3TKLB

Crystal structure of the gtp-bound rab1a in complex with the coiled-coil domain of lida from legionella pneumophila
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
192
structure length
192
Chain Sequence
b'SEELSLSEINEKMKAFSKDSEKLTQLMEKHKGDEKTVQSLQREHHDIKAKLANLQVLHDAHTGKKSYVNEKGNPVSSLKDAHLAINKDQEVVEHKGQFYLLQKGQWDAIKNDPAALEKAQKDYSQSKHDLATIKMEALIHKLSLEMEKQLETINDLIMSTDPKENEEATKLLHKHNGLNLKLANLQDMLAVH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ras-related protein Rab-1A
molecule tags Protein transport/protein binding
source organism Homo sapiens
publication title Structural insights into a unique Legionella pneumophila effector LidA recognizing both GDP and GTP bound Rab1 in their active state
pubmed doi rcsb
total genus 76
structure length 192
sequence length 192
ec nomenclature
pdb deposition date 2011-08-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.90 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3tklB01
2G0UA 3L3PA 2KWHA 3QUJA 1ZKEA 3FXDB 2MBGA 2C5KT 4B6XA 2KWIB 3P7IA 3CKDA 3CVRA 4EYYR 2X9YA 4DNDA 2IC9A 1LRZA 4L0RA 3S4UA 2C5JA 2K48A 3MXZA 2X9WA 1QSDA 1IJ5A 1LVFA 3N5LA 2X9XA 2IC6A 2C5IT 3FXEB 4CQIA 1Z0PA 1H7CA 2XTLA 2CA5A 1IJ6A 4J2CA 3QK6A 4FI5A 3TKLB
chains in the Genus database with same CATH superfamily
3QC9A 5EZYE 2A9UA 2LOSA 3C4WA 5FY7A 3RHWA 4CZZB 2E5VA 3QUJA 4ILUA 2WBLA 5TAOA 3UTKA 2MBGA 2M67A 4OHFA 5IWAT 3VKHA 5HEGA 1O3XA 1HNZT 2BG9A 4P0BA 5ABGA 4DV3T 3CVRA 2NW8A 4QH5A 4AIUA 2YK0A 3KV4A 4DBQA 4Q25A 2XQ5A 5ETWA 4WYVA 4U33A 4OFZA 2W2UA 3DTOA 5GONE 4G63A 5ADXL 5JR9B 4ZS3A 3ZMVB 4CXXA 5JDMA 2DI4A 4H9NC 4HFBA 1ZEEA 1J5ET 2UUBT 4IL4A 1I6ZA 2F4VT 3AA1B 5LMUT 3RIUA 2ACXA 3ABVA 4O4IE 3ZCIA 2YEVC 3RYIE 3OTOT 3KBUA 2LE8A 3AA6B 1WLXA 1XMOT 3AAEB 1OEDC 1OEDE 3L09A 3Q5EA 1D1AA 5H6QB 4EV6A 4YSZA 5J2TE 2WY2A 4HWDA 4YHHT 2CEAA 1XZYA 3N2GE 3N9PA 3KVAA 4YT0A 4ZEYA 3VR9A 2CMRA 4CN4A 3OYZA 4TX5A 2CE7A 4NIQA 5LGTB 3MKDA 5LMNT 4BAYB 2WQYA 2MYSA 3Q9DA 4JLEA 4X1KE 2IW5B 3SRZA 2KT9A 4UV9B 5LA6E 2BS4A 4EEBA 1VCTA 2V5CA 2X68A 3UQ4A 2DNXA 4YHJA 4X65T 4JI6T 1YQ4A 2J62A 2V8SV 4LFBT 2ZM0A 2X9HA 3CX8B 4IGUA 2X0LB 2D2SA 2OV9A 3LG7A 4TV8E 4ISTA 5LBMA 5JH7E 3C64A 4HFHA 5FXWA 3P4QA 1IBKT 2WAUA 4JEHB 1BR0A 2B76A 4B3RT 1YXRA 2LRKA 5LB7B 3PUSA 1Z0PA 1XDOA 3PUAA 2M6IA 2RPAA 3TLTA 3PDYA 2C0SA 2LSKA 4EEDA 3Q5WA 4HTEA 3L3PA 5LYJE 1OWAA 3TLVA 2VB6A 1D0ZA 5JDFA 5HYAA 4DUYT 1W09A 2Z6EA 5DABA 5HXRA 4B6XA 2FBWA 5FL0A 3X1DA 4YJ3E 5A1LA 4PFOA 5FL1A 4LMKA 2WWVA 3GMIA 3RQWA 4ADZA 3MA9A 2E9XC 1WFDA 4UVBB 4AKIA 2XAHB 2D0TA 4DVDA 4PJJA 5JREA 2DCFA 4PFPA 4QXCB 2DL1A 1XDPA 2H88A 2KZ7B 2OLTA 2YDSA 2E8IA 3LBXB 4YSXA 4ZI2D 2IUBA 2NP9A 4GYRA 2X9WA 3ZT6A 3OPCA 4AQFA 4AQFC 3N9MA 5L3CB 5CB4E 5ABHA 1SE7A 2BKPA 4HGAA 2IC6A 4NPPA 2L8KA 2A2FX 4PW8A 5AQHB 1CUNA 3F2EA 2CHNA 3T8OA 2DHRA 3ZSSA 4EAHA 3CMLA 4E7ZA 3HA4A 3P50A 4TWFA 5IHYA 3ZPOA 1IBLT 4DR1T 4IIJE 1D0XA 2LSYA 3AA0B 3AEFA 3PTRB 2WMOA 3FXDB 4IE7A 4KBMB 2LT3A 4YFSA 3W15B 4UF0A 2Q9QA 4U74A 5JDQA 3PE0A 3JADA 5DQWA 3ONXA 4JEUB 4CN1A 1M7KA 1HX8A 5F8PA 4CI1B 3RC8A 4YTNA 2VQET 3RGLA 3LSVA 3P4WA 2WDQA 1HCIA 3AECA 5AQPB 2V6YB 4IE4A 4L5GA 2CWOA 2A72A 4EB6E 1ZV4X 3T1YT 2X9XA 2L3LA 2UUCT 3FXEB 1D1BA 4JV5T 2XAJB 1HX1B 4GOUA 5JVDE 1W0BA 2VKDA 4U7YA 4WBOA 3RPUA 1FEWA 2LOPA 3NZQA 3ZT7A 1Z8UA 3LBXA 4C90A 4PNIA 2EHOB 4ERRA 3AEDA 5IYZE 5CGMA 4YSYA 3H3AA 5FXVA 5FVLA 3C4ZA 3I9WA 2XQ7A 3RF1A 3AA7B 3PV0F 4KX6A 3UT5E 4ZI2C 1MIVA 3Q5DA 5ABFA 3SWHA 1ZKEA 4TN7B 4C91A 2RA1A 3HR0A 5HAXA 2WSSV 4HWIB 2E9XD 4TZ4C 4A97A 2ZLYA 3UUBA 4E7SA 4ZI3D 2PTFA 5LXTE 2BS3A 5J0ZA 4KP3C 5DQVA 4IL9A 3CQGB 1NEKA 5FYMA 2LKGA 2NWBA 2Y8DA 1V9DA 2MTQA 1IZNB 2ZM8A 4QH1A 2N9DA 3N9NA 5AQVB 2WDVA 3ZYKA 1FMVA 2V7IA 5L4EA 5E0OA 3EDVA 3UU6A 4U3CA 2HPJA 4KHZF 5JDNA 1HR0T 2YU1A 3JAEA 2XTLA 5AQNB 3J9X1 4DV1T 3T1HT 2J1DG 3K3QC 5C3JA 1U5PA 1QLBA 2FJBA 3UQ7A 5ABFB 5LG3A 2XY8B 3NRYA 5ABEA 4JI1T 3RYCE 3CK6A 5HXEA 2VQFT 3H37A 2PBIA 4TWHA 4KI0F 2XQ3A 5FY0A 4HWCA 4HFIA 4O4HE 4ZXLA 3LJCA 4QXBB 3RYHE 2WDRA 3B5MA 3AE3A 2XZEA 3LK3B 2AXDS 3CPZA 5DJQC 4WW0A 3TLSA 4AKRB 5CJ5A 2JMKA 3R84B 4NUUA 4LF6T 4LF5T 3D0TA 4EIWA 1BR4A 4JI4T 1X9BA 3CWZB 4AKLA 5J2UE 5JQGE 1NENA 3DJBA 2KXPB 2NTXA 3NBXX 4PAGA 3P4RA 4Z91A 4LMLA 3WI3A 4ZHQE 5LJNA 3MJXA 4HFDA 1H7CA 4XZCA 2VWAA 3V5SA 2CXDA 2I6HA 3NVOA 3CQXC 3MACA 2QVAA 4NUVA 5L3GB 3B13A 4HFCA 1VOMA 3R6NA 5BR8T 2MAWA 4ZZCA 5AQGB 2VK9A 3ONJA 2K3WA 4QHOA 3RI5A 4O2AE 3JC6D 1MIYA 2PFVA 3P7IA 3ZSTA 2NW7A 2FJAA 2JJ9A 2XPKA 4XBFB 4CXYA 2WCAA 3ANWB 1HTJF 4X66T 4ISSA 4A56A 2ZM6T 2XSAA 1UX4A 2LJLA 3S4UA 3L8RA 4IE5A 3K3OA 4IDNA 4P1NA 4NXNT 5AQKB 5HEUA 4CN6A 4AQYT 2QGSA 3BK9A 2V7KA 3K8PC 3F31A 3KINB 5JR9C 2ACZA 2X0HA 2ES0A 3OVUA 2EHOD 3EVYA 3VKGA 2Q9QC 4H9PC 4CQIA 2H89A 4AI6A 2ZM2A 1XWMA 5L3EB 1MIWA 2CA5A 3VHLA 3FZLB 1N33T 4J2CA 4DR3T 3N2KE 3FZKB 3LK2B 2XM2A 5F5WA 2JPFA 3IEEA 4PK6A 3A7MA 5JDHA 2BBJA 4QH4A 3PJAJ 5LHHB 3EHZA 4YJ2E 3EAMA 1KNPA 3O1HA 4MBQA 4A98A 4I50E 5JDGA 1UK5A 3F57A 2KNDA 3E08A 3IBPA 3PUWF 2BG9B 2W67A 4H9SE 4B3ST 3JCFA 4OYKA 5CA0E 3RX6A 2WM9A 3ZMSB 2XAFB 1KNRA 4MHCA 2C5JA 3OKQA 1U4QA 2HPLA 4ASKA 1T72A 4IDQA 4KHPT 2BKNA 1WYCA 2LLYA 2HN1A 4JBWF 1WYBA 2E9XA 3N9QA 2JMHA 3Q5XA 5FXZA 4LF8T 2V1DB 2W61A 1MMGA 4MLKA 4ZOLE 5AQSB 4WBNE 3SS1A 3NRXA 4N78D 3AEGA 4JUYA 1KFYA 2FJDA 3QK6A 5J1GA 4O4JE 4KUMB 4DR2T 2LRLA 1T8BA 2VL0A 4JI7T 2I59A 4QX7B 2W66A 2XSBA 4EGWA 2MOZA 3ZC0A 3PURA 3AVSA 1XNQT 3C98B 3ZT5A 4PJLA 2CWYA 2QRXA 1FIOA 3FB2A 1S94A 2YDRA 2WB5A 4IHJE 3E0ZA 3KV6A 3BQIA 2NTYA 2M6BA 2V7JA 3AE6A 2VASA 3PUZF 3G06A 5AQLB 5JDLA 2XHEB 3CX7B 3N9OA 3IF8B 4GK5E 3UU8A 3J7Yq 4YTPA 3ZMZB 4JI8T 4OX9T 2HN2A 2D0UA 2IHR1 3A8YC 3QB5A 1E1HB 1CHUA 3AE5A 3OYXA 4P09A 1N32T 4U7IA 2V6XA 3ZEFB 1G73A 1US7B 1MMAA 4HWHA 4L9IA 2IDOB 3KVBA 1VRBA 2V26A 1BR1A 3O1IA 3PU3A 2UUAT 2G0UA 1KK7A 2CRBA 3OJAA 4BJNA 3FZFB 1IAPA 5FMNA 4CXWA 1LKXA 2C5KT 1SA0E 5L4HA 3U3IA 4UR9A 4Z90A 4I0UA 3P8CD 4O4LE 2E2AA 2VURA 4HEAA 3RIUC 3FZMB 3DP7A 4U2ZA 4JI3T 5AQTB 5M4YA 4K0KT 4I4TE 1UX5A 4MFRA 2YINA 4EOZB 4DR7T 2IC9A 1M62A 4OYJA 3KV5A 3ZN1B 4AKHA 3KV9A 3UU5A 5AQJB 2FJEA 2LHNA 4EYYR 2WMNA 3ZCJA 1UURA 3RKGA 2PG8A 4DMVA 5AQQB 2KINB 1NWMX 1OXZA 2PJQA 4FJOA 3MZKB 4IREA 3AAIA 3HKEE 5AQOB 2A3DA 5HEHA 1SUMB 1I94T 3UU3A 3CQCB 4H9OC 3I0OA 2FUPA 4X20E 2LKHA 3TKLB 2XJ7A 3WAJA 3GWHA 1MMDA 1UUSA 2H7VC 4TUYE 2W0GA 5C8YE 4QXHB 3LFMA 4BJMA 5KDMC 2KWIB 3C4XA 3L39A 4HKAA 3Q2MA 1YQ3A 4ILCA 4KMCA 5F3JA 3FHNA 5LHIB 2V6YA 1T7SA 4DNDA 1JNRA 2LSJA 3IHRA 4UF0B 4ZZBA 3ZLIA 2B1EA 4YTMA 2H7OA 3QOFA 5FNVE 2XQ8A 2UXBT 2CLYB 3AB3B 1YKHB 2JQHA 2NOXA 3MXZA 2XQ4A 2ZMAA 1KF6A 1W0AA 2BVMA 2XASB 4LF9T 3QB5K 3PUQA 4DBRA 4OK0A 1IJ5A 2WZHA 2D9DA 2NW9A 2K5BB 4EYUA 2N1GA 4O2BE 1D1CA 2BKOA 3UFGA 1W9RA 3GN5B 3HL6A 4WZXA 3TLUA 4IE0A 2BS2A 5LNKA 1ZP0A 4TNVA 2Y48B 5FXXA 2UU9T 3AVRA 3RYFE 2YDQA 4X62T 3CIRA 3ONLC 4FI5A 4DIDB 4DR5T 2J47A 5KMGP 2GK9A 1FJGT 3JAFA 5H6RB 1E7PA 3AE2A 5HEOA 2VL8A 5AQIB 3VRBA 3M65A 3RIFA 4ANJA 4CI3B 2XUEA 4P0AA 2WP9A 5JTGA 4NXMT 1XNRT 4Z8XA 4EZ4A 4GKKT 3AEBA 5AQFB 3VR8A 2LM9A 2V5DA 2XQ9A 2VKJA 3PUGA 3CX6B 4DV0T 3O1JA 4EZHA 5IUXA 3AAAB 3KDSE 4IDZA 3VRAA 5AQRB 2SPCA 4EXTA 3V5UA 2VKHA 2RP4A 2XAQB 3EUHA 4X1YE 3MK7C 2L9QA 5FVKA 5JRCB 2V7LA 2KSRA 1UGOA 1QSDA 3AEAA 4BA9A 3P4PA 3I0QA 4UXNB 5AFUL 4ZI3C 4AKGA 4JI5T 2CM0A 3ZMUB 1WR6A 2R6GF 2BBHA 2UXXB 2D5UA 2IIUA 2JQQA 5LHGB 3I1AA 4DV6T 3K1SA 4YY3T 3QNUA 3RIAA 1N36T 3I9YA 5HXHA 1J5WA 1HG5A 3ZJ2A 5L3DB 2W4XA 3EI0A 4DV2T 5L3FB 1ZOYA 2NR4A 3ETUA 3SFEA 1QUUA 4DR4T 5LCYA 3PU8A 1Y64B 4UELA 4PK5A 5LJMA 5HCJA 3O4XE 2EHOC 2X0YA 4X5TA 2BG9C 2BG9E 4ZI7E 3N2OA 4PK4A 4GK0E 2IAKA 3JC6C 1Y01A 2X9YA 2UXNB 3KFWX 4HN9A 4ZS2A 3RKOA 5FKYA 3U78A 4LF4T 2VKOA 1EZ3A 4LFCT 2KLQA 3LK42 1J1JA 2W00A 5EK4A 2XQ6A 3HKBE 5LGUB 4UV8B 1UCUA 3UUNA 4DMWA 4X64T 4LF7T 4GIWA 2BZBA 3EABA 3N5LA 1MNEA 2XQYA 1HG2A 2HH7A 4UVAB 5FP3A 2CLYC 3GN5A 1HF8A 3IA3A 2DWKA 3BQKA 3VU7H 3C51A 4H63H 3RC3A 2Q9QB 5AQUB 3AE4A 1WRDA 3RH3A 5BMVE 3NWIA 4MALA 1IBMT 2KWHA 3OBVE 4I55E 1D0YA 5LP6E 3LDQB 4YLHA 1B7TA 4JI0T 3ZYLA 3TLWA 2X51A 3K3NA 3NZPA 4G2AA 5HXSA 1KNZA 4JYAT 4K0UA 5KX5E 2YU2A 1WR0A 3UUXB 2CXLA 2CBIA 3SFDA 3ZJ1A 2E9XB 2WS3A 3ANWA 4UVCB 1OEDB 4GKJT 1KEYA 3FBZA 4TWDA 1LRZA 4UIGA 5AQMB 2DWGA 4DUZT 4DV7T 1X79A 3ESLA 3RLFF 3NKZA 4DR6T 4COFA 3HI2A 1DU2A 2ODVA 1SHZC 3PUXF 2UXCT 1HNWT 2W63A 3P4SA 4GYSA 2E5LT 2AE9A 3UU4A 3PUYF 2VVSA 3ZC1A 4DO0A 2HHHT 3O9XA 3PUVF 2WU2A 5CFBA 2JIWA 4PJNA 1G8XA 1S35A 2EHOA 4H63V 4HE8A 3AEEA 2CCQA 2P9BA 5FY1A 3AE7A 4JI2T 4ILBA 1FMWA 2QA7A 1XMQT 2LHRA 2LM2A 3AXJB 4X1IE 2JQ9A 3ZYMA 3HKDE 3ZN0B 2QYWA 1N34T 3H3MA 4TV9E 4O8SA 5LGNB 5EK2A 4B3MT 2UXDT 4AQGA 4WNKA 2CBJA 2YN6A 3CKDA 1L0VA 4IDPA 4U72A 3UUMA 5HWXA 2K24A 2LSGA 2V7MA 4TNWA 4QWNB 5CA1E 2ODUA 4L0RA 3E22E 3FBLA 4HFEA 1R8IA 4LMJA 4U2YA 5HEJA 3PJAA 4H9RC 2X66A 3A5XA 5JR9A 5L3BB 5JRCA 1GQEA 3BQLA 2CHOA 2J4GA 4U31A 3RRCA 5LOVE 4HWFA 1AJ3A 3ZMTB 2C5IT 1E2AA 5HXCA 3M3ZB 2K9AA 2VVNA 2N2NA 2XAGB 2Y6XA 4QKNA 2CPTA 3UFEA 5L2LA 3AE8A 2W62A 3AE1A 1IJ6A 4PJMA 1YD8G 5LBQB 3AE9A 1MNDA 4CI2B 2CXFA 4IE6A 4F8HA 2IMLA 2XQAA 3GA8A 2WU5A 4V1Av 2YOEA 5C2TA 5KXJA 1HNXT 1YKEB 2H3RA 2BVLA 2KMFA 5LG4A 2MPKA 4AXPA 1VCSA 3UULA 4ILAA 3ZKRA 4UEMA 2DLRA 1HFAA 4LFAT 4B3TT 4YXDA 3KBTA 5HCMA 2BDEA 2JQKA 4XAXB 4DV4T 1OEDA 2JRKA 4IT4A 1JNZA 1LVKA 4H9QC 3B57A 4HFVA 4QX8B 2I0MA 4AISA 2X67A 3FZHB 4F6RC 3HKCE 2K48A 2XM1A 1MMNA 2LSIA 1YW0A 1ZHCA 3ETVA 5L47A 3SOLA 4DV5T 3RRWA 1LVFA 1T98A 3C50A 2WZIA 3EDUA 3WAKA 4I43B 1WCRA 5HWYA 4M1PA 3N9LA 2Q9QD 5EK3A 2LEHA 4A5XA 3RQUA 2WWUA 2YKSA 3AXJA 4IDOA 2OA5A 1HS7A 1NAFA 1BR2A
chains in the Genus database with same CATH topology
3QC9A 5EZYE 2LOSA 3C4WA 5FY7A 4CZZB 3QUJA 4ILUA 2WBLA 5TAOA 3UTKA 2MBGA 2M67A 4OHFA 3VKHA 1O3XA 4P0BA 3CVRA 2NW8A 2YK0A 3KV4A 4DBQA 5ETWA 4OFZA 3DTOA 5GONE 4G63A 5ADXL 5JR9B 4ZS3A 3ZMVB 4CXXA 5JDMA 2DI4A 4H9NC 1ZEEA 3AA1B 2ACXA 4O4IE 3ZCIA 2YEVC 3RYIE 3KBUA 2LE8A 3AA6B 1WLXA 3AAEB 3L09A 1D1AA 5H6QB 5J2TE 2CEAA 3N2GE 3N9PA 3KVAA 2CMRA 3OYZA 4TX5A 2CE7A 5LGTB 3MKDA 4BAYB 4JLEA 2MYSA 3Q9DA 4X1KE 2IW5B 3SRZA 2KT9A 4UV9B 5LA6E 2X68A 2DNXA 4YHJA 2ZM0A 2X9HA 3CX8B 4IGUA 2X0LB 2D2SA 3LG7A 4TV8E 5LBMA 4ISTA 5JH7E 3C64A 5FXWA 2WAUA 4JEHB 3PUSA 1Z0PA 3PUAA 3PDYA 2C0SA 2LSKA 3Q5WA 4HTEA 3L3PA 5LYJE 1OWAA 2VB6A 1D0ZA 5JDFA 5HYAA 2Z6EA 5DABA 5HXRA 4B6XA 5A1LA 4YJ3E 4PFOA 3GMIA 4ADZA 3MA9A 2E9XC 4UVBB 4AKIA 2XAHB 2D0TA 4DVDA 4PJJA 5JREA 2DCFA 4PFPA 4QXCB 2KZ7B 2E8IA 3LBXB 4ZI2D 2NP9A 4GYRA 2X9WA 4AQFA 5L3CB 4AQFC 3N9MA 5CB4E 4HGAA 2IC6A 2L8KA 2A2FX 4PW8A 1CUNA 3F2EA 3T8OA 2DHRA 4EAHA 3CMLA 4E7ZA 3HA4A 5IHYA 3ZPOA 4IIJE 1D0XA 2LSYA 3AA0B 3PTRB 2WMOA 3FXDB 4IE7A 4KBMB 2LT3A 4YFSA 3W15B 4UF0A 2Q9QA 4U74A 5JDQA 3PE0A 5DQWA 3ONXA 4JEUB 1HX8A 5F8PA 4CI1B 3RC8A 1HCIA 4IE4A 4L5GA 2CWOA 2A72A 4EB6E 1ZV4X 2X9XA 2L3LA 3FXEB 1D1BA 2XAJB 4GOUA 5JVDE 3RPUA 2VKDA 4WBOA 4C90A 1FEWA 2LOPA 3NZQA 4ERRA 3LBXA 4PNIA 2EHOB 5IYZE 3H3AA 5FXVA 3C4ZA 3I9WA 3UT5E 3AA7B 4ZI2C 1MIVA 3SWHA 1ZKEA 4TN7B 4C91A 2RA1A 3HR0A 5HAXA 2WSSV 2E9XD 4TZ4C 4E7SA 2ZLYA 4ZI3D 5LXTE 4KP3C 5DQVA 3CQGB 5FYMA 2NWBA 2Y8DA 1V9DA 2MTQA 1IZNB 2ZM8A 2N9DA 3N9NA 3ZYKA 1FMVA 2V7IA 5E0OA 3EDVA 2HPJA 5JDNA 2YU1A 2XTLA 3J9X1 2J1DG 3K3QC 1U5PA 3NRYA 3RYCE 5HXEA 3H37A 2PBIA 5FY0A 4O4HE 3LJCA 4QXBB 3RYHE 5DJQC 3LK3B 5HXSA 3CPZA 4WW0A 4AKRB 2JMKA 3R84B 4NUUA 3D0TA 4EIWA 1BR4A 3VKGA 3CWZB 4AKLA 5JQGE 5J2UE 3DJBA 2KXPB 2NTXA 3NBXX 4PAGA 4ZHQE 5LJNA 3WI3A 3MJXA 4XZCA 1H7CA 3V5SA 2VWAA 2CXDA 3CQXC 3MACA 4NUVA 5L3GB 3B13A 1VOMA 3R6NA 2VK9A 4QHOA 4O2AE 3JC6D 1MIYA 2PFVA 3P7IA 2NW7A 2JJ9A 3ANWB 1HTJF 4ISSA 4A56A 1UX4A 2LJLA 3S4UA 4IE5A 3K3OA 2QGSA 3BK9A 2V7KA 3K8PC 3F31A 3KINB 5JR9C 2ES0A 2EHOD 3EVYA 2Q9QC 4H9PC 4CQIA 4AI6A 2ZM2A 5L3EB 1MIWA 2CA5A 3VHLA 4J2CA 3N2KE 3LK2B 2JPFA 3IEEA 4PK6A 5JDHA 5LHHB 4YJ2E 4MBQA 3O1HA 4I50E 5JDGA 3F57A 2KNDA 3E08A 3IBPA 4H9SE 5CA0E 4OYKA 3RX6A 2WM9A 3ZMSB 2XAFB 4MHCA 2C5JA 3OKQA 1U4QA 2HPLA 4ASKA 1WYCA 1WYBA 2E9XA 3N9QA 2JMHA 3Q5XA 5FXZA 2V1DB 2W61A 1MMGA 4MLKA 4ZOLE 4WBNE 3SS1A 3NRXA 4N78D 4JUYA 3QK6A 5J1GA 4O4JE 4KUMB 2I59A 4QX7B 2MOZA 3ZC0A 3PURA 3AVSA 3C98B 4PJLA 2CWYA 1FIOA 3FB2A 1S94A 4IHJE 3E0ZA 3KV6A 3BQIA 2NTYA 2V7JA 2VASA 2XHEB 3CX7B 3N9OA 3IF8B 4GK5E 3J7Yq 3ZMZB 4P09A 2D0UA 1E1HB 3OYXA 3ZEFB 1G73A 1US7B 1MMAA 4L9IA 3KVBA 1VRBA 2V26A 1BR1A 3O1IA 3PU3A 2G0UA 1KK7A 3OJAA 4BJNA 1IAPA 5FMNA 4CXWA 1LKXA 2C5KT 1SA0E 3U3IA 4EYYR 3P8CD 4O4LE 4HEAA 3DP7A 5M4YA 4I4TE 1UX5A 4MFRA 2YINA 4EOZB 2IC9A 4OYJA 3KV5A 3ZN1B 4AKHA 3KV9A 2LHNA 2WMNA 3ZCJA 2PG8A 4DMVA 2KINB 1NWMX 1OXZA 2PJQA 4FJOA 3MZKB 3AAIA 3HKEE 2A3DA 3CQCB 4H9OC 3I0OA 4X20E 3TKLB 3WAJA 3GWHA 1MMDA 2H7VC 4TUYE 2W0GA 5C8YE 4QXHB 3LFMA 4BJMA 5KDMC 2KWIB 3C4XA 4HKAA 3Q2MA 5F3JA 4KMCA 5LHIB 3FHNA 4DNDA 4UF0B 2LSJA 3IHRA 3ZLIA 2B1EA 2H7OA 5FNVE 2CLYB 3AB3B 1YKHB 2NOXA 3MXZA 2ZMAA 2BVMA 2XASB 4XBFB 4DBRA 3PUQA 4OK0A 1IJ5A 2NW9A 4EYUA 5JDLA 2K5BB 2N1GA 4O2BE 1D1CA 5LNKA 3GN5B 3HL6A 4IE0A 2Y48B 5FXXA 3AVRA 3RYFE 4FI5A 5KMGP 2GK9A 5H6RB 2VL8A 4ANJA 3M65A 4CI3B 4P0AA 2XUEA 4Z8XA 4EZ4A 2LM9A 2VKJA 3PUGA 3CX6B 3O1JA 4EZHA 3AAAB 3KDSE 4IDZA 2SPCA 4EXTA 3V5UA 2VKHA 2RP4A 2XAQB 3EUHA 4X1YE 3MK7C 2L9QA 5JRCB 2V7LA 1QSDA 4BA9A 3I0QA 4UXNB 5AFUL 4ZI3C 4AKGA 3ZMUB 2CM0A 1WR6A 2UXXB 2D5UA 5LHGB 2JQQA 3I1AA 3I9YA 5HXHA 1HG5A 3ZJ2A 5L3DB 5L3FB 3ETUA 1QUUA 5LCYA 3PU8A 1Y64B 4UELA 4PK5A 5LJMA 3O4XE 2EHOC 4ZI7E 3N2OA 4PK4A 4GK0E 2IAKA 3JC6C 2X9YA 3KFWX 2UXNB 4HN9A 4ZS2A 3RKOA 3U78A 2VKOA 1EZ3A 2KLQA 3LK42 2W00A 5EK4A 3HKBE 5LGUB 4UV8B 1UCUA 3UUNA 4DMWA 4GIWA 2BZBA 3N5LA 1MNEA 2XQYA 1HG2A 2HH7A 4UVAB 5FP3A 2CLYC 3GN5A 1HF8A 2DWKA 3BQKA 3VU7H 3C51A 4H63H 3RC3A 2Q9QB 1WRDA 3RH3A 5BMVE 4MALA 2KWHA 3OBVE 4I55E 1D0YA 5LP6E 4YLHA 1B7TA 3ZYLA 2X51A 3K3NA 3NZPA 4G2AA 1KNZA 4K0UA 5KX5E 2YU2A 3UUXB 2CXLA 3ZJ1A 2E9XB 3ANWA 4UVCB 3FBZA 4UIGA 1LRZA 2DWGA 1X79A 3ESLA 3HI2A 2ODVA 1SHZC 2W63A 4GYSA 3ZC1A 4DO0A 3O9XA 4PJNA 1G8XA 1S35A 2EHOA 4H63V 4HE8A 2CCQA 2P9BA 5FY1A 1FMWA 2QA7A 2LHRA 4X1IE 3ZYMA 3HKDE 3ZN0B 4TV9E 4O8SA 5LGNB 5EK2A 4AQGA 4WNKA 3CKDA 4U72A 3UUMA 5HWXA 2K24A 2LSGA 2V7MA 4QWNB 5CA1E 2ODUA 4L0RA 3E22E 3FBLA 4H9RC 5L3BB 2X66A 3A5XA 5JR9A 5JRCA 3BQLA 3RRCA 1AJ3A 5LOVE 3ZMTB 2C5IT 5HXCA 2K9AA 2N2NA 2XAGB 2Y6XA 4QKNA 3UFEA 5L2LA 2W62A 1IJ6A 4PJMA 1YD8G 5LBQB 4CI2B 1MNDA 2CXFA 4IE6A 4CXYA 4V1Av 3GA8A 1YKEB 2H3RA 2BVLA 2KMFA 5LG4A 4AXPA 3UULA 4UEMA 2DLRA 1HFAA 3KBTA 2BDEA 4XAXB 1BR0A 2JRKA 1LVKA 4H9QC 4HFVA 3B57A 4QX8B 2X67A 4F6RC 3HKCE 2K48A 1MMNA 2LSIA 1YW0A 1ZHCA 3ETVA 3SOLA 3RRWA 1LVFA 1T98A 3C50A 3EDUA 3WAKA 4I43B 5HWYA 4M1PA 3N9LA 2Q9QD 5EK3A 2LEHA 2WWUA 2OA5A 1HS7A 1NAFA 1BR2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2G0U A;  3L3P A;  2KWH A;  3QUJ A;  1ZKE A;  3FXD B;  2MBG A;  2C5K T;  4B6X A;  2KWI B;  3P7I A;  3CKD A;  3CVR A;  4EYY R;  2X9Y A;  4DND A;  2IC9 A;  1LRZ A;  4L0R A;  3S4U A;  2C5J A;  2K48 A;  3MXZ A;  2X9W A;  1QSD A;  1IJ5 A;  1LVF A;  3N5L A;  2X9X A;  2IC6 A;  2C5I T;  3FXE B;  4CQI A;  1Z0P A;  1H7C A;  2XTL A;  2CA5 A;  1IJ6 A;  4J2C A;  3QK6 A;  4FI5 A;  3TKL B; 
#chains in the Genus database with same CATH topology
 3QC9 A;  5EZY E;  2A9U A;  2LOS A;  3C4W A;  5FY7 A;  3RHW A;  4CZZ B;  2E5V A;  3QUJ A;  4ILU A;  2WBL A;  5TAO A;  3UTK A;  2MBG A;  2M67 A;  4OHF A;  5IWA T;  3VKH A;  5HEG A;  1O3X A;  1HNZ T;  2BG9 A;  4P0B A;  5ABG A;  4DV3 T;  3CVR A;  2NW8 A;  4QH5 A;  4AIU A;  2YK0 A;  3KV4 A;  4DBQ A;  4Q25 A;  2XQ5 A;  5ETW A;  4WYV A;  4U33 A;  4OFZ A;  2W2U A;  3DTO A;  5GON E;  4G63 A;  5ADX L;  5JR9 B;  4ZS3 A;  3ZMV B;  4CXX A;  5JDM A;  2DI4 A;  4H9N C;  4HFB A;  1ZEE A;  1J5E T;  2UUB T;  4IL4 A;  1I6Z A;  2F4V T;  3AA1 B;  5LMU T;  3RIU A;  2ACX A;  3ABV A;  4O4I E;  3ZCI A;  2YEV C;  3RYI E;  3OTO T;  3KBU A;  2LE8 A;  3AA6 B;  1WLX A;  1XMO T;  3AAE B;  1OED C;  1OED E;  3L09 A;  3Q5E A;  1D1A A;  5H6Q B;  4EV6 A;  4YSZ A;  5J2T E;  2WY2 A;  4HWD A;  4YHH T;  2CEA A;  1XZY A;  3N2G E;  3N9P A;  3KVA A;  4YT0 A;  4ZEY A;  3VR9 A;  2CMR A;  4CN4 A;  3OYZ A;  4TX5 A;  2CE7 A;  4NIQ A;  5LGT B;  3MKD A;  5LMN T;  4BAY B;  2WQY A;  2MYS A;  3Q9D A;  4JLE A;  4X1K E;  2IW5 B;  3SRZ A;  2KT9 A;  4UV9 B;  5LA6 E;  2BS4 A;  4EEB A;  1VCT A;  2V5C A;  2X68 A;  3UQ4 A;  2DNX A;  4YHJ A;  4X65 T;  4JI6 T;  1YQ4 A;  2J62 A;  2V8S V;  4LFB T;  2ZM0 A;  2X9H A;  3CX8 B;  4IGU A;  2X0L B;  2D2S A;  2OV9 A;  3LG7 A;  4TV8 E;  4IST A;  5LBM A;  5JH7 E;  3C64 A;  4HFH A;  5FXW A;  3P4Q A;  1IBK T;  2WAU A;  4JEH B;  1BR0 A;  2B76 A;  4B3R T;  1YXR A;  2LRK A;  5LB7 B;  3PUS A;  1Z0P A;  1XDO A;  3PUA A;  2M6I A;  2RPA A;  3TLT A;  3PDY A;  2C0S A;  2LSK A;  4EED A;  3Q5W A;  4HTE A;  3L3P A;  5LYJ E;  1OWA A;  3TLV A;  2VB6 A;  1D0Z A;  5JDF A;  5HYA A;  4DUY T;  1W09 A;  2Z6E A;  5DAB A;  5HXR A;  4B6X A;  2FBW A;  5FL0 A;  3X1D A;  4YJ3 E;  5A1L A;  4PFO A;  5FL1 A;  4LMK A;  2WWV A;  3GMI A;  3RQW A;  4ADZ A;  3MA9 A;  2E9X C;  1WFD A;  4UVB B;  4AKI A;  2XAH B;  2D0T A;  4DVD A;  4PJJ A;  5JRE A;  2DCF A;  4PFP A;  4QXC B;  2DL1 A;  1XDP A;  2H88 A;  2KZ7 B;  2OLT A;  2YDS A;  2E8I A;  3LBX B;  4YSX A;  4ZI2 D;  2IUB A;  2NP9 A;  4GYR A;  2X9W A;  3ZT6 A;  3OPC A;  4AQF A;  4AQF C;  3N9M A;  5L3C B;  5CB4 E;  5ABH A;  1SE7 A;  2BKP A;  4HGA A;  2IC6 A;  4NPP A;  2L8K A;  2A2F X;  4PW8 A;  5AQH B;  1CUN A;  3F2E A;  2CHN A;  3T8O A;  2DHR A;  3ZSS A;  4EAH A;  3CML A;  4E7Z A;  3HA4 A;  3P50 A;  4TWF A;  5IHY A;  3ZPO A;  1IBL T;  4DR1 T;  4IIJ E;  1D0X A;  2LSY A;  3AA0 B;  3AEF A;  3PTR B;  2WMO A;  3FXD B;  4IE7 A;  4KBM B;  2LT3 A;  4YFS A;  3W15 B;  4UF0 A;  2Q9Q A;  4U74 A;  5JDQ A;  3PE0 A;  3JAD A;  5DQW A;  3ONX A;  4JEU B;  4CN1 A;  1M7K A;  1HX8 A;  5F8P A;  4CI1 B;  3RC8 A;  4YTN A;  2VQE T;  3RGL A;  3LSV A;  3P4W A;  2WDQ A;  1HCI A;  3AEC A;  5AQP B;  2V6Y B;  4IE4 A;  4L5G A;  2CWO A;  2A72 A;  4EB6 E;  1ZV4 X;  3T1Y T;  2X9X A;  2L3L A;  2UUC T;  3FXE B;  1D1B A;  4JV5 T;  2XAJ B;  1HX1 B;  4GOU A;  5JVD E;  1W0B A;  2VKD A;  4U7Y A;  4WBO A;  3RPU A;  1FEW A;  2LOP A;  3NZQ A;  3ZT7 A;  1Z8U A;  3LBX A;  4C90 A;  4PNI A;  2EHO B;  4ERR A;  3AED A;  5IYZ E;  5CGM A;  4YSY A;  3H3A A;  5FXV A;  5FVL A;  3C4Z A;  3I9W A;  2XQ7 A;  3RF1 A;  3AA7 B;  3PV0 F;  4KX6 A;  3UT5 E;  4ZI2 C;  1MIV A;  3Q5D A;  5ABF A;  3SWH A;  1ZKE A;  4TN7 B;  4C91 A;  2RA1 A;  3HR0 A;  5HAX A;  2WSS V;  4HWI B;  2E9X D;  4TZ4 C;  4A97 A;  2ZLY A;  3UUB A;  4E7S A;  4ZI3 D;  2PTF A;  5LXT E;  2BS3 A;  5J0Z A;  4KP3 C;  5DQV A;  4IL9 A;  3CQG B;  1NEK A;  5FYM A;  2LKG A;  2NWB A;  2Y8D A;  1V9D A;  2MTQ A;  1IZN B;  2ZM8 A;  4QH1 A;  2N9D A;  3N9N A;  5AQV B;  2WDV A;  3ZYK A;  1FMV A;  2V7I A;  5L4E A;  5E0O A;  3EDV A;  3UU6 A;  4U3C A;  2HPJ A;  4KHZ F;  5JDN A;  1HR0 T;  2YU1 A;  3JAE A;  2XTL A;  5AQN B;  3J9X 1;  4DV1 T;  3T1H T;  2J1D G;  3K3Q C;  5C3J A;  1U5P A;  1QLB A;  2FJB A;  3UQ7 A;  5ABF B;  5LG3 A;  2XY8 B;  3NRY A;  5ABE A;  4JI1 T;  3RYC E;  3CK6 A;  5HXE A;  2VQF T;  3H37 A;  2PBI A;  4TWH A;  4KI0 F;  2XQ3 A;  5FY0 A;  4HWC A;  4HFI A;  4O4H E;  4ZXL A;  3LJC A;  4QXB B;  3RYH E;  2WDR A;  3B5M A;  3AE3 A;  2XZE A;  3LK3 B;  2AXD S;  3CPZ A;  5DJQ C;  4WW0 A;  3TLS A;  4AKR B;  5CJ5 A;  2JMK A;  3R84 B;  4NUU A;  4LF6 T;  4LF5 T;  3D0T A;  4EIW A;  1BR4 A;  4JI4 T;  1X9B A;  3CWZ B;  4AKL A;  5J2U E;  5JQG E;  1NEN A;  3DJB A;  2KXP B;  2NTX A;  3NBX X;  4PAG A;  3P4R A;  4Z91 A;  4LML A;  3WI3 A;  4ZHQ E;  5LJN A;  3MJX A;  4HFD A;  1H7C A;  4XZC A;  2VWA A;  3V5S A;  2CXD A;  2I6H A;  3NVO A;  3CQX C;  3MAC A;  2QVA A;  4NUV A;  5L3G B;  3B13 A;  4HFC A;  1VOM A;  3R6N A;  5BR8 T;  2MAW A;  4ZZC A;  5AQG B;  2VK9 A;  3ONJ A;  2K3W A;  4QHO A;  3RI5 A;  4O2A E;  3JC6 D;  1MIY A;  2PFV A;  3P7I A;  3ZST A;  2NW7 A;  2FJA A;  2JJ9 A;  2XPK A;  4XBF B;  4CXY A;  2WCA A;  3ANW B;  1HTJ F;  4X66 T;  4ISS A;  4A56 A;  2ZM6 T;  2XSA A;  1UX4 A;  2LJL A;  3S4U A;  3L8R A;  4IE5 A;  3K3O A;  4IDN A;  4P1N A;  4NXN T;  5AQK B;  5HEU A;  4CN6 A;  4AQY T;  2QGS A;  3BK9 A;  2V7K A;  3K8P C;  3F31 A;  3KIN B;  5JR9 C;  2ACZ A;  2X0H A;  2ES0 A;  3OVU A;  2EHO D;  3EVY A;  3VKG A;  2Q9Q C;  4H9P C;  4CQI A;  2H89 A;  4AI6 A;  2ZM2 A;  1XWM A;  5L3E B;  1MIW A;  2CA5 A;  3VHL A;  3FZL B;  1N33 T;  4J2C A;  4DR3 T;  3N2K E;  3FZK B;  3LK2 B;  2XM2 A;  5F5W A;  2JPF A;  3IEE A;  4PK6 A;  3A7M A;  5JDH A;  2BBJ A;  4QH4 A;  3PJA J;  5LHH B;  3EHZ A;  4YJ2 E;  3EAM A;  1KNP A;  3O1H A;  4MBQ A;  4A98 A;  4I50 E;  5JDG A;  1UK5 A;  3F57 A;  2KND A;  3E08 A;  3IBP A;  3PUW F;  2BG9 B;  2W67 A;  4H9S E;  4B3S T;  3JCF A;  4OYK A;  5CA0 E;  3RX6 A;  2WM9 A;  3ZMS B;  2XAF B;  1KNR A;  4MHC A;  2C5J A;  3OKQ A;  1U4Q A;  2HPL A;  4ASK A;  1T72 A;  4IDQ A;  4KHP T;  2BKN A;  1WYC A;  2LLY A;  2HN1 A;  4JBW F;  1WYB A;  2E9X A;  3N9Q A;  2JMH A;  3Q5X A;  5FXZ A;  4LF8 T;  2V1D B;  2W61 A;  1MMG A;  4MLK A;  4ZOL E;  5AQS B;  4WBN E;  3SS1 A;  3NRX A;  4N78 D;  3AEG A;  4JUY A;  1KFY A;  2FJD A;  3QK6 A;  5J1G A;  4O4J E;  4KUM B;  4DR2 T;  2LRL A;  1T8B A;  2VL0 A;  4JI7 T;  2I59 A;  4QX7 B;  2W66 A;  2XSB A;  4EGW A;  2MOZ A;  3ZC0 A;  3PUR A;  3AVS A;  1XNQ T;  3C98 B;  3ZT5 A;  4PJL A;  2CWY A;  2QRX A;  1FIO A;  3FB2 A;  1S94 A;  2YDR A;  2WB5 A;  4IHJ E;  3E0Z A;  3KV6 A;  3BQI A;  2NTY A;  2M6B A;  2V7J A;  3AE6 A;  2VAS A;  3PUZ F;  3G06 A;  5AQL B;  5JDL A;  2XHE B;  3CX7 B;  3N9O A;  3IF8 B;  4GK5 E;  3UU8 A;  3J7Y q;  4YTP A;  3ZMZ B;  4JI8 T;  4OX9 T;  2HN2 A;  2D0U A;  2IHR 1;  3A8Y C;  3QB5 A;  1E1H B;  1CHU A;  3AE5 A;  3OYX A;  4P09 A;  1N32 T;  4U7I A;  2V6X A;  3ZEF B;  1G73 A;  1US7 B;  1MMA A;  4HWH A;  4L9I A;  2IDO B;  3KVB A;  1VRB A;  2V26 A;  1BR1 A;  3O1I A;  3PU3 A;  2UUA T;  2G0U A;  1KK7 A;  2CRB A;  3OJA A;  4BJN A;  3FZF B;  1IAP A;  5FMN A;  4CXW A;  1LKX A;  2C5K T;  1SA0 E;  5L4H A;  3U3I A;  4UR9 A;  4Z90 A;  4I0U A;  3P8C D;  4O4L E;  2E2A A;  2VUR A;  4HEA A;  3RIU C;  3FZM B;  3DP7 A;  4U2Z A;  4JI3 T;  5AQT B;  5M4Y A;  4K0K T;  4I4T E;  1UX5 A;  4MFR A;  2YIN A;  4EOZ B;  4DR7 T;  2IC9 A;  1M62 A;  4OYJ A;  3KV5 A;  3ZN1 B;  4AKH A;  3KV9 A;  3UU5 A;  5AQJ B;  2FJE A;  2LHN A;  4EYY R;  2WMN A;  3ZCJ A;  1UUR A;  3RKG A;  2PG8 A;  4DMV A;  5AQQ B;  2KIN B;  1NWM X;  1OXZ A;  2PJQ A;  4FJO A;  3MZK B;  4IRE A;  3AAI A;  3HKE E;  5AQO B;  2A3D A;  5HEH A;  1SUM B;  1I94 T;  3UU3 A;  3CQC B;  4H9O C;  3I0O A;  2FUP A;  4X20 E;  2LKH A;  3TKL B;  2XJ7 A;  3WAJ A;  3GWH A;  1MMD A;  1UUS A;  2H7V C;  4TUY E;  2W0G A;  5C8Y E;  4QXH B;  3LFM A;  4BJM A;  5KDM C;  2KWI B;  3C4X A;  3L39 A;  4HKA A;  3Q2M A;  1YQ3 A;  4ILC A;  4KMC A;  5F3J A;  3FHN A;  5LHI B;  2V6Y A;  1T7S A;  4DND A;  1JNR A;  2LSJ A;  3IHR A;  4UF0 B;  4ZZB A;  3ZLI A;  2B1E A;  4YTM A;  2H7O A;  3QOF A;  5FNV E;  2XQ8 A;  2UXB T;  2CLY B;  3AB3 B;  1YKH B;  2JQH A;  2NOX A;  3MXZ A;  2XQ4 A;  2ZMA A;  1KF6 A;  1W0A A;  2BVM A;  2XAS B;  4LF9 T;  3QB5 K;  3PUQ A;  4DBR A;  4OK0 A;  1IJ5 A;  2WZH A;  2D9D A;  2NW9 A;  2K5B B;  4EYU A;  2N1G A;  4O2B E;  1D1C A;  2BKO A;  3UFG A;  1W9R A;  3GN5 B;  3HL6 A;  4WZX A;  3TLU A;  4IE0 A;  2BS2 A;  5LNK A;  1ZP0 A;  4TNV A;  2Y48 B;  5FXX A;  2UU9 T;  3AVR A;  3RYF E;  2YDQ A;  4X62 T;  3CIR A;  3ONL C;  4FI5 A;  4DID B;  4DR5 T;  2J47 A;  5KMG P;  2GK9 A;  1FJG T;  3JAF A;  5H6R B;  1E7P A;  3AE2 A;  5HEO A;  2VL8 A;  5AQI B;  3VRB A;  3M65 A;  3RIF A;  4ANJ A;  4CI3 B;  2XUE A;  4P0A A;  2WP9 A;  5JTG A;  4NXM T;  1XNR T;  4Z8X A;  4EZ4 A;  4GKK T;  3AEB A;  5AQF B;  3VR8 A;  2LM9 A;  2V5D A;  2XQ9 A;  2VKJ A;  3PUG A;  3CX6 B;  4DV0 T;  3O1J A;  4EZH A;  5IUX A;  3AAA B;  3KDS E;  4IDZ A;  3VRA A;  5AQR B;  2SPC A;  4EXT A;  3V5U A;  2VKH A;  2RP4 A;  2XAQ B;  3EUH A;  4X1Y E;  3MK7 C;  2L9Q A;  5FVK A;  5JRC B;  2V7L A;  2KSR A;  1UGO A;  1QSD A;  3AEA A;  4BA9 A;  3P4P A;  3I0Q A;  4UXN B;  5AFU L;  4ZI3 C;  4AKG A;  4JI5 T;  2CM0 A;  3ZMU B;  1WR6 A;  2R6G F;  2BBH A;  2UXX B;  2D5U A;  2IIU A;  2JQQ A;  5LHG B;  3I1A A;  4DV6 T;  3K1S A;  4YY3 T;  3QNU A;  3RIA A;  1N36 T;  3I9Y A;  5HXH A;  1J5W A;  1HG5 A;  3ZJ2 A;  5L3D B;  2W4X A;  3EI0 A;  4DV2 T;  5L3F B;  1ZOY A;  2NR4 A;  3ETU A;  3SFE A;  1QUU A;  4DR4 T;  5LCY A;  3PU8 A;  1Y64 B;  4UEL A;  4PK5 A;  5LJM A;  5HCJ A;  3O4X E;  2EHO C;  2X0Y A;  4X5T A;  2BG9 C;  2BG9 E;  4ZI7 E;  3N2O A;  4PK4 A;  4GK0 E;  2IAK A;  3JC6 C;  1Y01 A;  2X9Y A;  2UXN B;  3KFW X;  4HN9 A;  4ZS2 A;  3RKO A;  5FKY A;  3U78 A;  4LF4 T;  2VKO A;  1EZ3 A;  4LFC T;  2KLQ A;  3LK4 2;  1J1J A;  2W00 A;  5EK4 A;  2XQ6 A;  3HKB E;  5LGU B;  4UV8 B;  1UCU A;  3UUN A;  4DMW A;  4X64 T;  4LF7 T;  4GIW A;  2BZB A;  3EAB A;  3N5L A;  1MNE A;  2XQY A;  1HG2 A;  2HH7 A;  4UVA B;  5FP3 A;  2CLY C;  3GN5 A;  1HF8 A;  3IA3 A;  2DWK A;  3BQK A;  3VU7 H;  3C51 A;  4H63 H;  3RC3 A;  2Q9Q B;  5AQU B;  3AE4 A;  1WRD A;  3RH3 A;  5BMV E;  3NWI A;  4MAL A;  1IBM T;  2KWH A;  3OBV E;  4I55 E;  1D0Y A;  5LP6 E;  3LDQ B;  4YLH A;  1B7T A;  4JI0 T;  3ZYL A;  3TLW A;  2X51 A;  3K3N A;  3NZP A;  4G2A A;  5HXS A;  1KNZ A;  4JYA T;  4K0U A;  5KX5 E;  2YU2 A;  1WR0 A;  3UUX B;  2CXL A;  2CBI A;  3SFD A;  3ZJ1 A;  2E9X B;  2WS3 A;  3ANW A;  4UVC B;  1OED B;  4GKJ T;  1KEY A;  3FBZ A;  4TWD A;  1LRZ A;  4UIG A;  5AQM B;  2DWG A;  4DUZ T;  4DV7 T;  1X79 A;  3ESL A;  3RLF F;  3NKZ A;  4DR6 T;  4COF A;  3HI2 A;  1DU2 A;  2ODV A;  1SHZ C;  3PUX F;  2UXC T;  1HNW T;  2W63 A;  3P4S A;  4GYS A;  2E5L T;  2AE9 A;  3UU4 A;  3PUY F;  2VVS A;  3ZC1 A;  4DO0 A;  2HHH T;  3O9X A;  3PUV F;  2WU2 A;  5CFB A;  2JIW A;  4PJN A;  1G8X A;  1S35 A;  2EHO A;  4H63 V;  4HE8 A;  3AEE A;  2CCQ A;  2P9B A;  5FY1 A;  3AE7 A;  4JI2 T;  4ILB A;  1FMW A;  2QA7 A;  1XMQ T;  2LHR A;  2LM2 A;  3AXJ B;  4X1I E;  2JQ9 A;  3ZYM A;  3HKD E;  3ZN0 B;  2QYW A;  1N34 T;  3H3M A;  4TV9 E;  4O8S A;  5LGN B;  5EK2 A;  4B3M T;  2UXD T;  4AQG A;  4WNK A;  2CBJ A;  2YN6 A;  3CKD A;  1L0V A;  4IDP A;  4U72 A;  3UUM A;  5HWX A;  2K24 A;  2LSG A;  2V7M A;  4TNW A;  4QWN B;  5CA1 E;  2ODU A;  4L0R A;  3E22 E;  3FBL A;  4HFE A;  1R8I A;  4LMJ A;  4U2Y A;  5HEJ A;  3PJA A;  4H9R C;  2X66 A;  3A5X A;  5JR9 A;  5L3B B;  5JRC A;  1GQE A;  3BQL A;  2CHO A;  2J4G A;  4U31 A;  3RRC A;  5LOV E;  4HWF A;  1AJ3 A;  3ZMT B;  2C5I T;  1E2A A;  5HXC A;  3M3Z B;  2K9A A;  2VVN A;  2N2N A;  2XAG B;  2Y6X A;  4QKN A;  2CPT A;  3UFE A;  5L2L A;  3AE8 A;  2W62 A;  3AE1 A;  1IJ6 A;  4PJM A;  1YD8 G;  5LBQ B;  3AE9 A;  1MND A;  4CI2 B;  2CXF A;  4IE6 A;  4F8H A;  2IML A;  2XQA A;  3GA8 A;  2WU5 A;  4V1A v;  2YOE A;  5C2T A;  5KXJ A;  1HNX T;  1YKE B;  2H3R A;  2BVL A;  2KMF A;  5LG4 A;  2MPK A;  4AXP A;  1VCS A;  3UUL A;  4ILA A;  3ZKR A;  4UEM A;  2DLR A;  1HFA A;  4LFA T;  4B3T T;  4YXD A;  3KBT A;  5HCM A;  2BDE A;  2JQK A;  4XAX B;  4DV4 T;  1OED A;  2JRK A;  4IT4 A;  1JNZ A;  1LVK A;  4H9Q C;  3B57 A;  4HFV A;  4QX8 B;  2I0M A;  4AIS A;  2X67 A;  3FZH B;  4F6R C;  3HKC E;  2K48 A;  2XM1 A;  1MMN A;  2LSI A;  1YW0 A;  1ZHC A;  3ETV A;  5L47 A;  3SOL A;  4DV5 T;  3RRW A;  1LVF A;  1T98 A;  3C50 A;  2WZI A;  3EDU A;  3WAK A;  4I43 B;  1WCR A;  5HWY A;  4M1P A;  3N9L A;  2Q9Q D;  5EK3 A;  2LEH A;  4A5X A;  3RQU A;  2WWU A;  2YKS A;  3AXJ A;  4IDO A;  2OA5 A;  1HS7 A;  1NAF A;  1BR2 A; 
#chains in the Genus database with same CATH homology
 3QC9 A;  5EZY E;  2LOS A;  3C4W A;  5FY7 A;  4CZZ B;  3QUJ A;  4ILU A;  2WBL A;  5TAO A;  3UTK A;  2MBG A;  2M67 A;  4OHF A;  3VKH A;  1O3X A;  4P0B A;  3CVR A;  2NW8 A;  2YK0 A;  3KV4 A;  4DBQ A;  5ETW A;  4OFZ A;  3DTO A;  5GON E;  4G63 A;  5ADX L;  5JR9 B;  4ZS3 A;  3ZMV B;  4CXX A;  5JDM A;  2DI4 A;  4H9N C;  1ZEE A;  3AA1 B;  2ACX A;  4O4I E;  3ZCI A;  2YEV C;  3RYI E;  3KBU A;  2LE8 A;  3AA6 B;  1WLX A;  3AAE B;  3L09 A;  1D1A A;  5H6Q B;  5J2T E;  2CEA A;  3N2G E;  3N9P A;  3KVA A;  2CMR A;  3OYZ A;  4TX5 A;  2CE7 A;  5LGT B;  3MKD A;  4BAY B;  4JLE A;  2MYS A;  3Q9D A;  4X1K E;  2IW5 B;  3SRZ A;  2KT9 A;  4UV9 B;  5LA6 E;  2X68 A;  2DNX A;  4YHJ A;  2ZM0 A;  2X9H A;  3CX8 B;  4IGU A;  2X0L B;  2D2S A;  3LG7 A;  4TV8 E;  5LBM A;  4IST A;  5JH7 E;  3C64 A;  5FXW A;  2WAU A;  4JEH B;  3PUS A;  1Z0P A;  3PUA A;  3PDY A;  2C0S A;  2LSK A;  3Q5W A;  4HTE A;  3L3P A;  5LYJ E;  1OWA A;  2VB6 A;  1D0Z A;  5JDF A;  5HYA A;  2Z6E A;  5DAB A;  5HXR A;  4B6X A;  5A1L A;  4YJ3 E;  4PFO A;  3GMI A;  4ADZ A;  3MA9 A;  2E9X C;  4UVB B;  4AKI A;  2XAH B;  2D0T A;  4DVD A;  4PJJ A;  5JRE A;  2DCF A;  4PFP A;  4QXC B;  2KZ7 B;  2E8I A;  3LBX B;  4ZI2 D;  2NP9 A;  4GYR A;  2X9W A;  4AQF A;  5L3C B;  4AQF C;  3N9M A;  5CB4 E;  4HGA A;  2IC6 A;  2L8K A;  2A2F X;  4PW8 A;  1CUN A;  3F2E A;  3T8O A;  2DHR A;  4EAH A;  3CML A;  4E7Z A;  3HA4 A;  5IHY A;  3ZPO A;  4IIJ E;  1D0X A;  2LSY A;  3AA0 B;  3PTR B;  2WMO A;  3FXD B;  4IE7 A;  4KBM B;  2LT3 A;  4YFS A;  3W15 B;  4UF0 A;  2Q9Q A;  4U74 A;  5JDQ A;  3PE0 A;  5DQW A;  3ONX A;  4JEU B;  1HX8 A;  5F8P A;  4CI1 B;  3RC8 A;  1HCI A;  4IE4 A;  4L5G A;  2CWO A;  2A72 A;  4EB6 E;  1ZV4 X;  2X9X A;  2L3L A;  3FXE B;  1D1B A;  2XAJ B;  4GOU A;  5JVD E;  3RPU A;  2VKD A;  4WBO A;  4C90 A;  1FEW A;  2LOP A;  3NZQ A;  4ERR A;  3LBX A;  4PNI A;  2EHO B;  5IYZ E;  3H3A A;  5FXV A;  3C4Z A;  3I9W A;  3UT5 E;  3AA7 B;  4ZI2 C;  1MIV A;  3SWH A;  1ZKE A;  4TN7 B;  4C91 A;  2RA1 A;  3HR0 A;  5HAX A;  2WSS V;  2E9X D;  4TZ4 C;  4E7S A;  2ZLY A;  4ZI3 D;  5LXT E;  4KP3 C;  5DQV A;  3CQG B;  5FYM A;  2NWB A;  2Y8D A;  1V9D A;  2MTQ A;  1IZN B;  2ZM8 A;  2N9D A;  3N9N A;  3ZYK A;  1FMV A;  2V7I A;  5E0O A;  3EDV A;  2HPJ A;  5JDN A;  2YU1 A;  2XTL A;  3J9X 1;  2J1D G;  3K3Q C;  1U5P A;  3NRY A;  3RYC E;  5HXE A;  3H37 A;  2PBI A;  5FY0 A;  4O4H E;  3LJC A;  4QXB B;  3RYH E;  5DJQ C;  3LK3 B;  5HXS A;  3CPZ A;  4WW0 A;  4AKR B;  2JMK A;  3R84 B;  4NUU A;  3D0T A;  4EIW A;  1BR4 A;  3VKG A;  3CWZ B;  4AKL A;  5JQG E;  5J2U E;  3DJB A;  2KXP B;  2NTX A;  3NBX X;  4PAG A;  4ZHQ E;  5LJN A;  3WI3 A;  3MJX A;  4XZC A;  1H7C A;  3V5S A;  2VWA A;  2CXD A;  3CQX C;  3MAC A;  4NUV A;  5L3G B;  3B13 A;  1VOM A;  3R6N A;  2VK9 A;  4QHO A;  4O2A E;  3JC6 D;  1MIY A;  2PFV A;  3P7I A;  2NW7 A;  2JJ9 A;  3ANW B;  1HTJ F;  4ISS A;  4A56 A;  1UX4 A;  2LJL A;  3S4U A;  4IE5 A;  3K3O A;  2QGS A;  3BK9 A;  2V7K A;  3K8P C;  3F31 A;  3KIN B;  5JR9 C;  2ES0 A;  2EHO D;  3EVY A;  2Q9Q C;  4H9P C;  4CQI A;  4AI6 A;  2ZM2 A;  5L3E B;  1MIW A;  2CA5 A;  3VHL A;  4J2C A;  3N2K E;  3LK2 B;  2JPF A;  3IEE A;  4PK6 A;  5JDH A;  5LHH B;  4YJ2 E;  4MBQ A;  3O1H A;  4I50 E;  5JDG A;  3F57 A;  2KND A;  3E08 A;  3IBP A;  4H9S E;  5CA0 E;  4OYK A;  3RX6 A;  2WM9 A;  3ZMS B;  2XAF B;  4MHC A;  2C5J A;  3OKQ A;  1U4Q A;  2HPL A;  4ASK A;  1WYC A;  1WYB A;  2E9X A;  3N9Q A;  2JMH A;  3Q5X A;  5FXZ A;  2V1D B;  2W61 A;  1MMG A;  4MLK A;  4ZOL E;  4WBN E;  3SS1 A;  3NRX A;  4N78 D;  4JUY A;  3QK6 A;  5J1G A;  4O4J E;  4KUM B;  2I59 A;  4QX7 B;  2MOZ A;  3ZC0 A;  3PUR A;  3AVS A;  3C98 B;  4PJL A;  2CWY A;  1FIO A;  3FB2 A;  1S94 A;  4IHJ E;  3E0Z A;  3KV6 A;  3BQI A;  2NTY A;  2V7J A;  2VAS A;  2XHE B;  3CX7 B;  3N9O A;  3IF8 B;  4GK5 E;  3J7Y q;  3ZMZ B;  4P09 A;  2D0U A;  1E1H B;  3OYX A;  3ZEF B;  1G73 A;  1US7 B;  1MMA A;  4L9I A;  3KVB A;  1VRB A;  2V26 A;  1BR1 A;  3O1I A;  3PU3 A;  2G0U A;  1KK7 A;  3OJA A;  4BJN A;  1IAP A;  5FMN A;  4CXW A;  1LKX A;  2C5K T;  1SA0 E;  3U3I A;  4EYY R;  3P8C D;  4O4L E;  4HEA A;  3DP7 A;  5M4Y A;  4I4T E;  1UX5 A;  4MFR A;  2YIN A;  4EOZ B;  2IC9 A;  4OYJ A;  3KV5 A;  3ZN1 B;  4AKH A;  3KV9 A;  2LHN A;  2WMN A;  3ZCJ A;  2PG8 A;  4DMV A;  2KIN B;  1NWM X;  1OXZ A;  2PJQ A;  4FJO A;  3MZK B;  3AAI A;  3HKE E;  2A3D A;  3CQC B;  4H9O C;  3I0O A;  4X20 E;  3TKL B;  3WAJ A;  3GWH A;  1MMD A;  2H7V C;  4TUY E;  2W0G A;  5C8Y E;  4QXH B;  3LFM A;  4BJM A;  5KDM C;  2KWI B;  3C4X A;  4HKA A;  3Q2M A;  5F3J A;  4KMC A;  5LHI B;  3FHN A;  4DND A;  4UF0 B;  2LSJ A;  3IHR A;  3ZLI A;  2B1E A;  2H7O A;  5FNV E;  2CLY B;  3AB3 B;  1YKH B;  2NOX A;  3MXZ A;  2ZMA A;  2BVM A;  2XAS B;  4XBF B;  4DBR A;  3PUQ A;  4OK0 A;  1IJ5 A;  2NW9 A;  4EYU A;  5JDL A;  2K5B B;  2N1G A;  4O2B E;  1D1C A;  5LNK A;  3GN5 B;  3HL6 A;  4IE0 A;  2Y48 B;  5FXX A;  3AVR A;  3RYF E;  4FI5 A;  5KMG P;  2GK9 A;  5H6R B;  2VL8 A;  4ANJ A;  3M65 A;  4CI3 B;  4P0A A;  2XUE A;  4Z8X A;  4EZ4 A;  2LM9 A;  2VKJ A;  3PUG A;  3CX6 B;  3O1J A;  4EZH A;  3AAA B;  3KDS E;  4IDZ A;  2SPC A;  4EXT A;  3V5U A;  2VKH A;  2RP4 A;  2XAQ B;  3EUH A;  4X1Y E;  3MK7 C;  2L9Q A;  5JRC B;  2V7L A;  1QSD A;  4BA9 A;  3I0Q A;  4UXN B;  5AFU L;  4ZI3 C;  4AKG A;  3ZMU B;  2CM0 A;  1WR6 A;  2UXX B;  2D5U A;  5LHG B;  2JQQ A;  3I1A A;  3I9Y A;  5HXH A;  1HG5 A;  3ZJ2 A;  5L3D B;  5L3F B;  3ETU A;  1QUU A;  5LCY A;  3PU8 A;  1Y64 B;  4UEL A;  4PK5 A;  5LJM A;  3O4X E;  2EHO C;  4ZI7 E;  3N2O A;  4PK4 A;  4GK0 E;  2IAK A;  3JC6 C;  2X9Y A;  3KFW X;  2UXN B;  4HN9 A;  4ZS2 A;  3RKO A;  3U78 A;  2VKO A;  1EZ3 A;  2KLQ A;  3LK4 2;  2W00 A;  5EK4 A;  3HKB E;  5LGU B;  4UV8 B;  1UCU A;  3UUN A;  4DMW A;  4GIW A;  2BZB A;  3N5L A;  1MNE A;  2XQY A;  1HG2 A;  2HH7 A;  4UVA B;  5FP3 A;  2CLY C;  3GN5 A;  1HF8 A;  2DWK A;  3BQK A;  3VU7 H;  3C51 A;  4H63 H;  3RC3 A;  2Q9Q B;  1WRD A;  3RH3 A;  5BMV E;  4MAL A;  2KWH A;  3OBV E;  4I55 E;  1D0Y A;  5LP6 E;  4YLH A;  1B7T A;  3ZYL A;  2X51 A;  3K3N A;  3NZP A;  4G2A A;  1KNZ A;  4K0U A;  5KX5 E;  2YU2 A;  3UUX B;  2CXL A;  3ZJ1 A;  2E9X B;  3ANW A;  4UVC B;  3FBZ A;  4UIG A;  1LRZ A;  2DWG A;  1X79 A;  3ESL A;  3HI2 A;  2ODV A;  1SHZ C;  2W63 A;  4GYS A;  3ZC1 A;  4DO0 A;  3O9X A;  4PJN A;  1G8X A;  1S35 A;  2EHO A;  4H63 V;  4HE8 A;  2CCQ A;  2P9B A;  5FY1 A;  1FMW A;  2QA7 A;  2LHR A;  4X1I E;  3ZYM A;  3HKD E;  3ZN0 B;  4TV9 E;  4O8S A;  5LGN B;  5EK2 A;  4AQG A;  4WNK A;  3CKD A;  4U72 A;  3UUM A;  5HWX A;  2K24 A;  2LSG A;  2V7M A;  4QWN B;  5CA1 E;  2ODU A;  4L0R A;  3E22 E;  3FBL A;  4H9R C;  5L3B B;  2X66 A;  3A5X A;  5JR9 A;  5JRC A;  3BQL A;  3RRC A;  1AJ3 A;  5LOV E;  3ZMT B;  2C5I T;  5HXC A;  2K9A A;  2N2N A;  2XAG B;  2Y6X A;  4QKN A;  3UFE A;  5L2L A;  2W62 A;  1IJ6 A;  4PJM A;  1YD8 G;  5LBQ B;  4CI2 B;  1MND A;  2CXF A;  4IE6 A;  4CXY A;  4V1A v;  3GA8 A;  1YKE B;  2H3R A;  2BVL A;  2KMF A;  5LG4 A;  4AXP A;  3UUL A;  4UEM A;  2DLR A;  1HFA A;  3KBT A;  2BDE A;  4XAX B;  1BR0 A;  2JRK A;  1LVK A;  4H9Q C;  4HFV A;  3B57 A;  4QX8 B;  2X67 A;  4F6R C;  3HKC E;  2K48 A;  1MMN A;  2LSI A;  1YW0 A;  1ZHC A;  3ETV A;  3SOL A;  3RRW A;  1LVF A;  1T98 A;  3C50 A;  3EDU A;  3WAK A;  4I43 B;  5HWY A;  4M1P A;  3N9L A;  2Q9Q D;  5EK3 A;  2LEH A;  2WWU A;  2OA5 A;  1HS7 A;  1NAF A;  1BR2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...