWUA 4U33A 1MMAA 3ZN1B 3ZC1A 4COFA 1HCIA 2XAHB 5AQRB 4DV2T 4EYYR 5HYAA 3UU3A 2NR4A 3VKGA 4DR2T 3E0ZA 4X1YE 2LM2A 4H9PC 2BG9B 4DBRA 4ASKA 1W09A 2E8IA 3K3OA 4QH5A 3QNUA 1IJ6A 1OEDA 1YQ3A 5ABGA 5JR9C 3IA3A 2V6YB 3VU7H 5EK3A 2P9BA 3HI2A 4O2BE 2JPFA 5LB7B 2H7VC 4TV9E 1YKHB 5ADXL 2KINB 2JQQA 2V26A 3Q5EA 3QB5K 4AIUA 2UUAT 1XZYA 3ZLIA 1W9RA 4ZXLA 4QXCB 4KBMB 1MNEA 5FVLA 5LG4A 2BKNA 4OX9T 3AEDA 2X67A 2I59A 3RIUC 3O1IA 1WYCA 1X79A 3ONJA 1XDPA 4ILCA 2LKHA 2WB5A 2VVNA 5JDQA 4KX6A 2CM0A 3CKDA 3UU8A 2LKGA 2V7LA 2XY8B 4ISTA 5AQLB 3R84B 5F8PA 3MZKB 4DIDB 3HR0A 4U2YA 3ESLA 4X1IE 3GN5A 3H3AA 4EIWA 2HN2A 3PUYF 2OA5A 4H63H 3AA1B 3KVAA 3I9WA 5FXZA 2CXDA 4ADZA 1HG5A 2FJAA 4ILUA 2XZEA 2XAGB 2LEHA 1X9BA 2C5JA 4I55E 2V7KA 5H6QB 3RYHE 2YEVC 2Z6EA 4A56A 1OXZA 5KX5E 4YY3T 1S94A 2JRKA 4EXTA 2D5UA 2C5IT 3L39A 3N5LA 4QWNB 4HWHA 3FHNA 4ZZBA 3PUQA 5AQIB 3SFEA 4ILBA 2GK9A 3ZMZB 3UFGA 3I1AA 4UELA 3AECA 3PE0A 1S35A 4V1Av 4CI3B 3N2OA 4UEMA 2XAFB 1OEDB 4MBQA 3CIRA 2K24A 4CN4A 4U7YA 2H3RA 1I94T 5ABEA 2DWGA 2C0SA 1UX4A 3I9YA 2ES0A 4OK0A 4O2AE 4CZZB 3AA0B 4WZXA 4NXMT 2WU5A 3AB3B 2BG9C 1YD8G 2WZIA 3E08A 2WM9A 4CN6A 4DNDA 3UUBA 1HNZT 3NZQA 4ZEYA 2A9UA 4CI2B 3VHLA 3TLVA 2N1GA 1YXRA 5HWXA 3RKGA 4YT0A 4IREA 4JI0T 5LCYA 4QXHB 3KV6A 4CXYA 2KNDA 3GWHA 1UGOA 2DHRA 4PNIA 3AVRA 4LF4T 3P4SA 4L9IA 4JI4T 2UXCT 4JLEA 3ZC0A 3AA7B 1XNRT 3CWZB 5ABHA 3EDUA 3RQUA 4ZI3C 2KZ7B 5KXJA 4H9OC 4I43B 3QUJA 1Y01A 2CLYC 2I6HA 2VKHA 1KEYA 3LDQB 5HXSA 4YJ2E 5LHIB 4EB6E 3RRCA 2D0TA 2VKDA 4IL9A 4BJMA 4TX5A 2K3WA 3KBUA 4AKRB 1ZEEA 3L8RA 3LK2B 3NBXX 4M1PA 3ZT6A 3UU6A 4AKHA 1T98A 4B3MT 2MPKA 3LSVA 2CMRA 2DI4A 2Y8DA 1IBMT 1KF6A 1FMWA 5GONE 1ZHCA 2BBHA 1VCSA 4UVCB 4PJLA 3PJAJ 3AE1A 5FY1A 1ZOYA 2N2NA 5J2UE 2NWBA 1SUMB 1NENA 3RF1A 1BR1A 3FB2A 2WWVA 5KMGP 4YLHA 3B5MA 4E7ZA 1MIVA 1L0VA 4GKJT 5JDHA 4UVBB 2PBIA 3HKCE 1HR0T 1XMQT 4HFDA 5AQFB 3KFWX 4XZCA 1OEDC 1IBKT 4PJJA 5AQPB 1UUSA 1HG2A 3TLSA 2D9DA 3PURA 1LKXA 2UU9T 1XNQT 4O4IE 4F6RC 3SWHA 2BS4A 4X62T 3HKBE 4KHPT 2OLTA 4OYJA 4C90A 1H7CA 1V9DA 2E2AA 5ABFA 5HCMA 2XM1A 1MMNA 5FP3A 2VL0A 1MMGA 4GOUA 4EV6A 4HTEA 2ZM6T 2LHRA 4IGUA 1ZP0A 4I0UA 4TWFA 4L0RA 5L3BB 2BVLA 2BS2A 2HPJA 1D1CA 4K0KT 3JC6D 1D0ZA 5LHGB 4X5TA 2Y6XA 1ZV4X 2LM9A 4O4JE 2WY2A 3RHWA 2XQ8A 3O4XE 2XQYA 3MA9A 4X64T 4MHCA 3RRWA 4GKKT 3AAIA 2UXBT 3ZCIA 1LVFA 2G0UA 3ZMTB 3KBTA 2B1EA 2LRKA 2V7JA 1VRBA 4E7SA 4AXPA 3ZMSB 3MK7C 3SFDA 1YQ4A 3UFEA 3KINB 5EK2A 3CK6A 3K8PC 5JREA 1WR6A 3VKHA 2WMNA 1UX5A 4JBWF 2L3LA 4WBNE 5F5WA 3N9OA 2XUEA 4PK5A 3O1HA 1SE7A 3T1YT 3JAEA 4UV8B 5LMUT 4IDQA 2D2SA 3SOLA 3R6NA 2LOPA 3MXZA 1SA0E 2HPLA 1D1AA 2BS3A 5FXWA 1E1HB 3N9LA 5A1LA 4L5GA 3CMLA 5LJMA 5DJQC 2YOEA 5CB4E 1MMDA 5AQOB 4TNVA 3VR9A 2H7OA 2WQYA 1XWMA 5H6RB 3L3PA 2QVAA 1QSDA 2V5DA 4DR3T 4J2CA 2MTQA 2MOZA 5IHYA 1MIYA 4O8SA 1MNDA 2UUCT 4YHJA 3AE7A 3ZT5A 2M67A 2BKPA 2YU1A 2KWHA 1UCUA 1YKEB 2M6IA 3D0TA 3OPCA 4NXNT 5FL1A 2DWKA 4NUUA 4JI7T 4B3TT 3ETVA 4IE4A 1U4QA 3EVYA 1N36T 5FVKA 3C98B 5AQJB 4DUYT 4GYSA 2V1DB 5JVDE 1BR2A 3ZJ2A 3PUWF 3AVSA 2Q9QA 4DR6T 3I0QA 4LF5T 5FY0A 3G06A 4BAYB 4DR5T 2ODVA 4HEAA 3X1DA 2EHOA 2LE8A 3L09A 1QUUA 2YKSA 3AEGA 1J1JA 5C2TA 3T1HT 2VKOA 4BJNA 2W2UA 4WBOA 2XSBA 2E9XA 4H63V 2CLYB 2NW7A 5IYZE 4UF0B 4DO0A 3FBZA 4YXDA 4QHOA 3GMIA 2XAJB 2DNXA 5HCJA 3P4QA 4Z91A 4DV6T 3DJBA 3I0OA 4JV5T 4Z90A 3AXJA 2IAKA 4JI5T 3N9PA 4TWDA 4TV8E 2X9WA 3N2KE 4N78D 3WAKA 1BR4A 5L3EB 3EABA 3B13A 3ONXA 3ZEFB 3VRBA 4TWHA 4GIWA 2WS3A 1KNZA 2JMKA 2PFVA 3KV9A 5LG3A 4AI6A 1KNPA 2V5CA 2W63A 2MYSA 2HN1A 3P7IA 1HS7A 4U3CA 3AE4A 4EEDA 3LJCA 4TN7B 4UVAB 3LBXA 1BR0A 2VASA 1FJGT 3AE3A 3JCFA 4ZHQE 1HF8A 1Z0PA 2CBJA 1XMOT 4YSXA 5L3CB 3T8OA 4HFCA 3JC6C 4HFHA 2UXNB 3PV0F 3A5XA 2J47A 3WAJA 1T72A 4HN9A 2PJQA 2Q9QB 4OYKA 4QKNA 4P0BA 2H89A 2XQ5A 4PK4A 2J4GA 4JI8T 4AKIA 2WSSV 3RIFA 5HWYA 1ZKEA 1N32T 2EHOB 4JUYA 4DUZT 1VCTA 5LYJE 4IE6A 1KK7A 1DU2A 3Q9DA 3RPUA 3LG7A 2UUBT 4B6XA 2FJBA 4IT4A 2V6XA 4PJNA 3PUZF 2IUBA 1WLXA 3ZSTA 4DV3T 4IE7A 3FZHB 3TLTA 3RKOA 2K48A 5L4HA 4DR1T 2ACZA 5TAOA 2W00A 4YSYA 3S4UA 2W0GA 4HWDA 3LK3B 2DCFA 2DLRA 2LSIA 5HEUA 2IC6A 3CX8B 2NTYA 3GN5B 4CN1A 2LT3A 1YW0A 2X9YA 3AXJB 1US7B 3AAAB 3IHRA 3EHZA 1HNXT 4A5XA 4YTNA 3ZPOA 3FXEB 4ZI2C 2E5LT 2RA1A 2F4VT 1N33T 4JYAT 2LHNA 3DTOA 3ZYKA 1QLBA 4EAHA 4YHHT 1T8BA 1D0XA 2KWIB 4PK6A 4A98A 5HEHA 3ANWA 2ZM2A 2ZMAA 4NIQA 4I50E 3RIUA 2VWAA 3FBLA 3AEFA 3ZYLA 3BQKA 5L3FB 1FIOA 4NPPA 4H9RC 4X1KE 3BQIA 3WI3A 4ZS3A 4IIJE 2LOSA 5L3DB 3OYXA 1GQEA 3F31A 4JI3T 3Q5DA 5JRCA 2LSYA 4JEHB 5LOVE 1SHZC 2AE9A 3QB5A 2NP9A 3VR8A 2CBIA 4LFBT 3V5UA 5CFBA 4AQFA 4YSZA 3LFMA 4PFOA 4HGAA
chains in the Genus database with same CATH topology
1U5PA 1FMVA 1O3XA 2X67A 1WR6A 2I59A 3KVBA 3PDYA 3VKHA 3O1IA 1WYCA 2WMNA 1UX5A 5C8YE 2E9XB 3ZCJA 3CVRA 1IZNB 1X79A 2CWYA 2CXFA 4MFRA 2L3LA 4K0UA 4WBNE 2C5KT 2WAUA 5HAXA 3LK42 2QA7A 3FXDB 5JDQA 3N9OA 2XUEA 2CM0A 3CKDA 4PK5A 2V7LA 3C51A 4ISTA 2SPCA 5BMVE 3Q5XA 3UULA 3R84B 3H37A 3O1HA 4DVDA 5J1GA 3KV5A 3CPZA 5F8PA 3MZKB 3HR0A 1MIWA 4U72A 3ESLA 4UV8B 3C4XA 4KMCA 5KDMC 4H9QC 2D2SA 3SOLA 3R6NA 2Q9QC 5DQVA 4X1IE 2V7IA 3GN5A 4OFZA 2LOPA 3IEEA 3MXZA 1SA0E 3Q5WA 2X0LB 2YK0A 3H3AA 4EIWA 2CA5A 2HPLA 3C4WA 1D1AA 2OA5A 2YINA 4H63H 3AA1B 5JR9A 5FXWA 3KVAA 2EHOC 1E1HB 2A2FX 3U3IA 3I9WA 3N9LA 5FXZA 5FXVA 1LVKA 2CXDA 4X20E 5A1LA 4L5GA 4ADZA 2LSKA 1HG5A 3CMLA 2X51A 4ANJA 5LJMA 3PUGA 5DJQC 2MBGA 1Y64B 2CWOA 3PUAA 4QX7B 5LP6E 4ILUA 5CB4E 1MMDA 2XAGB 2LEHA 2H7OA 4DBQA 2C5JA 2HH7A 2E9XC 4I55E 5H6RB 4AKLA 5JH7E 3L3PA 2NW8A 2V7KA 1OWAA 5H6QB 5M4YA 3RYHE 1QSDA 2YEVC 2Z6EA 4G63A 4A56A 4J2CA 2MTQA 1OXZA 5JDNA 2MOZA 5IHYA 1MIYA 4PW8A 5FXXA 5KX5E 4O8SA 4TUYE 4BA9A 3C4ZA 3NZPA 1MNDA 4YHJA 1S94A 2JRKA 4EXTA 2D5UA 2M67A 2YU1A 4WW0A 2C5IT 3CQXC 3CQCB 3N5LA 2KWHA 4QWNB 2BVMA 3LBXB 2QGSA 1HFAA 3EDVA 1UCUA 1YKEB 3D0TA 3FHNA 3PUQA 4ZOLE 3ZMVB 4GK0E 3O1JA 4OHFA 2X9XA 2DWKA 3IF8B 2GK9A 2WBLA 4NUUA 3PU8A 3RYFE 3ZMZB 4KUMB 3I1AA 4UELA 3PE0A 1EZ3A 1S35A 2A72A 4V1Av 3ETVA 4IE4A 2ZM8A 4CI3B 1U4QA 2X68A 3EVYA 3N2OA 3IBPA 4UEMA 2XAFB 4FJOA 3C98B 3PU3A 3OKQA 3QK6A 4GYSA 2V1DB 4MBQA 1BR2A 5JVDE 3ZJ2A 4DMWA 2K24A 3AVSA 5LGUB 4ZS2A 2Q9QA 3J9X1 3UUXB 2H3RA 3I0QA 4MALA 2DWGA 2CCQA 2KT9A 2C0SA 3EUHA 5FY0A 4P0AA 4BAYB 5JRCB 1UX4A 3MJXA 4G2AA 3I9YA 2ES0A 3V5SA 4P09A 2ODVA 1WYBA 4O2AE 4HEAA 4OK0A 4UV9B 2EHOA 2LE8A 3L09A 4CZZB 3AA0B 4UXNB 1QUUA 5AFUL 4YJ3E 5JREA 2JJ9A 3AB3B 2W61A 2ZM0A 1YD8G 3E08A 2BZBA 2VKOA 4I4TE 2YU2A 4BJNA 3O9XA 2WM9A 3KV4A 4WBOA 2E9XA 4H63V 4DNDA 2CLYB 1G8XA 2NW7A 5IYZE 3SRZA 3ZN0B 4UF0B 4DO0A 3FBZA 3NZQA 5JDLA 4QHOA 4CI2B 3VHLA 5HXEA 3GMIA 4HE8A 2XAJB 2N1GA 4ZI2D 2DNXA 5HWXA 2NW9A 2PG8A 2XAQB 3U78A 5LCYA 3C50A 3DP7A 4AQGA 2J1DG 1WRDA 3GA8A 4QXHB 5DABA 3KV6A 2JMHA 2KNDA 3DJBA 4CXYA 3GWHA 3I0OA 4WNKA 5EZYE 5HXCA 1HX8A 2DHRA 3PUSA 4PNIA 3AVRA 3UUMA 2VKJA 3NRXA 5JDMA 2IAKA 3N9PA 4L9IA 2LSGA 4TV8E 2X9WA 3N2KE 1D1BA 4N78D 3WAKA 3OYZA 4NUVA 2IC9A 4JLEA 4O4LE 3ZC0A 3AA7B 4ISSA 3CWZB 5DQWA 4QX8B 1BR4A 4IHJE 5L3EB 4EOZB 3EDUA 5LBMA 3B13A 3F2EA 4ZI3C 3ZJ1A 5JR9B 2KZ7B 3ONXA 3ZEFB 3ZYMA 2ZLYA 4GIWA 4H9OC 4I43B 3AA6B 3QUJA 1NWMX 4YFSA 2BDEA 2CLYC 2VK9A 3E22E 1KNZA 2JMKA 2IW5B 2VKHA 2PFVA 3KV9A 4AI6A 4JEUB 2W63A 5HXSA 2MYSA 4YJ2E 3P7IA 3HL6A 5LHIB 4AKGA 1HS7A 3CQGB 5HXRA 4EB6E 1NAFA 3RH3A 2D0TA 3RRCA 2VKDA 3RYCE 4PFPA 4IE5A 4BJMA 4TZ4C 4ZI7E 3M65A 3ANWB 4TX5A 3LJCA 4TN7B 4Z8XA 4UVAB 3LBXA 1BR0A 1VOMA 2VASA 3OJAA 3KBUA 4AKRB 4GK5E 1ZEEA 4CXWA 5E0OA 3RX6A 5LXTE 1LRZA 3RC3A 3HA4A 5LJNA 3LK2B 3NBXX 4M1PA 3PTRB 5L2LA 4AKHA 1T98A 3UT5E 3N9NA 4U74A 4ZHQE 1HF8A 2CMRA 2DI4A 2Y8DA 1Z0PA 4HFVA 2LSJA 2NOXA 2V7MA 2WMOA 5CA0E 1FMWA 5GONE 5L3CB 5LA6E 3T8OA 1ZHCA 3JC6C 4DMVA 4UVCB 1CUNA 2UXNB 3CX7B 4PJMA 3OBVE 4PJLA 3A5XA 3K3QC 3J7Yq 3WAJA 4MLKA 5LBQB 4PAGA 1AJ3A 4HN9A 2PJQA 2Q9QB 4OYKA 4QKNA 4KP3C 4P0BA 4QXBB 2N2NA 2CE7A 5FY1A 3KDSE 5J2UE 2NWBA 4PK4A 4AKIA 2WSSV 1BR1A 5HWYA 3FB2A 5FYMA 2Q9QD 1ZKEA 5KMGP 4UIGA 1B7TA 5EK4A 5ETWA 4YLHA 2EHOB 4JUYA 4ERRA 5LYJE 4IE6A 3C64A 4E7ZA 2CEAA 4CQIA 5JQGE 1IAPA 1KK7A 4FI5A 1MIVA 2N9DA 2L8KA 3HKEE 3Q9DA 3RPUA 3LG7A 5CA1E 2EHOD 4B6XA 4UF0A 4EYUA 5JDHA 1IJ5A 4PJNA 3SS1A 4UVBB 2PBIA 1WLXA 4H9SE 5JDGA 3HKCE 4HKAA 5LHHB 2XASB 4IE0A 4IE7A 2D0UA 4EZ4A 2VL8A 3KFWX 3HKDE 4XZCA 5FY7A 4ZI3D 5F3JA 3QC9A 3RKOA 2K48A 2E9XD 4EZHA 5TAOA 4PJJA 2W00A 2X66A 1HG2A 3MACA 4H9NC 5LGTB 4GYRA 3S4UA 1HTJF 3UUNA 2W0GA 3N9QA 3PURA 3W15B 5HXHA 3LK3B 2DCFA 2DLRA 2LSIA 2IC6A 4O4HE 3CX8B 1G73A 2NTYA 2X9HA 3GN5B 1LKXA 5LGNB 2UXXB 2LT3A 2KLQA 4O4IE 5L3GB 1YW0A 4F6RC 2X9YA 1US7B 3SWHA 3AAAB 3NRYA 5J2TE 3BK9A 3K3NA 3IHRA 3HKBE 4AQFC 5FMNA 4CI1B 4OYJA 4C91A 4C90A 1H7CA 2RP4A 1V9DA 2L9QA 3MKDA 5JDFA 3ZPOA 3FXEB 2WWUA 2CXLA 4ZI2C 1MMAA 2RA1A 2XTLA 3N2GE 1MMNA 2LHNA 3DTOA 3ZYKA 3ZN1B 5FP3A 5LNKA 4EAHA 3ZC1A 1MMGA 2ODUA 2Y48B 3B57A 4GOUA 4HTEA 2LHRA 2VB6A 3F57A 3TKLB 1D0XA 1HCIA 2XAHB 2A3DA 2KWIB 4IGUA 3RC8A 3P8CD 4EYYR 4PK6A 1FEWA 4L0RA 5HYAA 2W62A 5L3BB 2BVLA 2HPJA 3ANWA 3RYIE 1D1CA 3VKGA 3JC6D 1D0ZA 2KMFA 2ZM2A 2ZMAA 5LHGB 3E0ZA 4X1YE 2LJLA 2Y6XA 4I50E 1ZV4X 3N9MA 4H9PC 2LM9A 4O4JE 2VWAA 3FBLA 4DBRA 4ASKA 3ZYLA 3BQKA 2E8IA 5L3FB 3K3OA 3BQLA 1FIOA 2KXPB 4H9RC 3O4XE 2XQYA 3MA9A 4XAXB 4X1KE 3BQIA 3WI3A 3ZMUB 2K9AA 4ZS3A 1IJ6A 2K5BB 5FNVE 4IIJE 4MHCA 2XHEB 5JR9C 3RRWA 2LOSA 3UTKA 5L3DB 3VU7H 3OYXA 3AAIA 5EK3A 2P9BA 3CX6B 3HI2A 4O2BE 2JPFA 3F31A 3ZCIA 1LVFA 2H7VC 4TV9E 1YKHB 5JRCA 2G0UA 2LSYA 5ADXL 4JEHB 3ZMTB 5LOVE 2KINB 3KBTA 1SHZC 2B1EA 2JQQA 2ACXA 2V26A 2V7JA 2NP9A 1D0YA 1VRBA 4E7SA 3ZLIA 4AXPA 3ZMSB 3Q2MA 4QXCB 4KBMB 3MK7C 3V5UA 2NTXA 1MNEA 3ETUA 4AQFA 3UFEA 4CXXA 3KINB 4XBFB 3LFMA 5EK2A 3AAEB 5LG4A 4PFOA 3K8PC 4HGAA 4IDZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LOS A;  2LOP A; 
#chains in the Genus database with same CATH topology
 1FMV A;  4EEB A;  4DV4 T;  3PDY A;  4HFB A;  4F8H A;  4HFI A;  5C8Y E;  3CVR A;  1IZN B;  3AEB A;  2C5K T;  2WAU A;  4Q25 A;  2QA7 A;  3FXD B;  4LF6 T;  5BMV E;  3UUL A;  3RLF F;  4ILA A;  4DVD A;  5J1G A;  3CPZ A;  4U72 A;  2HHH T;  3C4X A;  4KMC A;  5KDM C;  2Q9Q C;  2W67 A;  3ABV A;  5C3J A;  3IEE A;  2WZH A;  2X0L B;  2YK0 A;  3AE8 A;  4DR4 T;  3C4W A;  2YIN A;  2EHO C;  3U3I A;  1LVK A;  4X20 E;  5CJ5 A;  2X51 A;  4QX7 B;  3UQ7 A;  3TLW A;  3AE2 A;  2HH7 A;  2E9X C;  5JH7 E;  3OTO T;  4BA9 A;  2XQ3 A;  2CHN A;  4WW0 A;  1M62 A;  3CQC B;  5AQN B;  2BVM A;  2QGS A;  1HFA A;  1R8I A;  1J5E T;  3FZL B;  4ZOL E;  1I6Z A;  4GK0 E;  2WBL A;  4KUM B;  1NEK A;  2XQ7 A;  1EZ3 A;  2WDR A;  2ZM8 A;  3FZF B;  3IBP A;  3JAF A;  2XM2 A;  2CPT A;  3OKQ A;  5LGU B;  2KT9 A;  3NVO A;  4P0A A;  5JRC B;  4G2A A;  3V5S A;  1WYB A;  2XQ9 A;  2R6G F;  4YJ3 E;  3ONL C;  2JJ9 A;  2W61 A;  4KI0 F;  2ZM0 A;  5AQG B;  3O9X A;  3KV4 A;  1G8X A;  4LML A;  3SRZ A;  2E5V A;  4HE8 A;  4ZI2 D;  5CGM A;  3UU5 A;  2X0Y A;  2NW9 A;  1CHU A;  3C50 A;  2QRX A;  3DP7 A;  3NKZ A;  4AQG A;  2J1D G;  5DAB A;  2JMH A;  4WNK A;  1HX8 A;  3QOF A;  1XDO A;  3UUM A;  2VKJ A;  3NRX A;  5JDM A;  5DQW A;  5FL0 A;  2OV9 A;  4QH1 A;  5LBM A;  1WFD A;  3ZYM A;  2WU2 A;  5ABF B;  3AA6 B;  2VK9 A;  3E22 E;  2IW5 B;  4IDO A;  5JTG A;  2IML A;  4JEU B;  3HL6 A;  2YDQ A;  1KNR A;  3RH3 A;  3RYC E;  4LF7 T;  4PFP A;  4TZ4 C;  5AQS B;  4JI6 T;  1VOM A;  4B3R T;  4CXW A;  1N34 T;  3P50 A;  3RX6 A;  5LXT E;  2QYW A;  2RPA A;  2V8S V;  5L2L A;  4DV1 T;  3UT5 E;  4U74 A;  2JQH A;  4HFV A;  5AQM B;  2NOX A;  5CA0 E;  2IIU A;  3TLU A;  1J5W A;  3OBV E;  3K3Q C;  3J7Y q;  2MAW A;  5LBQ B;  4PAG A;  1AJ3 A;  2CE7 A;  3FZK B;  1WCR A;  2Q9Q D;  3AE9 A;  4UIG A;  5EK4 A;  5ETW A;  4ERR A;  3C64 A;  2CEA A;  4CQI A;  2L8K A;  3HKE E;  5CA1 E;  2EHO D;  4LFA T;  2XJ7 A;  1IJ5 A;  4H9S E;  4HKA A;  2XAS B;  4IE0 A;  4EZ4 A;  2M6B A;  3HKD E;  3QC9 A;  2E9X D;  4EZH A;  3UQ4 A;  2X66 A;  4LF8 T;  4H9N C;  3EI0 A;  4GYR A;  3N9Q A;  3ZSS A;  3W15 B;  5HXH A;  2JQK A;  4O4H E;  4X66 T;  1Z8U A;  5LGN B;  2BKO A;  2I0M A;  4LMK A;  2AXD S;  5J2T E;  3BK9 A;  4AQF C;  4LF9 T;  4CI1 B;  3MKD A;  5JDF A;  2W66 A;  4AIS A;  1UUR A;  2CXL A;  2J62 A;  4ZZC A;  2XTL A;  3N2G E;  3PUV F;  1E7P A;  4DV0 T;  2VUR A;  5LNK A;  3ZKR A;  2ODU A;  2Y48 B;  3B57 A;  2XQ4 A;  2VB6 A;  3F57 A;  3TKL B;  2A3D A;  3RC8 A;  2VVS A;  3P8C D;  3PJA A;  1FEW A;  2JIW A;  2W62 A;  3RYI E;  2KMF A;  5FKY A;  2LJL A;  5HEG A;  3N9M A;  4DV5 T;  3RGL A;  3BQL A;  2KXP B;  4XAX B;  3ZMU B;  2K9A A;  2K5B B;  5FNV E;  3P4P A;  2XHE B;  3UTK A;  3K1S A;  3AEA A;  3CX6 B;  2LRL A;  2UXD T;  2H88 A;  2FJD A;  2ACX A;  4EGW A;  1D0Y A;  1IBL T;  3Q2M A;  2NTX A;  3ETU A;  4CXX A;  4XBF B;  3AAE B;  4IDZ A;  4U2Z A;  1U5P A;  4LMJ A;  1O3X A;  3KVB A;  4U7I A;  1E2A A;  2IDO B;  2E9X B;  3VRA A;  3ZCJ A;  3UU4 A;  4WYV A;  2CWY A;  2CXF A;  4MFR A;  4K0U A;  5HAX A;  3LK4 2;  5J0Z A;  3C51 A;  2B76 A;  2SPC A;  3Q5X A;  3H37 A;  5AQU B;  3KV5 A;  5L47 A;  1MIW A;  4H9Q C;  5DQV A;  2V7I A;  4OFZ A;  3Q5W A;  3AE5 A;  2CA5 A;  2KSR A;  2XSA A;  5JR9 A;  4B3S T;  2A2F X;  5FXV A;  5BR8 T;  2LSK A;  1W0B A;  4ANJ A;  3PUG A;  2MBG A;  1Y64 B;  2CWO A;  3PUA A;  5LP6 E;  2FBW A;  4DBQ A;  4AKL A;  2NW8 A;  5IWA T;  1OWA A;  5M4Y A;  4G63 A;  2WDV A;  5JDN A;  4PW8 A;  5FXX A;  4TUY E;  3C4Z A;  3NZP A;  2XQ6 A;  3CQX C;  4LFC T;  3LBX B;  3EDV A;  2CHO A;  4JI1 T;  3ZMV B;  4YTP A;  3O1J A;  4OHF A;  2X9X A;  3IF8 B;  4TNW A;  3RYF E;  3PU8 A;  3M3Z B;  2A72 A;  4P1N A;  5HEO A;  4IDN A;  2X68 A;  4FJO A;  3PU3 A;  3QK6 A;  4DMW A;  4ZS2 A;  2W4X A;  3P4W A;  3J9X 1;  3UUX B;  2IHR 1;  1KFY A;  4MAL A;  2CCQ A;  3EUH A;  1T7S A;  3MJX A;  2WCA A;  2WP9 A;  4P09 A;  4UV9 B;  4UXN B;  5AFU L;  5L4E A;  3ZT7 A;  1JNZ A;  2BZB A;  4I4T E;  2YU2 A;  2YN6 A;  3ZN0 B;  2X0H A;  3A7M A;  5JDL A;  3RQW A;  5HXE A;  2PG8 A;  2XAQ B;  3U78 A;  2FUP A;  1WRD A;  3GA8 A;  2FJE A;  2XQA A;  5EZY E;  5HXC A;  3PUS A;  2BG9 E;  2LSG A;  1D1B A;  3OYZ A;  4NUV A;  2IC9 A;  4O4L E;  4ISS A;  4HWI B;  4QX8 B;  4IHJ E;  4EOZ B;  3F2E A;  5JR9 B;  3ZJ1 A;  5AQK B;  2ZLY A;  2YDS A;  2VQE T;  4YFS A;  1NWM X;  2BDE A;  5AQH B;  4AKG A;  3CQG B;  5HXR A;  2XPK A;  1NAF A;  1M7K A;  4IE5 A;  2BG9 A;  2YDR A;  4ZI7 E;  3M65 A;  3ANW B;  4Z8X A;  3OJA A;  3RI5 A;  3NWI A;  4GK5 E;  5E0O A;  1LRZ A;  3RC3 A;  1UK5 A;  3HA4 A;  2V6Y A;  2JQ9 A;  3AEE A;  5LJN A;  2CRB A;  4DV7 T;  3PTR B;  2PTF A;  3H3M A;  3N9N A;  4A97 A;  2LSJ A;  2BBJ A;  2V7M A;  2WMO A;  4HWC A;  5LA6 E;  3PUX F;  4AQY T;  1WR0 A;  4DMV A;  1CUN A;  3CX7 B;  4PJM A;  5AQT B;  1JNR A;  4YTM A;  3FZM B;  4MLK A;  4HWF A;  3A8Y C;  5LMN T;  2VQF T;  4IDP A;  4KP3 C;  4QXB B;  3KDS E;  3RIA A;  3JAD A;  5FYM A;  4UR9 A;  2DL1 A;  1B7T A;  4IL4 A;  2WDQ A;  5JQG E;  1IAP A;  4FI5 A;  2N9D A;  4UF0 A;  4EYU A;  4DR7 T;  3SS1 A;  5JDG A;  5LHH B;  2D0U A;  4HFE A;  2VL8 A;  5FY7 A;  4ZI3 D;  5F3J A;  3EAM A;  2LLY A;  4X65 T;  1HX1 B;  4QH4 A;  1W0A A;  3MAC A;  5LGT B;  4JI2 T;  1HTJ F;  3UUN A;  5AQV B;  1G73 A;  3P4R A;  2X9H A;  1HNW T;  4KHZ F;  2UXX B;  5AQQ B;  2KLQ A;  5L3G B;  5HEJ A;  3NRY A;  5IUX A;  3K3N A;  4U31 A;  5FMN A;  4C91 A;  2RP4 A;  2L9Q A;  3AE6 A;  3OVU A;  1OED E;  2WWU A;  4U33 A;  1MMA A;  3ZN1 B;  3ZC1 A;  4COF A;  1HCI A;  2XAH B;  5AQR B;  4DV2 T;  4EYY R;  5HYA A;  3UU3 A;  2NR4 A;  3VKG A;  4DR2 T;  3E0Z A;  4X1Y E;  2LM2 A;  4H9P C;  2BG9 B;  4DBR A;  4ASK A;  1W09 A;  2E8I A;  3K3O A;  4QH5 A;  3QNU A;  1IJ6 A;  1OED A;  1YQ3 A;  5ABG A;  5JR9 C;  3IA3 A;  2V6Y B;  3VU7 H;  5EK3 A;  2P9B A;  3HI2 A;  4O2B E;  2JPF A;  5LB7 B;  2H7V C;  4TV9 E;  1YKH B;  5ADX L;  2KIN B;  2JQQ A;  2V26 A;  3Q5E A;  3QB5 K;  4AIU A;  2UUA T;  1XZY A;  3ZLI A;  1W9R A;  4ZXL A;  4QXC B;  4KBM B;  1MNE A;  5FVL A;  5LG4 A;  2BKN A;  4OX9 T;  3AED A;  2X67 A;  2I59 A;  3RIU C;  3O1I A;  1WYC A;  1X79 A;  3ONJ A;  1XDP A;  4ILC A;  2LKH A;  2WB5 A;  2VVN A;  5JDQ A;  4KX6 A;  2CM0 A;  3CKD A;  3UU8 A;  2LKG A;  2V7L A;  2XY8 B;  4IST A;  5AQL B;  3R84 B;  5F8P A;  3MZK B;  4DID B;  3HR0 A;  4U2Y A;  3ESL A;  4X1I E;  3GN5 A;  3H3A A;  4EIW A;  2HN2 A;  3PUY F;  2OA5 A;  4H63 H;  3AA1 B;  3KVA A;  3I9W A;  5FXZ A;  2CXD A;  4ADZ A;  1HG5 A;  2FJA A;  4ILU A;  2XZE A;  2XAG B;  2LEH A;  1X9B A;  2C5J A;  4I55 E;  2V7K A;  5H6Q B;  3RYH E;  2YEV C;  2Z6E A;  4A56 A;  1OXZ A;  5KX5 E;  4YY3 T;  1S94 A;  2JRK A;  4EXT A;  2D5U A;  2C5I T;  3L39 A;  3N5L A;  4QWN B;  4HWH A;  3FHN A;  4ZZB A;  3PUQ A;  5AQI B;  3SFE A;  4ILB A;  2GK9 A;  3ZMZ B;  3UFG A;  3I1A A;  4UEL A;  3AEC A;  3PE0 A;  1S35 A;  4V1A v;  4CI3 B;  3N2O A;  4UEM A;  2XAF B;  1OED B;  4MBQ A;  3CIR A;  2K24 A;  4CN4 A;  4U7Y A;  2H3R A;  1I94 T;  5ABE A;  2DWG A;  2C0S A;  1UX4 A;  3I9Y A;  2ES0 A;  4OK0 A;  4O2A E;  4CZZ B;  3AA0 B;  4WZX A;  4NXM T;  2WU5 A;  3AB3 B;  2BG9 C;  1YD8 G;  2WZI A;  3E08 A;  2WM9 A;  4CN6 A;  4DND A;  3UUB A;  1HNZ T;  3NZQ A;  4ZEY A;  2A9U A;  4CI2 B;  3VHL A;  3TLV A;  2N1G A;  1YXR A;  5HWX A;  3RKG A;  4YT0 A;  4IRE A;  4JI0 T;  5LCY A;  4QXH B;  3KV6 A;  4CXY A;  2KND A;  3GWH A;  1UGO A;  2DHR A;  4PNI A;  3AVR A;  4LF4 T;  3P4S A;  4L9I A;  4JI4 T;  2UXC T;  4JLE A;  3ZC0 A;  3AA7 B;  1XNR T;  3CWZ B;  5ABH A;  3EDU A;  3RQU A;  4ZI3 C;  2KZ7 B;  5KXJ A;  4H9O C;  4I43 B;  3QUJ A;  1Y01 A;  2CLY C;  2I6H A;  2VKH A;  1KEY A;  3LDQ B;  5HXS A;  4YJ2 E;  5LHI B;  4EB6 E;  3RRC A;  2D0T A;  2VKD A;  4IL9 A;  4BJM A;  4TX5 A;  2K3W A;  3KBU A;  4AKR B;  1ZEE A;  3L8R A;  3LK2 B;  3NBX X;  4M1P A;  3ZT6 A;  3UU6 A;  4AKH A;  1T98 A;  4B3M T;  2MPK A;  3LSV A;  2CMR A;  2DI4 A;  2Y8D A;  1IBM T;  1KF6 A;  1FMW A;  5GON E;  1ZHC A;  2BBH A;  1VCS A;  4UVC B;  4PJL A;  3PJA J;  3AE1 A;  5FY1 A;  1ZOY A;  2N2N A;  5J2U E;  2NWB A;  1SUM B;  1NEN A;  3RF1 A;  1BR1 A;  3FB2 A;  2WWV A;  5KMG P;  4YLH A;  3B5M A;  4E7Z A;  1MIV A;  1L0V A;  4GKJ T;  5JDH A;  4UVB B;  2PBI A;  3HKC E;  1HR0 T;  1XMQ T;  4HFD A;  5AQF B;  3KFW X;  4XZC A;  1OED C;  1IBK T;  4PJJ A;  5AQP B;  1UUS A;  1HG2 A;  3TLS A;  2D9D A;  3PUR A;  1LKX A;  2UU9 T;  1XNQ T;  4O4I E;  4F6R C;  3SWH A;  2BS4 A;  4X62 T;  3HKB E;  4KHP T;  2OLT A;  4OYJ A;  4C90 A;  1H7C A;  1V9D A;  2E2A A;  5ABF A;  5HCM A;  2XM1 A;  1MMN A;  5FP3 A;  2VL0 A;  1MMG A;  4GOU A;  4EV6 A;  4HTE A;  2ZM6 T;  2LHR A;  4IGU A;  1ZP0 A;  4I0U A;  4TWF A;  4L0R A;  5L3B B;  2BVL A;  2BS2 A;  2HPJ A;  1D1C A;  4K0K T;  3JC6 D;  1D0Z A;  5LHG B;  4X5T A;  2Y6X A;  1ZV4 X;  2LM9 A;  4O4J E;  2WY2 A;  3RHW A;  2XQ8 A;  3O4X E;  2XQY A;  3MA9 A;  4X64 T;  4MHC A;  3RRW A;  4GKK T;  3AAI A;  2UXB T;  3ZCI A;  1LVF A;  2G0U A;  3ZMT B;  3KBT A;  2B1E A;  2LRK A;  2V7J A;  1VRB A;  4E7S A;  4AXP A;  3ZMS B;  3MK7 C;  3SFD A;  1YQ4 A;  3UFE A;  3KIN B;  5EK2 A;  3CK6 A;  3K8P C;  5JRE A;  1WR6 A;  3VKH A;  2WMN A;  1UX5 A;  4JBW F;  2L3L A;  4WBN E;  5F5W A;  3N9O A;  2XUE A;  4PK5 A;  3O1H A;  1SE7 A;  3T1Y T;  3JAE A;  4UV8 B;  5LMU T;  4IDQ A;  2D2S A;  3SOL A;  3R6N A;  2LOP A;  3MXZ A;  1SA0 E;  2HPL A;  1D1A A;  2BS3 A;  5FXW A;  1E1H B;  3N9L A;  5A1L A;  4L5G A;  3CML A;  5LJM A;  5DJQ C;  2YOE A;  5CB4 E;  1MMD A;  5AQO B;  4TNV A;  3VR9 A;  2H7O A;  2WQY A;  1XWM A;  5H6R B;  3L3P A;  2QVA A;  1QSD A;  2V5D A;  4DR3 T;  4J2C A;  2MTQ A;  2MOZ A;  5IHY A;  1MIY A;  4O8S A;  1MND A;  2UUC T;  4YHJ A;  3AE7 A;  3ZT5 A;  2M67 A;  2BKP A;  2YU1 A;  2KWH A;  1UCU A;  1YKE B;  2M6I A;  3D0T A;  3OPC A;  4NXN T;  5FL1 A;  2DWK A;  4NUU A;  4JI7 T;  4B3T T;  3ETV A;  4IE4 A;  1U4Q A;  3EVY A;  1N36 T;  5FVK A;  3C98 B;  5AQJ B;  4DUY T;  4GYS A;  2V1D B;  5JVD E;  1BR2 A;  3ZJ2 A;  3PUW F;  3AVS A;  2Q9Q A;  4DR6 T;  3I0Q A;  4LF5 T;  5FY0 A;  3G06 A;  4BAY B;  4DR5 T;  2ODV A;  4HEA A;  3X1D A;  2EHO A;  2LE8 A;  3L09 A;  1QUU A;  2YKS A;  3AEG A;  1J1J A;  5C2T A;  3T1H T;  2VKO A;  4BJN A;  2W2U A;  4WBO A;  2XSB A;  2E9X A;  4H63 V;  2CLY B;  2NW7 A;  5IYZ E;  4UF0 B;  4DO0 A;  3FBZ A;  4YXD A;  4QHO A;  3GMI A;  2XAJ B;  2DNX A;  5HCJ A;  3P4Q A;  4Z91 A;  4DV6 T;  3DJB A;  3I0O A;  4JV5 T;  4Z90 A;  3AXJ A;  2IAK A;  4JI5 T;  3N9P A;  4TWD A;  4TV8 E;  2X9W A;  3N2K E;  4N78 D;  3WAK A;  1BR4 A;  5L3E B;  3EAB A;  3B13 A;  3ONX A;  3ZEF B;  3VRB A;  4TWH A;  4GIW A;  2WS3 A;  1KNZ A;  2JMK A;  2PFV A;  3KV9 A;  5LG3 A;  4AI6 A;  1KNP A;  2V5C A;  2W63 A;  2MYS A;  2HN1 A;  3P7I A;  1HS7 A;  4U3C A;  3AE4 A;  4EED A;  3LJC A;  4TN7 B;  4UVA B;  3LBX A;  1BR0 A;  2VAS A;  1FJG T;  3AE3 A;  3JCF A;  4ZHQ E;  1HF8 A;  1Z0P A;  2CBJ A;  1XMO T;  4YSX A;  5L3C B;  3T8O A;  4HFC A;  3JC6 C;  4HFH A;  2UXN B;  3PV0 F;  3A5X A;  2J47 A;  3WAJ A;  1T72 A;  4HN9 A;  2PJQ A;  2Q9Q B;  4OYK A;  4QKN A;  4P0B A;  2H89 A;  2XQ5 A;  4PK4 A;  2J4G A;  4JI8 T;  4AKI A;  2WSS V;  3RIF A;  5HWY A;  1ZKE A;  1N32 T;  2EHO B;  4JUY A;  4DUZ T;  1VCT A;  5LYJ E;  4IE6 A;  1KK7 A;  1DU2 A;  3Q9D A;  3RPU A;  3LG7 A;  2UUB T;  4B6X A;  2FJB A;  4IT4 A;  2V6X A;  4PJN A;  3PUZ F;  2IUB A;  1WLX A;  3ZST A;  4DV3 T;  4IE7 A;  3FZH B;  3TLT A;  3RKO A;  2K48 A;  5L4H A;  4DR1 T;  2ACZ A;  5TAO A;  2W00 A;  4YSY A;  3S4U A;  2W0G A;  4HWD A;  3LK3 B;  2DCF A;  2DLR A;  2LSI A;  5HEU A;  2IC6 A;  3CX8 B;  2NTY A;  3GN5 B;  4CN1 A;  2LT3 A;  1YW0 A;  2X9Y A;  3AXJ B;  1US7 B;  3AAA B;  3IHR A;  3EHZ A;  1HNX T;  4A5X A;  4YTN A;  3ZPO A;  3FXE B;  4ZI2 C;  2E5L T;  2RA1 A;  2F4V T;  1N33 T;  4JYA T;  2LHN A;  3DTO A;  3ZYK A;  1QLB A;  4EAH A;  4YHH T;  1T8B A;  1D0X A;  2KWI B;  4PK6 A;  4A98 A;  5HEH A;  3ANW A;  2ZM2 A;  2ZMA A;  4NIQ A;  4I50 E;  3RIU A;  2VWA A;  3FBL A;  3AEF A;  3ZYL A;  3BQK A;  5L3F B;  1FIO A;  4NPP A;  4H9R C;  4X1K E;  3BQI A;  3WI3 A;  4ZS3 A;  4IIJ E;  2LOS A;  5L3D B;  3OYX A;  1GQE A;  3F31 A;  4JI3 T;  3Q5D A;  5JRC A;  2LSY A;  4JEH B;  5LOV E;  1SHZ C;  2AE9 A;  3QB5 A;  2NP9 A;  3VR8 A;  2CBI A;  4LFB T;  3V5U A;  5CFB A;  4AQF A;  4YSZ A;  3LFM A;  4PFO A;  4HGA A; 
#chains in the Genus database with same CATH homology
 1U5P A;  1FMV A;  1O3X A;  2X67 A;  1WR6 A;  2I59 A;  3KVB A;  3PDY A;  3VKH A;  3O1I A;  1WYC A;  2WMN A;  1UX5 A;  5C8Y E;  2E9X B;  3ZCJ A;  3CVR A;  1IZN B;  1X79 A;  2CWY A;  2CXF A;  4MFR A;  2L3L A;  4K0U A;  4WBN E;  2C5K T;  2WAU A;  5HAX A;  3LK4 2;  2QA7 A;  3FXD B;  5JDQ A;  3N9O A;  2XUE A;  2CM0 A;  3CKD A;  4PK5 A;  2V7L A;  3C51 A;  4IST A;  2SPC A;  5BMV E;  3Q5X A;  3UUL A;  3R84 B;  3H37 A;  3O1H A;  4DVD A;  5J1G A;  3KV5 A;  3CPZ A;  5F8P A;  3MZK B;  3HR0 A;  1MIW A;  4U72 A;  3ESL A;  4UV8 B;  3C4X A;  4KMC A;  5KDM C;  4H9Q C;  2D2S A;  3SOL A;  3R6N A;  2Q9Q C;  5DQV A;  4X1I E;  2V7I A;  3GN5 A;  4OFZ A;  2LOP A;  3IEE A;  3MXZ A;  1SA0 E;  3Q5W A;  2X0L B;  2YK0 A;  3H3A A;  4EIW A;  2CA5 A;  2HPL A;  3C4W A;  1D1A A;  2OA5 A;  2YIN A;  4H63 H;  3AA1 B;  5JR9 A;  5FXW A;  3KVA A;  2EHO C;  1E1H B;  2A2F X;  3U3I A;  3I9W A;  3N9L A;  5FXZ A;  5FXV A;  1LVK A;  2CXD A;  4X20 E;  5A1L A;  4L5G A;  4ADZ A;  2LSK A;  1HG5 A;  3CML A;  2X51 A;  4ANJ A;  5LJM A;  3PUG A;  5DJQ C;  2MBG A;  1Y64 B;  2CWO A;  3PUA A;  4QX7 B;  5LP6 E;  4ILU A;  5CB4 E;  1MMD A;  2XAG B;  2LEH A;  2H7O A;  4DBQ A;  2C5J A;  2HH7 A;  2E9X C;  4I55 E;  5H6R B;  4AKL A;  5JH7 E;  3L3P A;  2NW8 A;  2V7K A;  1OWA A;  5H6Q B;  5M4Y A;  3RYH E;  1QSD A;  2YEV C;  2Z6E A;  4G63 A;  4A56 A;  4J2C A;  2MTQ A;  1OXZ A;  5JDN A;  2MOZ A;  5IHY A;  1MIY A;  4PW8 A;  5FXX A;  5KX5 E;  4O8S A;  4TUY E;  4BA9 A;  3C4Z A;  3NZP A;  1MND A;  4YHJ A;  1S94 A;  2JRK A;  4EXT A;  2D5U A;  2M67 A;  2YU1 A;  4WW0 A;  2C5I T;  3CQX C;  3CQC B;  3N5L A;  2KWH A;  4QWN B;  2BVM A;  3LBX B;  2QGS A;  1HFA A;  3EDV A;  1UCU A;  1YKE B;  3D0T A;  3FHN A;  3PUQ A;  4ZOL E;  3ZMV B;  4GK0 E;  3O1J A;  4OHF A;  2X9X A;  2DWK A;  3IF8 B;  2GK9 A;  2WBL A;  4NUU A;  3PU8 A;  3RYF E;  3ZMZ B;  4KUM B;  3I1A A;  4UEL A;  3PE0 A;  1EZ3 A;  1S35 A;  2A72 A;  4V1A v;  3ETV A;  4IE4 A;  2ZM8 A;  4CI3 B;  1U4Q A;  2X68 A;  3EVY A;  3N2O A;  3IBP A;  4UEM A;  2XAF B;  4FJO A;  3C98 B;  3PU3 A;  3OKQ A;  3QK6 A;  4GYS A;  2V1D B;  4MBQ A;  1BR2 A;  5JVD E;  3ZJ2 A;  4DMW A;  2K24 A;  3AVS A;  5LGU B;  4ZS2 A;  2Q9Q A;  3J9X 1;  3UUX B;  2H3R A;  3I0Q A;  4MAL A;  2DWG A;  2CCQ A;  2KT9 A;  2C0S A;  3EUH A;  5FY0 A;  4P0A A;  4BAY B;  5JRC B;  1UX4 A;  3MJX A;  4G2A A;  3I9Y A;  2ES0 A;  3V5S A;  4P09 A;  2ODV A;  1WYB A;  4O2A E;  4HEA A;  4OK0 A;  4UV9 B;  2EHO A;  2LE8 A;  3L09 A;  4CZZ B;  3AA0 B;  4UXN B;  1QUU A;  5AFU L;  4YJ3 E;  5JRE A;  2JJ9 A;  3AB3 B;  2W61 A;  2ZM0 A;  1YD8 G;  3E08 A;  2BZB A;  2VKO A;  4I4T E;  2YU2 A;  4BJN A;  3O9X A;  2WM9 A;  3KV4 A;  4WBO A;  2E9X A;  4H63 V;  4DND A;  2CLY B;  1G8X A;  2NW7 A;  5IYZ E;  3SRZ A;  3ZN0 B;  4UF0 B;  4DO0 A;  3FBZ A;  3NZQ A;  5JDL A;  4QHO A;  4CI2 B;  3VHL A;  5HXE A;  3GMI A;  4HE8 A;  2XAJ B;  2N1G A;  4ZI2 D;  2DNX A;  5HWX A;  2NW9 A;  2PG8 A;  2XAQ B;  3U78 A;  5LCY A;  3C50 A;  3DP7 A;  4AQG A;  2J1D G;  1WRD A;  3GA8 A;  4QXH B;  5DAB A;  3KV6 A;  2JMH A;  2KND A;  3DJB A;  4CXY A;  3GWH A;  3I0O A;  4WNK A;  5EZY E;  5HXC A;  1HX8 A;  2DHR A;  3PUS A;  4PNI A;  3AVR A;  3UUM A;  2VKJ A;  3NRX A;  5JDM A;  2IAK A;  3N9P A;  4L9I A;  2LSG A;  4TV8 E;  2X9W A;  3N2K E;  1D1B A;  4N78 D;  3WAK A;  3OYZ A;  4NUV A;  2IC9 A;  4JLE A;  4O4L E;  3ZC0 A;  3AA7 B;  4ISS A;  3CWZ B;  5DQW A;  4QX8 B;  1BR4 A;  4IHJ E;  5L3E B;  4EOZ B;  3EDU A;  5LBM A;  3B13 A;  3F2E A;  4ZI3 C;  3ZJ1 A;  5JR9 B;  2KZ7 B;  3ONX A;  3ZEF B;  3ZYM A;  2ZLY A;  4GIW A;  4H9O C;  4I43 B;  3AA6 B;  3QUJ A;  1NWM X;  4YFS A;  2BDE A;  2CLY C;  2VK9 A;  3E22 E;  1KNZ A;  2JMK A;  2IW5 B;  2VKH A;  2PFV A;  3KV9 A;  4AI6 A;  4JEU B;  2W63 A;  5HXS A;  2MYS A;  4YJ2 E;  3P7I A;  3HL6 A;  5LHI B;  4AKG A;  1HS7 A;  3CQG B;  5HXR A;  4EB6 E;  1NAF A;  3RH3 A;  2D0T A;  3RRC A;  2VKD A;  3RYC E;  4PFP A;  4IE5 A;  4BJM A;  4TZ4 C;  4ZI7 E;  3M65 A;  3ANW B;  4TX5 A;  3LJC A;  4TN7 B;  4Z8X A;  4UVA B;  3LBX A;  1BR0 A;  1VOM A;  2VAS A;  3OJA A;  3KBU A;  4AKR B;  4GK5 E;  1ZEE A;  4CXW A;  5E0O A;  3RX6 A;  5LXT E;  1LRZ A;  3RC3 A;  3HA4 A;  5LJN A;  3LK2 B;  3NBX X;  4M1P A;  3PTR B;  5L2L A;  4AKH A;  1T98 A;  3UT5 E;  3N9N A;  4U74 A;  4ZHQ E;  1HF8 A;  2CMR A;  2DI4 A;  2Y8D A;  1Z0P A;  4HFV A;  2LSJ A;  2NOX A;  2V7M A;  2WMO A;  5CA0 E;  1FMW A;  5GON E;  5L3C B;  5LA6 E;  3T8O A;  1ZHC A;  3JC6 C;  4DMV A;  4UVC B;  1CUN A;  2UXN B;  3CX7 B;  4PJM A;  3OBV E;  4PJL A;  3A5X A;  3K3Q C;  3J7Y q;  3WAJ A;  4MLK A;  5LBQ B;  4PAG A;  1AJ3 A;  4HN9 A;  2PJQ A;  2Q9Q B;  4OYK A;  4QKN A;  4KP3 C;  4P0B A;  4QXB B;  2N2N A;  2CE7 A;  5FY1 A;  3KDS E;  5J2U E;  2NWB A;  4PK4 A;  4AKI A;  2WSS V;  1BR1 A;  5HWY A;  3FB2 A;  5FYM A;  2Q9Q D;  1ZKE A;  5KMG P;  4UIG A;  1B7T A;  5EK4 A;  5ETW A;  4YLH A;  2EHO B;  4JUY A;  4ERR A;  5LYJ E;  4IE6 A;  3C64 A;  4E7Z A;  2CEA A;  4CQI A;  5JQG E;  1IAP A;  1KK7 A;  4FI5 A;  1MIV A;  2N9D A;  2L8K A;  3HKE E;  3Q9D A;  3RPU A;  3LG7 A;  5CA1 E;  2EHO D;  4B6X A;  4UF0 A;  4EYU A;  5JDH A;  1IJ5 A;  4PJN A;  3SS1 A;  4UVB B;  2PBI A;  1WLX A;  4H9S E;  5JDG A;  3HKC E;  4HKA A;  5LHH B;  2XAS B;  4IE0 A;  4IE7 A;  2D0U A;  4EZ4 A;  2VL8 A;  3KFW X;  3HKD E;  4XZC A;  5FY7 A;  4ZI3 D;  5F3J A;  3QC9 A;  3RKO A;  2K48 A;  2E9X D;  4EZH A;  5TAO A;  4PJJ A;  2W00 A;  2X66 A;  1HG2 A;  3MAC A;  4H9N C;  5LGT B;  4GYR A;  3S4U A;  1HTJ F;  3UUN A;  2W0G A;  3N9Q A;  3PUR A;  3W15 B;  5HXH A;  3LK3 B;  2DCF A;  2DLR A;  2LSI A;  2IC6 A;  4O4H E;  3CX8 B;  1G73 A;  2NTY A;  2X9H A;  3GN5 B;  1LKX A;  5LGN B;  2UXX B;  2LT3 A;  2KLQ A;  4O4I E;  5L3G B;  1YW0 A;  4F6R C;  2X9Y A;  1US7 B;  3SWH A;  3AAA B;  3NRY A;  5J2T E;  3BK9 A;  3K3N A;  3IHR A;  3HKB E;  4AQF C;  5FMN A;  4CI1 B;  4OYJ A;  4C91 A;  4C90 A;  1H7C A;  2RP4 A;  1V9D A;  2L9Q A;  3MKD A;  5JDF A;  3ZPO A;  3FXE B;  2WWU A;  2CXL A;  4ZI2 C;  1MMA A;  2RA1 A;  2XTL A;  3N2G E;  1MMN A;  2LHN A;  3DTO A;  3ZYK A;  3ZN1 B;  5FP3 A;  5LNK A;  4EAH A;  3ZC1 A;  1MMG A;  2ODU A;  2Y48 B;  3B57 A;  4GOU A;  4HTE A;  2LHR A;  2VB6 A;  3F57 A;  3TKL B;  1D0X A;  1HCI A;  2XAH B;  2A3D A;  2KWI B;  4IGU A;  3RC8 A;  3P8C D;  4EYY R;  4PK6 A;  1FEW A;  4L0R A;  5HYA A;  2W62 A;  5L3B B;  2BVL A;  2HPJ A;  3ANW A;  3RYI E;  1D1C A;  3VKG A;  3JC6 D;  1D0Z A;  2KMF A;  2ZM2 A;  2ZMA A;  5LHG B;  3E0Z A;  4X1Y E;  2LJL A;  2Y6X A;  4I50 E;  1ZV4 X;  3N9M A;  4H9P C;  2LM9 A;  4O4J E;  2VWA A;  3FBL A;  4DBR A;  4ASK A;  3ZYL A;  3BQK A;  2E8I A;  5L3F B;  3K3O A;  3BQL A;  1FIO A;  2KXP B;  4H9R C;  3O4X E;  2XQY A;  3MA9 A;  4XAX B;  4X1K E;  3BQI A;  3WI3 A;  3ZMU B;  2K9A A;  4ZS3 A;  1IJ6 A;  2K5B B;  5FNV E;  4IIJ E;  4MHC A;  2XHE B;  5JR9 C;  3RRW A;  2LOS A;  3UTK A;  5L3D B;  3VU7 H;  3OYX A;  3AAI A;  5EK3 A;  2P9B A;  3CX6 B;  3HI2 A;  4O2B E;  2JPF A;  3F31 A;  3ZCI A;  1LVF A;  2H7V C;  4TV9 E;  1YKH B;  5JRC A;  2G0U A;  2LSY A;  5ADX L;  4JEH B;  3ZMT B;  5LOV E;  2KIN B;  3KBT A;  1SHZ C;  2B1E A;  2JQQ A;  2ACX A;  2V26 A;  2V7J A;  2NP9 A;  1D0Y A;  1VRB A;  4E7S A;  3ZLI A;  4AXP A;  3ZMS B;  3Q2M A;  4QXC B;  4KBM B;  3MK7 C;  3V5U A;  2NTX A;  1MNE A;  3ETU A;  4AQF A;  3UFE A;  4CXX A;  3KIN B;  4XBF B;  3LFM A;  5EK2 A;  3AAE B;  5LG4 A;  4PFO A;  3K8P C;  4HGA A;  4IDZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...