5AQUB

Fragment-based screening of hsp70 sheds light on the functional role of atp-binding site residues
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
115
structure length
115
Chain Sequence
GPLGSNSPQEEVELKKLKHLEKSVEKIADQLEELNKELTGIQQGFLPKDLQAEALCKLDRRVKATIEQFMKILEEIDTLILPENFKDSRLKRKGLVKKVQAFLAECDTVEQNICQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A fragment-based approach applied to a highly flexible target: Insights and challenges towards the inhibition of HSP70 isoforms.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chaperone
molecule keywords HEAT SHOCK COGNATE 71 KDA PROTEIN
total genus 45
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2015-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02179 BAG BAG domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.120 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 BAG domain 5aquB00
5AQNB 3FZKB 1T7SA 3FZFB 1I6ZA 5AQMB 3FZLB 5AQLB 4HWFA 4HWIB 1M62A 5AQKB 1UGOA 1UK5A 1M7KA 3FZHB 1HX1B 4HWHA 5AQJB 4HWDA 5AQIB 5AQHB 5AQPB 5AQRB 5AQTB 4HWCA 5AQVB 3LDQB 3FZMB 3A8YC 3M3ZB 5AQQB 5AQFB 2D9DA 5AQGB 5AQOB 5AQSB 5AQUB
chains in the Genus database with same CATH superfamily
3KBUA 3QK6A 3N2OA 1T7SA 4IE6A 1GQEA 4MALA 2V7KA 3K8PC 2RPAA 3VRBA 4EYUA 2X66A 5JTGA 3VR8A 3ZJ2A 4WZXA 2VKJA 3KV4A 4ZZCA 3QB5A 4JLEA 2WP9A 2WY2A 1BR1A 2YU2A 4H63V 2BVLA 4P09A 4QXHB 5F8PA 5L47A 4ZXLA 3SOLA 4DUYT 4LF5T 2UXDT 2RP4A 2W2UA 3AXJB 3IF8B 4X64T 1AJ3A 3PU8A 2UUAT 3P4PA 1IJ5A 2FJAA 3NZPA 3P4RA 4FI5A 5FL1A 3PUGA 2JQ9A 3L8RA 5CB4E 2LKGA 3SFDA 1HX8A 4YHHT 1D0ZA 4Z90A 5JR9C 3VKGA 1HG5A 4FJOA 3Q9DA 3AEAA 4AQFA 4B3RT 2BG9A 2W63A 5JH7E 4YXDA 2C5KT 3HKBE 1YXRA 1IBLT 2NTYA 1XWMA 2HN2A 2XQ4A 3JADA 4H9RC 4IDNA 4YY3T 3J7Yq 2E5LT 2XAGB 3C98B 2QVAA 4DBQA 4DR2T 3CWZB 3CK6A 2A72A 3UU8A 3H37A 2NW9A 1ZKEA 4K0KT 3EABA 4ISTA 4NPPA 4JI6T 5LXTE 3H3AA 2XQ7A 3A5XA 1HX1B 4QHOA 4YLHA 2L3LA 2XM1A 3N9LA 4H9NC 5HWYA 3UQ7A 5AQHB 2OA5A 4EIWA 2UUCT 2DCFA 2XSAA 3RC8A 4G2AA 3AE2A 5TAOA 4K0UA 5LHIB 1D1BA 3MJXA 5CJ5A 5L3GB 2VVNA 3PJAA 3J9X1 2OLTA 5HXEA 2XQYA 4LFCT 4LFBT 4QXBB 3ZMZB 5EK2A 5AQOB 4PFOA 2DNXA 1YQ4A 2E9XC 2VKOA 2WDRA 2SPCA 3UU3A 3AVRA 5FXXA 1IBKT 1NEKA 3KV6A 3TLWA 1UGOA 4H9QC 3JAFA 4DVDA 4HE8A 4U7IA 3RYHE 3IEEA 2N1GA 3VRAA 2VB6A 4DBRA 5ABEA 2KLQA 3CVRA 5JDQA 4CXYA 4TV9E 1SA0E 3JCFA 4UEMA 4F8HA 1YW0A 2UUBT 1LVFA 2K5BB 3MK7C 4QKNA 4LF8T 2CEAA 2BS3A 4ISSA 2XQ3A 2XM2A 3FXDB 2BG9B 5AQPB 4B6XA 5JDHA 1N34T 3QC9A 2W62A 1FEWA 4AKRB 2XZEA 3HI2A 1HNZT 3ONJA 5HXSA 2V5CA 4U74A 3B13A 3UUMA 4DMVA 2BZBA 4ZOLE 3I9WA 3NRXA 4JUYA 2N2NA 4EB6E 4G63A 4HN9A 3DP7A 4X65T 2YEVC 3V5UA 3ANWB 4EGWA 3QB5K 5AQNB 4I0UA 1HTJF 2YN6A 4EXTA 2WS3A 3M65A 1J5ET 3N9NA 2XAJB 5LG4A 2JPFA 3CX8B 1T98A 4IE0A 5L4EA 5AQKB 2D2SA 2LLYA 2WSSV 2C5IT 3VR9A 5IWAT 4TNVA 2JIWA 4HTEA 3AEEA 1HFAA 4PW8A 1HR0T 3RIUC 5JRCA 4IL4A 3EI0A 2J4GA 2XUEA 2NW7A 1WYBA 5AFUL 2E9XA 2V26A 1XNRT 2W4XA 4OK0A 4PJLA 1VCSA 2BS2A 5AQTB 5IYZE 5JDFA 3RQWA 3ZN0B 3DJBA 2W00A 2MOZA 3A8YC 3MA9A 3AE1A 4IDZA 4TV8E 2MBGA 5KDMC 5L2LA 1N36T 4GKKT 2I6HA 3P50A 4ZS3A 1CUNA 5ABFA 1L0VA 4JI3T 3ZMVB 4TWHA 2V7JA 5CA0E 1W09A 5AQUB 3F31A 3FZFB 1H7CA 3AE5A 1D1CA 3PUXF 4MFRA 2Y48B 2YKSA 3ZT7A 4DMWA 1ZOYA 2DI4A 2EHOB 4HWFA 3K3OA 2LOSA 4PAGA 4DV1T 5LA6E 2H7OA 4AI6A 2IUBA 1FIOA 2NTXA 3OYZA 4U2ZA 5LCYA 4ANJA 2CA5A 4LFAT 4LMKA 2WMOA 4C91A 2WBLA 1YD8G 3AEBA 4EEBA 1KEYA 3AAIA 2CPTA 1MMAA 2LT3A 3KVAA 2VL0A 3FHNA 3ZT5A 4CXXA 2HH7A 4J2CA 3RHWA 2W0GA 3N9OA 2LM2A 3EHZA 1MIVA 3OBVE 2PTFA 3OKQA 1XMQT 2VURA 3P4SA 2HN1A 3BQKA 2EHOD 1FMWA 2M67A 1IJ6A 5BMVE 3HKCE 4CI1B 4A97A 4UVCB 4OFZA 3G06A 4ZI7E 5JDNA 3ZC0A 1HCIA 5IUXA 5HAXA 5AQMB 4LF4T 2E9XD 2WB5A 4I4TE 3WAJA 2MYSA 2VASA 3TLUA 2YOEA 4H63H 1NWMX 4ZS2A 2DHRA 2KSRA 3RF1A 5H6RB 2X67A 2BDEA 3KFWX 4IE4A 4NUUA 2BBJA 2H89A 4DV4T 1M7KA 1G73A 1X9BA 4QH1A 2QRXA 4X5TA 1HNWT 1YKHB 5FVKA 4ZI2D 3KDSE 4N78D 5LGTB 4ILAA 4YTPA 4JEUB 2WU2A 2X0HA 5DJQC 4EZHA 4YTMA 3C51A 3ZKRA 2VQFT 2VL8A 4HWDA 3AA7B 4UR9A 4COFA 4TZ4C 1UUSA 3AXJA 4PK6A 5CGMA 1OEDE 2D5UA 2YU1A 3RYIE 5FXZA 3NWIA 3RGLA 3ZCJA 1KK7A 4WNKA 2E9XB 1OEDB 4AIUA 2PG8A 2E2AA 4QX8B 4YSYA 3BQIA 1D0XA 2JRKA 5FL0A 4YTNA 3RKGA 4HFDA 4HFEA 3UULA 4Q25A 5C8YE 5JDGA 4HEAA 3NRYA 4EYYR 2Q9QD 4V1Av 1WCRA 1XDPA 2FJEA 5HCMA 1E1HB 3W15B 1LKXA 2B76A 1BR4A 2KNDA 2YDRA 1U5PA 2ZM2A 3Q2MA 4IE7A 4A98A 2J1DG 3UTKA 4ZZBA 3PUZF 1UK5A 1IBMT 4X1YE 2IHR1 3AB3B 3Q5XA 4B3MT 1UURA 1W9RA 2D0UA 2IDOB 2KWIB 2V7IA 4IIJE 1W0AA 4P0BA 4UF0B 5FKYA 4JI1T 4JI7T 2XSBA 3LK3B 3A7MA 4X1IE 5L3DB 3ZYLA 4DR3T 5DQVA 1J1JA 4YJ2E 1T72A 3AE4A 5AQRB 3PU3A 3AVSA 3RPUA 4LF7T 3SS1A 3GWHA 4IGUA 4I50E 3O1IA 2JQQA 5L3EB 1D1AA 4H9PC 2V6YA 3LG7A 5LHGB 4CXWA 3ABVA 1WYCA 2JMKA 3ZCIA 4OX9T 4QX7B 4JYAT 4QXCB 4CI2B 5C2TA 1QSDA 1HG2A 2XQ6A 3FZKB 4XBFB 4GIWA 1ZP0A 3GN5A 4WBOA 1LRZA 4H9OC 3TKLB 2CXLA 5AQLB 1XZYA 3MACA 4YJ3E 3RI5A 2ZM6T 4BJMA 4DR5T 5LYJE 4ERRA 3ZMUB 1DU2A 2V8SV 2XAFB 2DWGA 1G8XA 1NAFA 3E22E 5FY0A 5JDLA 4DV2T 3OTOT 2I59A 5F5WA 5JREA 3PUQA 2IMLA 4PK4A 5EK4A 3CIRA 5LBMA 1N33T 2V6YB 2FBWA 3AE6A 3ZJ1A 4PNIA 2R6GF 2IC9A 1SE7A 4U72A 3LFMA 4DV0T 4GKJT 1UX5A 2KWHA 2WMNA 3LK42 4UF0A 3N2GE 3P7IA 3VU7H 2LKHA 3FZMB 3IHRA 4OYKA 3GN5B 5L3FB 4DV6T 1KF6A 3UUXB 4ZEYA 3UU4A 2LHNA 4AQYT 1KNRA 3UU5A 4A56A 2NOXA 4AISA 2LM9A 5JDMA 4X66T 1ZEEA 5ABHA 2K24A 1R8IA 4KI0F 1KNZA 5JVDE 2UXXB 2ZMAA 4IT4A 2X9HA 3HKEE 1FJGT 4IL9A 3NVOA 2CLYB 5H6QB 3LBXA 3GA8A 4QH4A 4UIGA 3SRZA 3EDUA 1MMNA 4KMCA 4LF9T 2CHOA 3PTRB 4PFPA 2UXNB 4HFHA 2H3RA 2CWOA 4IHJE 5AQJB 2YDQA 3E0ZA 2V1DB 4AKHA 3GMIA 4DO0A 2E8IA 2ZM8A 4AXPA 5ABFB 4EAHA 3AA6B 1I94T 5FY7A 5FMNA 3AAAB 3FB2A 1EZ3A 3P4QA 4EV6A 2UU9T 1US7B 2B1EA 4TNWA 5BR8T 3R6NA 3T1HT 4NXNT 2XJ7A 5LMUT 5HWXA 3TLSA 2DWKA 2UXBT 3C4XA 5FYMA 5LNKA 2D9DA 2LHRA 2E5VA 3RQUA 1T8BA 2AXDS 3DTOA 1XNQT 3I1AA 3RKOA 3UQ4A 3I0QA 3L09A 4UV8B 4JI4T 2Q9QA 2Q9QC 5JR9B 2BBHA 2MTQA 1Z0PA 3AECA 3SFEA 4AKIA 1ZHCA 3L3PA 2VKHA 3RYCE 4DR1T 3AA1B 1E2AA 2ACXA 2EHOC 3OYXA 2EHOA 4NXMT 2QGSA 2M6BA 2PJQA 3AEGA 2NR4A 2V7LA 4DR4T 2YK0A 1VOMA 2CM0A 3AE9A 4X20E 2HPJA 4KBMB 2Z6EA 4QH5A 2WZIA 2AE9A 3PDYA 4DR7T 5ADXL 3RIAA 2A2FX 3IA3A 3LDQB 3CQXC 4L5GA 4XAXB 3FBLA 2DLRA 3P4WA 2C0SA 4PJJA 1W0BA 3RYFE 3ONLC 1Y64B 3Q5WA 1XMOT 2WDQA 2BKPA 5AQFB 4E7SA 5HYAA 5HEUA 5AQSB 4GK0E 4ZI2C 1O3XA 2H7VC 1MMGA 4HFIA 4ILUA 4CN6A 2WZHA 3PUYF 5L3BB 3PE0A 5LMNT 2I0MA 3ETUA 2WM9A 4MHCA 4O2AE 1X79A 4JI0T 4H9SE 2ES0A 3WAKA 2WWVA 1HF8A 3IBPA 2X9XA 3WI3A 2RA1A 2Q9QB 2XY8B 3C50A 3EVYA 2NP9A 4U33A 2K3WA 2FUPA 1QLBA 2XQ5A 1MNDA 1NENA 5E0OA 5F3JA 1OEDA 2ACZA 1S35A 2ODUA 1FMVA 3ZT6A 1YKEB 3ZPOA 2D0TA 1MMDA 2OV9A 2CBIA 2KMFA 2VWAA 3KVBA 4P1NA 1YQ3A 4OHFA 4OYJA 5LBQB 4JI5T 4O4LE 2X51A 4CN1A 3C4WA 3K3QC 5HEGA 4EEDA 2W61A 4JI2T 5FNVE 5HXRA 2HPLA 3O1HA 5LOVE 2BG9C 3PUSA 2JQHA 3CMLA 5AQQB 3BK9A 3Q5DA 5AQGB 2CCQA 2ODVA 2LSIA 2LOPA 2QA7A 2A9UA 3PUWF 4MBQA 2BVMA 5ETWA 4BAYB 1BR0A 2ZLYA 3UFEA 4ADZA 3FBZA 3OJAA 4DNDA 4EZ4A 3X1DA 2VQET 4U2YA 5FXVA 4B3TT 2V7MA 2X0YA 3EUHA 1JNZA 3RLFF 2H88A 1D0YA 3AEFA 4HFCA 2GK9A 2K9AA 4YSXA 4HFBA 5M4YA 4X62T 2JJ9A 2YINA 1OWAA 3N9QA 1WRDA 4O4IE 3QOFA 5L4HA 2V6XA 3FZHB 5LB7B 3H3MA 1SHZC 4M1PA 2LRLA 3T1YT 3RRWA 3UUBA 5LP6E 5AQIB 1B7TA 4HWCA 4JEHB 3CKDA 3EAMA 2IC6A 2WCAA 3I0OA 5JRCB 4L9IA 3RIUA 2W66A 4X1KE 4YT0A 4JV5T 2J47A 1U4QA 3AA0B 4UVAB 3V5SA 2VK9A 3ZN1B 3C4ZA 3ZSTA 3ZEFB 1E7PA 5CA1E 2UXCT 1QUUA 1UX4A 4TN7B 4U31A 5FXWA 2P9BA 4ZHQE 4DV5T 3MZKB 3LBXB 4DV3T 3ZC1A 1IAPA 4P0AA 2WDVA 1OEDC 2XTLA 3K1SA 5KMGP 2JQKA 3FZLB 3O4XE 4B3ST 3AE3A 1MIWA 3CX7B 3TLTA 4UELA 3PJAJ 3T8OA 5LJMA 4L0RA 5KX5E 4QWNB 4IE5A 5DABA 5HEOA 4IDQA 3SWHA 1ZV4X 3N9PA 3PUVF 5FP3A 2XQAA 2A3DA 2WQYA 3NBXX 4YFSA 3U3IA 4UXNB 1V9DA 4ILCA 1JNRA 3AE7A 4IREA 4TX5A 2HHHT 5J1GA 4U7YA 3VKHA 2ZM0A 4WW0A 5AQVB 2XPKA 4TUYE 3L39A 5CFBA 5HEHA 2KXPB 4O4HE 3D0TA 1KNPA 2CXFA 3Q5EA 1IZNB 2M6IA 2CHNA 3M3ZB 2FJBA 3UUNA 3ZSSA 2XQ8A 1CHUA 1WR0A 5JR9A 3PV0F 3HKDE 1J5WA 3RH3A 3ETVA 3NKZA 4TWFA 5EZYE 5FY1A 4GYSA 4O2BE 5LG3A 2CRBA 2MAWA 3PUAA 5HXHA 3ZYKA 2Y8DA 1M62A 4TWDA 2LEHA 5EK3A 2CLYC 4PJMA 5FVLA 3RRCA 5J2UE 3LK2B 5JQGE 4PK5A 3ZLIA 3B5MA 3OVUA 2VKDA 4EOZB 4PJNA 1WR6A 4WYVA 4NIQA 1KFYA 2IAKA 3P8CD 2Y6XA 3CPZA 3N9MA 2KZ7B 5GONE 3RX6A 5LGNB 1HNXT 2F4VT 4KHPT 1Y01A 2CMRA 3CQCB 4CZZB 4LMJA 4YSZA 4IDOA 1LVKA 2LJLA 2CBJA 2X68A 4UVBB 2DL1A 3RIFA 4CN4A 3E08A 2XASB 5LGUB 4DIDB 5LHHB 3ESLA 2BKOA 2PBIA 4ILBA 3KV5A 4CI3B 3TLVA 2J62A 3U78A 4A5XA 2WWUA 4O4JE 5HXCA 1HS7A 3N2KE 4HFVA 5ABGA 1N32T 4HWIB 3UU6A 2NW8A 3CX6B 4JBWF 2NWBA 2V5DA 4U3CA 4JI8T 3OPCA 3UT5E 3AEDA 4ASKA 2LSJA 4BJNA 3B57A 5J0ZA 4GOUA 3UFGA 1Z8UA 3KV9A 4AQGA 4I55E 3ONXA 4DUZT 5LJNA 4I43B 2X0LB 3N5LA 2KINB 1WFDA 5IHYA 3BQLA 4HWHA 2G0UA 3QNUA 3O9XA 3O1JA 3AE8A 3JAEA 4Z8XA 2L8KA 3HR0A 1MIYA 5KXJA 2N9DA 3MKDA 4UV9B 2L9QA 4ZI3D 5HEJA 2BKNA 1S94A 2BS4A 3CQGB 4HGAA 3F57A 2YDSA 1VRBA 3I9YA 1WLXA 3JC6D 1XDOA 5A1LA 2IIUA 3RC3A 2LSYA 2K48A 2XQ9A 3NZQA 3QUJA 3ZMTB 2XAHB 3ZMSB 2X9WA 1I6ZA 3MXZA 3R84B 2X9YA 2CE7A 2PFVA 1BR2A 3LSVA 3PURA 2WAUA 2MPKA 4KP3C 5DQWA 3S4UA 4ZI3C 3ANWA 4NUVA 2C5JA 4XZCA 4F6RC 2LSGA 5HCJA 4AQFC 5L3CB 4KHZF 2LE8A 3JC6C 3C64A 3F2EA 4KUMB 4LMLA 4GYRA 4DV7T 4MLKA 2KT9A 4Z91A 4KX6A 3ZYMA 4DR6T 3FXEB 2CXDA 4AKLA 2JMHA 1SUMB 2IW5B 2FJDA 2VVSA 3VHLA 4E7ZA 5J2TE 2WU5A 4AKGA 2CWYA 4LF6T 2W67A 3KINB 4CQIA 2XAQB 4O8SA 2BG9E 4C90A 3HL6A 2QYWA 1MNEA 4HKAA 3K3NA 3EDVA 2LRKA 1VCTA 3LJCA 4WBNE 3KBTA 3HA4A 4GK5E 2XHEB 4IDPA 1OXZA 4YHJA 4BA9A 3AAEB 2LSKA 1UCUA 5C3JA
chains in the Genus database with same CATH topology
5AQNB 3FZKB 1T7SA 3FZFB 1I6ZA 5AQMB 3FZLB 5AQLB 4HWFA 4HWIB 1M62A 5AQKB 1UGOA 1UK5A 1M7KA 3FZHB 1HX1B 4HWHA 5AQJB 4HWDA 5AQIB 5AQHB 5AQPB 5AQRB 5AQTB 4HWCA 5AQVB 3LDQB 3FZMB 3A8YC 3M3ZB 5AQQB 5AQFB 2D9DA 5AQGB 5AQOB 5AQSB 5AQUB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AQN B;  3FZK B;  1T7S A;  3FZF B;  1I6Z A;  5AQM B;  3FZL B;  5AQL B;  4HWF A;  4HWI B;  1M62 A;  5AQK B;  1UGO A;  1UK5 A;  1M7K A;  3FZH B;  1HX1 B;  4HWH A;  5AQJ B;  4HWD A;  5AQI B;  5AQH B;  5AQP B;  5AQR B;  5AQT B;  4HWC A;  5AQV B;  3LDQ B;  3FZM B;  3A8Y C;  3M3Z B;  5AQQ B;  5AQF B;  2D9D A;  5AQG B;  5AQO B;  5AQS B;  5AQU B; 
#chains in the Genus database with same CATH topology
 3KBU A;  3QK6 A;  3N2O A;  1T7S A;  4IE6 A;  1GQE A;  4MAL A;  2V7K A;  3K8P C;  2RPA A;  3VRB A;  4EYU A;  2X66 A;  5JTG A;  3VR8 A;  3ZJ2 A;  4WZX A;  2VKJ A;  3KV4 A;  4ZZC A;  3QB5 A;  4JLE A;  2WP9 A;  2WY2 A;  1BR1 A;  2YU2 A;  4H63 V;  2BVL A;  4P09 A;  4QXH B;  5F8P A;  5L47 A;  4ZXL A;  3SOL A;  4DUY T;  4LF5 T;  2UXD T;  2RP4 A;  2W2U A;  3AXJ B;  3IF8 B;  4X64 T;  1AJ3 A;  3PU8 A;  2UUA T;  3P4P A;  1IJ5 A;  2FJA A;  3NZP A;  3P4R A;  4FI5 A;  5FL1 A;  3PUG A;  2JQ9 A;  3L8R A;  5CB4 E;  2LKG A;  3SFD A;  1HX8 A;  4YHH T;  1D0Z A;  4Z90 A;  5JR9 C;  3VKG A;  1HG5 A;  4FJO A;  3Q9D A;  3AEA A;  4AQF A;  4B3R T;  2BG9 A;  2W63 A;  5JH7 E;  4YXD A;  2C5K T;  3HKB E;  1YXR A;  1IBL T;  2NTY A;  1XWM A;  2HN2 A;  2XQ4 A;  3JAD A;  4H9R C;  4IDN A;  4YY3 T;  3J7Y q;  2E5L T;  2XAG B;  3C98 B;  2QVA A;  4DBQ A;  4DR2 T;  3CWZ B;  3CK6 A;  2A72 A;  3UU8 A;  3H37 A;  2NW9 A;  1ZKE A;  4K0K T;  3EAB A;  4IST A;  4NPP A;  4JI6 T;  5LXT E;  3H3A A;  2XQ7 A;  3A5X A;  1HX1 B;  4QHO A;  4YLH A;  2L3L A;  2XM1 A;  3N9L A;  4H9N C;  5HWY A;  3UQ7 A;  5AQH B;  2OA5 A;  4EIW A;  2UUC T;  2DCF A;  2XSA A;  3RC8 A;  4G2A A;  3AE2 A;  5TAO A;  4K0U A;  5LHI B;  1D1B A;  3MJX A;  5CJ5 A;  5L3G B;  2VVN A;  3PJA A;  3J9X 1;  2OLT A;  5HXE A;  2XQY A;  4LFC T;  4LFB T;  4QXB B;  3ZMZ B;  5EK2 A;  5AQO B;  4PFO A;  2DNX A;  1YQ4 A;  2E9X C;  2VKO A;  2WDR A;  2SPC A;  3UU3 A;  3AVR A;  5FXX A;  1IBK T;  1NEK A;  3KV6 A;  3TLW A;  1UGO A;  4H9Q C;  3JAF A;  4DVD A;  4HE8 A;  4U7I A;  3RYH E;  3IEE A;  2N1G A;  3VRA A;  2VB6 A;  4DBR A;  5ABE A;  2KLQ A;  3CVR A;  5JDQ A;  4CXY A;  4TV9 E;  1SA0 E;  3JCF A;  4UEM A;  4F8H A;  1YW0 A;  2UUB T;  1LVF A;  2K5B B;  3MK7 C;  4QKN A;  4LF8 T;  2CEA A;  2BS3 A;  4ISS A;  2XQ3 A;  2XM2 A;  3FXD B;  2BG9 B;  5AQP B;  4B6X A;  5JDH A;  1N34 T;  3QC9 A;  2W62 A;  1FEW A;  4AKR B;  2XZE A;  3HI2 A;  1HNZ T;  3ONJ A;  5HXS A;  2V5C A;  4U74 A;  3B13 A;  3UUM A;  4DMV A;  2BZB A;  4ZOL E;  3I9W A;  3NRX A;  4JUY A;  2N2N A;  4EB6 E;  4G63 A;  4HN9 A;  3DP7 A;  4X65 T;  2YEV C;  3V5U A;  3ANW B;  4EGW A;  3QB5 K;  5AQN B;  4I0U A;  1HTJ F;  2YN6 A;  4EXT A;  2WS3 A;  3M65 A;  1J5E T;  3N9N A;  2XAJ B;  5LG4 A;  2JPF A;  3CX8 B;  1T98 A;  4IE0 A;  5L4E A;  5AQK B;  2D2S A;  2LLY A;  2WSS V;  2C5I T;  3VR9 A;  5IWA T;  4TNV A;  2JIW A;  4HTE A;  3AEE A;  1HFA A;  4PW8 A;  1HR0 T;  3RIU C;  5JRC A;  4IL4 A;  3EI0 A;  2J4G A;  2XUE A;  2NW7 A;  1WYB A;  5AFU L;  2E9X A;  2V26 A;  1XNR T;  2W4X A;  4OK0 A;  4PJL A;  1VCS A;  2BS2 A;  5AQT B;  5IYZ E;  5JDF A;  3RQW A;  3ZN0 B;  3DJB A;  2W00 A;  2MOZ A;  3A8Y C;  3MA9 A;  3AE1 A;  4IDZ A;  4TV8 E;  2MBG A;  5KDM C;  5L2L A;  1N36 T;  4GKK T;  2I6H A;  3P50 A;  4ZS3 A;  1CUN A;  5ABF A;  1L0V A;  4JI3 T;  3ZMV B;  4TWH A;  2V7J A;  5CA0 E;  1W09 A;  5AQU B;  3F31 A;  3FZF B;  1H7C A;  3AE5 A;  1D1C A;  3PUX F;  4MFR A;  2Y48 B;  2YKS A;  3ZT7 A;  4DMW A;  1ZOY A;  2DI4 A;  2EHO B;  4HWF A;  3K3O A;  2LOS A;  4PAG A;  4DV1 T;  5LA6 E;  2H7O A;  4AI6 A;  2IUB A;  1FIO A;  2NTX A;  3OYZ A;  4U2Z A;  5LCY A;  4ANJ A;  2CA5 A;  4LFA T;  4LMK A;  2WMO A;  4C91 A;  2WBL A;  1YD8 G;  3AEB A;  4EEB A;  1KEY A;  3AAI A;  2CPT A;  1MMA A;  2LT3 A;  3KVA A;  2VL0 A;  3FHN A;  3ZT5 A;  4CXX A;  2HH7 A;  4J2C A;  3RHW A;  2W0G A;  3N9O A;  2LM2 A;  3EHZ A;  1MIV A;  3OBV E;  2PTF A;  3OKQ A;  1XMQ T;  2VUR A;  3P4S A;  2HN1 A;  3BQK A;  2EHO D;  1FMW A;  2M67 A;  1IJ6 A;  5BMV E;  3HKC E;  4CI1 B;  4A97 A;  4UVC B;  4OFZ A;  3G06 A;  4ZI7 E;  5JDN A;  3ZC0 A;  1HCI A;  5IUX A;  5HAX A;  5AQM B;  4LF4 T;  2E9X D;  2WB5 A;  4I4T E;  3WAJ A;  2MYS A;  2VAS A;  3TLU A;  2YOE A;  4H63 H;  1NWM X;  4ZS2 A;  2DHR A;  2KSR A;  3RF1 A;  5H6R B;  2X67 A;  2BDE A;  3KFW X;  4IE4 A;  4NUU A;  2BBJ A;  2H89 A;  4DV4 T;  1M7K A;  1G73 A;  1X9B A;  4QH1 A;  2QRX A;  4X5T A;  1HNW T;  1YKH B;  5FVK A;  4ZI2 D;  3KDS E;  4N78 D;  5LGT B;  4ILA A;  4YTP A;  4JEU B;  2WU2 A;  2X0H A;  5DJQ C;  4EZH A;  4YTM A;  3C51 A;  3ZKR A;  2VQF T;  2VL8 A;  4HWD A;  3AA7 B;  4UR9 A;  4COF A;  4TZ4 C;  1UUS A;  3AXJ A;  4PK6 A;  5CGM A;  1OED E;  2D5U A;  2YU1 A;  3RYI E;  5FXZ A;  3NWI A;  3RGL A;  3ZCJ A;  1KK7 A;  4WNK A;  2E9X B;  1OED B;  4AIU A;  2PG8 A;  2E2A A;  4QX8 B;  4YSY A;  3BQI A;  1D0X A;  2JRK A;  5FL0 A;  4YTN A;  3RKG A;  4HFD A;  4HFE A;  3UUL A;  4Q25 A;  5C8Y E;  5JDG A;  4HEA A;  3NRY A;  4EYY R;  2Q9Q D;  4V1A v;  1WCR A;  1XDP A;  2FJE A;  5HCM A;  1E1H B;  3W15 B;  1LKX A;  2B76 A;  1BR4 A;  2KND A;  2YDR A;  1U5P A;  2ZM2 A;  3Q2M A;  4IE7 A;  4A98 A;  2J1D G;  3UTK A;  4ZZB A;  3PUZ F;  1UK5 A;  1IBM T;  4X1Y E;  2IHR 1;  3AB3 B;  3Q5X A;  4B3M T;  1UUR A;  1W9R A;  2D0U A;  2IDO B;  2KWI B;  2V7I A;  4IIJ E;  1W0A A;  4P0B A;  4UF0 B;  5FKY A;  4JI1 T;  4JI7 T;  2XSB A;  3LK3 B;  3A7M A;  4X1I E;  5L3D B;  3ZYL A;  4DR3 T;  5DQV A;  1J1J A;  4YJ2 E;  1T72 A;  3AE4 A;  5AQR B;  3PU3 A;  3AVS A;  3RPU A;  4LF7 T;  3SS1 A;  3GWH A;  4IGU A;  4I50 E;  3O1I A;  2JQQ A;  5L3E B;  1D1A A;  4H9P C;  2V6Y A;  3LG7 A;  5LHG B;  4CXW A;  3ABV A;  1WYC A;  2JMK A;  3ZCI A;  4OX9 T;  4QX7 B;  4JYA T;  4QXC B;  4CI2 B;  5C2T A;  1QSD A;  1HG2 A;  2XQ6 A;  3FZK B;  4XBF B;  4GIW A;  1ZP0 A;  3GN5 A;  4WBO A;  1LRZ A;  4H9O C;  3TKL B;  2CXL A;  5AQL B;  1XZY A;  3MAC A;  4YJ3 E;  3RI5 A;  2ZM6 T;  4BJM A;  4DR5 T;  5LYJ E;  4ERR A;  3ZMU B;  1DU2 A;  2V8S V;  2XAF B;  2DWG A;  1G8X A;  1NAF A;  3E22 E;  5FY0 A;  5JDL A;  4DV2 T;  3OTO T;  2I59 A;  5F5W A;  5JRE A;  3PUQ A;  2IML A;  4PK4 A;  5EK4 A;  3CIR A;  5LBM A;  1N33 T;  2V6Y B;  2FBW A;  3AE6 A;  3ZJ1 A;  4PNI A;  2R6G F;  2IC9 A;  1SE7 A;  4U72 A;  3LFM A;  4DV0 T;  4GKJ T;  1UX5 A;  2KWH A;  2WMN A;  3LK4 2;  4UF0 A;  3N2G E;  3P7I A;  3VU7 H;  2LKH A;  3FZM B;  3IHR A;  4OYK A;  3GN5 B;  5L3F B;  4DV6 T;  1KF6 A;  3UUX B;  4ZEY A;  3UU4 A;  2LHN A;  4AQY T;  1KNR A;  3UU5 A;  4A56 A;  2NOX A;  4AIS A;  2LM9 A;  5JDM A;  4X66 T;  1ZEE A;  5ABH A;  2K24 A;  1R8I A;  4KI0 F;  1KNZ A;  5JVD E;  2UXX B;  2ZMA A;  4IT4 A;  2X9H A;  3HKE E;  1FJG T;  4IL9 A;  3NVO A;  2CLY B;  5H6Q B;  3LBX A;  3GA8 A;  4QH4 A;  4UIG A;  3SRZ A;  3EDU A;  1MMN A;  4KMC A;  4LF9 T;  2CHO A;  3PTR B;  4PFP A;  2UXN B;  4HFH A;  2H3R A;  2CWO A;  4IHJ E;  5AQJ B;  2YDQ A;  3E0Z A;  2V1D B;  4AKH A;  3GMI A;  4DO0 A;  2E8I A;  2ZM8 A;  4AXP A;  5ABF B;  4EAH A;  3AA6 B;  1I94 T;  5FY7 A;  5FMN A;  3AAA B;  3FB2 A;  1EZ3 A;  3P4Q A;  4EV6 A;  2UU9 T;  1US7 B;  2B1E A;  4TNW A;  5BR8 T;  3R6N A;  3T1H T;  4NXN T;  2XJ7 A;  5LMU T;  5HWX A;  3TLS A;  2DWK A;  2UXB T;  3C4X A;  5FYM A;  5LNK A;  2D9D A;  2LHR A;  2E5V A;  3RQU A;  1T8B A;  2AXD S;  3DTO A;  1XNQ T;  3I1A A;  3RKO A;  3UQ4 A;  3I0Q A;  3L09 A;  4UV8 B;  4JI4 T;  2Q9Q A;  2Q9Q C;  5JR9 B;  2BBH A;  2MTQ A;  1Z0P A;  3AEC A;  3SFE A;  4AKI A;  1ZHC A;  3L3P A;  2VKH A;  3RYC E;  4DR1 T;  3AA1 B;  1E2A A;  2ACX A;  2EHO C;  3OYX A;  2EHO A;  4NXM T;  2QGS A;  2M6B A;  2PJQ A;  3AEG A;  2NR4 A;  2V7L A;  4DR4 T;  2YK0 A;  1VOM A;  2CM0 A;  3AE9 A;  4X20 E;  2HPJ A;  4KBM B;  2Z6E A;  4QH5 A;  2WZI A;  2AE9 A;  3PDY A;  4DR7 T;  5ADX L;  3RIA A;  2A2F X;  3IA3 A;  3LDQ B;  3CQX C;  4L5G A;  4XAX B;  3FBL A;  2DLR A;  3P4W A;  2C0S A;  4PJJ A;  1W0B A;  3RYF E;  3ONL C;  1Y64 B;  3Q5W A;  1XMO T;  2WDQ A;  2BKP A;  5AQF B;  4E7S A;  5HYA A;  5HEU A;  5AQS B;  4GK0 E;  4ZI2 C;  1O3X A;  2H7V C;  1MMG A;  4HFI A;  4ILU A;  4CN6 A;  2WZH A;  3PUY F;  5L3B B;  3PE0 A;  5LMN T;  2I0M A;  3ETU A;  2WM9 A;  4MHC A;  4O2A E;  1X79 A;  4JI0 T;  4H9S E;  2ES0 A;  3WAK A;  2WWV A;  1HF8 A;  3IBP A;  2X9X A;  3WI3 A;  2RA1 A;  2Q9Q B;  2XY8 B;  3C50 A;  3EVY A;  2NP9 A;  4U33 A;  2K3W A;  2FUP A;  1QLB A;  2XQ5 A;  1MND A;  1NEN A;  5E0O A;  5F3J A;  1OED A;  2ACZ A;  1S35 A;  2ODU A;  1FMV A;  3ZT6 A;  1YKE B;  3ZPO A;  2D0T A;  1MMD A;  2OV9 A;  2CBI A;  2KMF A;  2VWA A;  3KVB A;  4P1N A;  1YQ3 A;  4OHF A;  4OYJ A;  5LBQ B;  4JI5 T;  4O4L E;  2X51 A;  4CN1 A;  3C4W A;  3K3Q C;  5HEG A;  4EED A;  2W61 A;  4JI2 T;  5FNV E;  5HXR A;  2HPL A;  3O1H A;  5LOV E;  2BG9 C;  3PUS A;  2JQH A;  3CML A;  5AQQ B;  3BK9 A;  3Q5D A;  5AQG B;  2CCQ A;  2ODV A;  2LSI A;  2LOP A;  2QA7 A;  2A9U A;  3PUW F;  4MBQ A;  2BVM A;  5ETW A;  4BAY B;  1BR0 A;  2ZLY A;  3UFE A;  4ADZ A;  3FBZ A;  3OJA A;  4DND A;  4EZ4 A;  3X1D A;  2VQE T;  4U2Y A;  5FXV A;  4B3T T;  2V7M A;  2X0Y A;  3EUH A;  1JNZ A;  3RLF F;  2H88 A;  1D0Y A;  3AEF A;  4HFC A;  2GK9 A;  2K9A A;  4YSX A;  4HFB A;  5M4Y A;  4X62 T;  2JJ9 A;  2YIN A;  1OWA A;  3N9Q A;  1WRD A;  4O4I E;  3QOF A;  5L4H A;  2V6X A;  3FZH B;  5LB7 B;  3H3M A;  1SHZ C;  4M1P A;  2LRL A;  3T1Y T;  3RRW A;  3UUB A;  5LP6 E;  5AQI B;  1B7T A;  4HWC A;  4JEH B;  3CKD A;  3EAM A;  2IC6 A;  2WCA A;  3I0O A;  5JRC B;  4L9I A;  3RIU A;  2W66 A;  4X1K E;  4YT0 A;  4JV5 T;  2J47 A;  1U4Q A;  3AA0 B;  4UVA B;  3V5S A;  2VK9 A;  3ZN1 B;  3C4Z A;  3ZST A;  3ZEF B;  1E7P A;  5CA1 E;  2UXC T;  1QUU A;  1UX4 A;  4TN7 B;  4U31 A;  5FXW A;  2P9B A;  4ZHQ E;  4DV5 T;  3MZK B;  3LBX B;  4DV3 T;  3ZC1 A;  1IAP A;  4P0A A;  2WDV A;  1OED C;  2XTL A;  3K1S A;  5KMG P;  2JQK A;  3FZL B;  3O4X E;  4B3S T;  3AE3 A;  1MIW A;  3CX7 B;  3TLT A;  4UEL A;  3PJA J;  3T8O A;  5LJM A;  4L0R A;  5KX5 E;  4QWN B;  4IE5 A;  5DAB A;  5HEO A;  4IDQ A;  3SWH A;  1ZV4 X;  3N9P A;  3PUV F;  5FP3 A;  2XQA A;  2A3D A;  2WQY A;  3NBX X;  4YFS A;  3U3I A;  4UXN B;  1V9D A;  4ILC A;  1JNR A;  3AE7 A;  4IRE A;  4TX5 A;  2HHH T;  5J1G A;  4U7Y A;  3VKH A;  2ZM0 A;  4WW0 A;  5AQV B;  2XPK A;  4TUY E;  3L39 A;  5CFB A;  5HEH A;  2KXP B;  4O4H E;  3D0T A;  1KNP A;  2CXF A;  3Q5E A;  1IZN B;  2M6I A;  2CHN A;  3M3Z B;  2FJB A;  3UUN A;  3ZSS A;  2XQ8 A;  1CHU A;  1WR0 A;  5JR9 A;  3PV0 F;  3HKD E;  1J5W A;  3RH3 A;  3ETV A;  3NKZ A;  4TWF A;  5EZY E;  5FY1 A;  4GYS A;  4O2B E;  5LG3 A;  2CRB A;  2MAW A;  3PUA A;  5HXH A;  3ZYK A;  2Y8D A;  1M62 A;  4TWD A;  2LEH A;  5EK3 A;  2CLY C;  4PJM A;  5FVL A;  3RRC A;  5J2U E;  3LK2 B;  5JQG E;  4PK5 A;  3ZLI A;  3B5M A;  3OVU A;  2VKD A;  4EOZ B;  4PJN A;  1WR6 A;  4WYV A;  4NIQ A;  1KFY A;  2IAK A;  3P8C D;  2Y6X A;  3CPZ A;  3N9M A;  2KZ7 B;  5GON E;  3RX6 A;  5LGN B;  1HNX T;  2F4V T;  4KHP T;  1Y01 A;  2CMR A;  3CQC B;  4CZZ B;  4LMJ A;  4YSZ A;  4IDO A;  1LVK A;  2LJL A;  2CBJ A;  2X68 A;  4UVB B;  2DL1 A;  3RIF A;  4CN4 A;  3E08 A;  2XAS B;  5LGU B;  4DID B;  5LHH B;  3ESL A;  2BKO A;  2PBI A;  4ILB A;  3KV5 A;  4CI3 B;  3TLV A;  2J62 A;  3U78 A;  4A5X A;  2WWU A;  4O4J E;  5HXC A;  1HS7 A;  3N2K E;  4HFV A;  5ABG A;  1N32 T;  4HWI B;  3UU6 A;  2NW8 A;  3CX6 B;  4JBW F;  2NWB A;  2V5D A;  4U3C A;  4JI8 T;  3OPC A;  3UT5 E;  3AED A;  4ASK A;  2LSJ A;  4BJN A;  3B57 A;  5J0Z A;  4GOU A;  3UFG A;  1Z8U A;  3KV9 A;  4AQG A;  4I55 E;  3ONX A;  4DUZ T;  5LJN A;  4I43 B;  2X0L B;  3N5L A;  2KIN B;  1WFD A;  5IHY A;  3BQL A;  4HWH A;  2G0U A;  3QNU A;  3O9X A;  3O1J A;  3AE8 A;  3JAE A;  4Z8X A;  2L8K A;  3HR0 A;  1MIY A;  5KXJ A;  2N9D A;  3MKD A;  4UV9 B;  2L9Q A;  4ZI3 D;  5HEJ A;  2BKN A;  1S94 A;  2BS4 A;  3CQG B;  4HGA A;  3F57 A;  2YDS A;  1VRB A;  3I9Y A;  1WLX A;  3JC6 D;  1XDO A;  5A1L A;  2IIU A;  3RC3 A;  2LSY A;  2K48 A;  2XQ9 A;  3NZQ A;  3QUJ A;  3ZMT B;  2XAH B;  3ZMS B;  2X9W A;  1I6Z A;  3MXZ A;  3R84 B;  2X9Y A;  2CE7 A;  2PFV A;  1BR2 A;  3LSV A;  3PUR A;  2WAU A;  2MPK A;  4KP3 C;  5DQW A;  3S4U A;  4ZI3 C;  3ANW A;  4NUV A;  2C5J A;  4XZC A;  4F6R C;  2LSG A;  5HCJ A;  4AQF C;  5L3C B;  4KHZ F;  2LE8 A;  3JC6 C;  3C64 A;  3F2E A;  4KUM B;  4LML A;  4GYR A;  4DV7 T;  4MLK A;  2KT9 A;  4Z91 A;  4KX6 A;  3ZYM A;  4DR6 T;  3FXE B;  2CXD A;  4AKL A;  2JMH A;  1SUM B;  2IW5 B;  2FJD A;  2VVS A;  3VHL A;  4E7Z A;  5J2T E;  2WU5 A;  4AKG A;  2CWY A;  4LF6 T;  2W67 A;  3KIN B;  4CQI A;  2XAQ B;  4O8S A;  2BG9 E;  4C90 A;  3HL6 A;  2QYW A;  1MNE A;  4HKA A;  3K3N A;  3EDV A;  2LRK A;  1VCT A;  3LJC A;  4WBN E;  3KBT A;  3HA4 A;  4GK5 E;  2XHE B;  4IDP A;  1OXZ A;  4YHJ A;  4BA9 A;  3AAE B;  2LSK A;  1UCU A;  5C3J A; 
#chains in the Genus database with same CATH homology
 5AQN B;  3FZK B;  1T7S A;  3FZF B;  1I6Z A;  5AQM B;  3FZL B;  5AQL B;  4HWF A;  4HWI B;  1M62 A;  5AQK B;  1UGO A;  1UK5 A;  1M7K A;  3FZH B;  1HX1 B;  4HWH A;  5AQJ B;  4HWD A;  5AQI B;  5AQH B;  5AQP B;  5AQR B;  5AQT B;  4HWC A;  5AQV B;  3LDQ B;  3FZM B;  3A8Y C;  3M3Z B;  5AQQ B;  5AQF B;  2D9D A;  5AQG B;  5AQO B;  5AQS B;  5AQU B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...