5AQUB

Fragment-based screening of hsp70 sheds light on the functional role of atp-binding site residues
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
115
structure length
115
Chain Sequence
GPLGSNSPQEEVELKKLKHLEKSVEKIADQLEELNKELTGIQQGFLPKDLQAEALCKLDRRVKATIEQFMKILEEIDTLILPENFKDSRLKRKGLVKKVQAFLAECDTVEQNICQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords HEAT SHOCK COGNATE 71 KDA PROTEIN
publication title A fragment-based approach applied to a highly flexible target: Insights and challenges towards the inhibition of HSP70 isoforms.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chaperone
total genus 45
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2015-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02179 BAG BAG domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.120 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 BAG domain 5aquB00
4HWCA 5AQIB 5AQTB 1HX1B 1UK5A 1I6ZA 4HWFA 1M7KA 3FZHB 5AQVB 3FZLB 5AQSB 5AQRB 3FZFB 4HWIB 5AQFB 1UGOA 5AQKB 3FZMB 5AQGB 5AQHB 1M62A 5AQQB 5AQOB 3M3ZB 3A8YC 3LDQB 4HWHA 5AQLB 1T7SA 5AQPB 3FZKB 5AQNB 4HWDA 5AQJB 2D9DA 5AQMB 5AQUB
chains in the Genus database with same CATH superfamily
4HFDA 2J47A 4YSXA 5EK2A 5FKYA 3RRWA 4EIWA 4ZXLA 2XHEB 3ZMTB 3HR0A 4K0KT 2DHRA 3CMLA 2F4VT 3AAAB 5L3GB 4ZI2D 4DO0A 3LG7A 3OKQA 3MJXA 2E9XD 2ACXA 3UQ7A 3E22E 4L5GA 1IBMT 4U2ZA 5FNVE 3K3OA 1FIOA 1KNPA 5AQMB 1HG5A 2KSRA 3UULA 5ABFA 1HF8A 3B5MA 3MXZA 2XAJB 1H7CA 5LNKA 3AA6B 2YU2A 3BQLA 4H63H 4NPPA 3BK9A 5HYAA 4PK5A 4DR6T 2LKHA 4TNWA 2VB6A 3NKZA 1V9DA 2H89A 4X1KE 2EHOD 2K3WA 5JTGA 3RKGA 3D0TA 2Y8DA 3ZN1B 2VKJA 4DNDA 3DP7A 1BR1A 5KXJA 4PK6A 3ZT5A 2NW8A 3R84B 1CUNA 1KNZA 4MALA 3ZYLA 5FY0A 3RIAA 3MK7C 3VRBA 4U7IA 1YKHB 1HG2A 1XNQT 3PUGA 3PUAA 2IMLA 2VL8A 5LBMA 5HCJA 5E0OA 1N36T 4ADZA 2CXFA 2ODUA 3FBLA 2XQ9A 4I4TE 3T1YT 2JJ9A 4IDOA 5DQVA 4YHJA 1SA0E 3MACA 2BVLA 3VRAA 3KVBA 3KV5A 2JQQA 1NAFA 2W66A 3UTKA 3P50A 2M6BA 4NUUA 2D9DA 4DBRA 2CWYA 1ZOYA 2MTQA 4O4JE 1IBLT 4HN9A 2HN1A 3CK6A 3K3QC 4LFBT 3ZYMA 3FZLB 2QRXA 2HPLA 2XQ8A 5JDNA 5FYMA 4LF6T 2IW5B 4DIDB 1OEDE 4QKNA 2A9UA 3L39A 2XASB 4H9SE 2V1DB 3H37A 3AEBA 2CRBA 3UUXB 2CA5A 1FEWA 4ZZCA 3CIRA 5ABGA 2VWAA 3AA0B 4WBNE 5ABEA 2QA7A 2VQET 4HWCA 3KVAA 4ERRA 2CBJA 5LHHB 2W0GA 3AAEB 3RYCE 1SE7A 3N9PA 1T8BA 1UGOA 1XNRT 5LGUB 1HNXT 2E9XB 5AQHB 5ADXL 2MOZA 5HXRA 2D5UA 5J2TE 3ANWA 5LXTE 4C90A 4A98A 4HFHA 3RX6A 2XQAA 4JEHB 3CVRA 4KBMB 2OA5A 2J4GA 2NR4A 4HFVA 3N9MA 5HXHA 1MIYA 4PK4A 2WB5A 4ILUA 3ZC0A 1T72A 3RH3A 5CA1E 2W63A 2KINB 3NWIA 4CXWA 3RF1A 2XM1A 1JNRA 4AQGA 2UXCT 3OPCA 2V7KA 2SPCA 4YTNA 2CWOA 2V7LA 4I50E 1MIVA 2FJAA 1NEKA 1OEDB 5AQTB 1Y64B 4IDPA 3O1HA 2EHOB 5JRCA 3LSVA 3F31A 1KEYA 3NRXA 3L09A 5JDHA 4YJ3E 2YEVC 1XMOT 3RKOA 4V1Av 2L3LA 5LCYA 3AEEA 4ISSA 5ETWA 3UUMA 1Z8UA 5TAOA 1XWMA 4J2CA 4P09A 2XAGB 4EOZB 5L3CB 3AEAA 2WMNA 3HL6A 3RC3A 1J1JA 2E5VA 3PUXF 3L3PA 5JDFA 3OYXA 4QH1A 4E7ZA 4HWHA 2KMFA 2MPKA 3OTOT 4M1PA 4JI6T 4LF5T 2DL1A 1J5ET 4IDQA 4U31A 1N34T 4EAHA 2NW9A 2W00A 2VKOA 4L9IA 3HKEE 3MA9A 3CQGB 5BMVE 1MNEA 2V6YA 3N2OA 5DQWA 2A72A 4YSZA 3C4XA 4OYKA 2FJDA 3N2KE 4UXNB 3PUSA 3EAMA 3IEEA 4DR5T 4AIUA 4JI7T 4AQYT 1JNZA 3Q9DA 1W0AA 4EZ4A 4AXPA 4PJJA 3ZSSA 3SS1A 5FXXA 4JI1T 2XPKA 2ZLYA 4ZI3C 3N9OA 5LA6E 3UFGA 3ZMSB 2W4XA 4H9OC 4OFZA 4KMCA 4JBWF 4LF7T 4O8SA 2D0TA 3NZPA 5JR9A 4ZEYA 3ZEFB 3P4SA 2XZEA 2HHHT 2MAWA 2LEHA 3J7Yq 1IJ5A 3EVYA 4NIQA 3V5SA 4EEDA 5HEJA 4ASKA 3C4WA 4MHCA 1VRBA 2N2NA 2J1DG 3A8YC 2DLRA 3DTOA 4UF0B 2UUCT 3LFMA 4L0RA 3RC8A 4JI0T 2Q9QC 2BS3A 4TN7B 4EZHA 3O9XA 3ABVA 2WDVA 4XAXB 4DV4T 2FUPA 1G8XA 2YDSA 2CCQA 2YDQA 4ANJA 3IBPA 3AE1A 4CI3B 4B3TT 3LDQB 2CXLA 5FXZA 2WCAA 3RYIE 4ZOLE 3ZSTA 4DV6T 3RYFE 4FI5A 5M4YA 4AKRB 4UEMA 4TNVA 2QYWA 3TKLB 3MZKB 1HNWT 2D0UA 4TWFA 4GIWA 2HN2A 2H7OA 2ZM8A 3GN5B 5JQGE 2VVSA 2UUAT 5FP3A 3ZCJA 4X64T 2CMRA 2WBLA 4X65T 2B76A 4A5XA 2CHNA 2X67A 3NBXX 3N5LA 4QXBB 2X68A 4AKIA 1O3XA 5FXVA 4ZZBA 3UQ4A 5H6QB 2CPTA 2CXDA 5JVDE 4CXYA 2V6XA 2ZMAA 5AQVB 3AE2A 2KNDA 2NOXA 1FMVA 3SOLA 3CWZB 4ZI7E 5FL0A 5IUXA 3KDSE 4ISTA 3ZLIA 4NUVA 3X1DA 4GYSA 4O2BE 2YKSA 4PJMA 4EGWA 2CBIA 5JDQA 2JPFA 4BAYB 1KFYA 3RLFF 2GK9A 3IHRA 4BA9A 3BQKA 3C50A 2M67A 1YQ4A 3RIUA 4JI3T 4YY3T 1LRZA 3Q5WA 1UUSA 4OX9T 4U3CA 3O1JA 2J62A 3A5XA 5HEGA 4LMJA 3KV9A 5AQJB 3ESLA 3AXJB 2NP9A 3UFEA 3VKGA 2OV9A 1D1BA 2VURA 3E0ZA 3HKBE 4U33A 3JADA 3UT5E 4UIGA 2LHNA 1NENA 3I0OA 2FJBA 2Q9QB 3ZT7A 3K1SA 2RP4A 4P0AA 5L3FB 3U3IA 4IE4A 4H9RC 2X9HA 2G0UA 1IZNB 2JQ9A 3FZMB 5L3EB 2P9BA 3PV0F 4BJMA 3Q2MA 5LGNB 2VQFT 3I0QA 2LJLA 4YXDA 2ACZA 2LT3A 3I1AA 2IHR1 4H9NC 3CQCB 3E08A 2XQ7A 4OK0A 3L8RA 4O4HE 3ZMVB 4WNKA 4C91A 3S4UA 1HR0T 4ZHQE 2PJQA 2B1EA 2IUBA 3FB2A 4EB6E 2IDOB 2IAKA 5KDMC 4AI6A 2LHRA 3I9YA 3PU8A 3N9QA 4DBQA 3KFWX 3GMIA 3RHWA 3LBXA 3CX8B 4LFCT 3CQXC 4TV8E 2UXNB 4U72A 5AQPB 2IC9A 2I0MA 4A97A 4IL4A 3OVUA 4CXXA 3WAKA 3AAIA 1XMQT 2WSSV 3GA8A 1KNRA 2H3RA 4HWFA 1XDOA 2LSGA 1ZV4X 1IAPA 2V7JA 3ETUA 2YDRA 3B57A 1MMNA 5H6RB 3SRZA 5LYJE 2QGSA 2WWVA 1HNZT 2IIUA 2RPAA 3UU4A 4TZ4C 3V5UA 4AISA 2WDQA 4LMKA 2AE9A 1M62A 4UR9A 2ZM0A 3QNUA 4HWDA 4IE5A 4DV5T 2CLYC 2WZIA 3KBUA 3CKDA 5F8PA 4TWHA 4HWIB 3ZJ1A 2BG9A 4IIJE 2ZM2A 2BVMA 3EI0A 4YLHA 3EUHA 5ABFB 5DABA 1VCSA 1HCIA 1WR6A 4Z90A 3TLVA 1KF6A 5L47A 5JDLA 1VOMA 4PAGA 4HKAA 2YK0A 3FZKB 3C98B 4NXNT 3PU3A 5F5WA 2WS3A 1OXZA 4LF4T 4AQFA 3C4ZA 3RQUA 4PNIA 4JLEA 5KX5E 2R6GF 2LSKA 2X9YA 3HKCE 1UX4A 1UX5A 4MBQA 5J1GA 4X1IE 4ZS2A 3F57A 1I94T 3RYHE 2XQ3A 2W61A 4CN6A 1MMGA 3HI2A 2C5JA 2LOSA 3SWHA 2DI4A 3ZKRA 4X20E 3OBVE 4HFEA 3KINB 3PE0A 2VKDA 2UXXB 3VHLA 4GKKT 2XTLA 1SHZC 3P4PA 2I59A 3ONJA 5HEUA 4MLKA 2V7MA 2V8SV 1ZEEA 4OYJA 5FY1A 3ZMUB 1HTJF 3T8OA 5LMNT 1YQ3A 4F6RC 4IREA 3VKHA 4B3ST 3NZQA 3C51A 3ONXA 2WMOA 2YU1A 4QWNB 4H63V 1D1AA 2BS2A 3K3NA 3ZJ2A 5J0ZA 4ZI3D 3N2GE 2JQKA 5L3DB 4I0UA 2X0YA 2RA1A 3WI3A 2BZBA 4WYVA 2XQYA 4EYUA 2NTYA 4JYAT 4GK0E 2VVNA 3JAFA 2BKPA 4PJLA 4MFRA 4YJ2E 4CI1B 4DR7T 3KV4A 3PUWF 4QX7B 3H3MA 3G06A 3ETVA 3JC6C 3AE3A 3Q5EA 5HWXA 3RGLA 5JR9C 1MNDA 2MBGA 4O2AE 5FVLA 3DJBA 4F8HA 2Q9QD 1KK7A 5AFUL 2WWUA 2KLQA 5AQNB 2X9XA 5FMNA 4UV9B 2IC6A 2CLYB 4XBFB 5IWAT 3Q5XA 5LBQB 5CFBA 3LK2B 4X66T 2WY2A 1SUMB 4U74A 4QH4A 4QHOA 4LMLA 3ANWB 2X0LB 2KZ7B 2WU2A 4LF9T 4NXMT 2DNXA 4ILBA 2CE7A 4P0BA 3QOFA 4IDZA 1N32T 3ZCIA 1ZP0A 2LSYA 3H3AA 2XY8B 5AQLB 4EEBA 3VU7H 3TLSA 1HFAA 3OJAA 4COFA 2H7VC 3GWHA 4GYRA 2UU9T 3ZN0B 2C5IT 4TX5A 4WW0A 5JRCB 2LOPA 2BBHA 3N9NA 1I6ZA 2DWKA 4KUMB 2V7IA 3FZFB 3F2EA 3P4WA 1IJ6A 4JI2T 3IF8B 4HEAA 3FXEB 2N1GA 3FBZA 4ZS3A 3PUYF 2M6IA 4DUYT 4PW8A 4JV5T 3FXDB 1WYBA 4DR1T 1E2AA 1E7PA 2D2SA 2X51A 3CX7B 3P7IA 2Y48B 5FVKA 2E9XA 2L8KA 2L9QA 1LVKA 2XUEA 4YT0A 3AE9A 2V6YB 2PG8A 4DR3T 1HS7A 4CN1A 4ZI2C 2BDEA 1WR0A 4A56A 4B3RT 2ES0A 3PUZF 5AQQB 5LHGB 3N9LA 2E5LT 4EXTA 2E9XC 3UUBA 3IA3A 4IT4A 3AECA 1FMWA 4U7YA 4QH5A 2CHOA 5J2UE 5AQKB 3K8PC 3PURA 3JCFA 3TLTA 4DV1T 5EK3A 4KI0F 1R8IA 5DJQC 5JR9B 2LKGA 4CN4A 5JH7E 3P4QA 3RIUC 1UURA 2BBJA 2VASA 3C64A 1OEDA 3FZHB 1UCUA 2AXDS 2EHOA 2FBWA 3KV6A 4ILAA 2QVAA 5CA0E 5KMGP 1IBKT 5A1LA 4B3MT 3OYZA 4PFPA 2X0HA 3ZT6A 2W62A 3QC9A 4IDNA 1U5PA 3EDUA 4I43B 2WP9A 1W0BA 2LE8A 5C2TA 1HX1B 3QB5K 1OEDC 3W15B 2K24A 4I55E 4HGAA 2EHOC 1L0VA 2HH7A 4DV0T 2X9WA 3UU3A 3AE7A 2JRKA 5HWYA 1X9BA 2XAHB 4X62T 5HXCA 1YKEB 5FY7A 3EHZA 5EK4A 4HFCA 3PUQA 1Y01A 5CGMA 4O4IE 2A2FX 1EZ3A 4G2AA 1T7SA 2K48A 3SFDA 5JDMA 5HAXA 3QB5A 4P1NA 2XAFB 5IHYA 3ZMZB 1M7KA 2LRLA 5CB4E 2H88A 4JI5T 2XM2A 4YSYA 5AQGB 3VR9A 3CX6B 3LJCA 3AB3B 2BKNA 3RI5A 3LK3B 4DMVA 1T98A 1BR0A 2MYSA 3AEDA 2Z6EA 1D1CA 2WAUA 2XSBA 4K0UA 2NTXA 4YHHT 2VKHA 3PTRB 4HE8A 2NW7A 2YOEA 3UU6A 4DV2T 1YD8G 5HCMA 1US7B 5AQIB 3ZPOA 5EZYE 3HKDE 4N78D 4X1YE 2ZM6T 4AKLA 3WAJA 3NRYA 4CI2B 2JMHA 2X66A 3J9X1 4DMWA 3FHNA 5AQOB 3AVSA 4U2YA 3RRCA 1ZKEA 1S35A 2WQYA 4IHJE 4UF0A 5LOVE 4JI4T 2LLYA 1QLBA 5LG3A 2E2AA 5JDGA 4G63A 3O4XE 2UUBT 3AE6A 3AEFA 3I9WA 4GOUA 3HA4A 4TWDA 2BS4A 3T1HT 4GKJT 3Q5DA 1D0ZA 2LRKA 3U78A 2W2UA 4IGUA 2XQ6A 2UXDT 1MMAA 4YFSA 2BG9C 4BJNA 2JMKA 4HTEA 3LK42 1WRDA 3CPZA 5F3JA 2JIWA 5FXWA 3UUNA 4UVBB 1WCRA 1MMDA 1CHUA 5LMUT 3MKDA 4PJNA 2VK9A 4PFOA 2V26A 3M3ZB 4IE6A 4ILCA 3AE5A 3M65A 1BR2A 3GN5A 5AQUB 2LSIA 4AQFC 3R6NA 3P4RA 4Z91A 5HEHA 2NWBA 5LGTB 2HPJA 2XJ7A 4UVAB 3ZYKA 4Q25A 3TLUA 2K5BB 5AQSB 5BR8T 2OLTA 4JUYA 2V5DA 4CZZB 4DV3T 1VCTA 1QUUA 4O4LE 4UVCB 3O1IA 1XZYA 4DR2T 3EABA 2DWGA 2LM9A 4YTPA 4UV8B 3BQIA 4JI8T 2XQ5A 3TLWA 4QXHB 5IYZE 4IE7A 4HFBA 4WZXA 4YTMA 2ODVA 1S94A 4H9QC 1DU2A 5LB7B 3P8CD 5JREA 5L4HA 4CQIA 2BG9E 3VR8A 4DV7T 1BR4A 2LM2A 2C5KT 1B7TA 4KHPT 1MIWA 1YW0A 2YINA 2XSAA 1Z0PA 1ZHCA 2N9DA 4XZCA 4Z8XA 3JAEA 5L2LA 3ZC1A 2JQHA 4EV6A 3QK6A 3QUJA 3AA7B 3UU8A 3KBTA 1UK5A 3ONLC 2E8IA 1J5WA 4H9PC 3JC6D 3A7MA 5AQFB 3LBXB 3PJAJ 3PJAA 2CM0A 2CEAA 4LF8T 2WU5A 4X5TA 5LJMA 1WYCA 2W67A 3AXJA 4AKGA 3RPUA 3B13A 5AQRB 5LG4A 2UXBT 2KT9A 5LHIB 2Y6XA 1OWAA 4JEUB 3RQWA 4KHZF 3PUVF 2BKOA 2PBIA 5HXSA 2Q9QA 1LKXA 2A3DA 4UELA 2YN6A 5LJNA 5L3BB 2KXPB 2DCFA 5C8YE 3AEGA 5ABHA 1NWMX 1D0YA 1U4QA 1G73A 1E1HB 3RIFA 4TUYE 4DUZT 4LFAT 1FJGT 4TV9E 1GQEA 4KX6A 1W09A 3AVRA 3UU5A 1D0XA 2K9AA 5HEOA 2BG9B 4HFIA 4QXCB 2WZHA 2WDRA 4GK5E 1QSDA 2XAQB 2I6HA 3AE4A 4B6XA 2C0SA 3AE8A 3PDYA 5GONE 3EDVA 4IE0A 1AJ3A 2LSJA 2FJEA 5HXEA 2XQ4A 4AKHA 5C3JA 4DVDA 1LVFA 4OHFA 4DR4T 1XDPA 4EYYR 2V5CA 1HX8A 2PFVA 1X79A 2KWIB 3AA1B 1WLXA 2VL0A 1WFDA 5CJ5A 3NVOA 3SFEA 4WBOA 5LP6E 4FJOA 1W9RA 1N33T 4E7SA 2KWHA 2PTFA 4KP3C 5FL1A 4IL9A 4QX8B 5L4EA 1YXRA 2WM9A
chains in the Genus database with same CATH topology
4HWCA 5AQIB 5AQTB 1HX1B 1UK5A 1I6ZA 4HWFA 1M7KA 3FZHB 5AQVB 3FZLB 5AQSB 5AQRB 3FZFB 4HWIB 5AQFB 1UGOA 5AQKB 3FZMB 5AQGB 5AQHB 1M62A 5AQQB 5AQOB 3M3ZB 3A8YC 3LDQB 4HWHA 5AQLB 1T7SA 5AQPB 3FZKB 5AQNB 4HWDA 5AQJB 2D9DA 5AQMB 5AQUB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HWC A;  5AQI B;  5AQT B;  1HX1 B;  1UK5 A;  1I6Z A;  4HWF A;  1M7K A;  3FZH B;  5AQV B;  3FZL B;  5AQS B;  5AQR B;  3FZF B;  4HWI B;  5AQF B;  1UGO A;  5AQK B;  3FZM B;  5AQG B;  5AQH B;  1M62 A;  5AQQ B;  5AQO B;  3M3Z B;  3A8Y C;  3LDQ B;  4HWH A;  5AQL B;  1T7S A;  5AQP B;  3FZK B;  5AQN B;  4HWD A;  5AQJ B;  2D9D A;  5AQM B;  5AQU B; 
#chains in the Genus database with same CATH topology
 4HFD A;  2J47 A;  4YSX A;  5EK2 A;  5FKY A;  3RRW A;  4EIW A;  4ZXL A;  2XHE B;  3ZMT B;  3HR0 A;  4K0K T;  2DHR A;  3CML A;  2F4V T;  3AAA B;  5L3G B;  4ZI2 D;  4DO0 A;  3LG7 A;  3OKQ A;  3MJX A;  2E9X D;  2ACX A;  3UQ7 A;  3E22 E;  4L5G A;  1IBM T;  4U2Z A;  5FNV E;  3K3O A;  1FIO A;  1KNP A;  5AQM B;  1HG5 A;  2KSR A;  3UUL A;  5ABF A;  1HF8 A;  3B5M A;  3MXZ A;  2XAJ B;  1H7C A;  5LNK A;  3AA6 B;  2YU2 A;  3BQL A;  4H63 H;  4NPP A;  3BK9 A;  5HYA A;  4PK5 A;  4DR6 T;  2LKH A;  4TNW A;  2VB6 A;  3NKZ A;  1V9D A;  2H89 A;  4X1K E;  2EHO D;  2K3W A;  5JTG A;  3RKG A;  3D0T A;  2Y8D A;  3ZN1 B;  2VKJ A;  4DND A;  3DP7 A;  1BR1 A;  5KXJ A;  4PK6 A;  3ZT5 A;  2NW8 A;  3R84 B;  1CUN A;  1KNZ A;  4MAL A;  3ZYL A;  5FY0 A;  3RIA A;  3MK7 C;  3VRB A;  4U7I A;  1YKH B;  1HG2 A;  1XNQ T;  3PUG A;  3PUA A;  2IML A;  2VL8 A;  5LBM A;  5HCJ A;  5E0O A;  1N36 T;  4ADZ A;  2CXF A;  2ODU A;  3FBL A;  2XQ9 A;  4I4T E;  3T1Y T;  2JJ9 A;  4IDO A;  5DQV A;  4YHJ A;  1SA0 E;  3MAC A;  2BVL A;  3VRA A;  3KVB A;  3KV5 A;  2JQQ A;  1NAF A;  2W66 A;  3UTK A;  3P50 A;  2M6B A;  4NUU A;  2D9D A;  4DBR A;  2CWY A;  1ZOY A;  2MTQ A;  4O4J E;  1IBL T;  4HN9 A;  2HN1 A;  3CK6 A;  3K3Q C;  4LFB T;  3ZYM A;  3FZL B;  2QRX A;  2HPL A;  2XQ8 A;  5JDN A;  5FYM A;  4LF6 T;  2IW5 B;  4DID B;  1OED E;  4QKN A;  2A9U A;  3L39 A;  2XAS B;  4H9S E;  2V1D B;  3H37 A;  3AEB A;  2CRB A;  3UUX B;  2CA5 A;  1FEW A;  4ZZC A;  3CIR A;  5ABG A;  2VWA A;  3AA0 B;  4WBN E;  5ABE A;  2QA7 A;  2VQE T;  4HWC A;  3KVA A;  4ERR A;  2CBJ A;  5LHH B;  2W0G A;  3AAE B;  3RYC E;  1SE7 A;  3N9P A;  1T8B A;  1UGO A;  1XNR T;  5LGU B;  1HNX T;  2E9X B;  5AQH B;  5ADX L;  2MOZ A;  5HXR A;  2D5U A;  5J2T E;  3ANW A;  5LXT E;  4C90 A;  4A98 A;  4HFH A;  3RX6 A;  2XQA A;  4JEH B;  3CVR A;  4KBM B;  2OA5 A;  2J4G A;  2NR4 A;  4HFV A;  3N9M A;  5HXH A;  1MIY A;  4PK4 A;  2WB5 A;  4ILU A;  3ZC0 A;  1T72 A;  3RH3 A;  5CA1 E;  2W63 A;  2KIN B;  3NWI A;  4CXW A;  3RF1 A;  2XM1 A;  1JNR A;  4AQG A;  2UXC T;  3OPC A;  2V7K A;  2SPC A;  4YTN A;  2CWO A;  2V7L A;  4I50 E;  1MIV A;  2FJA A;  1NEK A;  1OED B;  5AQT B;  1Y64 B;  4IDP A;  3O1H A;  2EHO B;  5JRC A;  3LSV A;  3F31 A;  1KEY A;  3NRX A;  3L09 A;  5JDH A;  4YJ3 E;  2YEV C;  1XMO T;  3RKO A;  4V1A v;  2L3L A;  5LCY A;  3AEE A;  4ISS A;  5ETW A;  3UUM A;  1Z8U A;  5TAO A;  1XWM A;  4J2C A;  4P09 A;  2XAG B;  4EOZ B;  5L3C B;  3AEA A;  2WMN A;  3HL6 A;  3RC3 A;  1J1J A;  2E5V A;  3PUX F;  3L3P A;  5JDF A;  3OYX A;  4QH1 A;  4E7Z A;  4HWH A;  2KMF A;  2MPK A;  3OTO T;  4M1P A;  4JI6 T;  4LF5 T;  2DL1 A;  1J5E T;  4IDQ A;  4U31 A;  1N34 T;  4EAH A;  2NW9 A;  2W00 A;  2VKO A;  4L9I A;  3HKE E;  3MA9 A;  3CQG B;  5BMV E;  1MNE A;  2V6Y A;  3N2O A;  5DQW A;  2A72 A;  4YSZ A;  3C4X A;  4OYK A;  2FJD A;  3N2K E;  4UXN B;  3PUS A;  3EAM A;  3IEE A;  4DR5 T;  4AIU A;  4JI7 T;  4AQY T;  1JNZ A;  3Q9D A;  1W0A A;  4EZ4 A;  4AXP A;  4PJJ A;  3ZSS A;  3SS1 A;  5FXX A;  4JI1 T;  2XPK A;  2ZLY A;  4ZI3 C;  3N9O A;  5LA6 E;  3UFG A;  3ZMS B;  2W4X A;  4H9O C;  4OFZ A;  4KMC A;  4JBW F;  4LF7 T;  4O8S A;  2D0T A;  3NZP A;  5JR9 A;  4ZEY A;  3ZEF B;  3P4S A;  2XZE A;  2HHH T;  2MAW A;  2LEH A;  3J7Y q;  1IJ5 A;  3EVY A;  4NIQ A;  3V5S A;  4EED A;  5HEJ A;  4ASK A;  3C4W A;  4MHC A;  1VRB A;  2N2N A;  2J1D G;  3A8Y C;  2DLR A;  3DTO A;  4UF0 B;  2UUC T;  3LFM A;  4L0R A;  3RC8 A;  4JI0 T;  2Q9Q C;  2BS3 A;  4TN7 B;  4EZH A;  3O9X A;  3ABV A;  2WDV A;  4XAX B;  4DV4 T;  2FUP A;  1G8X A;  2YDS A;  2CCQ A;  2YDQ A;  4ANJ A;  3IBP A;  3AE1 A;  4CI3 B;  4B3T T;  3LDQ B;  2CXL A;  5FXZ A;  2WCA A;  3RYI E;  4ZOL E;  3ZST A;  4DV6 T;  3RYF E;  4FI5 A;  5M4Y A;  4AKR B;  4UEM A;  4TNV A;  2QYW A;  3TKL B;  3MZK B;  1HNW T;  2D0U A;  4TWF A;  4GIW A;  2HN2 A;  2H7O A;  2ZM8 A;  3GN5 B;  5JQG E;  2VVS A;  2UUA T;  5FP3 A;  3ZCJ A;  4X64 T;  2CMR A;  2WBL A;  4X65 T;  2B76 A;  4A5X A;  2CHN A;  2X67 A;  3NBX X;  3N5L A;  4QXB B;  2X68 A;  4AKI A;  1O3X A;  5FXV A;  4ZZB A;  3UQ4 A;  5H6Q B;  2CPT A;  2CXD A;  5JVD E;  4CXY A;  2V6X A;  2ZMA A;  5AQV B;  3AE2 A;  2KND A;  2NOX A;  1FMV A;  3SOL A;  3CWZ B;  4ZI7 E;  5FL0 A;  5IUX A;  3KDS E;  4IST A;  3ZLI A;  4NUV A;  3X1D A;  4GYS A;  4O2B E;  2YKS A;  4PJM A;  4EGW A;  2CBI A;  5JDQ A;  2JPF A;  4BAY B;  1KFY A;  3RLF F;  2GK9 A;  3IHR A;  4BA9 A;  3BQK A;  3C50 A;  2M67 A;  1YQ4 A;  3RIU A;  4JI3 T;  4YY3 T;  1LRZ A;  3Q5W A;  1UUS A;  4OX9 T;  4U3C A;  3O1J A;  2J62 A;  3A5X A;  5HEG A;  4LMJ A;  3KV9 A;  5AQJ B;  3ESL A;  3AXJ B;  2NP9 A;  3UFE A;  3VKG A;  2OV9 A;  1D1B A;  2VUR A;  3E0Z A;  3HKB E;  4U33 A;  3JAD A;  3UT5 E;  4UIG A;  2LHN A;  1NEN A;  3I0O A;  2FJB A;  2Q9Q B;  3ZT7 A;  3K1S A;  2RP4 A;  4P0A A;  5L3F B;  3U3I A;  4IE4 A;  4H9R C;  2X9H A;  2G0U A;  1IZN B;  2JQ9 A;  3FZM B;  5L3E B;  2P9B A;  3PV0 F;  4BJM A;  3Q2M A;  5LGN B;  2VQF T;  3I0Q A;  2LJL A;  4YXD A;  2ACZ A;  2LT3 A;  3I1A A;  2IHR 1;  4H9N C;  3CQC B;  3E08 A;  2XQ7 A;  4OK0 A;  3L8R A;  4O4H E;  3ZMV B;  4WNK A;  4C91 A;  3S4U A;  1HR0 T;  4ZHQ E;  2PJQ A;  2B1E A;  2IUB A;  3FB2 A;  4EB6 E;  2IDO B;  2IAK A;  5KDM C;  4AI6 A;  2LHR A;  3I9Y A;  3PU8 A;  3N9Q A;  4DBQ A;  3KFW X;  3GMI A;  3RHW A;  3LBX A;  3CX8 B;  4LFC T;  3CQX C;  4TV8 E;  2UXN B;  4U72 A;  5AQP B;  2IC9 A;  2I0M A;  4A97 A;  4IL4 A;  3OVU A;  4CXX A;  3WAK A;  3AAI A;  1XMQ T;  2WSS V;  3GA8 A;  1KNR A;  2H3R A;  4HWF A;  1XDO A;  2LSG A;  1ZV4 X;  1IAP A;  2V7J A;  3ETU A;  2YDR A;  3B57 A;  1MMN A;  5H6R B;  3SRZ A;  5LYJ E;  2QGS A;  2WWV A;  1HNZ T;  2IIU A;  2RPA A;  3UU4 A;  4TZ4 C;  3V5U A;  4AIS A;  2WDQ A;  4LMK A;  2AE9 A;  1M62 A;  4UR9 A;  2ZM0 A;  3QNU A;  4HWD A;  4IE5 A;  4DV5 T;  2CLY C;  2WZI A;  3KBU A;  3CKD A;  5F8P A;  4TWH A;  4HWI B;  3ZJ1 A;  2BG9 A;  4IIJ E;  2ZM2 A;  2BVM A;  3EI0 A;  4YLH A;  3EUH A;  5ABF B;  5DAB A;  1VCS A;  1HCI A;  1WR6 A;  4Z90 A;  3TLV A;  1KF6 A;  5L47 A;  5JDL A;  1VOM A;  4PAG A;  4HKA A;  2YK0 A;  3FZK B;  3C98 B;  4NXN T;  3PU3 A;  5F5W A;  2WS3 A;  1OXZ A;  4LF4 T;  4AQF A;  3C4Z A;  3RQU A;  4PNI A;  4JLE A;  5KX5 E;  2R6G F;  2LSK A;  2X9Y A;  3HKC E;  1UX4 A;  1UX5 A;  4MBQ A;  5J1G A;  4X1I E;  4ZS2 A;  3F57 A;  1I94 T;  3RYH E;  2XQ3 A;  2W61 A;  4CN6 A;  1MMG A;  3HI2 A;  2C5J A;  2LOS A;  3SWH A;  2DI4 A;  3ZKR A;  4X20 E;  3OBV E;  4HFE A;  3KIN B;  3PE0 A;  2VKD A;  2UXX B;  3VHL A;  4GKK T;  2XTL A;  1SHZ C;  3P4P A;  2I59 A;  3ONJ A;  5HEU A;  4MLK A;  2V7M A;  2V8S V;  1ZEE A;  4OYJ A;  5FY1 A;  3ZMU B;  1HTJ F;  3T8O A;  5LMN T;  1YQ3 A;  4F6R C;  4IRE A;  3VKH A;  4B3S T;  3NZQ A;  3C51 A;  3ONX A;  2WMO A;  2YU1 A;  4QWN B;  4H63 V;  1D1A A;  2BS2 A;  3K3N A;  3ZJ2 A;  5J0Z A;  4ZI3 D;  3N2G E;  2JQK A;  5L3D B;  4I0U A;  2X0Y A;  2RA1 A;  3WI3 A;  2BZB A;  4WYV A;  2XQY A;  4EYU A;  2NTY A;  4JYA T;  4GK0 E;  2VVN A;  3JAF A;  2BKP A;  4PJL A;  4MFR A;  4YJ2 E;  4CI1 B;  4DR7 T;  3KV4 A;  3PUW F;  4QX7 B;  3H3M A;  3G06 A;  3ETV A;  3JC6 C;  3AE3 A;  3Q5E A;  5HWX A;  3RGL A;  5JR9 C;  1MND A;  2MBG A;  4O2A E;  5FVL A;  3DJB A;  4F8H A;  2Q9Q D;  1KK7 A;  5AFU L;  2WWU A;  2KLQ A;  5AQN B;  2X9X A;  5FMN A;  4UV9 B;  2IC6 A;  2CLY B;  4XBF B;  5IWA T;  3Q5X A;  5LBQ B;  5CFB A;  3LK2 B;  4X66 T;  2WY2 A;  1SUM B;  4U74 A;  4QH4 A;  4QHO A;  4LML A;  3ANW B;  2X0L B;  2KZ7 B;  2WU2 A;  4LF9 T;  4NXM T;  2DNX A;  4ILB A;  2CE7 A;  4P0B A;  3QOF A;  4IDZ A;  1N32 T;  3ZCI A;  1ZP0 A;  2LSY A;  3H3A A;  2XY8 B;  5AQL B;  4EEB A;  3VU7 H;  3TLS A;  1HFA A;  3OJA A;  4COF A;  2H7V C;  3GWH A;  4GYR A;  2UU9 T;  3ZN0 B;  2C5I T;  4TX5 A;  4WW0 A;  5JRC B;  2LOP A;  2BBH A;  3N9N A;  1I6Z A;  2DWK A;  4KUM B;  2V7I A;  3FZF B;  3F2E A;  3P4W A;  1IJ6 A;  4JI2 T;  3IF8 B;  4HEA A;  3FXE B;  2N1G A;  3FBZ A;  4ZS3 A;  3PUY F;  2M6I A;  4DUY T;  4PW8 A;  4JV5 T;  3FXD B;  1WYB A;  4DR1 T;  1E2A A;  1E7P A;  2D2S A;  2X51 A;  3CX7 B;  3P7I A;  2Y48 B;  5FVK A;  2E9X A;  2L8K A;  2L9Q A;  1LVK A;  2XUE A;  4YT0 A;  3AE9 A;  2V6Y B;  2PG8 A;  4DR3 T;  1HS7 A;  4CN1 A;  4ZI2 C;  2BDE A;  1WR0 A;  4A56 A;  4B3R T;  2ES0 A;  3PUZ F;  5AQQ B;  5LHG B;  3N9L A;  2E5L T;  4EXT A;  2E9X C;  3UUB A;  3IA3 A;  4IT4 A;  3AEC A;  1FMW A;  4U7Y A;  4QH5 A;  2CHO A;  5J2U E;  5AQK B;  3K8P C;  3PUR A;  3JCF A;  3TLT A;  4DV1 T;  5EK3 A;  4KI0 F;  1R8I A;  5DJQ C;  5JR9 B;  2LKG A;  4CN4 A;  5JH7 E;  3P4Q A;  3RIU C;  1UUR A;  2BBJ A;  2VAS A;  3C64 A;  1OED A;  3FZH B;  1UCU A;  2AXD S;  2EHO A;  2FBW A;  3KV6 A;  4ILA A;  2QVA A;  5CA0 E;  5KMG P;  1IBK T;  5A1L A;  4B3M T;  3OYZ A;  4PFP A;  2X0H A;  3ZT6 A;  2W62 A;  3QC9 A;  4IDN A;  1U5P A;  3EDU A;  4I43 B;  2WP9 A;  1W0B A;  2LE8 A;  5C2T A;  1HX1 B;  3QB5 K;  1OED C;  3W15 B;  2K24 A;  4I55 E;  4HGA A;  2EHO C;  1L0V A;  2HH7 A;  4DV0 T;  2X9W A;  3UU3 A;  3AE7 A;  2JRK A;  5HWY A;  1X9B A;  2XAH B;  4X62 T;  5HXC A;  1YKE B;  5FY7 A;  3EHZ A;  5EK4 A;  4HFC A;  3PUQ A;  1Y01 A;  5CGM A;  4O4I E;  2A2F X;  1EZ3 A;  4G2A A;  1T7S A;  2K48 A;  3SFD A;  5JDM A;  5HAX A;  3QB5 A;  4P1N A;  2XAF B;  5IHY A;  3ZMZ B;  1M7K A;  2LRL A;  5CB4 E;  2H88 A;  4JI5 T;  2XM2 A;  4YSY A;  5AQG B;  3VR9 A;  3CX6 B;  3LJC A;  3AB3 B;  2BKN A;  3RI5 A;  3LK3 B;  4DMV A;  1T98 A;  1BR0 A;  2MYS A;  3AED A;  2Z6E A;  1D1C A;  2WAU A;  2XSB A;  4K0U A;  2NTX A;  4YHH T;  2VKH A;  3PTR B;  4HE8 A;  2NW7 A;  2YOE A;  3UU6 A;  4DV2 T;  1YD8 G;  5HCM A;  1US7 B;  5AQI B;  3ZPO A;  5EZY E;  3HKD E;  4N78 D;  4X1Y E;  2ZM6 T;  4AKL A;  3WAJ A;  3NRY A;  4CI2 B;  2JMH A;  2X66 A;  3J9X 1;  4DMW A;  3FHN A;  5AQO B;  3AVS A;  4U2Y A;  3RRC A;  1ZKE A;  1S35 A;  2WQY A;  4IHJ E;  4UF0 A;  5LOV E;  4JI4 T;  2LLY A;  1QLB A;  5LG3 A;  2E2A A;  5JDG A;  4G63 A;  3O4X E;  2UUB T;  3AE6 A;  3AEF A;  3I9W A;  4GOU A;  3HA4 A;  4TWD A;  2BS4 A;  3T1H T;  4GKJ T;  3Q5D A;  1D0Z A;  2LRK A;  3U78 A;  2W2U A;  4IGU A;  2XQ6 A;  2UXD T;  1MMA A;  4YFS A;  2BG9 C;  4BJN A;  2JMK A;  4HTE A;  3LK4 2;  1WRD A;  3CPZ A;  5F3J A;  2JIW A;  5FXW A;  3UUN A;  4UVB B;  1WCR A;  1MMD A;  1CHU A;  5LMU T;  3MKD A;  4PJN A;  2VK9 A;  4PFO A;  2V26 A;  3M3Z B;  4IE6 A;  4ILC A;  3AE5 A;  3M65 A;  1BR2 A;  3GN5 A;  5AQU B;  2LSI A;  4AQF C;  3R6N A;  3P4R A;  4Z91 A;  5HEH A;  2NWB A;  5LGT B;  2HPJ A;  2XJ7 A;  4UVA B;  3ZYK A;  4Q25 A;  3TLU A;  2K5B B;  5AQS B;  5BR8 T;  2OLT A;  4JUY A;  2V5D A;  4CZZ B;  4DV3 T;  1VCT A;  1QUU A;  4O4L E;  4UVC B;  3O1I A;  1XZY A;  4DR2 T;  3EAB A;  2DWG A;  2LM9 A;  4YTP A;  4UV8 B;  3BQI A;  4JI8 T;  2XQ5 A;  3TLW A;  4QXH B;  5IYZ E;  4IE7 A;  4HFB A;  4WZX A;  4YTM A;  2ODV A;  1S94 A;  4H9Q C;  1DU2 A;  5LB7 B;  3P8C D;  5JRE A;  5L4H A;  4CQI A;  2BG9 E;  3VR8 A;  4DV7 T;  1BR4 A;  2LM2 A;  2C5K T;  1B7T A;  4KHP T;  1MIW A;  1YW0 A;  2YIN A;  2XSA A;  1Z0P A;  1ZHC A;  2N9D A;  4XZC A;  4Z8X A;  3JAE A;  5L2L A;  3ZC1 A;  2JQH A;  4EV6 A;  3QK6 A;  3QUJ A;  3AA7 B;  3UU8 A;  3KBT A;  1UK5 A;  3ONL C;  2E8I A;  1J5W A;  4H9P C;  3JC6 D;  3A7M A;  5AQF B;  3LBX B;  3PJA J;  3PJA A;  2CM0 A;  2CEA A;  4LF8 T;  2WU5 A;  4X5T A;  5LJM A;  1WYC A;  2W67 A;  3AXJ A;  4AKG A;  3RPU A;  3B13 A;  5AQR B;  5LG4 A;  2UXB T;  2KT9 A;  5LHI B;  2Y6X A;  1OWA A;  4JEU B;  3RQW A;  4KHZ F;  3PUV F;  2BKO A;  2PBI A;  5HXS A;  2Q9Q A;  1LKX A;  2A3D A;  4UEL A;  2YN6 A;  5LJN A;  5L3B B;  2KXP B;  2DCF A;  5C8Y E;  3AEG A;  5ABH A;  1NWM X;  1D0Y A;  1U4Q A;  1G73 A;  1E1H B;  3RIF A;  4TUY E;  4DUZ T;  4LFA T;  1FJG T;  4TV9 E;  1GQE A;  4KX6 A;  1W09 A;  3AVR A;  3UU5 A;  1D0X A;  2K9A A;  5HEO A;  2BG9 B;  4HFI A;  4QXC B;  2WZH A;  2WDR A;  4GK5 E;  1QSD A;  2XAQ B;  2I6H A;  3AE4 A;  4B6X A;  2C0S A;  3AE8 A;  3PDY A;  5GON E;  3EDV A;  4IE0 A;  1AJ3 A;  2LSJ A;  2FJE A;  5HXE A;  2XQ4 A;  4AKH A;  5C3J A;  4DVD A;  1LVF A;  4OHF A;  4DR4 T;  1XDP A;  4EYY R;  2V5C A;  1HX8 A;  2PFV A;  1X79 A;  2KWI B;  3AA1 B;  1WLX A;  2VL0 A;  1WFD A;  5CJ5 A;  3NVO A;  3SFE A;  4WBO A;  5LP6 E;  4FJO A;  1W9R A;  1N33 T;  4E7S A;  2KWH A;  2PTF A;  4KP3 C;  5FL1 A;  4IL9 A;  4QX8 B;  5L4E A;  1YXR A;  2WM9 A; 
#chains in the Genus database with same CATH homology
 4HWC A;  5AQI B;  5AQT B;  1HX1 B;  1UK5 A;  1I6Z A;  4HWF A;  1M7K A;  3FZH B;  5AQV B;  3FZL B;  5AQS B;  5AQR B;  3FZF B;  4HWI B;  5AQF B;  1UGO A;  5AQK B;  3FZM B;  5AQG B;  5AQH B;  1M62 A;  5AQQ B;  5AQO B;  3M3Z B;  3A8Y C;  3LDQ B;  4HWH A;  5AQL B;  1T7S A;  5AQP B;  3FZK B;  5AQN B;  4HWD A;  5AQJ B;  2D9D A;  5AQM B;  5AQU B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...