5AQUB

Fragment-based screening of hsp70 sheds light on the functional role of atp-binding site residues
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
115
structure length
115
Chain Sequence
GPLGSNSPQEEVELKKLKHLEKSVEKIADQLEELNKELTGIQQGFLPKDLQAEALCKLDRRVKATIEQFMKILEEIDTLILPENFKDSRLKRKGLVKKVQAFLAECDTVEQNICQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Chaperone
molecule keywords HEAT SHOCK COGNATE 71 KDA PROTEIN
publication title A fragment-based approach applied to a highly flexible target: Insights and challenges towards the inhibition of HSP70 isoforms.
pubmed doi rcsb
source organism Homo sapiens
total genus 45
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2015-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02179 BAG BAG domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.120 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 BAG domain 5aquB00
5AQGB 5AQMB 5AQPB 5AQRB 4HWFA 3FZLB 2D9DA 4HWDA 1UGOA 5AQTB 1T7SA 1UK5A 5AQNB 4HWCA 5AQHB 1I6ZA 4HWHA 5AQIB 3A8YC 1M62A 5AQFB 5AQSB 5AQJB 3FZKB 5AQKB 1M7KA 5AQLB 3FZFB 5AQQB 5AQVB 3LDQB 5AQUB 4HWIB 3FZMB 5AQOB 1HX1B 3M3ZB 3FZHB
chains in the Genus database with same CATH superfamily
3C64A 3LK2B 2XJ7A 2CWYA 2CXLA 2HPLA 4IDZA 3F31A 3L09A 4DV3T 5CA1E 4JI2T 4AISA 2X9HA 4HFVA 2N1GA 5AQLB 2WWUA 1HNXT 3OYXA 2BS2A 4I55E 5HEJA 5HXRA 1D0XA 3G06A 2BKOA 4X20E 4DV1T 4M1PA 5C2TA 2XZEA 2VQET 2WDQA 1I6ZA 2JJ9A 4O2BE 3SOLA 1N32T 2WMOA 3ZSSA 1FMVA 3LBXB 1T8BA 2YOEA 3ZSTA 2XQ4A 4PK6A 4WW0A 2E5VA 1AJ3A 5DQVA 2JRKA 3HR0A 3ETUA 2D0UA 3KINB 3VR9A 2QYWA 1MMGA 2PBIA 5L3FB 2MYSA 4KBMB 2UU9T 3Q5EA 1E7PA 3ANWA 5AQOB 4DR1T 2NTYA 3UQ7A 4H63V 3KBUA 4JEHB 2E2AA 3ZYMA 1XDPA 5AQIB 3I0OA 2W0GA 5LG4A 3ZC1A 4J2CA 5HWXA 1Y01A 2NP9A 3RYIE 4LF5T 4WNKA 1ZHCA 3K3NA 4YSZA 5JDQA 2UXXB 2K48A 3RF1A 4OYJA 4MHCA 2ACXA 1WLXA 2JQ9A 3FBLA 3UT5E 2IDOB 2Q9QD 4GIWA 2W66A 4Q25A 3P4PA 2LHNA 4CN1A 2XSAA 1MNDA 3I9YA 1SA0E 5CFBA 3JAFA 4QH4A 5ABFA 3AEBA 3AA6B 4IL9A 5L3BB 4ADZA 4KUMB 1HR0T 4ZI3D 2JPFA 3AE7A 4ZI7E 1J5ET 4HWFA 2Q9QA 4LMKA 4TNWA 3AXJB 5HXSA 4OHFA 3QB5K 3I0QA 2MBGA 3R6NA 4U3CA 4L0RA 3CKDA 5BR8T 2W63A 1M7KA 2GK9A 4TV9E 3ZYLA 2XY8B 3ZN1B 1VCTA 3ZMSB 4EB6E 1SE7A 2JQHA 1G73A 2X0YA 2VWAA 2FUPA 5TAOA 1OEDC 1YQ4A 4HFDA 1UCUA 2YN6A 1YD8G 1HS7A 2D5UA 2RP4A 4UF0A 2QVAA 2XAGB 3PU3A 4CI3B 5AQTB 5AQMB 4LFAT 3O1IA 4KMCA 2H7VC 3O1JA 2WZHA 1OEDB 3WAJA 5LHGB 1BR2A 4CI1B 4DV0T 4YSXA 2IIUA 2K5BB 4UV9B 5FY0A 2DLRA 3SRZA 2IHR1 3E08A 4DV6T 3DP7A 3IBPA 2K24A 2WU2A 4IE7A 4ILAA 2PG8A 4A5XA 2AE9A 3AE6A 3N9PA 3TKLB 2WY2A 4UR9A 1S35A 5C3JA 4PK5A 3B57A 3NZQA 2KWIB 3PJAA 4EV6A 5LMNT 3AA0B 4CQIA 4YY3T 4DNDA 4B3TT 4JUYA 4HFHA 2BDEA 4JI0T 4EAHA 3A8YC 2XUEA 5LB7B 2D0TA 2V7KA 4ZZCA 2DI4A 3UUMA 4IDOA 3C98B 4V1Av 4DO0A 4QH5A 5ETWA 4TV8E 1NAFA 2C0SA 3C4ZA 1W9RA 4FJOA 2CM0A 2OLTA 5HCMA 2J47A 3IEEA 5LGUB 3BQIA 2WCAA 3ZC0A 5LHIB 1BR0A 5IUXA 3NRYA 3FXDB 2CBJA 1YKEB 4AQFC 2XAJB 4U7YA 3T8OA 3BK9A 4P0AA 2M67A 4AKLA 4AIUA 4X1KE 3BQLA 5CJ5A 3VKHA 1CUNA 5FL0A 5FL1A 2N2NA 4IE6A 2V1DB 4HWIB 2KWHA 3EDVA 4YTNA 4DVDA 4EZHA 4GYRA 5AQRB 3RQWA 4YT0A 3N9LA 4U31A 3P8CD 3RIUA 1OEDE 2Y6XA 3FHNA 5LG3A 4AI6A 5CB4E 2X9XA 4ILUA 4TX5A 4HTEA 4HGAA 3VRBA 5LBQB 4CXWA 3ZMTB 2XQAA 3RPUA 2CBIA 4U2ZA 2VK9A 4DV2T 4YTMA 3NRXA 1N36T 2CE7A 3AE9A 2C5JA 3KVAA 2BKPA 3UULA 2R6GF 4I0UA 4HEAA 5JTGA 4B3ST 4H9OC 3UU6A 3PUSA 2L8KA 3UQ4A 2WDVA 5IHYA 2UUAT 4ZS3A 2BVMA 4P09A 2X0HA 1E1HB 1HG5A 2BS3A 4C91A 5KDMC 4K0UA 4F6RC 3AECA 3ABVA 2LM2A 4LF8T 2DHRA 2MTQA 4L9IA 5HXHA 2JQQA 3AE3A 3EDUA 4IT4A 1MIVA 3CQGB 4X62T 4DR7T 5JQGE 4H9QC 4JI4T 4I43B 4BJMA 2W61A 3QB5A 1FJGT 2FJBA 2ZM8A 5HWYA 2UXCT 5L4HA 1Y64B 2XSBA 1E2AA 1XDOA 3O9XA 3MJXA 2FBWA 4UVBB 3ESLA 2C5IT 1KNPA 1WR0A 2K9AA 2FJAA 4YSYA 3SWHA 5HAXA 4A98A 3IF8B 4H9RC 4GYSA 1BR4A 5F3JA 2X9WA 3EAMA 2CEAA 1QUUA 2L3LA 3KDSE 2YINA 5DQWA 1L0VA 5F8PA 2E9XD 2W67A 3HA4A 2B1EA 3Q5DA 4ILCA 2NW7A 5LNKA 1US7B 3N9OA 3RC3A 3UU5A 4X64T 2WWVA 2EHOD 3I9WA 5FKYA 1YKHB 4G2AA 4EEDA 2LHRA 3FBZA 2VKHA 2E9XA 2DNXA 5LYJE 2BS4A 3DJBA 2CLYB 4YJ2E 4OK0A 2EHOA 5AQUB 4AKGA 2ZMAA 2XASB 1UUSA 1VRBA 5EK4A 4DIDB 4PNIA 4CZZB 3IA3A 3AVRA 4LMJA 2DWGA 3ANWB 5FXWA 2G0UA 2KLQA 4PFPA 3RQUA 3EUHA 1QLBA 3T1YT 2BKNA 4ZI2D 5KXJA 2ZLYA 5JDGA 5L3GB 5FYMA 1NENA 4ZHQE 3ONXA 4E7ZA 4U33A 1ZEEA 4XAXB 3RH3A 3AE8A 4P1NA 2KSRA 3RIAA 4COFA 2WMNA 4H9PC 4QXBB 2YDQA 1MIWA 1SHZC 4MFRA 3JADA 4A97A 3E0ZA 3FZFB 3CPZA 3LDQB 4PW8A 3LBXA 2J1DG 2I0MA 2Q9QC 1GQEA 3FXEB 5JDLA 2VKDA 1W0BA 4DUZT 4UXNB 2XAHB 2JQKA 2ODVA 5KMGP 5ABFB 3PUAA 1Z8UA 1HTJF 3QK6A 3WI3A 2VURA 5AQSB 2X51A 4ZI3C 3GA8A 2Q9QB 5JDFA 2A3DA 3ETVA 5EK2A 5JR9A 2HN1A 4AKRB 4JI3T 3UTKA 2NW9A 5H6QB 4IREA 3UFGA 1BR1A 4ANJA 1HG2A 1YW0A 3AE4A 3RRCA 3P50A 5JDHA 2MAWA 4NXMT 3TLWA 5EZYE 5HEGA 2XQ8A 3NBXX 3MKDA 4DMWA 3CQCB 3ZJ2A 3KV6A 3J7Yq 4TNVA 4ZEYA 3FZHB 1MMNA 2XQ7A 3H3MA 3SFDA 2LSYA 1IJ6A 3Q5WA 3ZT7A 2LOSA 4YLHA 5FNVE 3PURA 1OWAA 2AXDS 2BVLA 2WDRA 2Y8DA 3HKEE 3RIFA 2K3WA 2H89A 5BMVE 2YDRA 4LF6T 3QOFA 4I4TE 4DR6T 3UFEA 3RC8A 4JI6T 3NZPA 3PUGA 1XNQT 2V6XA 5M4YA 3CMLA 5AQQB 2ZM0A 3RKGA 1HX1B 3ZPOA 4QXHB 2L9QA 3DTOA 3ZKRA 3CX7B 4PJJA 4O8SA 2XTLA 1HNZT 2PJQA 5FVLA 3HKCE 4ZS2A 2YU1A 3P4WA 4HN9A 3AE1A 2QA7A 4L5GA 2HH7A 1HNWT 5CGMA 5L4EA 2HHHT 5FMNA 3ONLC 3EABA 4NPPA 1QSDA 3K8PC 4JEUB 3U78A 5LHHB 4IDPA 3EVYA 3KV5A 1YQ3A 3NWIA 2ZM2A 4YXDA 4YHHT 4KHPT 4TWFA 4DMVA 4QHOA 2CRBA 4PJNA 2ZM6T 5LA6E 3MZKB 2V8SV 2VL8A 4HFIA 4DUYT 2CXFA 3L39A 4HE8A 3RIUC 1XWMA 4OFZA 3FZLB 4BA9A 4DR5T 5F5WA 2BBHA 4ZZBA 2WSSV 5ABHA 5IWAT 2UXNB 3HL6A 2IW5B 2LRKA 2LM9A 3MK7C 4HFCA 4IHJE 4JBWF 4ERRA 2LOPA 2J62A 2Z6EA 1XMOT 2XQ6A 3LJCA 3E22E 3TLVA 4CN4A 5AQHB 4EYUA 5LBMA 2CWOA 3R84B 2BG9A 2SPCA 5HCJA 5L2LA 4JI1T 4JYAT 1NWMX 4MBQA 4DV5T 3UUBA 2RA1A 3PV0F 3NKZA 4UELA 4O4LE 2XQYA 4HWCA 2DCFA 4MALA 1ZKEA 2XQ5A 2V7JA 3JC6C 3EI0A 3TLTA 2VL0A 1ZP0A 2X68A 3KBTA 5L47A 4GK5E 5LCYA 2B76A 3RYCE 2JIWA 5LP6E 2IAKA 1J1JA 4GK0E 4JV5T 3H3AA 3BQKA 2CHOA 3JC6D 4HKAA 5JVDE 5AQGB 2E8IA 2YKSA 3CVRA 2LLYA 4DV7T 5FXVA 4DBQA 3QC9A 2D2SA 2UXDT 2WAUA 3UU3A 3KVBA 4QX7B 5J0ZA 1HX8A 2XHEB 3PUWF 1CHUA 3LK3B 3PUQA 3AEFA 4WBNE 3VRAA 4B6XA 4JI5T 3K3OA 3LFMA 5JH7E 4HFEA 1FEWA 3UU8A 4IE0A 3ZN0B 3ZMVB 3VU7H 5HXCA 2W2UA 2X9YA 3N5LA 3LSVA 3K3QC 3B5MA 1UX5A 5H6RB 3F2EA 5LGNB 4Z91A 3AB3B 4U7IA 3P4RA 3RGLA 1IAPA 1KEYA 3CK6A 4A56A 3F57A 2LKGA 2CXDA 3V5UA 2E9XC 2N9DA 2XM2A 4QH1A 1FMWA 5ADXL 4H63H 1UGOA 4NIQA 2X67A 2XM1A 5JREA 4UIGA 3QNUA 2EHOC 3FZKB 4U2YA 3Q5XA 3PTRB 2V6YA 2E9XB 3J9X1 4DR4T 3C4WA 3SFEA 5JRCA 2WZIA 1JNRA 1H7CA 5LJMA 2EHOB 4X1IE 4E7SA 1LRZA 4QXCB 5ABEA 1WFDA 3HI2A 1ZV4X 5LGTB 3O1HA 3ZCIA 2NWBA 1IBKT 4KHZF 2IMLA 4CN6A 2LKHA 2JMKA 5A1LA 4YJ3E 2M6BA 4ISTA 4X5TA 4ISSA 3OYZA 1WR6A 4AKHA 2LRLA 3NVOA 2LSKA 4ZI2C 1X9BA 4U72A 2YU2A 5HEHA 4K0KT 1D0ZA 3SS1A 3C50A 3PUZF 4HWHA 3GN5A 4UEMA 4BAYB 3TLUA 5FY1A 3P4SA 2M6IA 1IZNB 4GKJT 3ZMUB 5JDNA 4EXTA 1KNZA 4EIWA 3AA1B 5ABGA 2VASA 4UV8B 3S4UA 4WYVA 3ZEFB 2J4GA 3N9MA 3GWHA 4NUUA 5JR9C 4OYKA 1SUMB 5HEUA 2VVSA 2LSGA 4Z8XA 4FI5A 4ILBA 1M62A 3AEEA 1MNEA 1WCRA 3ZJ1A 5JR9B 4KP3C 4TN7B 3PDYA 4UVAB 4JI8T 1D0YA 3EHZA 3AEAA 1U5PA 5HXEA 2WS3A 3CIRA 2MPKA 2YDSA 2ODUA 5HYAA 3RYFE 2LT3A 4HFBA 3OPCA 3CWZB 2WU5A 2IUBA 2YK0A 3CX8B 1MIYA 2FJDA 3H37A 3N2OA 1EZ3A 2VKJA 2XAQB 2XQ3A 2V7LA 2VKOA 5LJNA 1R8IA 5L3CB 5HEOA 2UUCT 4LF4T 1LVFA 4PFOA 4YHJA 4AQGA 3RLFF 3P7IA 2FJEA 4TZ4C 2CA5A 1KK7A 4P0BA 2X66A 4UF0B 3RYHE 3O4XE 3PJAJ 5EK3A 2ACZA 1KFYA 3VHLA 5JDMA 1IJ5A 2CPTA 4IGUA 3N2GE 2NTXA 3D0TA 2WBLA 2D9DA 2V26A 1UK5A 5AQNB 3MACA 4Z90A 4WBOA 1UURA 4IE5A 4UVCB 4ZOLE 3AE2A 3KFWX 3AEDA 4X1YE 3L3PA 2XQ9A 3LK42 4PJLA 4TWHA 3ZCJA 3X1DA 3Q2MA 1W09A 1VCSA 5KX5E 4TUYE 3AXJA 2KXPB 3ZMZB 3RX6A 2PFVA 4OX9T 4PAGA 1KF6A 5IYZE 4DR3T 1IBLT 1DU2A 2MOZA 3OVUA 2JMHA 4XZCA 3K1SA 4X65T 3A5XA 3AA7B 2V5CA 3V5SA 2E5LT 1W0AA 2X0LB 4O4JE 1V9DA 2V7MA 1OXZA 4LF9T 3KV9A 2H3RA 3AVSA 1XZYA 4QX8B 4EEBA 1D1CA 2PTFA 2I6HA 5FY7A 3OTOT 3Q9DA 3VKGA 2OV9A 2WP9A 3GMIA 1OEDA 5FXZA 4X66T 3CQXC 2Y48B 2KT9A 4IL4A 1O3XA 4PK4A 5DJQC 5GONE 3ZYKA 1T7SA 2P9BA 3OKQA 4IDQA 2BG9C 4CI2B 4XBFB 5CA0E 3AE5A 5L3DB 4KX6A 5J2UE 4JLEA 1LKXA 4B3RT 1WYBA 4LF7T 4HWDA 4QWNB 1J5WA 2BG9B 2WQYA 3RRWA 2DL1A 1N34T 4QKNA 3ZLIA 2XAFB 2HN2A 3QUJA 4TWDA 4JI7T 3UU4A 1U4QA 2LSIA 4B3MT 2LSJA 4GKKT 4YFSA 2NR4A 4MLKA 4AQYT 5FP3A 4C90A 5LXTE 3ZT5A 4DBRA 2C5KT 3A7MA 3U3IA 5AQKB 2LEHA 4LFCT 2H7OA 2H88A 3AEGA 5J2TE 4BJNA 1XMQT 4KI0F 4DV4T 1IBMT 1XNRT 4O2AE 1X79A 4EGWA 4EZ4A 5AQJB 3PU8A 4LFBT 3WAKA 3ZT6A 4ASKA 3C51A 5DABA 4IE4A 4H9NC 4DR2T 2A2FX 2BZBA 2KMFA 2W62A 2VB6A 4O4IE 1HFAA 2WM9A 4EYYR 4G63A 1VOMA 2BBJA 3L8RA 5AQFB 3HKDE 4AQFA 3PE0A 3FZMB 3N9NA 2HPJA 1ZOYA 3UUXB 2CMRA 3AAIA 5FXXA 2NOXA 3T1HT 5L3EB 4N78D 1B7TA 2UUBT 3TLSA 1UX4A 1WRDA 4H9SE 5LOVE 4ZXLA 3UUNA 5AQPB 3B13A 1LVKA 3KV4A 2VQFT 4AXPA 1HCIA 3JCFA 4I50E 3PUVF 3C4XA 2LJLA 2I59A 2LE8A 2UXBT 1T72A 3I1AA 4IDNA 5AFUL 4U74A 4NUVA 2BG9E 1D1BA 4WZXA 5FVKA 3CX6B 3OBVE 5LMUT 3P4QA 2KZ7B 2A9UA 3AAAB 2V6YB 2WB5A 2DWKA 3M65A 4F8HA 2KINB 3RHWA 4YTPA 1D1AA 2OA5A 5JRCB 2F4VT 2RPAA 3VR8A 5C8YE 3ONJA 2A72A 3PUYF 4LMLA 4GOUA 1FIOA 2KNDA 1T98A 4AKIA 1I94T 2YEVC 3HKBE 5E0OA 2CCQA 1N33T 4EOZB 2ES0A 4NXNT 3N2KE 2V5DA 3PUXF 3IHRA 4IIJE 4PJMA 2VVNA 3FB2A 3OJAA 1Z0PA 2CHNA 5AQVB 2IC6A 3RI5A 3JAEA 1YXRA 4CXXA 1MMDA 1G8XA 2NW8A 2QRXA 2IC9A 3W15B 3MXZA 3M3ZB 1NEKA 5J1GA 3GN5B 3AAEB 2W00A 2QGSA 3LG7A 3RKOA 2V7IA 1HF8A 1WYCA 2CLYC 1KNRA 1S94A 3MA9A 1JNZA 4O4HE 4CXYA 2XPKA 3N9QA 1MMAA 2W4XA
chains in the Genus database with same CATH topology
5AQGB 5AQMB 5AQPB 5AQRB 4HWFA 3FZLB 2D9DA 4HWDA 1UGOA 5AQTB 1T7SA 1UK5A 5AQNB 4HWCA 5AQHB 1I6ZA 4HWHA 5AQIB 3A8YC 1M62A 5AQFB 5AQSB 5AQJB 3FZKB 5AQKB 1M7KA 5AQLB 3FZFB 5AQQB 5AQVB 3LDQB 5AQUB 4HWIB 3FZMB 5AQOB 1HX1B 3M3ZB 3FZHB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AQG B;  5AQM B;  5AQP B;  5AQR B;  4HWF A;  3FZL B;  2D9D A;  4HWD A;  1UGO A;  5AQT B;  1T7S A;  1UK5 A;  5AQN B;  4HWC A;  5AQH B;  1I6Z A;  4HWH A;  5AQI B;  3A8Y C;  1M62 A;  5AQF B;  5AQS B;  5AQJ B;  3FZK B;  5AQK B;  1M7K A;  5AQL B;  3FZF B;  5AQQ B;  5AQV B;  3LDQ B;  5AQU B;  4HWI B;  3FZM B;  5AQO B;  1HX1 B;  3M3Z B;  3FZH B; 
#chains in the Genus database with same CATH topology
 3C64 A;  3LK2 B;  2XJ7 A;  2CWY A;  2CXL A;  2HPL A;  4IDZ A;  3F31 A;  3L09 A;  4DV3 T;  5CA1 E;  4JI2 T;  4AIS A;  2X9H A;  4HFV A;  2N1G A;  5AQL B;  2WWU A;  1HNX T;  3OYX A;  2BS2 A;  4I55 E;  5HEJ A;  5HXR A;  1D0X A;  3G06 A;  2BKO A;  4X20 E;  4DV1 T;  4M1P A;  5C2T A;  2XZE A;  2VQE T;  2WDQ A;  1I6Z A;  2JJ9 A;  4O2B E;  3SOL A;  1N32 T;  2WMO A;  3ZSS A;  1FMV A;  3LBX B;  1T8B A;  2YOE A;  3ZST A;  2XQ4 A;  4PK6 A;  4WW0 A;  2E5V A;  1AJ3 A;  5DQV A;  2JRK A;  3HR0 A;  3ETU A;  2D0U A;  3KIN B;  3VR9 A;  2QYW A;  1MMG A;  2PBI A;  5L3F B;  2MYS A;  4KBM B;  2UU9 T;  3Q5E A;  1E7P A;  3ANW A;  5AQO B;  4DR1 T;  2NTY A;  3UQ7 A;  4H63 V;  3KBU A;  4JEH B;  2E2A A;  3ZYM A;  1XDP A;  5AQI B;  3I0O A;  2W0G A;  5LG4 A;  3ZC1 A;  4J2C A;  5HWX A;  1Y01 A;  2NP9 A;  3RYI E;  4LF5 T;  4WNK A;  1ZHC A;  3K3N A;  4YSZ A;  5JDQ A;  2UXX B;  2K48 A;  3RF1 A;  4OYJ A;  4MHC A;  2ACX A;  1WLX A;  2JQ9 A;  3FBL A;  3UT5 E;  2IDO B;  2Q9Q D;  4GIW A;  2W66 A;  4Q25 A;  3P4P A;  2LHN A;  4CN1 A;  2XSA A;  1MND A;  3I9Y A;  1SA0 E;  5CFB A;  3JAF A;  4QH4 A;  5ABF A;  3AEB A;  3AA6 B;  4IL9 A;  5L3B B;  4ADZ A;  4KUM B;  1HR0 T;  4ZI3 D;  2JPF A;  3AE7 A;  4ZI7 E;  1J5E T;  4HWF A;  2Q9Q A;  4LMK A;  4TNW A;  3AXJ B;  5HXS A;  4OHF A;  3QB5 K;  3I0Q A;  2MBG A;  3R6N A;  4U3C A;  4L0R A;  3CKD A;  5BR8 T;  2W63 A;  1M7K A;  2GK9 A;  4TV9 E;  3ZYL A;  2XY8 B;  3ZN1 B;  1VCT A;  3ZMS B;  4EB6 E;  1SE7 A;  2JQH A;  1G73 A;  2X0Y A;  2VWA A;  2FUP A;  5TAO A;  1OED C;  1YQ4 A;  4HFD A;  1UCU A;  2YN6 A;  1YD8 G;  1HS7 A;  2D5U A;  2RP4 A;  4UF0 A;  2QVA A;  2XAG B;  3PU3 A;  4CI3 B;  5AQT B;  5AQM B;  4LFA T;  3O1I A;  4KMC A;  2H7V C;  3O1J A;  2WZH A;  1OED B;  3WAJ A;  5LHG B;  1BR2 A;  4CI1 B;  4DV0 T;  4YSX A;  2IIU A;  2K5B B;  4UV9 B;  5FY0 A;  2DLR A;  3SRZ A;  2IHR 1;  3E08 A;  4DV6 T;  3DP7 A;  3IBP A;  2K24 A;  2WU2 A;  4IE7 A;  4ILA A;  2PG8 A;  4A5X A;  2AE9 A;  3AE6 A;  3N9P A;  3TKL B;  2WY2 A;  4UR9 A;  1S35 A;  5C3J A;  4PK5 A;  3B57 A;  3NZQ A;  2KWI B;  3PJA A;  4EV6 A;  5LMN T;  3AA0 B;  4CQI A;  4YY3 T;  4DND A;  4B3T T;  4JUY A;  4HFH A;  2BDE A;  4JI0 T;  4EAH A;  3A8Y C;  2XUE A;  5LB7 B;  2D0T A;  2V7K A;  4ZZC A;  2DI4 A;  3UUM A;  4IDO A;  3C98 B;  4V1A v;  4DO0 A;  4QH5 A;  5ETW A;  4TV8 E;  1NAF A;  2C0S A;  3C4Z A;  1W9R A;  4FJO A;  2CM0 A;  2OLT A;  5HCM A;  2J47 A;  3IEE A;  5LGU B;  3BQI A;  2WCA A;  3ZC0 A;  5LHI B;  1BR0 A;  5IUX A;  3NRY A;  3FXD B;  2CBJ A;  1YKE B;  4AQF C;  2XAJ B;  4U7Y A;  3T8O A;  3BK9 A;  4P0A A;  2M67 A;  4AKL A;  4AIU A;  4X1K E;  3BQL A;  5CJ5 A;  3VKH A;  1CUN A;  5FL0 A;  5FL1 A;  2N2N A;  4IE6 A;  2V1D B;  4HWI B;  2KWH A;  3EDV A;  4YTN A;  4DVD A;  4EZH A;  4GYR A;  5AQR B;  3RQW A;  4YT0 A;  3N9L A;  4U31 A;  3P8C D;  3RIU A;  1OED E;  2Y6X A;  3FHN A;  5LG3 A;  4AI6 A;  5CB4 E;  2X9X A;  4ILU A;  4TX5 A;  4HTE A;  4HGA A;  3VRB A;  5LBQ B;  4CXW A;  3ZMT B;  2XQA A;  3RPU A;  2CBI A;  4U2Z A;  2VK9 A;  4DV2 T;  4YTM A;  3NRX A;  1N36 T;  2CE7 A;  3AE9 A;  2C5J A;  3KVA A;  2BKP A;  3UUL A;  2R6G F;  4I0U A;  4HEA A;  5JTG A;  4B3S T;  4H9O C;  3UU6 A;  3PUS A;  2L8K A;  3UQ4 A;  2WDV A;  5IHY A;  2UUA T;  4ZS3 A;  2BVM A;  4P09 A;  2X0H A;  1E1H B;  1HG5 A;  2BS3 A;  4C91 A;  5KDM C;  4K0U A;  4F6R C;  3AEC A;  3ABV A;  2LM2 A;  4LF8 T;  2DHR A;  2MTQ A;  4L9I A;  5HXH A;  2JQQ A;  3AE3 A;  3EDU A;  4IT4 A;  1MIV A;  3CQG B;  4X62 T;  4DR7 T;  5JQG E;  4H9Q C;  4JI4 T;  4I43 B;  4BJM A;  2W61 A;  3QB5 A;  1FJG T;  2FJB A;  2ZM8 A;  5HWY A;  2UXC T;  5L4H A;  1Y64 B;  2XSB A;  1E2A A;  1XDO A;  3O9X A;  3MJX A;  2FBW A;  4UVB B;  3ESL A;  2C5I T;  1KNP A;  1WR0 A;  2K9A A;  2FJA A;  4YSY A;  3SWH A;  5HAX A;  4A98 A;  3IF8 B;  4H9R C;  4GYS A;  1BR4 A;  5F3J A;  2X9W A;  3EAM A;  2CEA A;  1QUU A;  2L3L A;  3KDS E;  2YIN A;  5DQW A;  1L0V A;  5F8P A;  2E9X D;  2W67 A;  3HA4 A;  2B1E A;  3Q5D A;  4ILC A;  2NW7 A;  5LNK A;  1US7 B;  3N9O A;  3RC3 A;  3UU5 A;  4X64 T;  2WWV A;  2EHO D;  3I9W A;  5FKY A;  1YKH B;  4G2A A;  4EED A;  2LHR A;  3FBZ A;  2VKH A;  2E9X A;  2DNX A;  5LYJ E;  2BS4 A;  3DJB A;  2CLY B;  4YJ2 E;  4OK0 A;  2EHO A;  5AQU B;  4AKG A;  2ZMA A;  2XAS B;  1UUS A;  1VRB A;  5EK4 A;  4DID B;  4PNI A;  4CZZ B;  3IA3 A;  3AVR A;  4LMJ A;  2DWG A;  3ANW B;  5FXW A;  2G0U A;  2KLQ A;  4PFP A;  3RQU A;  3EUH A;  1QLB A;  3T1Y T;  2BKN A;  4ZI2 D;  5KXJ A;  2ZLY A;  5JDG A;  5L3G B;  5FYM A;  1NEN A;  4ZHQ E;  3ONX A;  4E7Z A;  4U33 A;  1ZEE A;  4XAX B;  3RH3 A;  3AE8 A;  4P1N A;  2KSR A;  3RIA A;  4COF A;  2WMN A;  4H9P C;  4QXB B;  2YDQ A;  1MIW A;  1SHZ C;  4MFR A;  3JAD A;  4A97 A;  3E0Z A;  3FZF B;  3CPZ A;  3LDQ B;  4PW8 A;  3LBX A;  2J1D G;  2I0M A;  2Q9Q C;  1GQE A;  3FXE B;  5JDL A;  2VKD A;  1W0B A;  4DUZ T;  4UXN B;  2XAH B;  2JQK A;  2ODV A;  5KMG P;  5ABF B;  3PUA A;  1Z8U A;  1HTJ F;  3QK6 A;  3WI3 A;  2VUR A;  5AQS B;  2X51 A;  4ZI3 C;  3GA8 A;  2Q9Q B;  5JDF A;  2A3D A;  3ETV A;  5EK2 A;  5JR9 A;  2HN1 A;  4AKR B;  4JI3 T;  3UTK A;  2NW9 A;  5H6Q B;  4IRE A;  3UFG A;  1BR1 A;  4ANJ A;  1HG2 A;  1YW0 A;  3AE4 A;  3RRC A;  3P50 A;  5JDH A;  2MAW A;  4NXM T;  3TLW A;  5EZY E;  5HEG A;  2XQ8 A;  3NBX X;  3MKD A;  4DMW A;  3CQC B;  3ZJ2 A;  3KV6 A;  3J7Y q;  4TNV A;  4ZEY A;  3FZH B;  1MMN A;  2XQ7 A;  3H3M A;  3SFD A;  2LSY A;  1IJ6 A;  3Q5W A;  3ZT7 A;  2LOS A;  4YLH A;  5FNV E;  3PUR A;  1OWA A;  2AXD S;  2BVL A;  2WDR A;  2Y8D A;  3HKE E;  3RIF A;  2K3W A;  2H89 A;  5BMV E;  2YDR A;  4LF6 T;  3QOF A;  4I4T E;  4DR6 T;  3UFE A;  3RC8 A;  4JI6 T;  3NZP A;  3PUG A;  1XNQ T;  2V6X A;  5M4Y A;  3CML A;  5AQQ B;  2ZM0 A;  3RKG A;  1HX1 B;  3ZPO A;  4QXH B;  2L9Q A;  3DTO A;  3ZKR A;  3CX7 B;  4PJJ A;  4O8S A;  2XTL A;  1HNZ T;  2PJQ A;  5FVL A;  3HKC E;  4ZS2 A;  2YU1 A;  3P4W A;  4HN9 A;  3AE1 A;  2QA7 A;  4L5G A;  2HH7 A;  1HNW T;  5CGM A;  5L4E A;  2HHH T;  5FMN A;  3ONL C;  3EAB A;  4NPP A;  1QSD A;  3K8P C;  4JEU B;  3U78 A;  5LHH B;  4IDP A;  3EVY A;  3KV5 A;  1YQ3 A;  3NWI A;  2ZM2 A;  4YXD A;  4YHH T;  4KHP T;  4TWF A;  4DMV A;  4QHO A;  2CRB A;  4PJN A;  2ZM6 T;  5LA6 E;  3MZK B;  2V8S V;  2VL8 A;  4HFI A;  4DUY T;  2CXF A;  3L39 A;  4HE8 A;  3RIU C;  1XWM A;  4OFZ A;  3FZL B;  4BA9 A;  4DR5 T;  5F5W A;  2BBH A;  4ZZB A;  2WSS V;  5ABH A;  5IWA T;  2UXN B;  3HL6 A;  2IW5 B;  2LRK A;  2LM9 A;  3MK7 C;  4HFC A;  4IHJ E;  4JBW F;  4ERR A;  2LOP A;  2J62 A;  2Z6E A;  1XMO T;  2XQ6 A;  3LJC A;  3E22 E;  3TLV A;  4CN4 A;  5AQH B;  4EYU A;  5LBM A;  2CWO A;  3R84 B;  2BG9 A;  2SPC A;  5HCJ A;  5L2L A;  4JI1 T;  4JYA T;  1NWM X;  4MBQ A;  4DV5 T;  3UUB A;  2RA1 A;  3PV0 F;  3NKZ A;  4UEL A;  4O4L E;  2XQY A;  4HWC A;  2DCF A;  4MAL A;  1ZKE A;  2XQ5 A;  2V7J A;  3JC6 C;  3EI0 A;  3TLT A;  2VL0 A;  1ZP0 A;  2X68 A;  3KBT A;  5L47 A;  4GK5 E;  5LCY A;  2B76 A;  3RYC E;  2JIW A;  5LP6 E;  2IAK A;  1J1J A;  4GK0 E;  4JV5 T;  3H3A A;  3BQK A;  2CHO A;  3JC6 D;  4HKA A;  5JVD E;  5AQG B;  2E8I A;  2YKS A;  3CVR A;  2LLY A;  4DV7 T;  5FXV A;  4DBQ A;  3QC9 A;  2D2S A;  2UXD T;  2WAU A;  3UU3 A;  3KVB A;  4QX7 B;  5J0Z A;  1HX8 A;  2XHE B;  3PUW F;  1CHU A;  3LK3 B;  3PUQ A;  3AEF A;  4WBN E;  3VRA A;  4B6X A;  4JI5 T;  3K3O A;  3LFM A;  5JH7 E;  4HFE A;  1FEW A;  3UU8 A;  4IE0 A;  3ZN0 B;  3ZMV B;  3VU7 H;  5HXC A;  2W2U A;  2X9Y A;  3N5L A;  3LSV A;  3K3Q C;  3B5M A;  1UX5 A;  5H6R B;  3F2E A;  5LGN B;  4Z91 A;  3AB3 B;  4U7I A;  3P4R A;  3RGL A;  1IAP A;  1KEY A;  3CK6 A;  4A56 A;  3F57 A;  2LKG A;  2CXD A;  3V5U A;  2E9X C;  2N9D A;  2XM2 A;  4QH1 A;  1FMW A;  5ADX L;  4H63 H;  1UGO A;  4NIQ A;  2X67 A;  2XM1 A;  5JRE A;  4UIG A;  3QNU A;  2EHO C;  3FZK B;  4U2Y A;  3Q5X A;  3PTR B;  2V6Y A;  2E9X B;  3J9X 1;  4DR4 T;  3C4W A;  3SFE A;  5JRC A;  2WZI A;  1JNR A;  1H7C A;  5LJM A;  2EHO B;  4X1I E;  4E7S A;  1LRZ A;  4QXC B;  5ABE A;  1WFD A;  3HI2 A;  1ZV4 X;  5LGT B;  3O1H A;  3ZCI A;  2NWB A;  1IBK T;  4KHZ F;  2IML A;  4CN6 A;  2LKH A;  2JMK A;  5A1L A;  4YJ3 E;  2M6B A;  4IST A;  4X5T A;  4ISS A;  3OYZ A;  1WR6 A;  4AKH A;  2LRL A;  3NVO A;  2LSK A;  4ZI2 C;  1X9B A;  4U72 A;  2YU2 A;  5HEH A;  4K0K T;  1D0Z A;  3SS1 A;  3C50 A;  3PUZ F;  4HWH A;  3GN5 A;  4UEM A;  4BAY B;  3TLU A;  5FY1 A;  3P4S A;  2M6I A;  1IZN B;  4GKJ T;  3ZMU B;  5JDN A;  4EXT A;  1KNZ A;  4EIW A;  3AA1 B;  5ABG A;  2VAS A;  4UV8 B;  3S4U A;  4WYV A;  3ZEF B;  2J4G A;  3N9M A;  3GWH A;  4NUU A;  5JR9 C;  4OYK A;  1SUM B;  5HEU A;  2VVS A;  2LSG A;  4Z8X A;  4FI5 A;  4ILB A;  1M62 A;  3AEE A;  1MNE A;  1WCR A;  3ZJ1 A;  5JR9 B;  4KP3 C;  4TN7 B;  3PDY A;  4UVA B;  4JI8 T;  1D0Y A;  3EHZ A;  3AEA A;  1U5P A;  5HXE A;  2WS3 A;  3CIR A;  2MPK A;  2YDS A;  2ODU A;  5HYA A;  3RYF E;  2LT3 A;  4HFB A;  3OPC A;  3CWZ B;  2WU5 A;  2IUB A;  2YK0 A;  3CX8 B;  1MIY A;  2FJD A;  3H37 A;  3N2O A;  1EZ3 A;  2VKJ A;  2XAQ B;  2XQ3 A;  2V7L A;  2VKO A;  5LJN A;  1R8I A;  5L3C B;  5HEO A;  2UUC T;  4LF4 T;  1LVF A;  4PFO A;  4YHJ A;  4AQG A;  3RLF F;  3P7I A;  2FJE A;  4TZ4 C;  2CA5 A;  1KK7 A;  4P0B A;  2X66 A;  4UF0 B;  3RYH E;  3O4X E;  3PJA J;  5EK3 A;  2ACZ A;  1KFY A;  3VHL A;  5JDM A;  1IJ5 A;  2CPT A;  4IGU A;  3N2G E;  2NTX A;  3D0T A;  2WBL A;  2D9D A;  2V26 A;  1UK5 A;  5AQN B;  3MAC A;  4Z90 A;  4WBO A;  1UUR A;  4IE5 A;  4UVC B;  4ZOL E;  3AE2 A;  3KFW X;  3AED A;  4X1Y E;  3L3P A;  2XQ9 A;  3LK4 2;  4PJL A;  4TWH A;  3ZCJ A;  3X1D A;  3Q2M A;  1W09 A;  1VCS A;  5KX5 E;  4TUY E;  3AXJ A;  2KXP B;  3ZMZ B;  3RX6 A;  2PFV A;  4OX9 T;  4PAG A;  1KF6 A;  5IYZ E;  4DR3 T;  1IBL T;  1DU2 A;  2MOZ A;  3OVU A;  2JMH A;  4XZC A;  3K1S A;  4X65 T;  3A5X A;  3AA7 B;  2V5C A;  3V5S A;  2E5L T;  1W0A A;  2X0L B;  4O4J E;  1V9D A;  2V7M A;  1OXZ A;  4LF9 T;  3KV9 A;  2H3R A;  3AVS A;  1XZY A;  4QX8 B;  4EEB A;  1D1C A;  2PTF A;  2I6H A;  5FY7 A;  3OTO T;  3Q9D A;  3VKG A;  2OV9 A;  2WP9 A;  3GMI A;  1OED A;  5FXZ A;  4X66 T;  3CQX C;  2Y48 B;  2KT9 A;  4IL4 A;  1O3X A;  4PK4 A;  5DJQ C;  5GON E;  3ZYK A;  1T7S A;  2P9B A;  3OKQ A;  4IDQ A;  2BG9 C;  4CI2 B;  4XBF B;  5CA0 E;  3AE5 A;  5L3D B;  4KX6 A;  5J2U E;  4JLE A;  1LKX A;  4B3R T;  1WYB A;  4LF7 T;  4HWD A;  4QWN B;  1J5W A;  2BG9 B;  2WQY A;  3RRW A;  2DL1 A;  1N34 T;  4QKN A;  3ZLI A;  2XAF B;  2HN2 A;  3QUJ A;  4TWD A;  4JI7 T;  3UU4 A;  1U4Q A;  2LSI A;  4B3M T;  2LSJ A;  4GKK T;  4YFS A;  2NR4 A;  4MLK A;  4AQY T;  5FP3 A;  4C90 A;  5LXT E;  3ZT5 A;  4DBR A;  2C5K T;  3A7M A;  3U3I A;  5AQK B;  2LEH A;  4LFC T;  2H7O A;  2H88 A;  3AEG A;  5J2T E;  4BJN A;  1XMQ T;  4KI0 F;  4DV4 T;  1IBM T;  1XNR T;  4O2A E;  1X79 A;  4EGW A;  4EZ4 A;  5AQJ B;  3PU8 A;  4LFB T;  3WAK A;  3ZT6 A;  4ASK A;  3C51 A;  5DAB A;  4IE4 A;  4H9N C;  4DR2 T;  2A2F X;  2BZB A;  2KMF A;  2W62 A;  2VB6 A;  4O4I E;  1HFA A;  2WM9 A;  4EYY R;  4G63 A;  1VOM A;  2BBJ A;  3L8R A;  5AQF B;  3HKD E;  4AQF A;  3PE0 A;  3FZM B;  3N9N A;  2HPJ A;  1ZOY A;  3UUX B;  2CMR A;  3AAI A;  5FXX A;  2NOX A;  3T1H T;  5L3E B;  4N78 D;  1B7T A;  2UUB T;  3TLS A;  1UX4 A;  1WRD A;  4H9S E;  5LOV E;  4ZXL A;  3UUN A;  5AQP B;  3B13 A;  1LVK A;  3KV4 A;  2VQF T;  4AXP A;  1HCI A;  3JCF A;  4I50 E;  3PUV F;  3C4X A;  2LJL A;  2I59 A;  2LE8 A;  2UXB T;  1T72 A;  3I1A A;  4IDN A;  5AFU L;  4U74 A;  4NUV A;  2BG9 E;  1D1B A;  4WZX A;  5FVK A;  3CX6 B;  3OBV E;  5LMU T;  3P4Q A;  2KZ7 B;  2A9U A;  3AAA B;  2V6Y B;  2WB5 A;  2DWK A;  3M65 A;  4F8H A;  2KIN B;  3RHW A;  4YTP A;  1D1A A;  2OA5 A;  5JRC B;  2F4V T;  2RPA A;  3VR8 A;  5C8Y E;  3ONJ A;  2A72 A;  3PUY F;  4LML A;  4GOU A;  1FIO A;  2KND A;  1T98 A;  4AKI A;  1I94 T;  2YEV C;  3HKB E;  5E0O A;  2CCQ A;  1N33 T;  4EOZ B;  2ES0 A;  4NXN T;  3N2K E;  2V5D A;  3PUX F;  3IHR A;  4IIJ E;  4PJM A;  2VVN A;  3FB2 A;  3OJA A;  1Z0P A;  2CHN A;  5AQV B;  2IC6 A;  3RI5 A;  3JAE A;  1YXR A;  4CXX A;  1MMD A;  1G8X A;  2NW8 A;  2QRX A;  2IC9 A;  3W15 B;  3MXZ A;  3M3Z B;  1NEK A;  5J1G A;  3GN5 B;  3AAE B;  2W00 A;  2QGS A;  3LG7 A;  3RKO A;  2V7I A;  1HF8 A;  1WYC A;  2CLY C;  1KNR A;  1S94 A;  3MA9 A;  1JNZ A;  4O4H E;  4CXY A;  2XPK A;  3N9Q A;  1MMA A;  2W4X A; 
#chains in the Genus database with same CATH homology
 5AQG B;  5AQM B;  5AQP B;  5AQR B;  4HWF A;  3FZL B;  2D9D A;  4HWD A;  1UGO A;  5AQT B;  1T7S A;  1UK5 A;  5AQN B;  4HWC A;  5AQH B;  1I6Z A;  4HWH A;  5AQI B;  3A8Y C;  1M62 A;  5AQF B;  5AQS B;  5AQJ B;  3FZK B;  5AQK B;  1M7K A;  5AQL B;  3FZF B;  5AQQ B;  5AQV B;  3LDQ B;  5AQU B;  4HWI B;  3FZM B;  5AQO B;  1HX1 B;  3M3Z B;  3FZH B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...