5AQUB

Fragment-based screening of hsp70 sheds light on the functional role of atp-binding site residues
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
115
structure length
115
Chain Sequence
GPLGSNSPQEEVELKKLKHLEKSVEKIADQLEELNKELTGIQQGFLPKDLQAEALCKLDRRVKATIEQFMKILEEIDTLILPENFKDSRLKRKGLVKKVQAFLAECDTVEQNICQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords HEAT SHOCK COGNATE 71 KDA PROTEIN
publication title A fragment-based approach applied to a highly flexible target: Insights and challenges towards the inhibition of HSP70 isoforms.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chaperone
total genus 45
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2015-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02179 BAG BAG domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.120 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 BAG domain 5aquB00
3FZKB 1UK5A 1UGOA 5AQRB 1I6ZA 5AQQB 3A8YC 5AQTB 2D9DA 5AQIB 5AQUB 4HWHA 3FZLB 5AQJB 3FZMB 5AQVB 1M62A 5AQNB 5AQLB 5AQFB 3FZHB 5AQGB 5AQPB 4HWIB 3LDQB 5AQHB 5AQMB 5AQSB 1M7KA 4HWCA 5AQOB 1HX1B 3M3ZB 3FZFB 4HWFA 1T7SA 4HWDA 5AQKB
chains in the Genus database with same CATH superfamily
5HAXA 4B3RT 4PNIA 1MIVA 2J4GA 4QHOA 5L4HA 4YFSA 4AKGA 2BG9E 2C5IT 5HEUA 3AAEB 2W4XA 3ZKRA 4GOUA 4Z91A 5DJQC 1QLBA 3A7MA 4O4LE 3RKGA 1QSDA 3O1JA 1SHZC 3RIUA 1IZNB 3NZQA 3ZYMA 3NRYA 4HE8A 2E2AA 1YD8G 3L09A 1ZEEA 5HEGA 3VR8A 2Q9QA 4HGAA 2NWBA 1IJ6A 2CWOA 2M67A 2JQHA 3TLUA 2L8KA 2JIWA 1UX4A 2CLYC 3AE8A 2VQFT 2LKHA 4YTNA 2ZM0A 2MPKA 3PJAA 4TWDA 2LHRA 2YINA 2X68A 3ZT5A 4ADZA 2E9XC 4ZI3D 1XDPA 4MALA 2JQKA 2WWUA 5AQNB 4V1Av 4GYSA 3KVBA 1HNWT 3AEDA 1M7KA 4DIDB 4UVAB 3IHRA 1NENA 3AE3A 3Q5EA 3OTOT 2EHOA 3UU3A 4KUMB 5L3BB 5LB7B 5HEJA 5AQLB 3C98B 5JDLA 4KHPT 2MOZA 4U3CA 1FJGT 5AQMB 4XBFB 3C64A 3EHZA 2YU1A 4ZZBA 2XY8B 5LG3A 2KT9A 3VRBA 2UXXB 3JC6C 5JH7E 4LFBT 2XJ7A 3ONXA 3ZYLA 5LHIB 4U72A 2K24A 4JI0T 3PUZF 4HFDA 4ILUA 3ZT7A 2NW9A 2ZM6T 2W66A 1OEDC 4IT4A 2OA5A 3CQGB 2IMLA 5C3JA 3MK7C 4XAXB 3ZT6A 2VASA 1D1BA 3O1IA 4YHJA 1G73A 4DR4T 4PK5A 2BVMA 5EK2A 5ABFA 2E5VA 4HWFA 3I1AA 1IBKT 5F8PA 2NR4A 4F8HA 2KMFA 5DABA 2XAQB 5HXEA 1LRZA 4C90A 1HNZT 2D2SA 4I0UA 3UU8A 4DV2T 1KK7A 1UUSA 4JI5T 4X66T 2C5JA 3CX6B 4P0AA 4EYUA 4B3MT 4DUYT 2CXLA 2Y8DA 2BBHA 3Q9DA 3AA6B 4IE4A 1LKXA 3P4RA 3O1HA 4PAGA 2MAWA 3FZLB 3PV0F 3SOLA 2PTFA 4DV7T 4JI6T 3TLWA 4I50E 4JI3T 3PDYA 5IYZE 3M65A 4WZXA 5L47A 3AEFA 4EZHA 2NOXA 1G8XA 1KNPA 1ZV4X 3N2KE 4EB6E 4LF4T 2YDRA 3H3AA 1T98A 3CX8B 2H7VC 2VL8A 2VVNA 2XHEB 1Z0PA 3HKCE 2YU2A 2E9XA 2A3DA 2AXDS 5AQRB 1XDOA 2WWVA 3FXEB 3IEEA 4IGUA 3NWIA 1KFYA 2CXDA 3ANWA 4X62T 2VKHA 3ZN0B 4P0BA 2DI4A 3A8YC 2V7JA 4MFRA 5FY7A 3N2GE 5FNVE 3L39A 4NIQA 2XPKA 3MA9A 3FBZA 3P4PA 3EI0A 5JDMA 3CWZB 3UT5E 1B7TA 3CQCB 3T1YT 2M6BA 4NXMT 5CA0E 2HPLA 4TNVA 4EOZB 3Q5DA 3EAMA 3LK42 4LMJA 3RIAA 4QXHB 4JEUB 2E8IA 2P9BA 3IA3A 2V6XA 4LF7T 1KEYA 2XQ6A 1OEDA 3ETVA 4MLKA 4DV4T 4X1IE 5HXRA 1SA0E 2JRKA 4E7SA 5L3EB 3EABA 2BZBA 1US7B 1WR0A 2FUPA 5LHHB 3AE2A 5HWXA 2LRLA 3ONJA 4DR6T 1W9RA 3QUJA 1MNDA 4IDPA 2I59A 2CXFA 2LEHA 1YKHB 2IUBA 5IWAT 4AQYT 3RIUC 1D0YA 3VU7H 1WR6A 2VVSA 4EXTA 1U4QA 4YHHT 3WAKA 4X64T 2DNXA 3E22E 3HA4A 4PFOA 2V8SV 5JDNA 2OV9A 3ZMTB 2Q9QC 4EAHA 3PUQA 4DMVA 2IC6A 4I4TE 1VOMA 4TZ4C 5L3FB 3RH3A 4ILBA 4N78D 3TKLB 2WDQA 2CPTA 4PJNA 3SWHA 5M4YA 1W0BA 2F4VT 3ZLIA 5EK4A 5HEOA 3DJBA 3WAJA 1J1JA 4EYYR 1BR4A 2XQAA 2WS3A 1UGOA 3OJAA 3IBPA 4OYJA 5JREA 4KP3C 3P4WA 2FJDA 2WAUA 2VKDA 3ONLC 1X9BA 3K3QC 1E2AA 1HF8A 2FJEA 2W61A 3N9QA 4CN6A 3MZKB 3N9OA 2DLRA 5LJMA 5GONE 3RQWA 2UUCT 2BDEA 1W0AA 4JI7T 4H9RC 4PW8A 1R8IA 3JCFA 3RC8A 2J47A 2FBWA 3OPCA 1NEKA 3CMLA 1MMAA 4ZI3C 3UQ4A 3O4XE 3AA7B 3SS1A 4CI1B 4LF8T 2XQ7A 3KV4A 2ACXA 5L2LA 4TWFA 2XAHB 4YSXA 2FJAA 4UELA 4LMLA 4AQGA 1NAFA 3ETUA 4AXPA 2XUEA 5AFUL 2K9AA 2V7IA 5HXSA 2L9QA 2BG9B 3F31A 4U31A 3VKHA 2CBJA 2CE7A 2NW7A 2N1GA 1E1HB 4H9NC 2DCFA 3PU3A 5AQGB 3HI2A 2W62A 2CRBA 2V26A 4KHZF 2V7KA 3H37A 4Z8XA 3AXJB 5HWYA 2CWYA 2A72A 4LMKA 4QXBB 4U2YA 2X9WA 4G63A 5LG4A 3VKGA 2WBLA 5E0OA 2JJ9A 4AKHA 1VRBA 5LBQB 1HX1B 3CVRA 2IAKA 2CEAA 2WZIA 2X66A 3CQXC 3N9MA 5AQVB 3N2OA 3KBTA 5HCJA 4H63H 5A1LA 5AQSB 4QXCB 2XM2A 3MJXA 4X1KE 5JR9B 2CBIA 3F57A 3KINB 2C5KT 4ZOLE 2WMNA 5L4EA 3IF8B 4UF0B 4DV1T 4ANJA 2FJBA 4OK0A 2XSAA 2VK9A 4ZI7E 1O3XA 3UUNA 4G2AA 2PBIA 5L3GB 1HCIA 5LGTB 2QGSA 3PJAJ 1OEDE 4U7YA 3AVSA 2LSJA 3LDQB 4NPPA 4K0KT 1IBMT 3NVOA 3CK6A 2OLTA 4QX8B 3LK2B 1J5ET 3AE7A 3RGLA 4CXXA 4LFAT 3L8RA 2J1DG 5ABHA 2VB6A 3FBLA 4JBWF 4TN7B 4OYKA 4WNKA 2K48A 1ZKEA 2NW8A 2DWGA 3N5LA 3AE9A 4PK4A 3AAAB 3QC9A 4YJ3E 2XQ4A 4O4JE 2D9DA 5LMNT 4HEAA 5BR8T 2JQ9A 3BQLA 5FVLA 5LGNB 1N33T 3RKOA 5FP3A 1OWAA 2WB5A 5JDGA 3V5UA 5L3DB 1HG5A 2V7MA 4CN4A 2KLQA 2RA1A 4IE0A 3KDSE 3AECA 1YQ3A 5L3CB 2YOEA 4O4IE 2LOSA 3ZMVB 2MBGA 4AKIA 4HFHA 4O4HE 1D0XA 3JAFA 5LJNA 4JEHB 4O2AE 3I9WA 2LSIA 2WCAA 4J2CA 4IL4A 1XWMA 4HFBA 3TLSA 2J62A 4NUVA 3ZMUB 5DQWA 2VQET 5AQKB 5J0ZA 1X79A 4UIGA 2ODVA 3B57A 5KX5E 4DV3T 3UTKA 2H88A 3Q2MA 2UXNB 2PFVA 2DL1A 3ZSSA 3VHLA 4JV5T 1H7CA 2QA7A 4MHCA 4TV8E 2H89A 1VCSA 1EZ3A 5LOVE 4COFA 2WZHA 4FJOA 4DBQA 3KVAA 4UR9A 2BG9A 2UXCT 1YQ4A 4O2BE 1WRDA 4IDOA 2VKOA 4PJJA 3GA8A 2WP9A 2YEVC 1AJ3A 4DV6T 2JPFA 3FZKB 3JC6D 2HN1A 2HN2A 4E7ZA 3J9X1 3KV6A 2X51A 2UU9T 2BS3A 4B3ST 2L3LA 3UUXB 1KNRA 2XAGB 3AXJA 4BJMA 4IHJE 1Y64B 2XASB 4PK6A 4EZ4A 4UEMA 4AISA 2X9YA 3EUHA 2WSSV 4YLHA 1ZHCA 2LSKA 2M6IA 1D1CA 1WCRA 4QH1A 3RI5A 3UUMA 3ZEFB 2LOPA 2AE9A 2NTYA 4HKAA 5LNKA 1N32T 5LBMA 2ODUA 3QNUA 3CIRA 2HH7A 4EEDA 2X9HA 2YDSA 2LKGA 4NUUA 4X1YE 5LGUB 2D0TA 5HCMA 2PJQA 2V5CA 4A97A 2XM1A 3LBXB 4BAYB 5FXVA 3RC3A 3TLVA 3RF1A 2YN6A 4HFVA 4CI2B 2MTQA 4Q25A 2XQYA 4UV8B 4WBNE 3BQKA 3JADA 3PURA 3ZC0A 5J1GA 3P4QA 4QH5A 4IDNA 1MIWA 4PFPA 2XAFB 5TAOA 5FMNA 1FEWA 2KZ7B 2W0GA 1I6ZA 3ZSTA 3X1DA 4OHFA 5F3JA 3VRAA 5JVDE 3RIFA 2VKJA 2A9UA 5HXCA 4TNWA 2CMRA 3PTRB 2X0HA 5FXWA 1N36T 3AA0B 3RPUA 4YJ2E 1WLXA 5AQUB 1XNQT 5ADXL 4H9PC 5FYMA 5H6RB 4DR3T 1BR0A 1MIYA 3AEEA 1JNRA 3GMIA 4HFCA 4F6RC 3R84B 4IL9A 4M1PA 4TX5A 4O8SA 4GK0E 3RYHE 4IE6A 4X65T 4HTEA 4X5TA 4WBOA 3K8PC 4DV5T 5FL0A 4JI8T 3RYIE 1T72A 3EDUA 1FMWA 3TLTA 1MMNA 4HWDA 2V7LA 4LFCT 3P4SA 2V5DA 2YK0A 5LCYA 3ZMZB 2E5LT 3AAIA 4L9IA 4YTPA 2PG8A 4ZI2D 3EDVA 1IJ5A 2ZLYA 3BK9A 2UUBT 2LM2A 4XZCA 3PUWF 3U3IA 3RQUA 1OXZA 2XQ8A 4ZS3A 1UX5A 5DQVA 3ZJ2A 3ESLA 4LF5T 1MMGA 4X20E 1M62A 1VCTA 1U5PA 2XQ9A 5IUXA 5AQOB 4GYRA 4B6XA 1FMVA 4AKLA 3UUBA 3QB5A 4FI5A 5CA1E 4U2ZA 1QUUA 2X0YA 4GKKT 5AQJB 2D0UA 4JLEA 3J7Yq 4H9OC 4TV9E 1XZYA 5FVKA 3Q5WA 2I6HA 3AE6A 3RYCE 3K3NA 5EZYE 4UVCB 1D0ZA 4CXWA 5C2TA 3PE0A 4JUYA 3C4WA 3VR9A 3RRCA 4YSYA 4DMWA 3UFEA 5AQPB 2BKOA 2QVAA 4KMCA 2Q9QD 5JRCB 2Y6XA 4IIJE 4CQIA 5C8YE 4ZS2A 3ANWB 4DBRA 3AE5A 3LK3B 2UUAT 1HFAA 1NWMX 3M3ZB 3FHNA 1LVFA 4QWNB 3P50A 3AEGA 3LFMA 3RRWA 3CX7B 1KF6A 2WMOA 1LVKA 5HEHA 2H3RA 5AQFB 2ES0A 1V9DA 2CCQA 1DU2A 1E7PA 1J5WA 4DR5T 5JDHA 3PUYF 3PUAA 3I0OA 3RHWA 3SFDA 2EHOD 5FXZA 2BG9C 4CN1A 5AQTB 2DHRA 4JI1T 4ERRA 3E0ZA 3LBXA 2WM9A 3C51A 3N9NA 4HFEA 4ZXLA 2VWAA 2Z6EA 2BKNA 1OEDB 2WDVA 3FZFB 1T7SA 2YKSA 2KWIB 5JTGA 1SUMB 4C91A 2LRKA 1UURA 4YT0A 5CGMA 2WU5A 1N34T 1IBLT 5CFBA 5ABEA 4A5XA 4ZEYA 3KBUA 3I9YA 3I0QA 4ILAA 3FZHB 3Q5XA 1HX8A 2V1DB 4H63V 5LHGB 3ZC1A 2ACZA 1SE7A 1UK5A 4WW0A 3QOFA 4WYVA 5J2TE 2B76A 1MNEA 3DTOA 5KDMC 5JDFA 3FB2A 1HTJF 2UXBT 5CJ5A 3H3MA 1HR0T 1YXRA 2LE8A 3UFGA 3HKEE 3ZJ1A 1Z8UA 5JR9C 4IE7A 2MYSA 3MKDA 3GN5B 1FIOA 3ZCIA 2LSYA 5FKYA 5H6QB 3DP7A 5AQQB 5BMVE 2N9DA 4A56A 4DUZT 3UU5A 4I43B 4ZZCA 1WYBA 2NTXA 1XNRT 2ZM8A 2XAJB 2WDRA 1YKEB 5F5WA 2KWHA 1YW0A 3B5MA 5FY1A 2LLYA 2Y48B 2GK9A 1XMOT 4UVBB 5HXHA 2ZMAA 1IAPA 4ISSA 5KMGP 4PJLA 3P8CD 4CZZB 2KXPB 4EV6A 2R6GF 2KSRA 5JQGE 2G0UA 2E9XD 3OYXA 2LHNA 3UULA 2HHHT 2KINB 3KV9A 4U33A 3N9PA 4AKRB 2X67A 4DVDA 3C4XA 3AB3B 1HS7A 3JAEA 5LXTE 4HFIA 4QKNA 4JI4T 1Y01A 1HG2A 2W2UA 2W00A 4OX9T 4AQFC 2IHR1 3ZN1B 2UXDT 3HL6A 4U7IA 3S4UA 3NBXX 3F2EA 2CHOA 3T1HT 3G06A 4MBQA 2JMKA 1ZP0A 2D5UA 3MXZA 2V6YB 3U78A 4DR1T 5LP6E 3AE4A 2XQ3A 2WY2A 3EVYA 4EGWA 1T8BA 3HR0A 4PJMA 3AEAA 5JRCA 1L0VA 1ZOYA 4ASKA 4H9SE 2BS2A 3ABVA 3SFEA 5ETWA 2KNDA 1CHUA 3ZCJA 2CM0A 1MMDA 1I94T 4TUYE 2RPAA 4P1NA 3O9XA 5KXJA 2LM9A 2BKPA 2A2FX 4UXNB 3K3OA 2X9XA 2ZM2A 3LJCA 2N2NA 3ZYKA 5AQIB 2Q9QB 4HWHA 3FZMB 3NRXA 2NP9A 5JR9A 2XQ5A 5J2UE 4ZI2C 4ISTA 2LJLA 3NZPA 2VL0A 3C4ZA 3FXDB 4UF0A 3RX6A 4DR7T 4IE5A 3LSVA 2SPCA 3ZPOA 3T8OA 4DO0A 4EEBA 3KFWX 3R6NA 5IHYA 4BJNA 4YSZA 2B1EA 4ZHQE 2CA5A 1UCUA 3A5XA 3OKQA 5FXXA 1S94A 3AVRA 4QX7B 3AA1B 4AIUA 2W63A 4KI0F 2QRXA 5AQHB 3GWHA 2I0MA 5LYJE 2EHOB 2H7OA 3K1SA 1CUNA 4LF6T 4DNDA 5FY0A 2C0SA 2DWKA 1JNZA 4L0RA 3OBVE 4TWHA 3UQ7A 3PUGA 1BR1A 3B13A 2WU2A 1GQEA 4ILCA 4GKJT 4GIWA 2JQQA 3UU6A 4Z90A 3N9LA 2W67A 3GN5A 4H9QC 1S35A 4AQFA 4QH4A 2K3WA 4L5GA 3SRZA 2IDOB 3HKBE 1HNXT 5CB4E 3AEBA 3OVUA 4B3TT 2BVLA 4KX6A 3E08A 5LA6E 1KNZA 2IW5B 2VURA 3PUVF 5ABFB 4YTMA 4BA9A 2QYWA 4DR2T 3LG7A 4IDQA 4I55E 2HPJA 4HWIB 3RLFF 3V5SA 4K0UA 4OFZA 2X0LB 3ZMSB 2CHNA 4IDZA 3NKZA 2EHOC 1BR2A 3C50A 5EK3A 4JI2T 4UV9B 4KBMB 4NXNT 1W09A 4IREA 3CPZA 3PUXF 3HKDE 2YDQA 3L3PA 2WQYA 2XSBA 5FL1A 2IC9A 4JYAT 2LSGA 5HYAA 4CXYA 2XZEA 1WYCA 4DV0T 1WFDA 2LT3A 3P7IA 3OYZA 4YXDA 3UU4A 3AE1A 4CI3B 2RP4A 3RYFE 2JMHA 4YY3T 4GK5E 4A98A 3W15B 3BQIA 3QB5K 3KV5A 4LF9T 2CLYB 2BBJA 4U74A 2K5BB 1XMQT 2V6YA 3CKDA 5ABGA 3WI3A 4EIWA 4P09A 4AI6A 2E9XB 3PUSA 3D0TA 3QK6A 5LMUT 2BS4A 3MACA 2XTLA 3PU8A 4HWCA 1D1AA 5JDQA 4HN9A 2IIUA
chains in the Genus database with same CATH topology
3FZKB 1UK5A 1UGOA 5AQRB 1I6ZA 5AQQB 3A8YC 5AQTB 2D9DA 5AQIB 5AQUB 4HWHA 3FZLB 5AQJB 3FZMB 5AQVB 1M62A 5AQNB 5AQLB 5AQFB 3FZHB 5AQGB 5AQPB 4HWIB 3LDQB 5AQHB 5AQMB 5AQSB 1M7KA 4HWCA 5AQOB 1HX1B 3M3ZB 3FZFB 4HWFA 1T7SA 4HWDA 5AQKB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FZK B;  1UK5 A;  1UGO A;  5AQR B;  1I6Z A;  5AQQ B;  3A8Y C;  5AQT B;  2D9D A;  5AQI B;  5AQU B;  4HWH A;  3FZL B;  5AQJ B;  3FZM B;  5AQV B;  1M62 A;  5AQN B;  5AQL B;  5AQF B;  3FZH B;  5AQG B;  5AQP B;  4HWI B;  3LDQ B;  5AQH B;  5AQM B;  5AQS B;  1M7K A;  4HWC A;  5AQO B;  1HX1 B;  3M3Z B;  3FZF B;  4HWF A;  1T7S A;  4HWD A;  5AQK B; 
#chains in the Genus database with same CATH topology
 5HAX A;  4B3R T;  4PNI A;  1MIV A;  2J4G A;  4QHO A;  5L4H A;  4YFS A;  4AKG A;  2BG9 E;  2C5I T;  5HEU A;  3AAE B;  2W4X A;  3ZKR A;  4GOU A;  4Z91 A;  5DJQ C;  1QLB A;  3A7M A;  4O4L E;  3RKG A;  1QSD A;  3O1J A;  1SHZ C;  3RIU A;  1IZN B;  3NZQ A;  3ZYM A;  3NRY A;  4HE8 A;  2E2A A;  1YD8 G;  3L09 A;  1ZEE A;  5HEG A;  3VR8 A;  2Q9Q A;  4HGA A;  2NWB A;  1IJ6 A;  2CWO A;  2M67 A;  2JQH A;  3TLU A;  2L8K A;  2JIW A;  1UX4 A;  2CLY C;  3AE8 A;  2VQF T;  2LKH A;  4YTN A;  2ZM0 A;  2MPK A;  3PJA A;  4TWD A;  2LHR A;  2YIN A;  2X68 A;  3ZT5 A;  4ADZ A;  2E9X C;  4ZI3 D;  1XDP A;  4MAL A;  2JQK A;  2WWU A;  5AQN B;  4V1A v;  4GYS A;  3KVB A;  1HNW T;  3AED A;  1M7K A;  4DID B;  4UVA B;  3IHR A;  1NEN A;  3AE3 A;  3Q5E A;  3OTO T;  2EHO A;  3UU3 A;  4KUM B;  5L3B B;  5LB7 B;  5HEJ A;  5AQL B;  3C98 B;  5JDL A;  4KHP T;  2MOZ A;  4U3C A;  1FJG T;  5AQM B;  4XBF B;  3C64 A;  3EHZ A;  2YU1 A;  4ZZB A;  2XY8 B;  5LG3 A;  2KT9 A;  3VRB A;  2UXX B;  3JC6 C;  5JH7 E;  4LFB T;  2XJ7 A;  3ONX A;  3ZYL A;  5LHI B;  4U72 A;  2K24 A;  4JI0 T;  3PUZ F;  4HFD A;  4ILU A;  3ZT7 A;  2NW9 A;  2ZM6 T;  2W66 A;  1OED C;  4IT4 A;  2OA5 A;  3CQG B;  2IML A;  5C3J A;  3MK7 C;  4XAX B;  3ZT6 A;  2VAS A;  1D1B A;  3O1I A;  4YHJ A;  1G73 A;  4DR4 T;  4PK5 A;  2BVM A;  5EK2 A;  5ABF A;  2E5V A;  4HWF A;  3I1A A;  1IBK T;  5F8P A;  2NR4 A;  4F8H A;  2KMF A;  5DAB A;  2XAQ B;  5HXE A;  1LRZ A;  4C90 A;  1HNZ T;  2D2S A;  4I0U A;  3UU8 A;  4DV2 T;  1KK7 A;  1UUS A;  4JI5 T;  4X66 T;  2C5J A;  3CX6 B;  4P0A A;  4EYU A;  4B3M T;  4DUY T;  2CXL A;  2Y8D A;  2BBH A;  3Q9D A;  3AA6 B;  4IE4 A;  1LKX A;  3P4R A;  3O1H A;  4PAG A;  2MAW A;  3FZL B;  3PV0 F;  3SOL A;  2PTF A;  4DV7 T;  4JI6 T;  3TLW A;  4I50 E;  4JI3 T;  3PDY A;  5IYZ E;  3M65 A;  4WZX A;  5L47 A;  3AEF A;  4EZH A;  2NOX A;  1G8X A;  1KNP A;  1ZV4 X;  3N2K E;  4EB6 E;  4LF4 T;  2YDR A;  3H3A A;  1T98 A;  3CX8 B;  2H7V C;  2VL8 A;  2VVN A;  2XHE B;  1Z0P A;  3HKC E;  2YU2 A;  2E9X A;  2A3D A;  2AXD S;  5AQR B;  1XDO A;  2WWV A;  3FXE B;  3IEE A;  4IGU A;  3NWI A;  1KFY A;  2CXD A;  3ANW A;  4X62 T;  2VKH A;  3ZN0 B;  4P0B A;  2DI4 A;  3A8Y C;  2V7J A;  4MFR A;  5FY7 A;  3N2G E;  5FNV E;  3L39 A;  4NIQ A;  2XPK A;  3MA9 A;  3FBZ A;  3P4P A;  3EI0 A;  5JDM A;  3CWZ B;  3UT5 E;  1B7T A;  3CQC B;  3T1Y T;  2M6B A;  4NXM T;  5CA0 E;  2HPL A;  4TNV A;  4EOZ B;  3Q5D A;  3EAM A;  3LK4 2;  4LMJ A;  3RIA A;  4QXH B;  4JEU B;  2E8I A;  2P9B A;  3IA3 A;  2V6X A;  4LF7 T;  1KEY A;  2XQ6 A;  1OED A;  3ETV A;  4MLK A;  4DV4 T;  4X1I E;  5HXR A;  1SA0 E;  2JRK A;  4E7S A;  5L3E B;  3EAB A;  2BZB A;  1US7 B;  1WR0 A;  2FUP A;  5LHH B;  3AE2 A;  5HWX A;  2LRL A;  3ONJ A;  4DR6 T;  1W9R A;  3QUJ A;  1MND A;  4IDP A;  2I59 A;  2CXF A;  2LEH A;  1YKH B;  2IUB A;  5IWA T;  4AQY T;  3RIU C;  1D0Y A;  3VU7 H;  1WR6 A;  2VVS A;  4EXT A;  1U4Q A;  4YHH T;  3WAK A;  4X64 T;  2DNX A;  3E22 E;  3HA4 A;  4PFO A;  2V8S V;  5JDN A;  2OV9 A;  3ZMT B;  2Q9Q C;  4EAH A;  3PUQ A;  4DMV A;  2IC6 A;  4I4T E;  1VOM A;  4TZ4 C;  5L3F B;  3RH3 A;  4ILB A;  4N78 D;  3TKL B;  2WDQ A;  2CPT A;  4PJN A;  3SWH A;  5M4Y A;  1W0B A;  2F4V T;  3ZLI A;  5EK4 A;  5HEO A;  3DJB A;  3WAJ A;  1J1J A;  4EYY R;  1BR4 A;  2XQA A;  2WS3 A;  1UGO A;  3OJA A;  3IBP A;  4OYJ A;  5JRE A;  4KP3 C;  3P4W A;  2FJD A;  2WAU A;  2VKD A;  3ONL C;  1X9B A;  3K3Q C;  1E2A A;  1HF8 A;  2FJE A;  2W61 A;  3N9Q A;  4CN6 A;  3MZK B;  3N9O A;  2DLR A;  5LJM A;  5GON E;  3RQW A;  2UUC T;  2BDE A;  1W0A A;  4JI7 T;  4H9R C;  4PW8 A;  1R8I A;  3JCF A;  3RC8 A;  2J47 A;  2FBW A;  3OPC A;  1NEK A;  3CML A;  1MMA A;  4ZI3 C;  3UQ4 A;  3O4X E;  3AA7 B;  3SS1 A;  4CI1 B;  4LF8 T;  2XQ7 A;  3KV4 A;  2ACX A;  5L2L A;  4TWF A;  2XAH B;  4YSX A;  2FJA A;  4UEL A;  4LML A;  4AQG A;  1NAF A;  3ETU A;  4AXP A;  2XUE A;  5AFU L;  2K9A A;  2V7I A;  5HXS A;  2L9Q A;  2BG9 B;  3F31 A;  4U31 A;  3VKH A;  2CBJ A;  2CE7 A;  2NW7 A;  2N1G A;  1E1H B;  4H9N C;  2DCF A;  3PU3 A;  5AQG B;  3HI2 A;  2W62 A;  2CRB A;  2V26 A;  4KHZ F;  2V7K A;  3H37 A;  4Z8X A;  3AXJ B;  5HWY A;  2CWY A;  2A72 A;  4LMK A;  4QXB B;  4U2Y A;  2X9W A;  4G63 A;  5LG4 A;  3VKG A;  2WBL A;  5E0O A;  2JJ9 A;  4AKH A;  1VRB A;  5LBQ B;  1HX1 B;  3CVR A;  2IAK A;  2CEA A;  2WZI A;  2X66 A;  3CQX C;  3N9M A;  5AQV B;  3N2O A;  3KBT A;  5HCJ A;  4H63 H;  5A1L A;  5AQS B;  4QXC B;  2XM2 A;  3MJX A;  4X1K E;  5JR9 B;  2CBI A;  3F57 A;  3KIN B;  2C5K T;  4ZOL E;  2WMN A;  5L4E A;  3IF8 B;  4UF0 B;  4DV1 T;  4ANJ A;  2FJB A;  4OK0 A;  2XSA A;  2VK9 A;  4ZI7 E;  1O3X A;  3UUN A;  4G2A A;  2PBI A;  5L3G B;  1HCI A;  5LGT B;  2QGS A;  3PJA J;  1OED E;  4U7Y A;  3AVS A;  2LSJ A;  3LDQ B;  4NPP A;  4K0K T;  1IBM T;  3NVO A;  3CK6 A;  2OLT A;  4QX8 B;  3LK2 B;  1J5E T;  3AE7 A;  3RGL A;  4CXX A;  4LFA T;  3L8R A;  2J1D G;  5ABH A;  2VB6 A;  3FBL A;  4JBW F;  4TN7 B;  4OYK A;  4WNK A;  2K48 A;  1ZKE A;  2NW8 A;  2DWG A;  3N5L A;  3AE9 A;  4PK4 A;  3AAA B;  3QC9 A;  4YJ3 E;  2XQ4 A;  4O4J E;  2D9D A;  5LMN T;  4HEA A;  5BR8 T;  2JQ9 A;  3BQL A;  5FVL A;  5LGN B;  1N33 T;  3RKO A;  5FP3 A;  1OWA A;  2WB5 A;  5JDG A;  3V5U A;  5L3D B;  1HG5 A;  2V7M A;  4CN4 A;  2KLQ A;  2RA1 A;  4IE0 A;  3KDS E;  3AEC A;  1YQ3 A;  5L3C B;  2YOE A;  4O4I E;  2LOS A;  3ZMV B;  2MBG A;  4AKI A;  4HFH A;  4O4H E;  1D0X A;  3JAF A;  5LJN A;  4JEH B;  4O2A E;  3I9W A;  2LSI A;  2WCA A;  4J2C A;  4IL4 A;  1XWM A;  4HFB A;  3TLS A;  2J62 A;  4NUV A;  3ZMU B;  5DQW A;  2VQE T;  5AQK B;  5J0Z A;  1X79 A;  4UIG A;  2ODV A;  3B57 A;  5KX5 E;  4DV3 T;  3UTK A;  2H88 A;  3Q2M A;  2UXN B;  2PFV A;  2DL1 A;  3ZSS A;  3VHL A;  4JV5 T;  1H7C A;  2QA7 A;  4MHC A;  4TV8 E;  2H89 A;  1VCS A;  1EZ3 A;  5LOV E;  4COF A;  2WZH A;  4FJO A;  4DBQ A;  3KVA A;  4UR9 A;  2BG9 A;  2UXC T;  1YQ4 A;  4O2B E;  1WRD A;  4IDO A;  2VKO A;  4PJJ A;  3GA8 A;  2WP9 A;  2YEV C;  1AJ3 A;  4DV6 T;  2JPF A;  3FZK B;  3JC6 D;  2HN1 A;  2HN2 A;  4E7Z A;  3J9X 1;  3KV6 A;  2X51 A;  2UU9 T;  2BS3 A;  4B3S T;  2L3L A;  3UUX B;  1KNR A;  2XAG B;  3AXJ A;  4BJM A;  4IHJ E;  1Y64 B;  2XAS B;  4PK6 A;  4EZ4 A;  4UEM A;  4AIS A;  2X9Y A;  3EUH A;  2WSS V;  4YLH A;  1ZHC A;  2LSK A;  2M6I A;  1D1C A;  1WCR A;  4QH1 A;  3RI5 A;  3UUM A;  3ZEF B;  2LOP A;  2AE9 A;  2NTY A;  4HKA A;  5LNK A;  1N32 T;  5LBM A;  2ODU A;  3QNU A;  3CIR A;  2HH7 A;  4EED A;  2X9H A;  2YDS A;  2LKG A;  4NUU A;  4X1Y E;  5LGU B;  2D0T A;  5HCM A;  2PJQ A;  2V5C A;  4A97 A;  2XM1 A;  3LBX B;  4BAY B;  5FXV A;  3RC3 A;  3TLV A;  3RF1 A;  2YN6 A;  4HFV A;  4CI2 B;  2MTQ A;  4Q25 A;  2XQY A;  4UV8 B;  4WBN E;  3BQK A;  3JAD A;  3PUR A;  3ZC0 A;  5J1G A;  3P4Q A;  4QH5 A;  4IDN A;  1MIW A;  4PFP A;  2XAF B;  5TAO A;  5FMN A;  1FEW A;  2KZ7 B;  2W0G A;  1I6Z A;  3ZST A;  3X1D A;  4OHF A;  5F3J A;  3VRA A;  5JVD E;  3RIF A;  2VKJ A;  2A9U A;  5HXC A;  4TNW A;  2CMR A;  3PTR B;  2X0H A;  5FXW A;  1N36 T;  3AA0 B;  3RPU A;  4YJ2 E;  1WLX A;  5AQU B;  1XNQ T;  5ADX L;  4H9P C;  5FYM A;  5H6R B;  4DR3 T;  1BR0 A;  1MIY A;  3AEE A;  1JNR A;  3GMI A;  4HFC A;  4F6R C;  3R84 B;  4IL9 A;  4M1P A;  4TX5 A;  4O8S A;  4GK0 E;  3RYH E;  4IE6 A;  4X65 T;  4HTE A;  4X5T A;  4WBO A;  3K8P C;  4DV5 T;  5FL0 A;  4JI8 T;  3RYI E;  1T72 A;  3EDU A;  1FMW A;  3TLT A;  1MMN A;  4HWD A;  2V7L A;  4LFC T;  3P4S A;  2V5D A;  2YK0 A;  5LCY A;  3ZMZ B;  2E5L T;  3AAI A;  4L9I A;  4YTP A;  2PG8 A;  4ZI2 D;  3EDV A;  1IJ5 A;  2ZLY A;  3BK9 A;  2UUB T;  2LM2 A;  4XZC A;  3PUW F;  3U3I A;  3RQU A;  1OXZ A;  2XQ8 A;  4ZS3 A;  1UX5 A;  5DQV A;  3ZJ2 A;  3ESL A;  4LF5 T;  1MMG A;  4X20 E;  1M62 A;  1VCT A;  1U5P A;  2XQ9 A;  5IUX A;  5AQO B;  4GYR A;  4B6X A;  1FMV A;  4AKL A;  3UUB A;  3QB5 A;  4FI5 A;  5CA1 E;  4U2Z A;  1QUU A;  2X0Y A;  4GKK T;  5AQJ B;  2D0U A;  4JLE A;  3J7Y q;  4H9O C;  4TV9 E;  1XZY A;  5FVK A;  3Q5W A;  2I6H A;  3AE6 A;  3RYC E;  3K3N A;  5EZY E;  4UVC B;  1D0Z A;  4CXW A;  5C2T A;  3PE0 A;  4JUY A;  3C4W A;  3VR9 A;  3RRC A;  4YSY A;  4DMW A;  3UFE A;  5AQP B;  2BKO A;  2QVA A;  4KMC A;  2Q9Q D;  5JRC B;  2Y6X A;  4IIJ E;  4CQI A;  5C8Y E;  4ZS2 A;  3ANW B;  4DBR A;  3AE5 A;  3LK3 B;  2UUA T;  1HFA A;  1NWM X;  3M3Z B;  3FHN A;  1LVF A;  4QWN B;  3P50 A;  3AEG A;  3LFM A;  3RRW A;  3CX7 B;  1KF6 A;  2WMO A;  1LVK A;  5HEH A;  2H3R A;  5AQF B;  2ES0 A;  1V9D A;  2CCQ A;  1DU2 A;  1E7P A;  1J5W A;  4DR5 T;  5JDH A;  3PUY F;  3PUA A;  3I0O A;  3RHW A;  3SFD A;  2EHO D;  5FXZ A;  2BG9 C;  4CN1 A;  5AQT B;  2DHR A;  4JI1 T;  4ERR A;  3E0Z A;  3LBX A;  2WM9 A;  3C51 A;  3N9N A;  4HFE A;  4ZXL A;  2VWA A;  2Z6E A;  2BKN A;  1OED B;  2WDV A;  3FZF B;  1T7S A;  2YKS A;  2KWI B;  5JTG A;  1SUM B;  4C91 A;  2LRK A;  1UUR A;  4YT0 A;  5CGM A;  2WU5 A;  1N34 T;  1IBL T;  5CFB A;  5ABE A;  4A5X A;  4ZEY A;  3KBU A;  3I9Y A;  3I0Q A;  4ILA A;  3FZH B;  3Q5X A;  1HX8 A;  2V1D B;  4H63 V;  5LHG B;  3ZC1 A;  2ACZ A;  1SE7 A;  1UK5 A;  4WW0 A;  3QOF A;  4WYV A;  5J2T E;  2B76 A;  1MNE A;  3DTO A;  5KDM C;  5JDF A;  3FB2 A;  1HTJ F;  2UXB T;  5CJ5 A;  3H3M A;  1HR0 T;  1YXR A;  2LE8 A;  3UFG A;  3HKE E;  3ZJ1 A;  1Z8U A;  5JR9 C;  4IE7 A;  2MYS A;  3MKD A;  3GN5 B;  1FIO A;  3ZCI A;  2LSY A;  5FKY A;  5H6Q B;  3DP7 A;  5AQQ B;  5BMV E;  2N9D A;  4A56 A;  4DUZ T;  3UU5 A;  4I43 B;  4ZZC A;  1WYB A;  2NTX A;  1XNR T;  2ZM8 A;  2XAJ B;  2WDR A;  1YKE B;  5F5W A;  2KWH A;  1YW0 A;  3B5M A;  5FY1 A;  2LLY A;  2Y48 B;  2GK9 A;  1XMO T;  4UVB B;  5HXH A;  2ZMA A;  1IAP A;  4ISS A;  5KMG P;  4PJL A;  3P8C D;  4CZZ B;  2KXP B;  4EV6 A;  2R6G F;  2KSR A;  5JQG E;  2G0U A;  2E9X D;  3OYX A;  2LHN A;  3UUL A;  2HHH T;  2KIN B;  3KV9 A;  4U33 A;  3N9P A;  4AKR B;  2X67 A;  4DVD A;  3C4X A;  3AB3 B;  1HS7 A;  3JAE A;  5LXT E;  4HFI A;  4QKN A;  4JI4 T;  1Y01 A;  1HG2 A;  2W2U A;  2W00 A;  4OX9 T;  4AQF C;  2IHR 1;  3ZN1 B;  2UXD T;  3HL6 A;  4U7I A;  3S4U A;  3NBX X;  3F2E A;  2CHO A;  3T1H T;  3G06 A;  4MBQ A;  2JMK A;  1ZP0 A;  2D5U A;  3MXZ A;  2V6Y B;  3U78 A;  4DR1 T;  5LP6 E;  3AE4 A;  2XQ3 A;  2WY2 A;  3EVY A;  4EGW A;  1T8B A;  3HR0 A;  4PJM A;  3AEA A;  5JRC A;  1L0V A;  1ZOY A;  4ASK A;  4H9S E;  2BS2 A;  3ABV A;  3SFE A;  5ETW A;  2KND A;  1CHU A;  3ZCJ A;  2CM0 A;  1MMD A;  1I94 T;  4TUY E;  2RPA A;  4P1N A;  3O9X A;  5KXJ A;  2LM9 A;  2BKP A;  2A2F X;  4UXN B;  3K3O A;  2X9X A;  2ZM2 A;  3LJC A;  2N2N A;  3ZYK A;  5AQI B;  2Q9Q B;  4HWH A;  3FZM B;  3NRX A;  2NP9 A;  5JR9 A;  2XQ5 A;  5J2U E;  4ZI2 C;  4IST A;  2LJL A;  3NZP A;  2VL0 A;  3C4Z A;  3FXD B;  4UF0 A;  3RX6 A;  4DR7 T;  4IE5 A;  3LSV A;  2SPC A;  3ZPO A;  3T8O A;  4DO0 A;  4EEB A;  3KFW X;  3R6N A;  5IHY A;  4BJN A;  4YSZ A;  2B1E A;  4ZHQ E;  2CA5 A;  1UCU A;  3A5X A;  3OKQ A;  5FXX A;  1S94 A;  3AVR A;  4QX7 B;  3AA1 B;  4AIU A;  2W63 A;  4KI0 F;  2QRX A;  5AQH B;  3GWH A;  2I0M A;  5LYJ E;  2EHO B;  2H7O A;  3K1S A;  1CUN A;  4LF6 T;  4DND A;  5FY0 A;  2C0S A;  2DWK A;  1JNZ A;  4L0R A;  3OBV E;  4TWH A;  3UQ7 A;  3PUG A;  1BR1 A;  3B13 A;  2WU2 A;  1GQE A;  4ILC A;  4GKJ T;  4GIW A;  2JQQ A;  3UU6 A;  4Z90 A;  3N9L A;  2W67 A;  3GN5 A;  4H9Q C;  1S35 A;  4AQF A;  4QH4 A;  2K3W A;  4L5G A;  3SRZ A;  2IDO B;  3HKB E;  1HNX T;  5CB4 E;  3AEB A;  3OVU A;  4B3T T;  2BVL A;  4KX6 A;  3E08 A;  5LA6 E;  1KNZ A;  2IW5 B;  2VUR A;  3PUV F;  5ABF B;  4YTM A;  4BA9 A;  2QYW A;  4DR2 T;  3LG7 A;  4IDQ A;  4I55 E;  2HPJ A;  4HWI B;  3RLF F;  3V5S A;  4K0U A;  4OFZ A;  2X0L B;  3ZMS B;  2CHN A;  4IDZ A;  3NKZ A;  2EHO C;  1BR2 A;  3C50 A;  5EK3 A;  4JI2 T;  4UV9 B;  4KBM B;  4NXN T;  1W09 A;  4IRE A;  3CPZ A;  3PUX F;  3HKD E;  2YDQ A;  3L3P A;  2WQY A;  2XSB A;  5FL1 A;  2IC9 A;  4JYA T;  2LSG A;  5HYA A;  4CXY A;  2XZE A;  1WYC A;  4DV0 T;  1WFD A;  2LT3 A;  3P7I A;  3OYZ A;  4YXD A;  3UU4 A;  3AE1 A;  4CI3 B;  2RP4 A;  3RYF E;  2JMH A;  4YY3 T;  4GK5 E;  4A98 A;  3W15 B;  3BQI A;  3QB5 K;  3KV5 A;  4LF9 T;  2CLY B;  2BBJ A;  4U74 A;  2K5B B;  1XMQ T;  2V6Y A;  3CKD A;  5ABG A;  3WI3 A;  4EIW A;  4P09 A;  4AI6 A;  2E9X B;  3PUS A;  3D0T A;  3QK6 A;  5LMU T;  2BS4 A;  3MAC A;  2XTL A;  3PU8 A;  4HWC A;  1D1A A;  5JDQ A;  4HN9 A;  2IIU A; 
#chains in the Genus database with same CATH homology
 3FZK B;  1UK5 A;  1UGO A;  5AQR B;  1I6Z A;  5AQQ B;  3A8Y C;  5AQT B;  2D9D A;  5AQI B;  5AQU B;  4HWH A;  3FZL B;  5AQJ B;  3FZM B;  5AQV B;  1M62 A;  5AQN B;  5AQL B;  5AQF B;  3FZH B;  5AQG B;  5AQP B;  4HWI B;  3LDQ B;  5AQH B;  5AQM B;  5AQS B;  1M7K A;  4HWC A;  5AQO B;  1HX1 B;  3M3Z B;  3FZF B;  4HWF A;  1T7S A;  4HWD A;  5AQK B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...