2LOSA

Backbone structure of human membrane protein tmem14c
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
112
structure length
112
Chain Sequence
MQDTSSVVPLHWFGFGYAALVASGGIIGYVKAGSVPSLAAGLLFGSLAGLGAYQLSQDPRNVWVFLATSGTLAGIMGMRFYHSGKFMPAGLIAGASLLMVAKVGVSMFNRPH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords Transmembrane protein 14C
publication title Facile backbone structure determination of human membrane proteins by NMR spectroscopy.
pubmed doi rcsb
source organism Homo sapiens
total genus 29
structure length 112
sequence length 112
ec nomenclature
pdb deposition date 2012-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03647 Tmemb_14 Transmembrane proteins 14C
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1140 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2losA00
2LOSA 2LOPA
chains in the Genus database with same CATH superfamily
2CXFA 2LM9A 2WMNA 2P9BA 4IDPA 2IDOB 4C91A 3AE4A 4C90A 2W2UA 5HXHA 2OV9A 2C5IT 2BBJA 3EDVA 2KZ7B 2JQKA 2KT9A 3FZFB 2QVAA 4HFVA 3ZT6A 3OYZA 3K3QC 4DNDA 5JTGA 1V9DA 4H9QC 3A7MA 2RPAA 4AIUA 4X20E 4K0KT 3RC3A 3CQGB 2WQYA 4OX9T 3ZMZB 3ZLIA 3QNUA 2UU9T 3NKZA 3C4WA 4HWIB 4I4TE 1IBLT 3F57A 3ZMTB 2C5KT 2DNXA 2V1DB 4EV6A 3C50A 3VR9A 1X9BA 2WBLA 4E7SA 2H89A 4EB6E 2V8SV 2LSYA 1LKXA 3AXJB 4TZ4C 3N9QA 4P09A 3N2OA 3RHWA 4IHJE 3H37A 3BQLA 5HEUA 1I94T 4K0UA 4HFHA 5FXZA 3I1AA 4DV0T 4BJNA 5LP6E 1L0VA 5ABEA 5JH7E 4BJMA 1O3XA 3MXZA 5L3FB 1IAPA 4HWDA 3TLWA 1UUSA 4HTEA 4I55E 5LHGB 4P0BA 3SS1A 2FJAA 2F4VT 3NWIA 3TLUA 4TV8E 2XSBA 4PJMA 4YT0A 2V26A 4KMCA 4ZHQE 4EGWA 3AEBA 2WWUA 2DL1A 4CI3B 5LBQB 2WY2A 3RRCA 3RH3A 4XBFB 2I59A 2CLYC 2ODVA 1CHUA 3AXJA 4DIDB 4JYAT 4Z90A 4UVBB 4IREA 4X1KE 3AE9A 4I50E 2XM1A 2J62A 3GWHA 4UV9B 4G2AA 1ZOYA 2XSAA 3U3IA 4XAXB 4KHZF 4WBNE 4CZZB 3VRAA 2V7KA 4PK4A 1W0AA 3OJAA 4NPPA 5JQGE 3N9NA 3AVSA 4MLKA 5FP3A 2BZBA 5ABFA 4ZI2C 4Z91A 2YU2A 5EK4A 3U78A 1XZYA 2X9HA 4WBOA 3EABA 2WDRA 3K3OA 1YKHB 5HCJA 4MBQA 2DCFA 3AEEA 5J1GA 5IHYA 2KWHA 1NAFA 5F8PA 2MPKA 3PUGA 3RIFA 2Y8DA 3FBZA 1DU2A 2JPFA 4CXWA 4JI5T 3ZYMA 4DV4T 1UX4A 3C4XA 2NP9A 3L09A 5AQKB 2UUBT 2W4XA 4J2CA 4COFA 3I0QA 5JVDE 4H9NC 4A98A 3ONLC 3RF1A 4GK0E 4YTPA 2CEAA 4DMVA 2WDVA 4JLEA 4NUVA 2Q9QB 3EVYA 4UVCB 4DR5T 4ZI2D 3UT5E 5L3GB 4DR7T 4ZXLA 3HI2A 5CFBA 2WS3A 4O2BE 5L3DB 3AEDA 3LK3B 4B3MT 4JI0T 3HKDE 2NTYA 3P7IA 2ES0A 2X9XA 1UGOA 2DHRA 1SUMB 5AQIB 2YOEA 2V6YB 1XDOA 2CXLA 4CN4A 1XMOT 3CX7B 1Z8UA 3SWHA 3AE7A 3W15B 3Q5EA 4ILCA 5A1LA 4E7ZA 5H6QB 1US7B 4JUYA 3KFWX 4I43B 1FEWA 3FZMB 3T1YT 4DV1T 1YD8G 2XQ6A 4LMLA 2YDQA 2E5LT 2ZM0A 3GMIA 3AA6B 5LG3A 3VKGA 3AVRA 4JI8T 3AE1A 4TX5A 4JBWF 1KFYA 2XPKA 2XAGB 5JRCB 4WNKA 5KX5E 2DWGA 2Q9QA 4EYYR 2CPTA 3P50A 4JI2T 4AKGA 2LE8A 3EHZA 4L0RA 2ODUA 3MJXA 1KNPA 1W0BA 5JDQA 5L47A 1XNQT 4JEUB 3JAEA 2KNDA 2CWOA 3RYFE 1D0ZA 2KMFA 5DQWA 1D1BA 3PDYA 3RIAA 3PUQA 3MA9A 2UXBT 2XQ7A 3B5MA 2WWVA 4QH4A 4O2AE 4EXTA 1Y64B 3AE8A 2OA5A 3PUSA 3UULA 4YXDA 2LKGA 2CM0A 3KVAA 2DLRA 2N2NA 2XASB 1D1AA 2A72A 3QB5A 2I0MA 2ZM2A 2XQ8A 1UX5A 3ZYKA 5LB7B 2N9DA 4L5GA 2PBIA 4HKAA 1UK5A 2M6IA 1UURA 3MACA 4JI1T 4YSXA 3QB5K 3OTOT 5HWYA 4UF0B 4JI3T 1HR0T 4U3CA 3LG7A 4EZ4A 5LHHB 5AQLB 3VKHA 3B13A 3BQKA 2VQET 5LMNT 4P0AA 4AKHA 5JR9B 3MKDA 2LLYA 3J9X1 5HYAA 3P4SA 3CKDA 1KF6A 2E8IA 3UU4A 2A3DA 1NWMX 5FXWA 2W66A 4PNIA 1QUUA 3ZMUB 5BR8T 1NENA 1MIWA 1KNZA 3KBUA 4DV3T 2YDRA 1QSDA 5AQUB 3UFEA 1MNEA 2MBGA 4LF7T 5HAXA 4IGUA 3CX8B 2R6GF 5JREA 2VKOA 3Q5XA 2JMKA 2DWKA 2YK0A 3KV6A 4AQGA 2V7JA 2D0UA 4PFPA 5GONE 4UF0A 2YU1A 3P4PA 2YEVC 2WAUA 2Q9QC 4ILAA 1IJ6A 3A8YC 4OFZA 4ANJA 3AEGA 5AQGB 1ZHCA 1XNRT 4NXNT 5JR9A 2IW5B 2UUAT 2BG9B 4ERRA 1KK7A 4AISA 3E08A 4DVDA 1WYBA 3PUWF 2XAHB 3UQ4A 5CA1E 3WAJA 4F6RC 2VASA 2WDQA 5HXEA 3TLSA 2V7LA 3QUJA 2WU5A 3CVRA 4HEAA 1OWAA 5LJMA 3TKLB 3OPCA 2C5JA 2LHNA 5F5WA 4U72A 5CGMA 3SRZA 2B76A 2KLQA 2CCQA 3TLTA 3N9LA 4BAYB 5JDFA 3ZSSA 4JI7T 4DUZT 3ZCJA 1ZV4X 3CWZB 4ZOLE 3AA7B 1N33T 3ONXA 5HCMA 5H6RB 2XAFB 2FJEA 1MNDA 3JCFA 2LEHA 2Q9QD 2PG8A 2FUPA 3RX6A 5ABFB 3OKQA 2BG9A 2K9AA 4QH1A 2C0SA 4AKLA 5LNKA 2HN1A 2X51A 2BG9E 4YJ3E 4AQFA 4IE6A 2WB5A 4B3RT 3ZJ1A 2VL0A 2MOZA 3I0OA 3RYHE 3OBVE 4UV8B 4BA9A 2WSSV 2BKNA 5FL1A 5LHIB 1J5ET 3ZPOA 2CMRA 3AEAA 2N1GA 4PAGA 4X5TA 3O1JA 2ZLYA 2YDSA 4PJJA 2YINA 3C51A 3CX6B 4O4LE 4ZZCA 3ZC0A 2XTLA 5AQSB 1VCTA 2WZHA 3K3NA 3P4RA 3JADA 2IUBA 2JIWA 2NR4A 5AQMB 5AFUL 4KUMB 4PJNA 5C2TA 2V7IA 3UFGA 3AA1B 4OHFA 3IF8B 2NOXA 2L8KA 5LMUT 4F8HA 2X9YA 5L3EB 3IBPA 2Z6EA 1MIYA 4ILBA 3ZN0B 3O9XA 2LOPA 5JR9C 4LF6T 4AQYT 2IMLA 4JI4T 3QK6A 4EAHA 3WI3A 3FHNA 3K1SA 2J4GA 3UTKA 3UU3A 4HFCA 2G0UA 2Y48B 4ZI3D 3F2EA 5TAOA 3CMLA 3UUNA 3C4ZA 4TNWA 4NUUA 3GN5B 4QX7B 3PTRB 2XQ9A 4AKRB 5J2UE 2VKDA 2HPLA 1LRZA 5AQPB 2VVSA 3G06A 1FJGT 4I0UA 2QRXA 4EEBA 2HN2A 3EAMA 2BS2A 2Y6XA 1LVKA 4TN7B 3T1HT 3FBLA 3CPZA 1HTJF 1KNRA 2K5BB 2WU2A 4KHPT 4TWFA 3RPUA 3HR0A 2XQAA 1YQ3A 5ADXL 4EEDA 3EDUA 3NBXX 4O4IE 5JDHA 3JAFA 2LOSA 4KI0F 4UVAB 4H9SE 2BG9C 3IEEA 1N36T 1Z0PA 4KX6A 5FYMA 5FXXA 2L3LA 1YQ4A 1G8XA 4IDZA 4AQFC 4O4JE 3C64A 1J1JA 2BKOA 3N9OA 1N34T 4WZXA 4DR6T 2QYWA 2LM2A 2X9WA 1H7CA 2W67A 2CE7A 2CHNA 4ZI7E 4U31A 1SE7A 4CN6A 2AXDS 3GN5A 3LFMA 5AQHB 2K3WA 3AAEB 3ETVA 5HEHA 2QA7A 4DR1T 2JQHA 3EI0A 3V5UA 3M3ZB 2XZEA 5FMNA 3I9YA 4A97A 4IE5A 3ESLA 3AA0B 5HXRA 3H3AA 2JQ9A 2X0LB 3UU6A 2D5UA 3EUHA 3RKOA 1WLXA 2HPJA 3ETUA 2LHRA 2V7MA 5KDMC 2WZIA 5FY0A 2NWBA 3H3MA 1YXRA 3ZC1A 4ILUA 4ASKA 2UXCT 4OYKA 1T72A 3FXEB 4DV5T 4AXPA 5DJQC 2LT3A 2WMOA 2EHOD 5KXJA 1MMNA 4IDNA 3AAIA 2BS3A 3NRXA 3PU3A 2D9DA 3VR8A 4DMWA 1U4QA 3O4XE 5FNVE 3HKBE 3KVBA 1XMQT 4YLHA 4TUYE 2VQFT 4MHCA 3ZT5A 4IDQA 3R6NA 1Y01A 3VRBA 1S94A 3MZKB 2CWYA 2PJQA 2YKSA 4N78D 2FBWA 2ACXA 3PJAA 4LMKA 1HX1B 4EZHA 1M7KA 4U74A 4PFOA 4DV6T 2XAJB 4GKKT 5JDNA 5LG4A 3RQWA 1D0XA 3ZT7A 2KXPB 2E9XD 4WYVA 1T8BA 4U33A 5KMGP 5L4EA 5ABGA 5EK3A 2XUEA 2VK9A 3PUYF 3OVUA 2BVMA 1LVFA 2LRKA 4HE8A 5JDLA 5FKYA 3DP7A 5HEJA 4DV7T 1HNWT 4IDOA 2ZM6T 1NEKA 3PJAJ 3O1HA 4UXNB 5E0OA 5L2LA 3E0ZA 1HS7A 4UIGA 4QXHB 3HKEE 4DO0A 4L9IA 3MK7C 1WRDA 3OYXA 3LBXB 3RKGA 3R84B 2VURA 1BR4A 3V5SA 3P8CD 3AECA 3T8OA 4Q25A 4DUYT 3AE3A 1JNZA 3RYCE 2XQ4A 1X79A 5AQVB 5AQQB 2LRLA 4DR2T 3VU7H 2HH7A 3CIRA 1HNZT 2ZM8A 4AI6A 2PTFA 4GIWA 2B1EA 3BQIA 4GKJT 5AQFB 5L4HA 2JQQA 4GOUA 3I9WA 4KBMB 2CRBA 4HFDA 4LFAT 3AE5A 5JDMA 4B3TT 2ACZA 4CI2B 5ETWA 4ZZBA 3RYIE 1D0YA 4GYSA 4ISTA 2NW7A 1HF8A 5ABHA 1OXZA 3LK2B 4B3ST 1HNXT 3JC6C 1VOMA 1R8IA 3FZKB 2KSRA 1WCRA 4H9RC 4TWHA 4X1YE 3N2KE 4IE0A 2EHOB 4MALA 5EZYE 1BR2A 3HL6A 4YTNA 1N32T 2E2AA 2VWAA 3LBXA 2E5VA 4PK5A 4A56A 4X65T 2RP4A 2LSKA 5HEOA 4FI5A 2WP9A 4PK6A 3ZEFB 4O4HE 1HG5A 3AAAB 2BDEA 2CBIA 1J5WA 3A5XA 2XM2A 2FJDA 2XHEB 3J7Yq 1BR0A 3HKCE 2UXXB 4NXMT 1ZP0A 3GA8A 4KP3C 3F31A 1JNRA 5IWAT 1ZEEA 3FZLB 2E9XB 2H88A 3D0TA 3KV9A 5LJNA 4YSZA 3KINB 2A2FX 1E7PA 4QX8B 5BMVE 4X1IE 3BK9A 4YSYA 3TLVA 1S35A 1HCIA 3QC9A 5LCYA 1T7SA 1FIOA 4LF4T 1B7TA 5CJ5A 3JC6D 3SOLA 2UXNB 2XY8B 2H7VC 3PUXF 1FMWA 2EHOA 2JJ9A 2W0GA 4G63A 4IIJE 3S4UA 1WYCA 1E2AA 3P4QA 2QGSA 4WW0A 3HA4A 2W61A 3RQUA 3PUAA 4B6XA 4ZI3C 1VCSA 1WFDA 1CUNA 3LJCA 3DTOA 3ONJA 1GQEA 5JDGA 3PV0F 4YHJA 4LF5T 1EZ3A 1HG2A 2XJ7A 4AKIA 2AE9A 1WR0A 1IBKT 5F3JA 2VKHA 2BVLA 4PW8A 3Q9DA 5EK2A 4ISSA 2CXDA 2LSGA 4Z8XA 3IHRA 2LKHA 3ZMSB 2E9XA 5LOVE 1SA0E 3ZKRA 4ZS2A 3CQCB 4IL4A 4QKNA 4XZCA 5M4YA 2X0YA 3L39A 3UU5A 5LGTB 5C3JA 4H63V 5FY1A 3P4WA 5AQRB 5FVKA 2X68A 1G73A 2X67A 2SPCA 1MMGA 3LDQB 5DABA 2H3RA 2VVNA 2V5DA 5CB4E 5L3BB 2L9QA 4DR4T 4PJLA 3ZSTA 2VB6A 4X62T 3E22E 5FY7A 1I6ZA 2NW9A 2CBJA 2YN6A 4HWFA 1HFAA 3RC8A 3N9PA 3Q2MA 1XDPA 1OEDB 3VHLA 4EYUA 2X0HA 4IT4A 4U7YA 3Q5DA 2NTXA 5AQOB 5HXCA 2FJBA 2WM9A 3RI5A 4IE7A 2XQ3A 1QLBA 2DI4A 2XQ5A 2J47A 3UU8A 4TWDA 3UUMA 3L8RA 4HN9A 2PFVA 4O8SA 3RIUA 1W9RA 4X66T 3CK6A 2J1DG 3M65A 2JMHA 2XAQB 4H9OC 4V1Av 2A9UA 5CA0E 3SFDA 3AE2A 3CQXC 1MMDA 2KWIB 3LSVA 4OK0A 4YFSA 3K8PC 5J0ZA 4HWCA 2V6XA 3QOFA 2JRKA 4U2YA 2UXDT 1KEYA 2OLTA 2KINB 1HX8A 4DBQA 3X1DA 3N2GE 5IYZE 2LSIA 3ANWB 2EHOC 3N9MA 1BR1A 4LFCT 3PU8A 2W62A 2MTQA 3UUXB 1IBMT 3UUBA 2IHR1 2K48A 1OEDA 4ZS3A 3ZJ2A 2BKPA 5LGNB 1OEDE 1VRBA 4OYJA 4U2ZA 3PURA 5IUXA 2W00A 2XQYA 3DJBA 2IIUA 1XWMA 4H63H 4EOZB 1SHZC 2E9XC 4HFEA 1AJ3A 2NW8A 4GYRA 3N5LA 4CXYA 1D1CA 2VKJA 4QWNB 5LBMA 1IZNB 4QHOA 3RRWA 4P1NA 4IE4A 5AQJB 4LF8T 1ZKEA 4JV5T 4CI1B 4DBRA 5HWXA 1T98A 5FL0A 3AE6A 5J2TE 4YHHT 2M6BA 4IL9A 1M62A 1YW0A 3KV4A 3ANWA 4QXBB 4LMJA 3ZMVB 2V5CA 1E1HB 4UR9A 1U5PA 2MAWA 5HEGA 1MMAA 4TNVA 4YTMA 2UUCT 2HHHT 4X64T 3PUVF 1MIVA 3B57A 4QXCB 2V6YA 3PUZF 5C8YE 3AB3B 3O1IA 3LK42 3KBTA 5LGUB 3ZN1B 4M1PA 3FZHB 2WCAA 2CLYB 2K24A 4GK5E 4UEMA 4CQIA 4QH5A 4ADZA 3RGLA 3ZYLA 4JI6T 2IC9A 1WR6A 3FB2A 3IA3A 4LF9T 1IJ5A 5LA6E 3PE0A 2ZMAA 3AEFA 2IAKA 4DV2T 3KV5A 2BS4A 3RIUC 5JRCA 2CA5A 2D0TA 2LSJA 2VL8A 4JEHB 4HWHA 4TV9E 2M67A 2I6HA 2BBHA 3WAKA 4HGAA 4UELA 4A5XA 4MFRA 4YJ2E 4LFBT 4YY3T 5AQTB 2CHOA 3SFEA 4H9PC 1UCUA 5L3CB 4DR3T 3UQ7A 3Q5WA 2IC6A 1FMVA 3FXDB 4EIWA 5LYJE 2LJLA 4CN1A 2W63A 4FJOA 3NZPA 1OEDC 1YKEB 2H7OA 4CXXA 2GK9A 5FXVA 5AQNB 3NVOA 5DQVA 2MYSA 3ABVA 3ZCIA 4ZEYA 5LXTE 3KDSE 2D2SA 4NIQA 3NZQA 4HFBA 4HFIA 5FVLA 4U7IA 2RA1A 3RLFF 3NRYA 3L3PA 2X66A 5HXSA 1W09A 3C98B
chains in the Genus database with same CATH topology
3HA4A 2Y6XA 1LVKA 2W61A 4TN7B 2CXFA 3MA9A 2LM9A 3FBLA 3CPZA 3PUAA 4B6XA 4ZI3C 2WMNA 1HTJF 2P9BA 2K5BB 1CUNA 3RPUA 3HR0A 3LJCA 3DTOA 4O2AE 5ADXL 4EXTA 4C91A 1Y64B 3EDUA 3NBXX 4O4IE 5JDGA 4YHJA 1EZ3A 1HG2A 2OA5A 5JDHA 4AKIA 3PUSA 2LOSA 4UVAB 4C90A 5HXHA 4H9SE 3UULA 3IEEA 2C5IT 1Z0PA 3EDVA 5FYMA 2CM0A 3KVAA 2VKHA 5FXXA 2BVLA 2DLRA 2L3LA 5F3JA 2KZ7B 4PW8A 1G8XA 2KT9A 3Q9DA 4HFVA 5EK2A 4ISSA 2N2NA 4IDZA 2CXDA 2LSGA 4AQFC 4Z8XA 2XASB 3OYZA 4O4JE 3IHRA 3K3QC 4DNDA 1D1AA 2A72A 3C64A 3ZMSB 1V9DA 2ZM2A 4H9QC 2E9XA 1UX5A 3ZYKA 3N9OA 4X20E 2N9DA 3CQGB 4L5GA 3RC3A 5LOVE 2PBIA 3ZMZB 1SA0E 3ZLIA 4HKAA 4PK6A 4ZS2A 3CQCB 3MACA 2X9WA 1H7CA 3C4WA 2CE7A 4I4TE 4QKNA 4ZI7E 4XZCA 3F57A 5M4YA 5HWYA 3ZMTB 4UF0B 5LGTB 5JRCA 2C5KT 2DNXA 2V1DB 3GN5A 4H63V 5FY1A 3LG7A 3C50A 4EZ4A 3LFMA 5LHHB 2X68A 3VKHA 1G73A 2X67A 2WBLA 3B13A 2SPCA 4EB6E 4E7SA 1MMGA 3BQKA 5DABA 2H3RA 1LKXA 2LSYA 4P0AA 3AAEB 3ETVA 2QA7A 4AKHA 5JR9B 3MKDA 3J9X1 5CB4E 5HYAA 3V5UA 4TZ4C 5L3BB 3N9QA 2L9QA 5FMNA 4P09A 3N2OA 3I9YA 4IHJE 3H37A 3BQLA 4PJLA 4IE5A 3CKDA 2VB6A 3E22E 3ESLA 5FY7A 2E8IA 3AA0B 2A3DA 1NWMX 4K0UA 5FXWA 2NW9A 4PNIA 5FXZA 5HXRA 3I1AA 3H3AA 4BJNA 1HFAA 2X0LB 5LP6E 2D5UA 1QUUA 3EUHA 3RC8A 3N9PA 3ZMUB 3RKOA 3Q2MA 1WLXA 2HPJA 3ETUA 2LHRA 3VHLA 5JH7E 4EYUA 1MIWA 4BJMA 2V7MA 1O3XA 3MXZA 5KDMC 5L3FB 1KNZA 3KBUA 1IAPA 4HTEA 5FY0A 4I55E 2NTXA 5LHGB 1QSDA 5HXCA 2NWBA 4P0BA 3UFEA 1MNEA 2WM9A 3SS1A 4IE7A 2MBGA 5HAXA 3ZC1A 4IGUA 3CX8B 4ILUA 4ASKA 4TV8E 4OYKA 5JREA 2VKOA 3FXEB 4PJMA 3Q5XA 2DI4A 2JMKA 2DWKA 2V26A 2YK0A 3KV6A 4KMCA 4AXPA 4ZHQE 5DJQC 2V7JA 4AQGA 2LT3A 2WMOA 2EHOD 2D0UA 1MMNA 3AAIA 3UUMA 3NRXA 3PU3A 4PFPA 2WWUA 4DMWA 1U4QA 4HN9A 2PFVA 3O4XE 4CI3B 4O8SA 5LBQB 5FNVE 3HKBE 5GONE 3RRCA 4UF0A 3KVBA 2YU1A 4YLHA 4TUYE 2J1DG 3RH3A 2YEVC 2WAUA 4MHCA 2Q9QC 3M65A 2JMHA 2XAQB 4H9OC 4XBFB 1IJ6A 3R6NA 4V1Av 2I59A 5CA0E 1S94A 3CQXC 4OFZA 1MMDA 2CLYC 2KWIB 3MZKB 4ANJA 4OK0A 2CWYA 2ODVA 2PJQA 4YFSA 1ZHCA 3K8PC 4N78D 5JR9A 2IW5B 4UVBB 2ACXA 2JRKA 4ERRA 1KK7A 2KINB 1HX8A 4DBQA 3E08A 4EZHA 4DVDA 3N2GE 4U74A 1WYBA 2LSIA 2XAHB 4PFOA 4X1KE 3ANWB 5IYZE 2EHOC 2XAJB 3N9MA 5CA1E 1BR1A 4I50E 3PU8A 3GWHA 3WAJA 5JDNA 4UV9B 4G2AA 5LG4A 2W62A 4F6RC 2MTQA 3UUXB 3U3IA 1D0XA 4XAXB 4WBNE 2VASA 2KXPB 4CZZB 2K48A 2E9XD 5HXEA 2V7KA 4PK4A 5KMGP 4ZS3A 3ZJ2A 3OJAA 2V7LA 3QUJA 5EK3A 2XUEA 3CVRA 5JQGE 2VK9A 4HEAA 1OWAA 5LGNB 5LJMA 3N9NA 2BVMA 3AVSA 1VRBA 4MLKA 3TKLB 1LVFA 4OYJA 4HE8A 2C5JA 2LHNA 2BZBA 4U72A 5FP3A 3SRZA 5JDLA 3PURA 4ZI2C 2W00A 2KLQA 2CCQA 2XQYA 3DP7A 2YU2A 4BAYB 3N9LA 3DJBA 5EK4A 5JDFA 3U78A 2X9HA 4WBOA 3ZCJA 1ZV4X 3K3OA 4H63H 1YKHB 4EOZB 3CWZB 4ZOLE 3AA7B 4MBQA 1SHZC 2DCFA 3O1HA 5J1GA 4UXNB 3ONXA 5E0OA 5H6RB 5IHYA 5L2LA 2KWHA 2XAFB 2E9XC 3E0ZA 1NAFA 1HS7A 4UIGA 1AJ3A 4QXHB 5F8PA 3HKEE 1MNDA 2NW8A 4DO0A 4GYRA 3N5LA 4CXYA 4L9IA 3MK7C 3PUGA 1WRDA 3OYXA 1D1CA 2VKJA 3LBXB 4QWNB 2Y8DA 3FBZA 5LBMA 1IZNB 3R84B 2LEHA 2JPFA 1BR4A 4QHOA 3V5SA 3RRWA 2Q9QD 4IE4A 1ZKEA 2PG8A 3P8CD 3T8OA 4CI1B 4DBRA 4CXWA 5HWXA 1T98A 3RYCE 3ZYMA 3RX6A 5J2TE 3OKQA 1UX4A 3C4XA 2NP9A 1X79A 2K9AA 3L09A 1YW0A 3ZEFB 3KV4A 3ANWA 2C0SA 4QXBB 4AKLA 5LNKA 3VU7H 2X51A 2HH7A 3ZMVB 4YJ3E 2ZM8A 4AQFA 4IE6A 4J2CA 3ZJ1A 4AI6A 1E1HB 2MOZA 3I0OA 3RYHE 3OBVE 1U5PA 4GIWA 4UV8B 2B1EA 3BQIA 1MMAA 4BA9A 2JQQA 4GOUA 3I9WA 4KBMB 3I0QA 5JVDE 4H9NC 1MIVA 5JDMA 2WSSV 3B57A 4CI2B 5ETWA 5LHIB 4QXCB 3RYIE 4GK0E 1D0YA 3ZPOA 2CMRA 2CEAA 4GYSA 5C8YE 2N1GA 4PAGA 4ISTA 4DMVA 4JLEA 4NUVA 2NW7A 3O1JA 2Q9QB 3AB3B 1HF8A 2ZLYA 3LK42 3EVYA 3O1IA 4PJJA 4UVCB 3KBTA 1OXZA 2YINA 3C51A 5LGUB 3CX6B 3ZN1B 4ZI2D 3UT5E 4M1PA 4O4LE 5L3GB 3LK2B 2CLYB 2K24A 4GK5E 4UEMA 4CQIA 3ZC0A 4ADZA 3JC6C 1VOMA 3ZYLA 3HI2A 2XTLA 2IC9A 4O2BE 4H9RC 1WR6A 5L3DB 3K3NA 3FB2A 3LK3B 4X1YE 3N2KE 4IE0A 3HKDE 1IJ5A 2EHOB 2NTYA 4MALA 3P7IA 5EZYE 5LA6E 1BR2A 3HL6A 2ES0A 3PE0A 5AFUL 2ZMAA 2X9XA 4KUMB 2DHRA 2IAKA 2VWAA 3LBXA 4PJNA 3KV5A 4PK5A 2V7IA 4A56A 2RP4A 2LSKA 4FI5A 3AA1B 4OHFA 2CA5A 2CXLA 2D0TA 2LSJA 2VL8A 3IF8B 4O4HE 1HG5A 2NOXA 3AAAB 4JEHB 2L8KA 2BDEA 3CX7B 4TV9E 2M67A 3SWHA 2X9YA 5L3EB 3IBPA 3W15B 2Z6EA 1MIYA 3WAKA 4HGAA 4UELA 5A1LA 3A5XA 3ZN0B 3O9XA 2LOPA 4MFRA 4E7ZA 5JR9C 2XHEB 4YJ2E 5H6QB 1US7B 4JUYA 3KFWX 4I43B 1FEWA 3J7Yq 1BR0A 3HKCE 2UXXB 3QK6A 4EAHA 1YD8G 3GA8A 4H9PC 1UCUA 3WI3A 2ZM0A 4KP3C 5L3CB 3GMIA 3F31A 3AA6B 3FHNA 1ZEEA 3Q5WA 3VKGA 3AVRA 2E9XB 2IC6A 1FMVA 3FXDB 4EIWA 5LYJE 2LJLA 3D0TA 2W63A 4FJOA 3UTKA 4TX5A 3KV9A 3NZPA 5LJNA 1YKEB 3KINB 2H7OA 2A2FX 2G0UA 2XAGB 4QX8B 4CXXA 5BMVE 5JRCB 4WNKA 4X1IE 5KX5E 3BK9A 2GK9A 2Y48B 2DWGA 2Q9QA 4ZI3D 4EYYR 3F2EA 5TAOA 1S35A 4AKGA 3CMLA 5FXVA 2LE8A 1HCIA 3UUNA 3QC9A 4L0RA 5LCYA 2ODUA 3C4ZA 1FIOA 3MJXA 5DQVA 2MYSA 4NUUA 1B7TA 3GN5B 4QX7B 3PTRB 5JDQA 4AKRB 3ZCIA 3JC6D 5LXTE 3KDSE 2D2SA 3SOLA 2UXNB 5J2UE 2VKDA 2HPLA 2H7VC 1FMWA 3NZQA 4JEUB 1LRZA 2EHOA 2JJ9A 2W0GA 4G63A 2RA1A 4IIJE 2KNDA 2CWOA 3S4UA 1WYCA 3RYFE 3NRYA 3L3PA 2X66A 1D0ZA 2KMFA 2QGSA 5DQWA 1D1BA 3PDYA 5HXSA 4WW0A 3PUQA 3C98B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LOS A;  2LOP A; 
#chains in the Genus database with same CATH topology
 2CXF A;  2LM9 A;  2WMN A;  2P9B A;  4IDP A;  2IDO B;  4C91 A;  3AE4 A;  4C90 A;  2W2U A;  5HXH A;  2OV9 A;  2C5I T;  2BBJ A;  3EDV A;  2KZ7 B;  2JQK A;  2KT9 A;  3FZF B;  2QVA A;  4HFV A;  3ZT6 A;  3OYZ A;  3K3Q C;  4DND A;  5JTG A;  1V9D A;  4H9Q C;  3A7M A;  2RPA A;  4AIU A;  4X20 E;  4K0K T;  3RC3 A;  3CQG B;  2WQY A;  4OX9 T;  3ZMZ B;  3ZLI A;  3QNU A;  2UU9 T;  3NKZ A;  3C4W A;  4HWI B;  4I4T E;  1IBL T;  3F57 A;  3ZMT B;  2C5K T;  2DNX A;  2V1D B;  4EV6 A;  3C50 A;  3VR9 A;  1X9B A;  2WBL A;  4E7S A;  2H89 A;  4EB6 E;  2V8S V;  2LSY A;  1LKX A;  3AXJ B;  4TZ4 C;  3N9Q A;  4P09 A;  3N2O A;  3RHW A;  4IHJ E;  3H37 A;  3BQL A;  5HEU A;  1I94 T;  4K0U A;  4HFH A;  5FXZ A;  3I1A A;  4DV0 T;  4BJN A;  5LP6 E;  1L0V A;  5ABE A;  5JH7 E;  4BJM A;  1O3X A;  3MXZ A;  5L3F B;  1IAP A;  4HWD A;  3TLW A;  1UUS A;  4HTE A;  4I55 E;  5LHG B;  4P0B A;  3SS1 A;  2FJA A;  2F4V T;  3NWI A;  3TLU A;  4TV8 E;  2XSB A;  4PJM A;  4YT0 A;  2V26 A;  4KMC A;  4ZHQ E;  4EGW A;  3AEB A;  2WWU A;  2DL1 A;  4CI3 B;  5LBQ B;  2WY2 A;  3RRC A;  3RH3 A;  4XBF B;  2I59 A;  2CLY C;  2ODV A;  1CHU A;  3AXJ A;  4DID B;  4JYA T;  4Z90 A;  4UVB B;  4IRE A;  4X1K E;  3AE9 A;  4I50 E;  2XM1 A;  2J62 A;  3GWH A;  4UV9 B;  4G2A A;  1ZOY A;  2XSA A;  3U3I A;  4XAX B;  4KHZ F;  4WBN E;  4CZZ B;  3VRA A;  2V7K A;  4PK4 A;  1W0A A;  3OJA A;  4NPP A;  5JQG E;  3N9N A;  3AVS A;  4MLK A;  5FP3 A;  2BZB A;  5ABF A;  4ZI2 C;  4Z91 A;  2YU2 A;  5EK4 A;  3U78 A;  1XZY A;  2X9H A;  4WBO A;  3EAB A;  2WDR A;  3K3O A;  1YKH B;  5HCJ A;  4MBQ A;  2DCF A;  3AEE A;  5J1G A;  5IHY A;  2KWH A;  1NAF A;  5F8P A;  2MPK A;  3PUG A;  3RIF A;  2Y8D A;  3FBZ A;  1DU2 A;  2JPF A;  4CXW A;  4JI5 T;  3ZYM A;  4DV4 T;  1UX4 A;  3C4X A;  2NP9 A;  3L09 A;  5AQK B;  2UUB T;  2W4X A;  4J2C A;  4COF A;  3I0Q A;  5JVD E;  4H9N C;  4A98 A;  3ONL C;  3RF1 A;  4GK0 E;  4YTP A;  2CEA A;  4DMV A;  2WDV A;  4JLE A;  4NUV A;  2Q9Q B;  3EVY A;  4UVC B;  4DR5 T;  4ZI2 D;  3UT5 E;  5L3G B;  4DR7 T;  4ZXL A;  3HI2 A;  5CFB A;  2WS3 A;  4O2B E;  5L3D B;  3AED A;  3LK3 B;  4B3M T;  4JI0 T;  3HKD E;  2NTY A;  3P7I A;  2ES0 A;  2X9X A;  1UGO A;  2DHR A;  1SUM B;  5AQI B;  2YOE A;  2V6Y B;  1XDO A;  2CXL A;  4CN4 A;  1XMO T;  3CX7 B;  1Z8U A;  3SWH A;  3AE7 A;  3W15 B;  3Q5E A;  4ILC A;  5A1L A;  4E7Z A;  5H6Q B;  1US7 B;  4JUY A;  3KFW X;  4I43 B;  1FEW A;  3FZM B;  3T1Y T;  4DV1 T;  1YD8 G;  2XQ6 A;  4LML A;  2YDQ A;  2E5L T;  2ZM0 A;  3GMI A;  3AA6 B;  5LG3 A;  3VKG A;  3AVR A;  4JI8 T;  3AE1 A;  4TX5 A;  4JBW F;  1KFY A;  2XPK A;  2XAG B;  5JRC B;  4WNK A;  5KX5 E;  2DWG A;  2Q9Q A;  4EYY R;  2CPT A;  3P50 A;  4JI2 T;  4AKG A;  2LE8 A;  3EHZ A;  4L0R A;  2ODU A;  3MJX A;  1KNP A;  1W0B A;  5JDQ A;  5L47 A;  1XNQ T;  4JEU B;  3JAE A;  2KND A;  2CWO A;  3RYF E;  1D0Z A;  2KMF A;  5DQW A;  1D1B A;  3PDY A;  3RIA A;  3PUQ A;  3MA9 A;  2UXB T;  2XQ7 A;  3B5M A;  2WWV A;  4QH4 A;  4O2A E;  4EXT A;  1Y64 B;  3AE8 A;  2OA5 A;  3PUS A;  3UUL A;  4YXD A;  2LKG A;  2CM0 A;  3KVA A;  2DLR A;  2N2N A;  2XAS B;  1D1A A;  2A72 A;  3QB5 A;  2I0M A;  2ZM2 A;  2XQ8 A;  1UX5 A;  3ZYK A;  5LB7 B;  2N9D A;  4L5G A;  2PBI A;  4HKA A;  1UK5 A;  2M6I A;  1UUR A;  3MAC A;  4JI1 T;  4YSX A;  3QB5 K;  3OTO T;  5HWY A;  4UF0 B;  4JI3 T;  1HR0 T;  4U3C A;  3LG7 A;  4EZ4 A;  5LHH B;  5AQL B;  3VKH A;  3B13 A;  3BQK A;  2VQE T;  5LMN T;  4P0A A;  4AKH A;  5JR9 B;  3MKD A;  2LLY A;  3J9X 1;  5HYA A;  3P4S A;  3CKD A;  1KF6 A;  2E8I A;  3UU4 A;  2A3D A;  1NWM X;  5FXW A;  2W66 A;  4PNI A;  1QUU A;  3ZMU B;  5BR8 T;  1NEN A;  1MIW A;  1KNZ A;  3KBU A;  4DV3 T;  2YDR A;  1QSD A;  5AQU B;  3UFE A;  1MNE A;  2MBG A;  4LF7 T;  5HAX A;  4IGU A;  3CX8 B;  2R6G F;  5JRE A;  2VKO A;  3Q5X A;  2JMK A;  2DWK A;  2YK0 A;  3KV6 A;  4AQG A;  2V7J A;  2D0U A;  4PFP A;  5GON E;  4UF0 A;  2YU1 A;  3P4P A;  2YEV C;  2WAU A;  2Q9Q C;  4ILA A;  1IJ6 A;  3A8Y C;  4OFZ A;  4ANJ A;  3AEG A;  5AQG B;  1ZHC A;  1XNR T;  4NXN T;  5JR9 A;  2IW5 B;  2UUA T;  2BG9 B;  4ERR A;  1KK7 A;  4AIS A;  3E08 A;  4DVD A;  1WYB A;  3PUW F;  2XAH B;  3UQ4 A;  5CA1 E;  3WAJ A;  4F6R C;  2VAS A;  2WDQ A;  5HXE A;  3TLS A;  2V7L A;  3QUJ A;  2WU5 A;  3CVR A;  4HEA A;  1OWA A;  5LJM A;  3TKL B;  3OPC A;  2C5J A;  2LHN A;  5F5W A;  4U72 A;  5CGM A;  3SRZ A;  2B76 A;  2KLQ A;  2CCQ A;  3TLT A;  3N9L A;  4BAY B;  5JDF A;  3ZSS A;  4JI7 T;  4DUZ T;  3ZCJ A;  1ZV4 X;  3CWZ B;  4ZOL E;  3AA7 B;  1N33 T;  3ONX A;  5HCM A;  5H6R B;  2XAF B;  2FJE A;  1MND A;  3JCF A;  2LEH A;  2Q9Q D;  2PG8 A;  2FUP A;  3RX6 A;  5ABF B;  3OKQ A;  2BG9 A;  2K9A A;  4QH1 A;  2C0S A;  4AKL A;  5LNK A;  2HN1 A;  2X51 A;  2BG9 E;  4YJ3 E;  4AQF A;  4IE6 A;  2WB5 A;  4B3R T;  3ZJ1 A;  2VL0 A;  2MOZ A;  3I0O A;  3RYH E;  3OBV E;  4UV8 B;  4BA9 A;  2WSS V;  2BKN A;  5FL1 A;  5LHI B;  1J5E T;  3ZPO A;  2CMR A;  3AEA A;  2N1G A;  4PAG A;  4X5T A;  3O1J A;  2ZLY A;  2YDS A;  4PJJ A;  2YIN A;  3C51 A;  3CX6 B;  4O4L E;  4ZZC A;  3ZC0 A;  2XTL A;  5AQS B;  1VCT A;  2WZH A;  3K3N A;  3P4R A;  3JAD A;  2IUB A;  2JIW A;  2NR4 A;  5AQM B;  5AFU L;  4KUM B;  4PJN A;  5C2T A;  2V7I A;  3UFG A;  3AA1 B;  4OHF A;  3IF8 B;  2NOX A;  2L8K A;  5LMU T;  4F8H A;  2X9Y A;  5L3E B;  3IBP A;  2Z6E A;  1MIY A;  4ILB A;  3ZN0 B;  3O9X A;  2LOP A;  5JR9 C;  4LF6 T;  4AQY T;  2IML A;  4JI4 T;  3QK6 A;  4EAH A;  3WI3 A;  3FHN A;  3K1S A;  2J4G A;  3UTK A;  3UU3 A;  4HFC A;  2G0U A;  2Y48 B;  4ZI3 D;  3F2E A;  5TAO A;  3CML A;  3UUN A;  3C4Z A;  4TNW A;  4NUU A;  3GN5 B;  4QX7 B;  3PTR B;  2XQ9 A;  4AKR B;  5J2U E;  2VKD A;  2HPL A;  1LRZ A;  5AQP B;  2VVS A;  3G06 A;  1FJG T;  4I0U A;  2QRX A;  4EEB A;  2HN2 A;  3EAM A;  2BS2 A;  2Y6X A;  1LVK A;  4TN7 B;  3T1H T;  3FBL A;  3CPZ A;  1HTJ F;  1KNR A;  2K5B B;  2WU2 A;  4KHP T;  4TWF A;  3RPU A;  3HR0 A;  2XQA A;  1YQ3 A;  5ADX L;  4EED A;  3EDU A;  3NBX X;  4O4I E;  5JDH A;  3JAF A;  2LOS A;  4KI0 F;  4UVA B;  4H9S E;  2BG9 C;  3IEE A;  1N36 T;  1Z0P A;  4KX6 A;  5FYM A;  5FXX A;  2L3L A;  1YQ4 A;  1G8X A;  4IDZ A;  4AQF C;  4O4J E;  3C64 A;  1J1J A;  2BKO A;  3N9O A;  1N34 T;  4WZX A;  4DR6 T;  2QYW A;  2LM2 A;  2X9W A;  1H7C A;  2W67 A;  2CE7 A;  2CHN A;  4ZI7 E;  4U31 A;  1SE7 A;  4CN6 A;  2AXD S;  3GN5 A;  3LFM A;  5AQH B;  2K3W A;  3AAE B;  3ETV A;  5HEH A;  2QA7 A;  4DR1 T;  2JQH A;  3EI0 A;  3V5U A;  3M3Z B;  2XZE A;  5FMN A;  3I9Y A;  4A97 A;  4IE5 A;  3ESL A;  3AA0 B;  5HXR A;  3H3A A;  2JQ9 A;  2X0L B;  3UU6 A;  2D5U A;  3EUH A;  3RKO A;  1WLX A;  2HPJ A;  3ETU A;  2LHR A;  2V7M A;  5KDM C;  2WZI A;  5FY0 A;  2NWB A;  3H3M A;  1YXR A;  3ZC1 A;  4ILU A;  4ASK A;  2UXC T;  4OYK A;  1T72 A;  3FXE B;  4DV5 T;  4AXP A;  5DJQ C;  2LT3 A;  2WMO A;  2EHO D;  5KXJ A;  1MMN A;  4IDN A;  3AAI A;  2BS3 A;  3NRX A;  3PU3 A;  2D9D A;  3VR8 A;  4DMW A;  1U4Q A;  3O4X E;  5FNV E;  3HKB E;  3KVB A;  1XMQ T;  4YLH A;  4TUY E;  2VQF T;  4MHC A;  3ZT5 A;  4IDQ A;  3R6N A;  1Y01 A;  3VRB A;  1S94 A;  3MZK B;  2CWY A;  2PJQ A;  2YKS A;  4N78 D;  2FBW A;  2ACX A;  3PJA A;  4LMK A;  1HX1 B;  4EZH A;  1M7K A;  4U74 A;  4PFO A;  4DV6 T;  2XAJ B;  4GKK T;  5JDN A;  5LG4 A;  3RQW A;  1D0X A;  3ZT7 A;  2KXP B;  2E9X D;  4WYV A;  1T8B A;  4U33 A;  5KMG P;  5L4E A;  5ABG A;  5EK3 A;  2XUE A;  2VK9 A;  3PUY F;  3OVU A;  2BVM A;  1LVF A;  2LRK A;  4HE8 A;  5JDL A;  5FKY A;  3DP7 A;  5HEJ A;  4DV7 T;  1HNW T;  4IDO A;  2ZM6 T;  1NEK A;  3PJA J;  3O1H A;  4UXN B;  5E0O A;  5L2L A;  3E0Z A;  1HS7 A;  4UIG A;  4QXH B;  3HKE E;  4DO0 A;  4L9I A;  3MK7 C;  1WRD A;  3OYX A;  3LBX B;  3RKG A;  3R84 B;  2VUR A;  1BR4 A;  3V5S A;  3P8C D;  3AEC A;  3T8O A;  4Q25 A;  4DUY T;  3AE3 A;  1JNZ A;  3RYC E;  2XQ4 A;  1X79 A;  5AQV B;  5AQQ B;  2LRL A;  4DR2 T;  3VU7 H;  2HH7 A;  3CIR A;  1HNZ T;  2ZM8 A;  4AI6 A;  2PTF A;  4GIW A;  2B1E A;  3BQI A;  4GKJ T;  5AQF B;  5L4H A;  2JQQ A;  4GOU A;  3I9W A;  4KBM B;  2CRB A;  4HFD A;  4LFA T;  3AE5 A;  5JDM A;  4B3T T;  2ACZ A;  4CI2 B;  5ETW A;  4ZZB A;  3RYI E;  1D0Y A;  4GYS A;  4IST A;  2NW7 A;  1HF8 A;  5ABH A;  1OXZ A;  3LK2 B;  4B3S T;  1HNX T;  3JC6 C;  1VOM A;  1R8I A;  3FZK B;  2KSR A;  1WCR A;  4H9R C;  4TWH A;  4X1Y E;  3N2K E;  4IE0 A;  2EHO B;  4MAL A;  5EZY E;  1BR2 A;  3HL6 A;  4YTN A;  1N32 T;  2E2A A;  2VWA A;  3LBX A;  2E5V A;  4PK5 A;  4A56 A;  4X65 T;  2RP4 A;  2LSK A;  5HEO A;  4FI5 A;  2WP9 A;  4PK6 A;  3ZEF B;  4O4H E;  1HG5 A;  3AAA B;  2BDE A;  2CBI A;  1J5W A;  3A5X A;  2XM2 A;  2FJD A;  2XHE B;  3J7Y q;  1BR0 A;  3HKC E;  2UXX B;  4NXM T;  1ZP0 A;  3GA8 A;  4KP3 C;  3F31 A;  1JNR A;  5IWA T;  1ZEE A;  3FZL B;  2E9X B;  2H88 A;  3D0T A;  3KV9 A;  5LJN A;  4YSZ A;  3KIN B;  2A2F X;  1E7P A;  4QX8 B;  5BMV E;  4X1I E;  3BK9 A;  4YSY A;  3TLV A;  1S35 A;  1HCI A;  3QC9 A;  5LCY A;  1T7S A;  1FIO A;  4LF4 T;  1B7T A;  5CJ5 A;  3JC6 D;  3SOL A;  2UXN B;  2XY8 B;  2H7V C;  3PUX F;  1FMW A;  2EHO A;  2JJ9 A;  2W0G A;  4G63 A;  4IIJ E;  3S4U A;  1WYC A;  1E2A A;  3P4Q A;  2QGS A;  4WW0 A;  3HA4 A;  2W61 A;  3RQU A;  3PUA A;  4B6X A;  4ZI3 C;  1VCS A;  1WFD A;  1CUN A;  3LJC A;  3DTO A;  3ONJ A;  1GQE A;  5JDG A;  3PV0 F;  4YHJ A;  4LF5 T;  1EZ3 A;  1HG2 A;  2XJ7 A;  4AKI A;  2AE9 A;  1WR0 A;  1IBK T;  5F3J A;  2VKH A;  2BVL A;  4PW8 A;  3Q9D A;  5EK2 A;  4ISS A;  2CXD A;  2LSG A;  4Z8X A;  3IHR A;  2LKH A;  3ZMS B;  2E9X A;  5LOV E;  1SA0 E;  3ZKR A;  4ZS2 A;  3CQC B;  4IL4 A;  4QKN A;  4XZC A;  5M4Y A;  2X0Y A;  3L39 A;  3UU5 A;  5LGT B;  5C3J A;  4H63 V;  5FY1 A;  3P4W A;  5AQR B;  5FVK A;  2X68 A;  1G73 A;  2X67 A;  2SPC A;  1MMG A;  3LDQ B;  5DAB A;  2H3R A;  2VVN A;  2V5D A;  5CB4 E;  5L3B B;  2L9Q A;  4DR4 T;  4PJL A;  3ZST A;  2VB6 A;  4X62 T;  3E22 E;  5FY7 A;  1I6Z A;  2NW9 A;  2CBJ A;  2YN6 A;  4HWF A;  1HFA A;  3RC8 A;  3N9P A;  3Q2M A;  1XDP A;  1OED B;  3VHL A;  4EYU A;  2X0H A;  4IT4 A;  4U7Y A;  3Q5D A;  2NTX A;  5AQO B;  5HXC A;  2FJB A;  2WM9 A;  3RI5 A;  4IE7 A;  2XQ3 A;  1QLB A;  2DI4 A;  2XQ5 A;  2J47 A;  3UU8 A;  4TWD A;  3UUM A;  3L8R A;  4HN9 A;  2PFV A;  4O8S A;  3RIU A;  1W9R A;  4X66 T;  3CK6 A;  2J1D G;  3M65 A;  2JMH A;  2XAQ B;  4H9O C;  4V1A v;  2A9U A;  5CA0 E;  3SFD A;  3AE2 A;  3CQX C;  1MMD A;  2KWI B;  3LSV A;  4OK0 A;  4YFS A;  3K8P C;  5J0Z A;  4HWC A;  2V6X A;  3QOF A;  2JRK A;  4U2Y A;  2UXD T;  1KEY A;  2OLT A;  2KIN B;  1HX8 A;  4DBQ A;  3X1D A;  3N2G E;  5IYZ E;  2LSI A;  3ANW B;  2EHO C;  3N9M A;  1BR1 A;  4LFC T;  3PU8 A;  2W62 A;  2MTQ A;  3UUX B;  1IBM T;  3UUB A;  2IHR 1;  2K48 A;  1OED A;  4ZS3 A;  3ZJ2 A;  2BKP A;  5LGN B;  1OED E;  1VRB A;  4OYJ A;  4U2Z A;  3PUR A;  5IUX A;  2W00 A;  2XQY A;  3DJB A;  2IIU A;  1XWM A;  4H63 H;  4EOZ B;  1SHZ C;  2E9X C;  4HFE A;  1AJ3 A;  2NW8 A;  4GYR A;  3N5L A;  4CXY A;  1D1C A;  2VKJ A;  4QWN B;  5LBM A;  1IZN B;  4QHO A;  3RRW A;  4P1N A;  4IE4 A;  5AQJ B;  4LF8 T;  1ZKE A;  4JV5 T;  4CI1 B;  4DBR A;  5HWX A;  1T98 A;  5FL0 A;  3AE6 A;  5J2T E;  4YHH T;  2M6B A;  4IL9 A;  1M62 A;  1YW0 A;  3KV4 A;  3ANW A;  4QXB B;  4LMJ A;  3ZMV B;  2V5C A;  1E1H B;  4UR9 A;  1U5P A;  2MAW A;  5HEG A;  1MMA A;  4TNV A;  4YTM A;  2UUC T;  2HHH T;  4X64 T;  3PUV F;  1MIV A;  3B57 A;  4QXC B;  2V6Y A;  3PUZ F;  5C8Y E;  3AB3 B;  3O1I A;  3LK4 2;  3KBT A;  5LGU B;  3ZN1 B;  4M1P A;  3FZH B;  2WCA A;  2CLY B;  2K24 A;  4GK5 E;  4UEM A;  4CQI A;  4QH5 A;  4ADZ A;  3RGL A;  3ZYL A;  4JI6 T;  2IC9 A;  1WR6 A;  3FB2 A;  3IA3 A;  4LF9 T;  1IJ5 A;  5LA6 E;  3PE0 A;  2ZMA A;  3AEF A;  2IAK A;  4DV2 T;  3KV5 A;  2BS4 A;  3RIU C;  5JRC A;  2CA5 A;  2D0T A;  2LSJ A;  2VL8 A;  4JEH B;  4HWH A;  4TV9 E;  2M67 A;  2I6H A;  2BBH A;  3WAK A;  4HGA A;  4UEL A;  4A5X A;  4MFR A;  4YJ2 E;  4LFB T;  4YY3 T;  5AQT B;  2CHO A;  3SFE A;  4H9P C;  1UCU A;  5L3C B;  4DR3 T;  3UQ7 A;  3Q5W A;  2IC6 A;  1FMV A;  3FXD B;  4EIW A;  5LYJ E;  2LJL A;  4CN1 A;  2W63 A;  4FJO A;  3NZP A;  1OED C;  1YKE B;  2H7O A;  4CXX A;  2GK9 A;  5FXV A;  5AQN B;  3NVO A;  5DQV A;  2MYS A;  3ABV A;  3ZCI A;  4ZEY A;  5LXT E;  3KDS E;  2D2S A;  4NIQ A;  3NZQ A;  4HFB A;  4HFI A;  5FVL A;  4U7I A;  2RA1 A;  3RLF F;  3NRY A;  3L3P A;  2X66 A;  5HXS A;  1W09 A;  3C98 B; 
#chains in the Genus database with same CATH homology
 3HA4 A;  2Y6X A;  1LVK A;  2W61 A;  4TN7 B;  2CXF A;  3MA9 A;  2LM9 A;  3FBL A;  3CPZ A;  3PUA A;  4B6X A;  4ZI3 C;  2WMN A;  1HTJ F;  2P9B A;  2K5B B;  1CUN A;  3RPU A;  3HR0 A;  3LJC A;  3DTO A;  4O2A E;  5ADX L;  4EXT A;  4C91 A;  1Y64 B;  3EDU A;  3NBX X;  4O4I E;  5JDG A;  4YHJ A;  1EZ3 A;  1HG2 A;  2OA5 A;  5JDH A;  4AKI A;  3PUS A;  2LOS A;  4UVA B;  4C90 A;  5HXH A;  4H9S E;  3UUL A;  3IEE A;  2C5I T;  1Z0P A;  3EDV A;  5FYM A;  2CM0 A;  3KVA A;  2VKH A;  5FXX A;  2BVL A;  2DLR A;  2L3L A;  5F3J A;  2KZ7 B;  4PW8 A;  1G8X A;  2KT9 A;  3Q9D A;  4HFV A;  5EK2 A;  4ISS A;  2N2N A;  4IDZ A;  2CXD A;  2LSG A;  4AQF C;  4Z8X A;  2XAS B;  3OYZ A;  4O4J E;  3IHR A;  3K3Q C;  4DND A;  1D1A A;  2A72 A;  3C64 A;  3ZMS B;  1V9D A;  2ZM2 A;  4H9Q C;  2E9X A;  1UX5 A;  3ZYK A;  3N9O A;  4X20 E;  2N9D A;  3CQG B;  4L5G A;  3RC3 A;  5LOV E;  2PBI A;  3ZMZ B;  1SA0 E;  3ZLI A;  4HKA A;  4PK6 A;  4ZS2 A;  3CQC B;  3MAC A;  2X9W A;  1H7C A;  3C4W A;  2CE7 A;  4I4T E;  4QKN A;  4ZI7 E;  4XZC A;  3F57 A;  5M4Y A;  5HWY A;  3ZMT B;  4UF0 B;  5LGT B;  5JRC A;  2C5K T;  2DNX A;  2V1D B;  3GN5 A;  4H63 V;  5FY1 A;  3LG7 A;  3C50 A;  4EZ4 A;  3LFM A;  5LHH B;  2X68 A;  3VKH A;  1G73 A;  2X67 A;  2WBL A;  3B13 A;  2SPC A;  4EB6 E;  4E7S A;  1MMG A;  3BQK A;  5DAB A;  2H3R A;  1LKX A;  2LSY A;  4P0A A;  3AAE B;  3ETV A;  2QA7 A;  4AKH A;  5JR9 B;  3MKD A;  3J9X 1;  5CB4 E;  5HYA A;  3V5U A;  4TZ4 C;  5L3B B;  3N9Q A;  2L9Q A;  5FMN A;  4P09 A;  3N2O A;  3I9Y A;  4IHJ E;  3H37 A;  3BQL A;  4PJL A;  4IE5 A;  3CKD A;  2VB6 A;  3E22 E;  3ESL A;  5FY7 A;  2E8I A;  3AA0 B;  2A3D A;  1NWM X;  4K0U A;  5FXW A;  2NW9 A;  4PNI A;  5FXZ A;  5HXR A;  3I1A A;  3H3A A;  4BJN A;  1HFA A;  2X0L B;  5LP6 E;  2D5U A;  1QUU A;  3EUH A;  3RC8 A;  3N9P A;  3ZMU B;  3RKO A;  3Q2M A;  1WLX A;  2HPJ A;  3ETU A;  2LHR A;  3VHL A;  5JH7 E;  4EYU A;  1MIW A;  4BJM A;  2V7M A;  1O3X A;  3MXZ A;  5KDM C;  5L3F B;  1KNZ A;  3KBU A;  1IAP A;  4HTE A;  5FY0 A;  4I55 E;  2NTX A;  5LHG B;  1QSD A;  5HXC A;  2NWB A;  4P0B A;  3UFE A;  1MNE A;  2WM9 A;  3SS1 A;  4IE7 A;  2MBG A;  5HAX A;  3ZC1 A;  4IGU A;  3CX8 B;  4ILU A;  4ASK A;  4TV8 E;  4OYK A;  5JRE A;  2VKO A;  3FXE B;  4PJM A;  3Q5X A;  2DI4 A;  2JMK A;  2DWK A;  2V26 A;  2YK0 A;  3KV6 A;  4KMC A;  4AXP A;  4ZHQ E;  5DJQ C;  2V7J A;  4AQG A;  2LT3 A;  2WMO A;  2EHO D;  2D0U A;  1MMN A;  3AAI A;  3UUM A;  3NRX A;  3PU3 A;  4PFP A;  2WWU A;  4DMW A;  1U4Q A;  4HN9 A;  2PFV A;  3O4X E;  4CI3 B;  4O8S A;  5LBQ B;  5FNV E;  3HKB E;  5GON E;  3RRC A;  4UF0 A;  3KVB A;  2YU1 A;  4YLH A;  4TUY E;  2J1D G;  3RH3 A;  2YEV C;  2WAU A;  4MHC A;  2Q9Q C;  3M65 A;  2JMH A;  2XAQ B;  4H9O C;  4XBF B;  1IJ6 A;  3R6N A;  4V1A v;  2I59 A;  5CA0 E;  1S94 A;  3CQX C;  4OFZ A;  1MMD A;  2CLY C;  2KWI B;  3MZK B;  4ANJ A;  4OK0 A;  2CWY A;  2ODV A;  2PJQ A;  4YFS A;  1ZHC A;  3K8P C;  4N78 D;  5JR9 A;  2IW5 B;  4UVB B;  2ACX A;  2JRK A;  4ERR A;  1KK7 A;  2KIN B;  1HX8 A;  4DBQ A;  3E08 A;  4EZH A;  4DVD A;  3N2G E;  4U74 A;  1WYB A;  2LSI A;  2XAH B;  4PFO A;  4X1K E;  3ANW B;  5IYZ E;  2EHO C;  2XAJ B;  3N9M A;  5CA1 E;  1BR1 A;  4I50 E;  3PU8 A;  3GWH A;  3WAJ A;  5JDN A;  4UV9 B;  4G2A A;  5LG4 A;  2W62 A;  4F6R C;  2MTQ A;  3UUX B;  3U3I A;  1D0X A;  4XAX B;  4WBN E;  2VAS A;  2KXP B;  4CZZ B;  2K48 A;  2E9X D;  5HXE A;  2V7K A;  4PK4 A;  5KMG P;  4ZS3 A;  3ZJ2 A;  3OJA A;  2V7L A;  3QUJ A;  5EK3 A;  2XUE A;  3CVR A;  5JQG E;  2VK9 A;  4HEA A;  1OWA A;  5LGN B;  5LJM A;  3N9N A;  2BVM A;  3AVS A;  1VRB A;  4MLK A;  3TKL B;  1LVF A;  4OYJ A;  4HE8 A;  2C5J A;  2LHN A;  2BZB A;  4U72 A;  5FP3 A;  3SRZ A;  5JDL A;  3PUR A;  4ZI2 C;  2W00 A;  2KLQ A;  2CCQ A;  2XQY A;  3DP7 A;  2YU2 A;  4BAY B;  3N9L A;  3DJB A;  5EK4 A;  5JDF A;  3U78 A;  2X9H A;  4WBO A;  3ZCJ A;  1ZV4 X;  3K3O A;  4H63 H;  1YKH B;  4EOZ B;  3CWZ B;  4ZOL E;  3AA7 B;  4MBQ A;  1SHZ C;  2DCF A;  3O1H A;  5J1G A;  4UXN B;  3ONX A;  5E0O A;  5H6R B;  5IHY A;  5L2L A;  2KWH A;  2XAF B;  2E9X C;  3E0Z A;  1NAF A;  1HS7 A;  4UIG A;  1AJ3 A;  4QXH B;  5F8P A;  3HKE E;  1MND A;  2NW8 A;  4DO0 A;  4GYR A;  3N5L A;  4CXY A;  4L9I A;  3MK7 C;  3PUG A;  1WRD A;  3OYX A;  1D1C A;  2VKJ A;  3LBX B;  4QWN B;  2Y8D A;  3FBZ A;  5LBM A;  1IZN B;  3R84 B;  2LEH A;  2JPF A;  1BR4 A;  4QHO A;  3V5S A;  3RRW A;  2Q9Q D;  4IE4 A;  1ZKE A;  2PG8 A;  3P8C D;  3T8O A;  4CI1 B;  4DBR A;  4CXW A;  5HWX A;  1T98 A;  3RYC E;  3ZYM A;  3RX6 A;  5J2T E;  3OKQ A;  1UX4 A;  3C4X A;  2NP9 A;  1X79 A;  2K9A A;  3L09 A;  1YW0 A;  3ZEF B;  3KV4 A;  3ANW A;  2C0S A;  4QXB B;  4AKL A;  5LNK A;  3VU7 H;  2X51 A;  2HH7 A;  3ZMV B;  4YJ3 E;  2ZM8 A;  4AQF A;  4IE6 A;  4J2C A;  3ZJ1 A;  4AI6 A;  1E1H B;  2MOZ A;  3I0O A;  3RYH E;  3OBV E;  1U5P A;  4GIW A;  4UV8 B;  2B1E A;  3BQI A;  1MMA A;  4BA9 A;  2JQQ A;  4GOU A;  3I9W A;  4KBM B;  3I0Q A;  5JVD E;  4H9N C;  1MIV A;  5JDM A;  2WSS V;  3B57 A;  4CI2 B;  5ETW A;  5LHI B;  4QXC B;  3RYI E;  4GK0 E;  1D0Y A;  3ZPO A;  2CMR A;  2CEA A;  4GYS A;  5C8Y E;  2N1G A;  4PAG A;  4IST A;  4DMV A;  4JLE A;  4NUV A;  2NW7 A;  3O1J A;  2Q9Q B;  3AB3 B;  1HF8 A;  2ZLY A;  3LK4 2;  3EVY A;  3O1I A;  4PJJ A;  4UVC B;  3KBT A;  1OXZ A;  2YIN A;  3C51 A;  5LGU B;  3CX6 B;  3ZN1 B;  4ZI2 D;  3UT5 E;  4M1P A;  4O4L E;  5L3G B;  3LK2 B;  2CLY B;  2K24 A;  4GK5 E;  4UEM A;  4CQI A;  3ZC0 A;  4ADZ A;  3JC6 C;  1VOM A;  3ZYL A;  3HI2 A;  2XTL A;  2IC9 A;  4O2B E;  4H9R C;  1WR6 A;  5L3D B;  3K3N A;  3FB2 A;  3LK3 B;  4X1Y E;  3N2K E;  4IE0 A;  3HKD E;  1IJ5 A;  2EHO B;  2NTY A;  4MAL A;  3P7I A;  5EZY E;  5LA6 E;  1BR2 A;  3HL6 A;  2ES0 A;  3PE0 A;  5AFU L;  2ZMA A;  2X9X A;  4KUM B;  2DHR A;  2IAK A;  2VWA A;  3LBX A;  4PJN A;  3KV5 A;  4PK5 A;  2V7I A;  4A56 A;  2RP4 A;  2LSK A;  4FI5 A;  3AA1 B;  4OHF A;  2CA5 A;  2CXL A;  2D0T A;  2LSJ A;  2VL8 A;  3IF8 B;  4O4H E;  1HG5 A;  2NOX A;  3AAA B;  4JEH B;  2L8K A;  2BDE A;  3CX7 B;  4TV9 E;  2M67 A;  3SWH A;  2X9Y A;  5L3E B;  3IBP A;  3W15 B;  2Z6E A;  1MIY A;  3WAK A;  4HGA A;  4UEL A;  5A1L A;  3A5X A;  3ZN0 B;  3O9X A;  2LOP A;  4MFR A;  4E7Z A;  5JR9 C;  2XHE B;  4YJ2 E;  5H6Q B;  1US7 B;  4JUY A;  3KFW X;  4I43 B;  1FEW A;  3J7Y q;  1BR0 A;  3HKC E;  2UXX B;  3QK6 A;  4EAH A;  1YD8 G;  3GA8 A;  4H9P C;  1UCU A;  3WI3 A;  2ZM0 A;  4KP3 C;  5L3C B;  3GMI A;  3F31 A;  3AA6 B;  3FHN A;  1ZEE A;  3Q5W A;  3VKG A;  3AVR A;  2E9X B;  2IC6 A;  1FMV A;  3FXD B;  4EIW A;  5LYJ E;  2LJL A;  3D0T A;  2W63 A;  4FJO A;  3UTK A;  4TX5 A;  3KV9 A;  3NZP A;  5LJN A;  1YKE B;  3KIN B;  2H7O A;  2A2F X;  2G0U A;  2XAG B;  4QX8 B;  4CXX A;  5BMV E;  5JRC B;  4WNK A;  4X1I E;  5KX5 E;  3BK9 A;  2GK9 A;  2Y48 B;  2DWG A;  2Q9Q A;  4ZI3 D;  4EYY R;  3F2E A;  5TAO A;  1S35 A;  4AKG A;  3CML A;  5FXV A;  2LE8 A;  1HCI A;  3UUN A;  3QC9 A;  4L0R A;  5LCY A;  2ODU A;  3C4Z A;  1FIO A;  3MJX A;  5DQV A;  2MYS A;  4NUU A;  1B7T A;  3GN5 B;  4QX7 B;  3PTR B;  5JDQ A;  4AKR B;  3ZCI A;  3JC6 D;  5LXT E;  3KDS E;  2D2S A;  3SOL A;  2UXN B;  5J2U E;  2VKD A;  2HPL A;  2H7V C;  1FMW A;  3NZQ A;  4JEU B;  1LRZ A;  2EHO A;  2JJ9 A;  2W0G A;  4G63 A;  2RA1 A;  4IIJ E;  2KND A;  2CWO A;  3S4U A;  1WYC A;  3RYF E;  3NRY A;  3L3P A;  2X66 A;  1D0Z A;  2KMF A;  2QGS A;  5DQW A;  1D1B A;  3PDY A;  5HXS A;  4WW0 A;  3PUQ A;  3C98 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...