3TKLB

Crystal structure of the gtp-bound rab1a in complex with the coiled-coil domain of lida from legionella pneumophila
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
192
structure length
192
Chain Sequence
SEELSLSEINEKMKAFSKDSEKLTQLMEKHKGDEKTVQSLQREHHDIKAKLANLQVLHDAHTGKKSYVNEKGNPVSSLKDAHLAINKDQEVVEHKGQFYLLQKGQWDAIKNDPAALEKAQKDYSQSKHDLATIKMEALIHKLSLEMEKQLETINDLIMSTDPKENEEATKLLHKHNGLNLKLANLQDMLAVH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural insights into a unique Legionella pneumophila effector LidA recognizing both GDP and GTP bound Rab1 in their active state
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport/protein binding
molecule keywords Ras-related protein Rab-1A
total genus 76
structure length 192
sequence length 192
ec nomenclature
pdb deposition date 2011-08-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.90 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3tklB01
3MXZA 4CQIA 1IJ6A 2X9XA 2K48A 3N5LA 2IC6A 1IJ5A 3FXEB 3CKDA 4J2CA 4FI5A 3QK6A 2X9YA 2KWIB 2XTLA 2C5KT 2C5IT 3CVRA 2MBGA 4EYYR 3QUJA 1Z0PA 2G0UA 2CA5A 3S4UA 3L3PA 3P7IA 1ZKEA 3TKLB 4L0RA 4DNDA 2C5JA 4B6XA 1QSDA 1H7CA 3FXDB 1LRZA 2IC9A 1LVFA 2X9WA 2KWHA
chains in the Genus database with same CATH superfamily
3HKCE 2CHNA 3VHLA 5LJNA 2E9XD 2XZEA 1J1JA 4IREA 4F8HA 3NRYA 4UIGA 5IUXA 4GKKT 3EAMA 4HFBA 4DO0A 3ZT7A 3WAJA 2CXDA 4WBOA 5LHHB 3OTOT 2JQKA 2BG9C 1YKEB 2KINB 3KV9A 4G2AA 2VASA 4CXXA 5HXEA 5HEHA 5J0ZA 2ODUA 3Q5WA 1YD8G 2BKNA 4QXCB 4QH4A 5LYJE 3KBTA 3NZQA 5JQGE 4YFSA 3AA7B 3QOFA 1Z0PA 3MZKB 3P4RA 3RIFA 4U2ZA 1VCSA 3AAAB 3AEAA 3S4UA 2H88A 4A98A 2XM1A 5LCYA 5L3BB 4DNDA 1HNWT 4IL9A 5L4EA 3SWHA 3IBPA 1N36T 2UU9T 4TNVA 3ZMTB 1W09A 4ZI7E 1SA0E 1MIWA 3C4ZA 2X9WA 3NBXX 3UFGA 3RLFF 5FNVE 5KX5E 4ZI2C 5AQPB 2D0UA 2VKJA 3N5LA 3ANWA 4EYUA 2IC6A 2M67A 2WBLA 3N2KE 2LHRA 2KXPB 3FZMB 4JBWF 1UK5A 4N78D 3N9MA 4U2YA 5BR8T 3FZHB 4HEAA 5FY1A 3T1YT 5AQFB 2IMLA 1D0XA 4K0KT 2ZM6T 2KWIB 3CVRA 1ZHCA 4AKRB 1QLBA 4P1NA 3LFMA 2VWAA 3U78A 2XSAA 1R8IA 4CN1A 3MJXA 2DWGA 3JC6D 1GQEA 4ZEYA 2WQYA 3N2GE 3FZFB 4B3MT 2MAWA 4O4HE 3DTOA 4JEHB 5TAOA 3RQUA 3CX6B 2XUEA 4PK6A 1LRZA 3UT5E 3ZJ2A 2H7VC 1XDPA 3UU5A 4YSXA 2F4VT 2W4XA 1KNPA 3Q5EA 4MHCA 2K48A 2V7IA 3N9QA 4IDZA 4AI6A 3H3MA 2V26A 5BMVE 4GOUA 4EGWA 3B5MA 1MMDA 2BKPA 3CQCB 2XTLA 1Z8UA 1AJ3A 3SFDA 3HKBE 3K3QC 5EK2A 3M65A 5CB4E 4B3TT 4ILCA 2WS3A 3GWHA 3EABA 3O1IA 4IE4A 3WAKA 4DV6T 4NXNT 5M4YA 2V5CA 4HFVA 3ESLA 5AQTB 4AQFC 2XQYA 2Z6EA 4TV9E 3TLTA 5HYAA 5J2TE 5AFUL 1DU2A 1KF6A 3BQLA 1V9DA 4AXPA 2BDEA 2RP4A 3D0TA 1MMAA 2V7JA 1LVFA 2E8IA 5JDLA 3LBXA 3AEBA 4TZ4C 5LB7B 2X9XA 3ZMVB 2CHOA 3VKGA 2I0MA 1ZEEA 2ODVA 1NWMX 3FXEB 2V6XA 4AIUA 2LRKA 2V5DA 3L39A 2WSSV 4ZS3A 4LMKA 5AQKB 4ZXLA 5LGNB 4HWCA 3SFEA 4X64T 2MOZA 2LHNA 4P09A 1X79A 4EXTA 3UU8A 2LT3A 2C5IT 1M7KA 3CQXC 2V8SV 4QX7B 2J1DG 3E22E 4X65T 4PK4A 2UUCT 3ABVA 3F2EA 4QH5A 2Q9QD 3P4WA 2KZ7B 2E9XB 4ZHQE 2KNDA 3ETUA 5HXSA 5HEOA 2ZM2A 2L3LA 1HG5A 1ZKEA 3P7IA 1OEDA 2ZLYA 4HFIA 3JC6C 4IE5A 1QUUA 4QHOA 5AQQB 4YT0A 4B6XA 2NW7A 1QSDA 4WW0A 5LMNT 2ES0A 2N1GA 4DR2T 3WI3A 2EHOA 4L9IA 1FEWA 4F6RC 3CPZA 4YTMA 5AQIB 3OJAA 2L8KA 5FL1A 5FMNA 3QB5A 3AVSA 4E7SA 1N34T 3ZCIA 1HTJF 2QYWA 4DR6T 3ZEFB 2W63A 3AA0B 4HFCA 3E0ZA 4TNWA 3TLSA 2LKGA 3MKDA 4O8SA 1O3XA 1MMNA 5L2LA 4DVDA 4PNIA 2UUBT 3PV0F 2K24A 2W66A 4JI6T 1MNEA 2AXDS 2XHEB 1OXZA 4CN4A 3UFEA 4ISSA 4YHJA 4YTPA 1J5WA 2C5KT 2JPFA 2KLQA 2X66A 3ONXA 1UGOA 1KK7A 2X68A 3FHNA 4TX5A 5LA6E 3RRWA 4DBQA 4CXYA 4DV3T 3IF8B 3AXJB 3OYZA 1IAPA 3ZC1A 3IA3A 4U74A 2VL0A 3FBZA 3NZPA 4IDOA 3RC3A 1HX8A 3ZCJA 5JREA 1WYBA 4H63V 4H9QC 3F31A 3LBXB 1FMWA 4EAHA 2IUBA 2KSRA 2LOPA 5AQNB 3W15B 5JR9B 3O1JA 2XQ8A 4UELA 2B76A 3AA1B 3Q2MA 4FJOA 4UF0B 2XAJB 4X20E 4DV5T 3RPUA 2CRBA 4CXWA 5LP6E 4NXMT 3GN5A 3CIRA 2MPKA 3I9WA 1UX5A 4IDPA 4MALA 2IDOB 5FXVA 4GYSA 4HTEA 5IYZE 4C91A 1HNXT 4DR7T 5AQLB 1KNRA 2LOSA 1YKHB 4PJMA 2D9DA 2XQAA 5LG4A 5LGTB 4WZXA 4I4TE 1FJGT 5LJMA 1S94A 4KHPT 3RF1A 3AE4A 5AQRB 5FXWA 3Q5XA 3ZSTA 4AQFA 4DV1T 3RC8A 3NKZA 2V7LA 3UQ7A 4ZS2A 5HEJA 5KDMC 3C50A 3QUJA 3K1SA 4JI2T 3Q5DA 1M62A 2LSYA 4L5GA 4HWIB 5AQVB 4ISTA 3ZYKA 5CA0E 1WRDA 2VVNA 3KINB 2PG8A 4X5TA 3ZN1B 5H6QB 4ADZA 5JDQA 4H9NC 2X51A 3GMIA 1T72A 4Z8XA 4B3RT 2KMFA 4HKAA 4LF9T 3ONLC 2K9AA 2VK9A 3KBUA 2H89A 3RYCE 2BG9A 2SPCA 2WP9A 3P8CD 1W9RA 2LRLA 4PJNA 1IBKT 3A8YC 2V7MA 3Q9DA 4PK5A 2XY8B 4IT4A 4U31A 3KFWX 1BR1A 2WDQA 2WCAA 2CXLA 3ZMZB 1IJ6A 2YKSA 4DV0T 2YDQA 2LE8A 4UEMA 4GYRA 4DUZT 2NP9A 2NTYA 3HKEE 1S35A 3CQGB 4CI2B 3EI0A 1D1BA 1SUMB 4KP3C 2XQ9A 4AKGA 1IBMT 2QGSA 3QK6A 2VVSA 2X9YA 3CK6A 3PU8A 4YJ3E 3JAFA 3J9X1 4JI0T 3T8OA 3BQKA 3RYFE 5E0OA 3OPCA 3EUHA 1CHUA 3VRAA 1FMVA 4DMWA 2UXBT 4U3CA 3N9LA 5FL0A 1N32T 1T98A 4OFZA 2XAFB 4KBMB 2D0TA 5HCJA 4HWFA 3T1HT 4IE0A 5LG3A 5DABA 2Y6XA 3RIUC 4BAYB 5ADXL 5LOVE 3GN5B 3V5UA 2OA5A 2XAGB 3AE3A 2K3WA 2K5BB 1NENA 3P4SA 4UF0A 4HE8A 2YU1A 5KXJA 2ACXA 4M1PA 3RI5A 4IGUA 5JR9A 1XNRT 3ZC0A 4LFBT 2W61A 4JLEA 2UXXB 2IHR1 4DIDB 4A97A 3P4QA 4P0BA 2DWKA 4IL4A 4QXHB 5FYMA 2IW5B 1LKXA 3GA8A 3AE5A 3DJBA 4LMJA 3LSVA 4PFOA 4DV2T 4GIWA 1HF8A 3X1DA 3I9YA 2HHHT 2UXCT 1HCIA 4QXBB 3QNUA 2XM2A 4A5XA 3L3PA 5KMGP 2XPKA 3ZLIA 2CLYB 2CWOA 2W67A 5LGUB 4JI3T 4TWFA 2CPTA 4ZOLE 4BJNA 2NR4A 2VKOA 3RKOA 1WR0A 2RPAA 1I94T 1WLXA 3UULA 5DQWA 2W2UA 1NAFA 2EHOB 2XJ7A 4O4IE 4PFPA 2XQ4A 2YDSA 3N9OA 3UU3A 3VR9A 4DBRA 4AQGA 5JTGA 5LNKA 2E9XC 4IDQA 4PJLA 3BQIA 5L47A 4PW8A 2FJAA 4O2BE 2FUPA 4YY3T 4DUYT 4I43B 1IJ5A 1YQ4A 2M6BA 4XAXB 5AQUB 2IAKA 4ZZCA 1OWAA 4HFEA 2QA7A 4JI7T 5HEUA 4LF4T 3K3NA 1D1CA 2MYSA 4OYKA 2M6IA 1JNRA 1W0BA 5JDGA 2Y48B 2BVMA 2AE9A 4V1Av 4EOZB 3IHRA 1CUNA 1UX4A 1EZ3A 2A72A 3AE6A 3KVAA 2Q9QC 4KMCA 4NUVA 3C4XA 2HN2A 4IDNA 4EIWA 4ZZBA 4X62T 4X66T 1BR4A 4LF6T 2YEVC 5FVLA 2CMRA 5HEGA 2RA1A 4TWHA 4BJMA 2BVLA 4I55E 3PUVF 4EZHA 2WB5A 4HWDA 1HS7A 4QWNB 2L9QA 4XZCA 3NRXA 5FP3A 2DHRA 3ETVA 2WY2A 4EB6E 3LK42 2WDVA 2VQFT 2VL8A 2W0GA 5L4HA 4JUYA 1XWMA 2YK0A 4MLKA 4EV6A 2BKOA 1ZV4X 4GK0E 2CEAA 4CN6A 2JQ9A 5C3JA 3EDVA 5JDFA 1BR0A 4LFCT 3PUZF 4U33A 2XSBA 3VRBA 3AE8A 2J47A 1E2AA 2JIWA 2MTQA 5EK3A 3KV4A 3RKGA 3AECA 3VKHA 4BA9A 4CZZB 4LF8T 5HXHA 2V6YA 3NWIA 5FVKA 3PTRB 4DR3T 5EZYE 1L0VA 2FJDA 2H3RA 4KX6A 1OEDC 1U4QA 3MA9A 4IHJE 2LM2A 4L0RA 4WNKA 3B57A 3EVYA 2FBWA 2XAQB 2X9HA 5F8PA 2X0HA 2JJ9A 2YDRA 1FIOA 2JMHA 4HFDA 3RIAA 2OLTA 2BG9B 2N9DA 2E2AA 3RRCA 3I0QA 3ZSSA 5LBQB 4UXNB 3VR8A 1HNZT 1XNQT 4LF7T 4I0UA 3AVRA 3AB3B 3PDYA 4COFA 4B3ST 3OBVE 3MACA 2LSIA 3KVBA 5F3JA 4HN9A 5EK4A 5LMUT 4TWDA 2X67A 4NPPA 3RH3A 3RYHE 4TUYE 5FY0A 3U3IA 2YINA 3KV5A 3SOLA 2LEHA 4EYYR 5JH7E 2WDRA 2CWYA 4KI0F 4YSZA 4DR5T 2DLRA 4C90A 2LJLA 1G73A 3C51A 5JDMA 4JI8T 4YJ2E 2DNXA 3C64A 3NVOA 2W62A 3PUQA 5AQSB 4YSYA 3JADA 2V1DB 3RQWA 4EEDA 1KNZA 4AKHA 3TKLB 2UXNB 3G06A 5H6RB 4LFAT 3OKQA 2N2NA 3HL6A 4HGAA 1ZOYA 1US7B 4MFRA 4PAGA 5F5WA 2A3DA 3LDQB 4Z90A 2JMKA 3FXDB 4O4JE 4KHZF 5HCMA 1G8XA 3AE9A 5HXCA 4YXDA 4DV7T 4YHHT 3PURA 1IBLT 2KT9A 5C2TA 4AQYT 3A5XA 4Z91A 3HR0A 2ZMAA 2BBJA 3SRZA 2Y8DA 3AEFA 5JR9C 1MMGA 1ZP0A 5FY7A 5HWXA 5ABFA 3ZYLA 3AXJA 2HH7A 2H7OA 2WU2A 3CMLA 2C0SA 1WCRA 2DI4A 3PE0A 4FI5A 5AQOB 3ZN0B 3AA6B 4KUMB 2XQ3A 2R6GF 2V7KA 1LVKA 3AE2A 2I59A 3KV6A 4QH1A 3R6NA 4A56A 1SHZC 5C8YE 2JQQA 4JI5T 4UVAB 1YW0A 2HPLA 2BBHA 2XQ6A 2VURA 1KEYA 1T7SA 1B7TA 1MIYA 2HN1A 1XDOA 3AEGA 4Q25A 3PUWF 5ABHA 3CX8B 2D5UA 5AQHB 4ZI3D 5IHYA 3H37A 1Y01A 4U72A 2I6HA 2WAUA 4JV5T 3PU3A 2C5JA 2XAHB 4LMLA 4E7ZA 4X1KE 2JRKA 5GONE 2BS4A 2WWVA 3UQ4A 5LHIB 4LF5T 4AKIA 2WZIA 4JEUB 4MBQA 3FZLB 3AAEB 1SE7A 3EHZA 5DJQC 5L3DB 5LHGB 2CLYC 2KWHA 2WMNA 2WZHA 5ABEA 2DL1A 3QB5K 4AISA 5ABFB 1U5PA 4DR4T 1E7PA 2LSJA 2X0YA 1XMQT 1VOMA 3TLVA 3HA4A 4OHFA 2XQ7A 3ZT5A 2XQ5A 1WYCA 4ZI2D 5JDHA 2ZM0A 3F57A 3LG7A 4ILUA 2PFVA 4U7IA 1MNDA 2QRXA 3A7MA 3K8PC 3UUXB 3UU4A 4ERRA 4DMVA 3PUAA 3IEEA 5CGMA 4H9PC 1KFYA 1YXRA 1Y64B 3LK2B 2CCQA 2VKHA 3UUBA 3ZPOA 2W00A 2BS2A 1T8BA 2LLYA 3I1AA 3RHWA 2B1EA 4ZI3C 4ASKA 5L3GB 3SS1A 2IC9A 5JRCA 3HKDE 5ETWA 3AAIA 3TLUA 3UUMA 4TV8E 2J62A 1BR2A 3ZMSB 5ABGA 4CQIA 4IE7A 4HFHA 4ILAA 4UV9B 3V5SA 4CI1B 4H9SE 4OYJA 2YOEA 5HWYA 3ZMUB 5L3CB 5L3FB 2PTFA 2LM9A 3N9PA 2EHOD 2PJQA 2NW8A 3PUSA 4J2CA 4NIQA 1NEKA 4H63H 4UVBB 5DQVA 3UUNA 1J5ET 4UR9A 4WYVA 3MK7C 4EZ4A 2HPJA 2IIUA 4UV8B 3PUXF 4DV4T 4GK5E 4H9OC 4IIJE 5FKYA 1IZNB 2DCFA 5JVDE 2Q9QA 4OK0A 4O4LE 3H3AA 2BG9E 1MIVA 2J4GA 3JCFA 1E1HB 3ONJA 3P50A 3C4WA 5L3EB 5AQGB 5J1GA 5CA1E 4JI1T 3C98B 3EDUA 2CBIA 3K3OA 2CM0A 2WMOA 3CX7B 3PJAJ 4O2AE 3PUYF 2WWUA 4WBNE 1I6ZA 4UVCB 1VCTA 4ILBA 2OV9A 3ZT6A 5AQMB 1HR0T 1XZYA 1OEDB 5FXXA 4U7YA 3PUGA 3RYIE 5FXZA 2ACZA 1XMOT 4HWHA 2GK9A 2E9XA 2FJEA 2QVAA 3BK9A 3L09A 3N2OA 4G63A 1HX1B 5HAXA 3O1HA 3J7Yq 2V6YB 3OYXA 2EHOC 3RX6A 1UUSA 2NOXA 3CKDA 3DP7A 3HI2A 5A1LA 3LK3B 4DR1T 1UCUA 4EEBA 3L8RA 2XASB 2BS3A 4P0AA 4I50E 3ZJ1A 2A2FX 2MBGA 1HFAA 2LSGA 3OVUA 4CI3B 5CFBA 5IWAT 1X9BA 2WU5A 3QC9A 2NWBA 2VB6A 3AE1A 2YN6A 3TLWA 5LXTE 3FB2A 2JQHA 3LJCA 4X1IE 3VU7H 4ANJA 5J2UE 2D2SA 2FJBA 3N9NA 3AEDA 1JNZA 5JRCB 3AE7A 5LBMA 5CJ5A 2LKHA 2BZBA 4X1YE 3FZKB 3MXZA 2CE7A 4TN7B 4JI4T 1YQ3A 3P4PA 2Q9QB 5HXRA 1N33T 4JYAT 1D1AA 1WR6A 1WFDA 3E08A 2A9UA 4YLHA 3ZKRA 2WM9A 1W0AA 2CBJA 2CXFA 4H9RC 1D0YA 1HG2A 4QKNA 5JDNA 2YU2A 2VQET 3RIUA 2X0LB 3O9XA 4NUUA 2G0UA 4GKJT 3UTKA 1VRBA 2E5VA 2P9BA 2PBIA 4XBFB 2CA5A 3KDSE 3ANWB 3UU6A 1D0ZA 3AEEA 4IE6A 4AKLA 4YTNA 2NW9A 3PJAA 3B13A 3ZYMA 1H7CA 1OEDE 1UURA 3JAEA 4QX8B 5AQJB 2E5LT 2VKDA 3I0OA 3M3ZB 4K0UA 3RGLA 3R84B 2UXDT 2LSKA 2ZM8A 3O4XE 3CWZB 2UUAT 4PJJA 3FBLA 4OX9T 2NTXA
chains in the Genus database with same CATH topology
3HKCE 3VHLA 5LJNA 2E9XD 3NRYA 4UIGA 4DO0A 3WAJA 2CXDA 4WBOA 5LHHB 5HXEA 1YKEB 2KINB 3KV9A 4G2AA 2VASA 4CXXA 2ODUA 3Q5WA 1YD8G 4QXCB 5LYJE 3KBTA 3NZQA 5JQGE 4YFSA 3AA7B 1Z0PA 3MZKB 3AAAB 3S4UA 5LCYA 4DNDA 3SWHA 3IBPA 3ZMTB 4ZI7E 1SA0E 1MIWA 3C4ZA 2X9WA 3NBXX 5FNVE 5KX5E 4ZI2C 4EYUA 2D0UA 2VKJA 3N5LA 3ANWA 2IC6A 2M67A 2WBLA 3N2KE 2LHRA 2KXPB 4N78D 3N9MA 4HEAA 5FY1A 1D0XA 2KWIB 3CVRA 1ZHCA 4AKRB 3LFMA 2VWAA 3U78A 3MJXA 2DWGA 3JC6D 3N2GE 4O4HE 3DTOA 4JEHB 5TAOA 3CX6B 2XUEA 4PK6A 1LRZA 3UT5E 3ZJ2A 2H7VC 4MHCA 2K48A 2V7IA 3N9QA 4IDZA 4AI6A 2V26A 5BMVE 4GOUA 1MMDA 3CQCB 2XTLA 1AJ3A 3HKBE 3K3QC 5EK2A 3M65A 5CB4E 3GWHA 3O1IA 4IE4A 3WAKA 5M4YA 4HFVA 3ESLA 4AQFC 2XQYA 2Z6EA 4TV9E 5HYAA 5J2TE 5AFUL 3BQLA 1V9DA 4AXPA 2BDEA 2RP4A 3D0TA 1MMAA 2V7JA 1LVFA 2E8IA 5JDLA 3LBXA 4TZ4C 2X9XA 3VKGA 1ZEEA 2ODVA 1NWMX 3FXEB 4ZS3A 2WSSV 5LGNB 2MOZA 2LHNA 4P09A 1X79A 4EXTA 2LT3A 2C5IT 3CQXC 4QX7B 2J1DG 3E22E 4PK4A 3F2EA 5HXSA 2Q9QD 4ZHQE 2KZ7B 2E9XB 2KNDA 3ETUA 2ZM2A 2L3LA 1HG5A 1ZKEA 3P7IA 4IE5A 2ZLYA 4QHOA 3JC6C 1QUUA 4B6XA 2NW7A 1QSDA 4WW0A 2ES0A 2N1GA 3WI3A 2EHOA 4L9IA 1FEWA 4F6RC 3CPZA 3OJAA 2L8KA 5FMNA 4E7SA 3AVSA 3VKHA 3ZCIA 1HTJF 3ZEFB 2W63A 3AA0B 3E0ZA 3MKDA 4O8SA 1O3XA 1MMNA 5L2LA 4DVDA 4PNIA 2K24A 1MNEA 2XHEB 1OXZA 3UFEA 4ISSA 4YHJA 2C5KT 2JPFA 2KLQA 2X66A 3ONXA 4TX5A 1KK7A 2X68A 3FHNA 5LA6E 4DBQA 3RRWA 4CXYA 3IF8B 3ZC1A 3OYZA 1IAPA 4U74A 3FBZA 3NZPA 3RC3A 5JREA 1HX8A 3ZCJA 1WYBA 4H63V 4H9QC 3F31A 3LBXB 1FMWA 4EAHA 2LOPA 3W15B 5JR9B 3O1JA 4UELA 3AA1B 3Q2MA 4FJOA 4UF0B 2XAJB 4X20E 3RPUA 4CXWA 5LP6E 3GN5A 3I9WA 1UX5A 4C91A 4MALA 5FXVA 5IYZE 4GYSA 4HTEA 2LOSA 1YKHB 4PJMA 5LG4A 5LGTB 4I4TE 5LJMA 1S94A 4AQFA 5FXWA 3RC8A 3Q5XA 2V7LA 4ZS2A 5KDMC 3C50A 3QUJA 3ZYKA 2LSYA 4L5GA 4ISTA 5CA0E 1WRDA 3KINB 2PG8A 3ZN1B 4ADZA 5H6QB 5JDQA 4H9NC 2X51A 3GMIA 4Z8XA 2KMFA 4HKAA 2K9AA 2VK9A 3KBUA 3RYCE 2SPCA 3P8CD 4PJNA 2V7MA 3Q9DA 4PK5A 3KFWX 1BR1A 2CXLA 3ZMZB 1IJ6A 4UEMA 2LE8A 4GYRA 2NP9A 2NTYA 3HKEE 1S35A 3CQGB 4CI2B 4KP3C 1D1BA 4AKGA 2QGSA 3QK6A 2X9YA 3PU8A 4YJ3E 3J9X1 3T8OA 3BQKA 4DMWA 5E0OA 3EUHA 1FMVA 3N9LA 1T98A 4OFZA 2XAFB 4KBMB 2D0TA 4IE0A 5DABA 2Y6XA 4BAYB 5ADXL 5LOVE 3GN5B 3V5UA 2OA5A 2XAGB 2K5BB 4UF0A 4HE8A 2YU1A 2ACXA 4M1PA 4IGUA 5JR9A 3ZC0A 2W61A 4JLEA 2UXXB 4P0BA 2DWKA 4QXHB 5FYMA 2IW5B 1LKXA 3GA8A 3DJBA 4PFOA 4GIWA 1HF8A 3I9YA 1HCIA 4QXBB 3L3PA 5KMGP 3ZLIA 2CLYB 2CWOA 5LGUB 4ZOLE 4BJNA 2VKOA 3RKOA 1WLXA 3UULA 5DQWA 1NAFA 2EHOB 4O4IE 4DBRA 4PFPA 3N9OA 5LNKA 4AQGA 2E9XC 4PJLA 3BQIA 4PW8A 4O2BE 4I43B 1IJ5A 4XAXB 2IAKA 1OWAA 2QA7A 3K3NA 1D1CA 2MYSA 4OYKA 5JDGA 2Y48B 2BVMA 4V1Av 4EOZB 3IHRA 1CUNA 1UX4A 1EZ3A 2A72A 3KVAA 4KMCA 2Q9QC 4NUVA 4WNKA 3C4XA 4BJMA 4EIWA 1BR4A 2YEVC 2CMRA 2RA1A 2BVLA 4I55E 4EZHA 1HS7A 4QWNB 2L9QA 4XZCA 3NRXA 5FP3A 2DHRA 3ETVA 4EB6E 3LK42 2VL8A 2W0GA 4JUYA 2YK0A 4MLKA 4GK0E 1ZV4X 2CEAA 3EDVA 5JDFA 1BR0A 2MTQA 5EK3A 3KV4A 4BA9A 4CZZB 5HXHA 3PTRB 5EZYE 2H3RA 4IHJE 1U4QA 3MA9A 4L0RA 3B57A 3EVYA 2XAQB 2X9HA 5F8PA 2JJ9A 1FIOA 2JMHA 3RRCA 2N9DA 3I0QA 5LBQB 4UXNB 3AVRA 3AB3B 3PDYA 3OBVE 3MACA 2LSIA 3KVBA 5F3JA 4HN9A 5EK4A 2X67A 3RYHE 3RH3A 4TUYE 5FY0A 3U3IA 2YINA 3KV5A 3SOLA 2LEHA 4EYYR 5JH7E 2CWYA 2DLRA 4C90A 2LJLA 1G73A 3C51A 5JDMA 4YJ2E 2DNXA 3C64A 2W62A 3PUQA 4AKHA 2V1DB 1KNZA 3TKLB 2UXNB 5H6RB 3OKQA 2N2NA 3HL6A 4HGAA 4PAGA 1US7B 4MFRA 2A3DA 2JMKA 3FXDB 4O4JE 5HXCA 1G8XA 3PURA 2KT9A 3A5XA 3SRZA 3HR0A 2ZMAA 2Y8DA 5JR9C 1MMGA 5FY7A 5HWXA 3ZYLA 2HH7A 2H7OA 3CMLA 2C0SA 2DI4A 3PE0A 4FI5A 3ZN0B 3AA6B 4KUMB 3RYFE 2V7KA 3KV6A 1LVKA 4A56A 2I59A 3R6NA 1SHZC 5C8YE 2JQQA 4UVAB 1YW0A 3HI2A 2HPLA 1B7TA 1MIYA 3CX8B 2D5UA 4ZI3D 5IHYA 3H37A 4U72A 2WAUA 3PU3A 2C5JA 2XAHB 4E7ZA 4X1KE 2JRKA 5GONE 5LHIB 4AKIA 4JEUB 4MBQA 3AAEB 5DJQC 5L3DB 5LHGB 2WMNA 2CLYC 2KWHA 1U5PA 2LSJA 1VOMA 3HA4A 4OHFA 1WYCA 4ZI2D 5JDHA 2ZM0A 3F57A 3LG7A 4ILUA 2PFVA 1MNDA 3K8PC 3UUXB 4ERRA 4DMVA 3PUAA 3IEEA 4H9PC 1Y64B 3LK2B 2CCQA 2VKHA 3ZPOA 2W00A 3I1AA 2B1EA 4ZI3C 4ASKA 5L3GB 3SS1A 2IC9A 5JRCA 3HKDE 5ETWA 3AAIA 3UUMA 1BR2A 3ZMSB 4CQIA 4IE7A 4UV9B 3V5SA 4CI1B 4H9SE 4OYJA 5HWYA 3ZMUB 5L3CB 5L3FB 3N9PA 2LM9A 3PUSA 2EHOD 2PJQA 2NW8A 4J2CA 4TV8E 4UVBB 5DQVA 4H63H 3UUNA 3MK7C 4EZ4A 2HPJA 4UV8B 4GK5E 4H9OC 4IIJE 1IZNB 2DCFA 5JVDE 2Q9QA 4OK0A 4O4LE 3H3AA 3ZMVB 1MIVA 5L3BB 5L3EB 1E1HB 3C4WA 5J1GA 5CA1E 3C98B 3EDUA 3K3OA 4O2AE 2CM0A 2WMOA 3CX7B 4WBNE 2WWUA 4UVCB 5FXXA 3PUGA 3RYIE 5FXZA 2GK9A 2E9XA 3BK9A 3L09A 3N2OA 4G63A 5HAXA 3O1HA 3J7Yq 3OYXA 3RX6A 2EHOC 5A1LA 2NOXA 3CKDA 3DP7A 3LK3B 1UCUA 2XASB 4P0AA 4I50E 3ZJ1A 2A2FX 2MBGA 1HFAA 2LSGA 4CI3B 3QC9A 2NWBA 2VB6A 5LXTE 3FB2A 3LJCA 3VU7H 4X1IE 4ANJA 5J2UE 2D2SA 3N9NA 5JRCB 5LBMA 2BZBA 4X1YE 3MXZA 2CE7A 4TN7B 5HXRA 2Q9QB 1D1AA 1WR6A 3E08A 4YLHA 2WM9A 2CXFA 4H9RC 1D0YA 1HG2A 4QKNA 5JDNA 2YU2A 2X0LB 3O9XA 4NUUA 2G0UA 3UTKA 1VRBA 2P9BA 2PBIA 4XBFB 2CA5A 3KDSE 3ANWB 1D0ZA 4IE6A 4AKLA 2NW9A 3B13A 3ZYMA 1H7CA 4QX8B 2VKDA 3I0OA 4K0UA 3R84B 2LSKA 2ZM8A 3O4XE 3CWZB 4PJJA 3FBLA 2NTXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MXZ A;  4CQI A;  1IJ6 A;  2X9X A;  2K48 A;  3N5L A;  2IC6 A;  1IJ5 A;  3FXE B;  3CKD A;  4J2C A;  4FI5 A;  3QK6 A;  2X9Y A;  2KWI B;  2XTL A;  2C5K T;  2C5I T;  3CVR A;  2MBG A;  4EYY R;  3QUJ A;  1Z0P A;  2G0U A;  2CA5 A;  3S4U A;  3L3P A;  3P7I A;  1ZKE A;  3TKL B;  4L0R A;  4DND A;  2C5J A;  4B6X A;  1QSD A;  1H7C A;  3FXD B;  1LRZ A;  2IC9 A;  1LVF A;  2X9W A;  2KWH A; 
#chains in the Genus database with same CATH topology
 3HKC E;  2CHN A;  3VHL A;  5LJN A;  2E9X D;  2XZE A;  1J1J A;  4IRE A;  4F8H A;  3NRY A;  4UIG A;  5IUX A;  4GKK T;  3EAM A;  4HFB A;  4DO0 A;  3ZT7 A;  3WAJ A;  2CXD A;  4WBO A;  5LHH B;  3OTO T;  2JQK A;  2BG9 C;  1YKE B;  2KIN B;  3KV9 A;  4G2A A;  2VAS A;  4CXX A;  5HXE A;  5HEH A;  5J0Z A;  2ODU A;  3Q5W A;  1YD8 G;  2BKN A;  4QXC B;  4QH4 A;  5LYJ E;  3KBT A;  3NZQ A;  5JQG E;  4YFS A;  3AA7 B;  3QOF A;  1Z0P A;  3MZK B;  3P4R A;  3RIF A;  4U2Z A;  1VCS A;  3AAA B;  3AEA A;  3S4U A;  2H88 A;  4A98 A;  2XM1 A;  5LCY A;  5L3B B;  4DND A;  1HNW T;  4IL9 A;  5L4E A;  3SWH A;  3IBP A;  1N36 T;  2UU9 T;  4TNV A;  3ZMT B;  1W09 A;  4ZI7 E;  1SA0 E;  1MIW A;  3C4Z A;  2X9W A;  3NBX X;  3UFG A;  3RLF F;  5FNV E;  5KX5 E;  4ZI2 C;  5AQP B;  2D0U A;  2VKJ A;  3N5L A;  3ANW A;  4EYU A;  2IC6 A;  2M67 A;  2WBL A;  3N2K E;  2LHR A;  2KXP B;  3FZM B;  4JBW F;  1UK5 A;  4N78 D;  3N9M A;  4U2Y A;  5BR8 T;  3FZH B;  4HEA A;  5FY1 A;  3T1Y T;  5AQF B;  2IML A;  1D0X A;  4K0K T;  2ZM6 T;  2KWI B;  3CVR A;  1ZHC A;  4AKR B;  1QLB A;  4P1N A;  3LFM A;  2VWA A;  3U78 A;  2XSA A;  1R8I A;  4CN1 A;  3MJX A;  2DWG A;  3JC6 D;  1GQE A;  4ZEY A;  2WQY A;  3N2G E;  3FZF B;  4B3M T;  2MAW A;  4O4H E;  3DTO A;  4JEH B;  5TAO A;  3RQU A;  3CX6 B;  2XUE A;  4PK6 A;  1LRZ A;  3UT5 E;  3ZJ2 A;  2H7V C;  1XDP A;  3UU5 A;  4YSX A;  2F4V T;  2W4X A;  1KNP A;  3Q5E A;  4MHC A;  2K48 A;  2V7I A;  3N9Q A;  4IDZ A;  4AI6 A;  3H3M A;  2V26 A;  5BMV E;  4GOU A;  4EGW A;  3B5M A;  1MMD A;  2BKP A;  3CQC B;  2XTL A;  1Z8U A;  1AJ3 A;  3SFD A;  3HKB E;  3K3Q C;  5EK2 A;  3M65 A;  5CB4 E;  4B3T T;  4ILC A;  2WS3 A;  3GWH A;  3EAB A;  3O1I A;  4IE4 A;  3WAK A;  4DV6 T;  4NXN T;  5M4Y A;  2V5C A;  4HFV A;  3ESL A;  5AQT B;  4AQF C;  2XQY A;  2Z6E A;  4TV9 E;  3TLT A;  5HYA A;  5J2T E;  5AFU L;  1DU2 A;  1KF6 A;  3BQL A;  1V9D A;  4AXP A;  2BDE A;  2RP4 A;  3D0T A;  1MMA A;  2V7J A;  1LVF A;  2E8I A;  5JDL A;  3LBX A;  3AEB A;  4TZ4 C;  5LB7 B;  2X9X A;  3ZMV B;  2CHO A;  3VKG A;  2I0M A;  1ZEE A;  2ODV A;  1NWM X;  3FXE B;  2V6X A;  4AIU A;  2LRK A;  2V5D A;  3L39 A;  2WSS V;  4ZS3 A;  4LMK A;  5AQK B;  4ZXL A;  5LGN B;  4HWC A;  3SFE A;  4X64 T;  2MOZ A;  2LHN A;  4P09 A;  1X79 A;  4EXT A;  3UU8 A;  2LT3 A;  2C5I T;  1M7K A;  3CQX C;  2V8S V;  4QX7 B;  2J1D G;  3E22 E;  4X65 T;  4PK4 A;  2UUC T;  3ABV A;  3F2E A;  4QH5 A;  2Q9Q D;  3P4W A;  2KZ7 B;  2E9X B;  4ZHQ E;  2KND A;  3ETU A;  5HXS A;  5HEO A;  2ZM2 A;  2L3L A;  1HG5 A;  1ZKE A;  3P7I A;  1OED A;  2ZLY A;  4HFI A;  3JC6 C;  4IE5 A;  1QUU A;  4QHO A;  5AQQ B;  4YT0 A;  4B6X A;  2NW7 A;  1QSD A;  4WW0 A;  5LMN T;  2ES0 A;  2N1G A;  4DR2 T;  3WI3 A;  2EHO A;  4L9I A;  1FEW A;  4F6R C;  3CPZ A;  4YTM A;  5AQI B;  3OJA A;  2L8K A;  5FL1 A;  5FMN A;  3QB5 A;  3AVS A;  4E7S A;  1N34 T;  3ZCI A;  1HTJ F;  2QYW A;  4DR6 T;  3ZEF B;  2W63 A;  3AA0 B;  4HFC A;  3E0Z A;  4TNW A;  3TLS A;  2LKG A;  3MKD A;  4O8S A;  1O3X A;  1MMN A;  5L2L A;  4DVD A;  4PNI A;  2UUB T;  3PV0 F;  2K24 A;  2W66 A;  4JI6 T;  1MNE A;  2AXD S;  2XHE B;  1OXZ A;  4CN4 A;  3UFE A;  4ISS A;  4YHJ A;  4YTP A;  1J5W A;  2C5K T;  2JPF A;  2KLQ A;  2X66 A;  3ONX A;  1UGO A;  1KK7 A;  2X68 A;  3FHN A;  4TX5 A;  5LA6 E;  3RRW A;  4DBQ A;  4CXY A;  4DV3 T;  3IF8 B;  3AXJ B;  3OYZ A;  1IAP A;  3ZC1 A;  3IA3 A;  4U74 A;  2VL0 A;  3FBZ A;  3NZP A;  4IDO A;  3RC3 A;  1HX8 A;  3ZCJ A;  5JRE A;  1WYB A;  4H63 V;  4H9Q C;  3F31 A;  3LBX B;  1FMW A;  4EAH A;  2IUB A;  2KSR A;  2LOP A;  5AQN B;  3W15 B;  5JR9 B;  3O1J A;  2XQ8 A;  4UEL A;  2B76 A;  3AA1 B;  3Q2M A;  4FJO A;  4UF0 B;  2XAJ B;  4X20 E;  4DV5 T;  3RPU A;  2CRB A;  4CXW A;  5LP6 E;  4NXM T;  3GN5 A;  3CIR A;  2MPK A;  3I9W A;  1UX5 A;  4IDP A;  4MAL A;  2IDO B;  5FXV A;  4GYS A;  4HTE A;  5IYZ E;  4C91 A;  1HNX T;  4DR7 T;  5AQL B;  1KNR A;  2LOS A;  1YKH B;  4PJM A;  2D9D A;  2XQA A;  5LG4 A;  5LGT B;  4WZX A;  4I4T E;  1FJG T;  5LJM A;  1S94 A;  4KHP T;  3RF1 A;  3AE4 A;  5AQR B;  5FXW A;  3Q5X A;  3ZST A;  4AQF A;  4DV1 T;  3RC8 A;  3NKZ A;  2V7L A;  3UQ7 A;  4ZS2 A;  5HEJ A;  5KDM C;  3C50 A;  3QUJ A;  3K1S A;  4JI2 T;  3Q5D A;  1M62 A;  2LSY A;  4L5G A;  4HWI B;  5AQV B;  4IST A;  3ZYK A;  5CA0 E;  1WRD A;  2VVN A;  3KIN B;  2PG8 A;  4X5T A;  3ZN1 B;  5H6Q B;  4ADZ A;  5JDQ A;  4H9N C;  2X51 A;  3GMI A;  1T72 A;  4Z8X A;  4B3R T;  2KMF A;  4HKA A;  4LF9 T;  3ONL C;  2K9A A;  2VK9 A;  3KBU A;  2H89 A;  3RYC E;  2BG9 A;  2SPC A;  2WP9 A;  3P8C D;  1W9R A;  2LRL A;  4PJN A;  1IBK T;  3A8Y C;  2V7M A;  3Q9D A;  4PK5 A;  2XY8 B;  4IT4 A;  4U31 A;  3KFW X;  1BR1 A;  2WDQ A;  2WCA A;  2CXL A;  3ZMZ B;  1IJ6 A;  2YKS A;  4DV0 T;  2YDQ A;  2LE8 A;  4UEM A;  4GYR A;  4DUZ T;  2NP9 A;  2NTY A;  3HKE E;  1S35 A;  3CQG B;  4CI2 B;  3EI0 A;  1D1B A;  1SUM B;  4KP3 C;  2XQ9 A;  4AKG A;  1IBM T;  2QGS A;  3QK6 A;  2VVS A;  2X9Y A;  3CK6 A;  3PU8 A;  4YJ3 E;  3JAF A;  3J9X 1;  4JI0 T;  3T8O A;  3BQK A;  3RYF E;  5E0O A;  3OPC A;  3EUH A;  1CHU A;  3VRA A;  1FMV A;  4DMW A;  2UXB T;  4U3C A;  3N9L A;  5FL0 A;  1N32 T;  1T98 A;  4OFZ A;  2XAF B;  4KBM B;  2D0T A;  5HCJ A;  4HWF A;  3T1H T;  4IE0 A;  5LG3 A;  5DAB A;  2Y6X A;  3RIU C;  4BAY B;  5ADX L;  5LOV E;  3GN5 B;  3V5U A;  2OA5 A;  2XAG B;  3AE3 A;  2K3W A;  2K5B B;  1NEN A;  3P4S A;  4UF0 A;  4HE8 A;  2YU1 A;  5KXJ A;  2ACX A;  4M1P A;  3RI5 A;  4IGU A;  5JR9 A;  1XNR T;  3ZC0 A;  4LFB T;  2W61 A;  4JLE A;  2UXX B;  2IHR 1;  4DID B;  4A97 A;  3P4Q A;  4P0B A;  2DWK A;  4IL4 A;  4QXH B;  5FYM A;  2IW5 B;  1LKX A;  3GA8 A;  3AE5 A;  3DJB A;  4LMJ A;  3LSV A;  4PFO A;  4DV2 T;  4GIW A;  1HF8 A;  3X1D A;  3I9Y A;  2HHH T;  2UXC T;  1HCI A;  4QXB B;  3QNU A;  2XM2 A;  4A5X A;  3L3P A;  5KMG P;  2XPK A;  3ZLI A;  2CLY B;  2CWO A;  2W67 A;  5LGU B;  4JI3 T;  4TWF A;  2CPT A;  4ZOL E;  4BJN A;  2NR4 A;  2VKO A;  3RKO A;  1WR0 A;  2RPA A;  1I94 T;  1WLX A;  3UUL A;  5DQW A;  2W2U A;  1NAF A;  2EHO B;  2XJ7 A;  4O4I E;  4PFP A;  2XQ4 A;  2YDS A;  3N9O A;  3UU3 A;  3VR9 A;  4DBR A;  4AQG A;  5JTG A;  5LNK A;  2E9X C;  4IDQ A;  4PJL A;  3BQI A;  5L47 A;  4PW8 A;  2FJA A;  4O2B E;  2FUP A;  4YY3 T;  4DUY T;  4I43 B;  1IJ5 A;  1YQ4 A;  2M6B A;  4XAX B;  5AQU B;  2IAK A;  4ZZC A;  1OWA A;  4HFE A;  2QA7 A;  4JI7 T;  5HEU A;  4LF4 T;  3K3N A;  1D1C A;  2MYS A;  4OYK A;  2M6I A;  1JNR A;  1W0B A;  5JDG A;  2Y48 B;  2BVM A;  2AE9 A;  4V1A v;  4EOZ B;  3IHR A;  1CUN A;  1UX4 A;  1EZ3 A;  2A72 A;  3AE6 A;  3KVA A;  2Q9Q C;  4KMC A;  4NUV A;  3C4X A;  2HN2 A;  4IDN A;  4EIW A;  4ZZB A;  4X62 T;  4X66 T;  1BR4 A;  4LF6 T;  2YEV C;  5FVL A;  2CMR A;  5HEG A;  2RA1 A;  4TWH A;  4BJM A;  2BVL A;  4I55 E;  3PUV F;  4EZH A;  2WB5 A;  4HWD A;  1HS7 A;  4QWN B;  2L9Q A;  4XZC A;  3NRX A;  5FP3 A;  2DHR A;  3ETV A;  2WY2 A;  4EB6 E;  3LK4 2;  2WDV A;  2VQF T;  2VL8 A;  2W0G A;  5L4H A;  4JUY A;  1XWM A;  2YK0 A;  4MLK A;  4EV6 A;  2BKO A;  1ZV4 X;  4GK0 E;  2CEA A;  4CN6 A;  2JQ9 A;  5C3J A;  3EDV A;  5JDF A;  1BR0 A;  4LFC T;  3PUZ F;  4U33 A;  2XSB A;  3VRB A;  3AE8 A;  2J47 A;  1E2A A;  2JIW A;  2MTQ A;  5EK3 A;  3KV4 A;  3RKG A;  3AEC A;  3VKH A;  4BA9 A;  4CZZ B;  4LF8 T;  5HXH A;  2V6Y A;  3NWI A;  5FVK A;  3PTR B;  4DR3 T;  5EZY E;  1L0V A;  2FJD A;  2H3R A;  4KX6 A;  1OED C;  1U4Q A;  3MA9 A;  4IHJ E;  2LM2 A;  4L0R A;  4WNK A;  3B57 A;  3EVY A;  2FBW A;  2XAQ B;  2X9H A;  5F8P A;  2X0H A;  2JJ9 A;  2YDR A;  1FIO A;  2JMH A;  4HFD A;  3RIA A;  2OLT A;  2BG9 B;  2N9D A;  2E2A A;  3RRC A;  3I0Q A;  3ZSS A;  5LBQ B;  4UXN B;  3VR8 A;  1HNZ T;  1XNQ T;  4LF7 T;  4I0U A;  3AVR A;  3AB3 B;  3PDY A;  4COF A;  4B3S T;  3OBV E;  3MAC A;  2LSI A;  3KVB A;  5F3J A;  4HN9 A;  5EK4 A;  5LMU T;  4TWD A;  2X67 A;  4NPP A;  3RH3 A;  3RYH E;  4TUY E;  5FY0 A;  3U3I A;  2YIN A;  3KV5 A;  3SOL A;  2LEH A;  4EYY R;  5JH7 E;  2WDR A;  2CWY A;  4KI0 F;  4YSZ A;  4DR5 T;  2DLR A;  4C90 A;  2LJL A;  1G73 A;  3C51 A;  5JDM A;  4JI8 T;  4YJ2 E;  2DNX A;  3C64 A;  3NVO A;  2W62 A;  3PUQ A;  5AQS B;  4YSY A;  3JAD A;  2V1D B;  3RQW A;  4EED A;  1KNZ A;  4AKH A;  3TKL B;  2UXN B;  3G06 A;  5H6R B;  4LFA T;  3OKQ A;  2N2N A;  3HL6 A;  4HGA A;  1ZOY A;  1US7 B;  4MFR A;  4PAG A;  5F5W A;  2A3D A;  3LDQ B;  4Z90 A;  2JMK A;  3FXD B;  4O4J E;  4KHZ F;  5HCM A;  1G8X A;  3AE9 A;  5HXC A;  4YXD A;  4DV7 T;  4YHH T;  3PUR A;  1IBL T;  2KT9 A;  5C2T A;  4AQY T;  3A5X A;  4Z91 A;  3HR0 A;  2ZMA A;  2BBJ A;  3SRZ A;  2Y8D A;  3AEF A;  5JR9 C;  1MMG A;  1ZP0 A;  5FY7 A;  5HWX A;  5ABF A;  3ZYL A;  3AXJ A;  2HH7 A;  2H7O A;  2WU2 A;  3CML A;  2C0S A;  1WCR A;  2DI4 A;  3PE0 A;  4FI5 A;  5AQO B;  3ZN0 B;  3AA6 B;  4KUM B;  2XQ3 A;  2R6G F;  2V7K A;  1LVK A;  3AE2 A;  2I59 A;  3KV6 A;  4QH1 A;  3R6N A;  4A56 A;  1SHZ C;  5C8Y E;  2JQQ A;  4JI5 T;  4UVA B;  1YW0 A;  2HPL A;  2BBH A;  2XQ6 A;  2VUR A;  1KEY A;  1T7S A;  1B7T A;  1MIY A;  2HN1 A;  1XDO A;  3AEG A;  4Q25 A;  3PUW F;  5ABH A;  3CX8 B;  2D5U A;  5AQH B;  4ZI3 D;  5IHY A;  3H37 A;  1Y01 A;  4U72 A;  2I6H A;  2WAU A;  4JV5 T;  3PU3 A;  2C5J A;  2XAH B;  4LML A;  4E7Z A;  4X1K E;  2JRK A;  5GON E;  2BS4 A;  2WWV A;  3UQ4 A;  5LHI B;  4LF5 T;  4AKI A;  2WZI A;  4JEU B;  4MBQ A;  3FZL B;  3AAE B;  1SE7 A;  3EHZ A;  5DJQ C;  5L3D B;  5LHG B;  2CLY C;  2KWH A;  2WMN A;  2WZH A;  5ABE A;  2DL1 A;  3QB5 K;  4AIS A;  5ABF B;  1U5P A;  4DR4 T;  1E7P A;  2LSJ A;  2X0Y A;  1XMQ T;  1VOM A;  3TLV A;  3HA4 A;  4OHF A;  2XQ7 A;  3ZT5 A;  2XQ5 A;  1WYC A;  4ZI2 D;  5JDH A;  2ZM0 A;  3F57 A;  3LG7 A;  4ILU A;  2PFV A;  4U7I A;  1MND A;  2QRX A;  3A7M A;  3K8P C;  3UUX B;  3UU4 A;  4ERR A;  4DMV A;  3PUA A;  3IEE A;  5CGM A;  4H9P C;  1KFY A;  1YXR A;  1Y64 B;  3LK2 B;  2CCQ A;  2VKH A;  3UUB A;  3ZPO A;  2W00 A;  2BS2 A;  1T8B A;  2LLY A;  3I1A A;  3RHW A;  2B1E A;  4ZI3 C;  4ASK A;  5L3G B;  3SS1 A;  2IC9 A;  5JRC A;  3HKD E;  5ETW A;  3AAI A;  3TLU A;  3UUM A;  4TV8 E;  2J62 A;  1BR2 A;  3ZMS B;  5ABG A;  4CQI A;  4IE7 A;  4HFH A;  4ILA A;  4UV9 B;  3V5S A;  4CI1 B;  4H9S E;  4OYJ A;  2YOE A;  5HWY A;  3ZMU B;  5L3C B;  5L3F B;  2PTF A;  2LM9 A;  3N9P A;  2EHO D;  2PJQ A;  2NW8 A;  3PUS A;  4J2C A;  4NIQ A;  1NEK A;  4H63 H;  4UVB B;  5DQV A;  3UUN A;  1J5E T;  4UR9 A;  4WYV A;  3MK7 C;  4EZ4 A;  2HPJ A;  2IIU A;  4UV8 B;  3PUX F;  4DV4 T;  4GK5 E;  4H9O C;  4IIJ E;  5FKY A;  1IZN B;  2DCF A;  5JVD E;  2Q9Q A;  4OK0 A;  4O4L E;  3H3A A;  2BG9 E;  1MIV A;  2J4G A;  3JCF A;  1E1H B;  3ONJ A;  3P50 A;  3C4W A;  5L3E B;  5AQG B;  5J1G A;  5CA1 E;  4JI1 T;  3C98 B;  3EDU A;  2CBI A;  3K3O A;  2CM0 A;  2WMO A;  3CX7 B;  3PJA J;  4O2A E;  3PUY F;  2WWU A;  4WBN E;  1I6Z A;  4UVC B;  1VCT A;  4ILB A;  2OV9 A;  3ZT6 A;  5AQM B;  1HR0 T;  1XZY A;  1OED B;  5FXX A;  4U7Y A;  3PUG A;  3RYI E;  5FXZ A;  2ACZ A;  1XMO T;  4HWH A;  2GK9 A;  2E9X A;  2FJE A;  2QVA A;  3BK9 A;  3L09 A;  3N2O A;  4G63 A;  1HX1 B;  5HAX A;  3O1H A;  3J7Y q;  2V6Y B;  3OYX A;  2EHO C;  3RX6 A;  1UUS A;  2NOX A;  3CKD A;  3DP7 A;  3HI2 A;  5A1L A;  3LK3 B;  4DR1 T;  1UCU A;  4EEB A;  3L8R A;  2XAS B;  2BS3 A;  4P0A A;  4I50 E;  3ZJ1 A;  2A2F X;  2MBG A;  1HFA A;  2LSG A;  3OVU A;  4CI3 B;  5CFB A;  5IWA T;  1X9B A;  2WU5 A;  3QC9 A;  2NWB A;  2VB6 A;  3AE1 A;  2YN6 A;  3TLW A;  5LXT E;  3FB2 A;  2JQH A;  3LJC A;  4X1I E;  3VU7 H;  4ANJ A;  5J2U E;  2D2S A;  2FJB A;  3N9N A;  3AED A;  1JNZ A;  5JRC B;  3AE7 A;  5LBM A;  5CJ5 A;  2LKH A;  2BZB A;  4X1Y E;  3FZK B;  3MXZ A;  2CE7 A;  4TN7 B;  4JI4 T;  1YQ3 A;  3P4P A;  2Q9Q B;  5HXR A;  1N33 T;  4JYA T;  1D1A A;  1WR6 A;  1WFD A;  3E08 A;  2A9U A;  4YLH A;  3ZKR A;  2WM9 A;  1W0A A;  2CBJ A;  2CXF A;  4H9R C;  1D0Y A;  1HG2 A;  4QKN A;  5JDN A;  2YU2 A;  2VQE T;  3RIU A;  2X0L B;  3O9X A;  4NUU A;  2G0U A;  4GKJ T;  3UTK A;  1VRB A;  2E5V A;  2P9B A;  2PBI A;  4XBF B;  2CA5 A;  3KDS E;  3ANW B;  3UU6 A;  1D0Z A;  3AEE A;  4IE6 A;  4AKL A;  4YTN A;  2NW9 A;  3PJA A;  3B13 A;  3ZYM A;  1H7C A;  1OED E;  1UUR A;  3JAE A;  4QX8 B;  5AQJ B;  2E5L T;  2VKD A;  3I0O A;  3M3Z B;  4K0U A;  3RGL A;  3R84 B;  2UXD T;  2LSK A;  2ZM8 A;  3O4X E;  3CWZ B;  2UUA T;  4PJJ A;  3FBL A;  4OX9 T;  2NTX A; 
#chains in the Genus database with same CATH homology
 3HKC E;  3VHL A;  5LJN A;  2E9X D;  3NRY A;  4UIG A;  4DO0 A;  3WAJ A;  2CXD A;  4WBO A;  5LHH B;  5HXE A;  1YKE B;  2KIN B;  3KV9 A;  4G2A A;  2VAS A;  4CXX A;  2ODU A;  3Q5W A;  1YD8 G;  4QXC B;  5LYJ E;  3KBT A;  3NZQ A;  5JQG E;  4YFS A;  3AA7 B;  1Z0P A;  3MZK B;  3AAA B;  3S4U A;  5LCY A;  4DND A;  3SWH A;  3IBP A;  3ZMT B;  4ZI7 E;  1SA0 E;  1MIW A;  3C4Z A;  2X9W A;  3NBX X;  5FNV E;  5KX5 E;  4ZI2 C;  4EYU A;  2D0U A;  2VKJ A;  3N5L A;  3ANW A;  2IC6 A;  2M67 A;  2WBL A;  3N2K E;  2LHR A;  2KXP B;  4N78 D;  3N9M A;  4HEA A;  5FY1 A;  1D0X A;  2KWI B;  3CVR A;  1ZHC A;  4AKR B;  3LFM A;  2VWA A;  3U78 A;  3MJX A;  2DWG A;  3JC6 D;  3N2G E;  4O4H E;  3DTO A;  4JEH B;  5TAO A;  3CX6 B;  2XUE A;  4PK6 A;  1LRZ A;  3UT5 E;  3ZJ2 A;  2H7V C;  4MHC A;  2K48 A;  2V7I A;  3N9Q A;  4IDZ A;  4AI6 A;  2V26 A;  5BMV E;  4GOU A;  1MMD A;  3CQC B;  2XTL A;  1AJ3 A;  3HKB E;  3K3Q C;  5EK2 A;  3M65 A;  5CB4 E;  3GWH A;  3O1I A;  4IE4 A;  3WAK A;  5M4Y A;  4HFV A;  3ESL A;  4AQF C;  2XQY A;  2Z6E A;  4TV9 E;  5HYA A;  5J2T E;  5AFU L;  3BQL A;  1V9D A;  4AXP A;  2BDE A;  2RP4 A;  3D0T A;  1MMA A;  2V7J A;  1LVF A;  2E8I A;  5JDL A;  3LBX A;  4TZ4 C;  2X9X A;  3VKG A;  1ZEE A;  2ODV A;  1NWM X;  3FXE B;  4ZS3 A;  2WSS V;  5LGN B;  2MOZ A;  2LHN A;  4P09 A;  1X79 A;  4EXT A;  2LT3 A;  2C5I T;  3CQX C;  4QX7 B;  2J1D G;  3E22 E;  4PK4 A;  3F2E A;  5HXS A;  2Q9Q D;  4ZHQ E;  2KZ7 B;  2E9X B;  2KND A;  3ETU A;  2ZM2 A;  2L3L A;  1HG5 A;  1ZKE A;  3P7I A;  4IE5 A;  2ZLY A;  4QHO A;  3JC6 C;  1QUU A;  4B6X A;  2NW7 A;  1QSD A;  4WW0 A;  2ES0 A;  2N1G A;  3WI3 A;  2EHO A;  4L9I A;  1FEW A;  4F6R C;  3CPZ A;  3OJA A;  2L8K A;  5FMN A;  4E7S A;  3AVS A;  3VKH A;  3ZCI A;  1HTJ F;  3ZEF B;  2W63 A;  3AA0 B;  3E0Z A;  3MKD A;  4O8S A;  1O3X A;  1MMN A;  5L2L A;  4DVD A;  4PNI A;  2K24 A;  1MNE A;  2XHE B;  1OXZ A;  3UFE A;  4ISS A;  4YHJ A;  2C5K T;  2JPF A;  2KLQ A;  2X66 A;  3ONX A;  4TX5 A;  1KK7 A;  2X68 A;  3FHN A;  5LA6 E;  4DBQ A;  3RRW A;  4CXY A;  3IF8 B;  3ZC1 A;  3OYZ A;  1IAP A;  4U74 A;  3FBZ A;  3NZP A;  3RC3 A;  5JRE A;  1HX8 A;  3ZCJ A;  1WYB A;  4H63 V;  4H9Q C;  3F31 A;  3LBX B;  1FMW A;  4EAH A;  2LOP A;  3W15 B;  5JR9 B;  3O1J A;  4UEL A;  3AA1 B;  3Q2M A;  4FJO A;  4UF0 B;  2XAJ B;  4X20 E;  3RPU A;  4CXW A;  5LP6 E;  3GN5 A;  3I9W A;  1UX5 A;  4C91 A;  4MAL A;  5FXV A;  5IYZ E;  4GYS A;  4HTE A;  2LOS A;  1YKH B;  4PJM A;  5LG4 A;  5LGT B;  4I4T E;  5LJM A;  1S94 A;  4AQF A;  5FXW A;  3RC8 A;  3Q5X A;  2V7L A;  4ZS2 A;  5KDM C;  3C50 A;  3QUJ A;  3ZYK A;  2LSY A;  4L5G A;  4IST A;  5CA0 E;  1WRD A;  3KIN B;  2PG8 A;  3ZN1 B;  4ADZ A;  5H6Q B;  5JDQ A;  4H9N C;  2X51 A;  3GMI A;  4Z8X A;  2KMF A;  4HKA A;  2K9A A;  2VK9 A;  3KBU A;  3RYC E;  2SPC A;  3P8C D;  4PJN A;  2V7M A;  3Q9D A;  4PK5 A;  3KFW X;  1BR1 A;  2CXL A;  3ZMZ B;  1IJ6 A;  4UEM A;  2LE8 A;  4GYR A;  2NP9 A;  2NTY A;  3HKE E;  1S35 A;  3CQG B;  4CI2 B;  4KP3 C;  1D1B A;  4AKG A;  2QGS A;  3QK6 A;  2X9Y A;  3PU8 A;  4YJ3 E;  3J9X 1;  3T8O A;  3BQK A;  4DMW A;  5E0O A;  3EUH A;  1FMV A;  3N9L A;  1T98 A;  4OFZ A;  2XAF B;  4KBM B;  2D0T A;  4IE0 A;  5DAB A;  2Y6X A;  4BAY B;  5ADX L;  5LOV E;  3GN5 B;  3V5U A;  2OA5 A;  2XAG B;  2K5B B;  4UF0 A;  4HE8 A;  2YU1 A;  2ACX A;  4M1P A;  4IGU A;  5JR9 A;  3ZC0 A;  2W61 A;  4JLE A;  2UXX B;  4P0B A;  2DWK A;  4QXH B;  5FYM A;  2IW5 B;  1LKX A;  3GA8 A;  3DJB A;  4PFO A;  4GIW A;  1HF8 A;  3I9Y A;  1HCI A;  4QXB B;  3L3P A;  5KMG P;  3ZLI A;  2CLY B;  2CWO A;  5LGU B;  4ZOL E;  4BJN A;  2VKO A;  3RKO A;  1WLX A;  3UUL A;  5DQW A;  1NAF A;  2EHO B;  4O4I E;  4DBR A;  4PFP A;  3N9O A;  5LNK A;  4AQG A;  2E9X C;  4PJL A;  3BQI A;  4PW8 A;  4O2B E;  4I43 B;  1IJ5 A;  4XAX B;  2IAK A;  1OWA A;  2QA7 A;  3K3N A;  1D1C A;  2MYS A;  4OYK A;  5JDG A;  2Y48 B;  2BVM A;  4V1A v;  4EOZ B;  3IHR A;  1CUN A;  1UX4 A;  1EZ3 A;  2A72 A;  3KVA A;  4KMC A;  2Q9Q C;  4NUV A;  4WNK A;  3C4X A;  4BJM A;  4EIW A;  1BR4 A;  2YEV C;  2CMR A;  2RA1 A;  2BVL A;  4I55 E;  4EZH A;  1HS7 A;  4QWN B;  2L9Q A;  4XZC A;  3NRX A;  5FP3 A;  2DHR A;  3ETV A;  4EB6 E;  3LK4 2;  2VL8 A;  2W0G A;  4JUY A;  2YK0 A;  4MLK A;  4GK0 E;  1ZV4 X;  2CEA A;  3EDV A;  5JDF A;  1BR0 A;  2MTQ A;  5EK3 A;  3KV4 A;  4BA9 A;  4CZZ B;  5HXH A;  3PTR B;  5EZY E;  2H3R A;  4IHJ E;  1U4Q A;  3MA9 A;  4L0R A;  3B57 A;  3EVY A;  2XAQ B;  2X9H A;  5F8P A;  2JJ9 A;  1FIO A;  2JMH A;  3RRC A;  2N9D A;  3I0Q A;  5LBQ B;  4UXN B;  3AVR A;  3AB3 B;  3PDY A;  3OBV E;  3MAC A;  2LSI A;  3KVB A;  5F3J A;  4HN9 A;  5EK4 A;  2X67 A;  3RYH E;  3RH3 A;  4TUY E;  5FY0 A;  3U3I A;  2YIN A;  3KV5 A;  3SOL A;  2LEH A;  4EYY R;  5JH7 E;  2CWY A;  2DLR A;  4C90 A;  2LJL A;  1G73 A;  3C51 A;  5JDM A;  4YJ2 E;  2DNX A;  3C64 A;  2W62 A;  3PUQ A;  4AKH A;  2V1D B;  1KNZ A;  3TKL B;  2UXN B;  5H6R B;  3OKQ A;  2N2N A;  3HL6 A;  4HGA A;  4PAG A;  1US7 B;  4MFR A;  2A3D A;  2JMK A;  3FXD B;  4O4J E;  5HXC A;  1G8X A;  3PUR A;  2KT9 A;  3A5X A;  3SRZ A;  3HR0 A;  2ZMA A;  2Y8D A;  5JR9 C;  1MMG A;  5FY7 A;  5HWX A;  3ZYL A;  2HH7 A;  2H7O A;  3CML A;  2C0S A;  2DI4 A;  3PE0 A;  4FI5 A;  3ZN0 B;  3AA6 B;  4KUM B;  3RYF E;  2V7K A;  3KV6 A;  1LVK A;  4A56 A;  2I59 A;  3R6N A;  1SHZ C;  5C8Y E;  2JQQ A;  4UVA B;  1YW0 A;  3HI2 A;  2HPL A;  1B7T A;  1MIY A;  3CX8 B;  2D5U A;  4ZI3 D;  5IHY A;  3H37 A;  4U72 A;  2WAU A;  3PU3 A;  2C5J A;  2XAH B;  4E7Z A;  4X1K E;  2JRK A;  5GON E;  5LHI B;  4AKI A;  4JEU B;  4MBQ A;  3AAE B;  5DJQ C;  5L3D B;  5LHG B;  2WMN A;  2CLY C;  2KWH A;  1U5P A;  2LSJ A;  1VOM A;  3HA4 A;  4OHF A;  1WYC A;  4ZI2 D;  5JDH A;  2ZM0 A;  3F57 A;  3LG7 A;  4ILU A;  2PFV A;  1MND A;  3K8P C;  3UUX B;  4ERR A;  4DMV A;  3PUA A;  3IEE A;  4H9P C;  1Y64 B;  3LK2 B;  2CCQ A;  2VKH A;  3ZPO A;  2W00 A;  3I1A A;  2B1E A;  4ZI3 C;  4ASK A;  5L3G B;  3SS1 A;  2IC9 A;  5JRC A;  3HKD E;  5ETW A;  3AAI A;  3UUM A;  1BR2 A;  3ZMS B;  4CQI A;  4IE7 A;  4UV9 B;  3V5S A;  4CI1 B;  4H9S E;  4OYJ A;  5HWY A;  3ZMU B;  5L3C B;  5L3F B;  3N9P A;  2LM9 A;  3PUS A;  2EHO D;  2PJQ A;  2NW8 A;  4J2C A;  4TV8 E;  4UVB B;  5DQV A;  4H63 H;  3UUN A;  3MK7 C;  4EZ4 A;  2HPJ A;  4UV8 B;  4GK5 E;  4H9O C;  4IIJ E;  1IZN B;  2DCF A;  5JVD E;  2Q9Q A;  4OK0 A;  4O4L E;  3H3A A;  3ZMV B;  1MIV A;  5L3B B;  5L3E B;  1E1H B;  3C4W A;  5J1G A;  5CA1 E;  3C98 B;  3EDU A;  3K3O A;  4O2A E;  2CM0 A;  2WMO A;  3CX7 B;  4WBN E;  2WWU A;  4UVC B;  5FXX A;  3PUG A;  3RYI E;  5FXZ A;  2GK9 A;  2E9X A;  3BK9 A;  3L09 A;  3N2O A;  4G63 A;  5HAX A;  3O1H A;  3J7Y q;  3OYX A;  3RX6 A;  2EHO C;  5A1L A;  2NOX A;  3CKD A;  3DP7 A;  3LK3 B;  1UCU A;  2XAS B;  4P0A A;  4I50 E;  3ZJ1 A;  2A2F X;  2MBG A;  1HFA A;  2LSG A;  4CI3 B;  3QC9 A;  2NWB A;  2VB6 A;  5LXT E;  3FB2 A;  3LJC A;  3VU7 H;  4X1I E;  4ANJ A;  5J2U E;  2D2S A;  3N9N A;  5JRC B;  5LBM A;  2BZB A;  4X1Y E;  3MXZ A;  2CE7 A;  4TN7 B;  5HXR A;  2Q9Q B;  1D1A A;  1WR6 A;  3E08 A;  4YLH A;  2WM9 A;  2CXF A;  4H9R C;  1D0Y A;  1HG2 A;  4QKN A;  5JDN A;  2YU2 A;  2X0L B;  3O9X A;  4NUU A;  2G0U A;  3UTK A;  1VRB A;  2P9B A;  2PBI A;  4XBF B;  2CA5 A;  3KDS E;  3ANW B;  1D0Z A;  4IE6 A;  4AKL A;  2NW9 A;  3B13 A;  3ZYM A;  1H7C A;  4QX8 B;  2VKD A;  3I0O A;  4K0U A;  3R84 B;  2LSK A;  2ZM8 A;  3O4X E;  3CWZ B;  4PJJ A;  3FBL A;  2NTX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...