3TKLB

Crystal structure of the gtp-bound rab1a in complex with the coiled-coil domain of lida from legionella pneumophila
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
192
structure length
192
Chain Sequence
SEELSLSEINEKMKAFSKDSEKLTQLMEKHKGDEKTVQSLQREHHDIKAKLANLQVLHDAHTGKKSYVNEKGNPVSSLKDAHLAINKDQEVVEHKGQFYLLQKGQWDAIKNDPAALEKAQKDYSQSKHDLATIKMEALIHKLSLEMEKQLETINDLIMSTDPKENEEATKLLHKHNGLNLKLANLQDMLAVH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Protein transport/protein binding
molecule keywords Ras-related protein Rab-1A
publication title Structural insights into a unique Legionella pneumophila effector LidA recognizing both GDP and GTP bound Rab1 in their active state
pubmed doi rcsb
source organism Homo sapiens
total genus 76
structure length 192
sequence length 192
ec nomenclature
pdb deposition date 2011-08-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.90 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3tklB01
3QUJA 3MXZA 2IC6A 1QSDA 2C5IT 2C5KT 2IC9A 3FXDB 3N5LA 3L3PA 1LVFA 4J2CA 4EYYR 2KWHA 3CKDA 1Z0PA 2MBGA 3TKLB 1H7CA 1LRZA 3S4UA 2X9WA 1IJ6A 1IJ5A 4FI5A 3FXEB 2KWIB 2K48A 2CA5A 2G0UA 4B6XA 3P7IA 2C5JA 1ZKEA 2X9YA 2X9XA 4DNDA 2XTLA 3QK6A 3CVRA 4CQIA 4L0RA
chains in the Genus database with same CATH superfamily
4H9OC 2P9BA 3C4WA 1HF8A 2YINA 4YSXA 2LSYA 5ADXL 3MJXA 2KINB 1MMAA 4IIJE 3Q2MA 3FBZA 2LOPA 2JQHA 3J9X1 1OXZA 4L0RA 3QUJA 4X1IE 5FYMA 4GKJT 2K5BB 4DV4T 3OYXA 4IE6A 2D2SA 2W00A 3MACA 4HTEA 5JDQA 1HX8A 2CM0A 2W4XA 3RQUA 3T1YT 4YJ2E 2W2UA 3RKOA 3PJAA 2UUBT 4PJNA 5L3FB 3ETVA 2WP9A 2WDQA 5ABFA 5DQWA 3IA3A 3AVSA 2MBGA 2WU2A 3H37A 2LT3A 2X66A 3HKBE 4TWHA 4QWNB 2H7OA 2C0SA 5F8PA 3AA6B 3FZKB 4AKHA 2E9XA 2LHNA 3LSVA 3NZPA 4DV2T 3RQWA 1IBLT 5EK4A 4P09A 2RA1A 3ZMVB 4WZXA 2X9YA 2MTQA 2XQAA 4I55E 4LMLA 5ABHA 5KDMC 4I4TE 2VL8A 1I6ZA 2UUCT 5AQFB 4PAGA 4GYRA 3CQXC 5JDMA 2V7LA 3C64A 4AI6A 3RF1A 3OVUA 2CE7A 3FHNA 2V6YA 2V7JA 2CXDA 1E7PA 4C91A 5L3GB 2YN6A 5LA6E 1WR0A 3AEFA 2BG9B 1KF6A 4X64T 4QH1A 3AA7B 3N9QA 5IHYA 1M62A 1BR1A 2JMHA 2YKSA 4CI1B 3EDVA 2NR4A 2X9HA 1VCSA 3OYZA 4WYVA 1SHZC 2WS3A 1N33T 3IEEA 3AE5A 4DR2T 2ODUA 3KV4A 3PUAA 4IL9A 2VK9A 3EABA 2CXLA 2Q9QA 1W0BA 1KNZA 3IBPA 5AQHB 4UF0B 3VRBA 1FEWA 3PTRB 4Z91A 4JI4T 2JRKA 2LLYA 5H6RB 4M1PA 1XMQT 2H89A 3AEGA 2Y48B 4ILAA 3H3AA 5LOVE 2YDRA 3P50A 4IDZA 5GONE 3C98B 4EEBA 2QGSA 5FL0A 5H6QB 4BJNA 4PFOA 3CKDA 3I0QA 5AQSB 2NW8A 1UGOA 2CWOA 1HCIA 2BBJA 2WSSV 1UURA 4TV8E 3T8OA 4DBQA 4A98A 4H63H 2J62A 3ZT5A 1UX4A 1X79A 2LKHA 4UV9B 1FJGT 4COFA 3ZCIA 2WM9A 4UXNB 2VASA 3RLFF 2X51A 4JI1T 1QUUA 1W0AA 4DUZT 2A9UA 3CX6B 1IZNB 4LF6T 2LOSA 2PG8A 4QX8B 3RRWA 2LM9A 4PJMA 4HWFA 2KLQA 4ZI7E 2KXPB 1LVKA 5FL1A 5HXHA 2HH7A 4CXXA 4Z90A 2WB5A 2M67A 3TLWA 2IW5B 5HEGA 2L8KA 3MA9A 3BQLA 1S35A 3NBXX 4IDQA 2X68A 4NPPA 5LGUB 3LK42 3N9OA 4JYAT 2D5UA 2UU9T 3L09A 3AE2A 1YKHB 3SFDA 3QK6A 4UV8B 1D0ZA 2VL0A 5KX5E 3B13A 2BKPA 5CA1E 4WBNE 4ZXLA 4AQGA 4ERRA 4TZ4C 3FZHB 3CQGB 4U7IA 1OEDE 5L47A 3CX7B 2E8IA 3N9PA 4U7YA 2FJAA 4LF8T 2NW9A 4ANJA 4AIUA 5C3JA 1HNWT 5ABEA 4DR4T 1IBKT 3N2OA 3ZMSB 5L3BB 4WW0A 4QX7B 1XDPA 1HR0T 2YU2A 3AA0B 5BMVE 1XNRT 4HFCA 2XQ8A 3O1JA 4GYSA 1X9BA 4GIWA 5HAXA 3N9NA 5A1LA 5LP6E 1YQ4A 1SA0E 2FUPA 4J2CA 2LKGA 2LSIA 1OWAA 3LG7A 4BA9A 3KV6A 4U2ZA 3P4QA 3P7IA 1KEYA 4X1KE 5JRCB 2XY8B 2IMLA 2FBWA 5FVKA 3I1AA 2LEHA 5AQLB 1N34T 2XQ4A 1HFAA 4YSYA 4FJOA 3VU7H 5FY7A 3VR9A 2VKJA 2BG9A 2DI4A 4ZHQE 2YU1A 3P4WA 2I59A 4E7SA 4DVDA 2VB6A 2PBIA 2E2AA 5LG3A 3A5XA 2G0UA 2EHOC 4LFBT 2ACXA 4JEUB 3QNUA 4CQIA 4ZI2C 1R8IA 3NRXA 3LBXB 4YLHA 2NW7A 3E22E 2HPJA 3SFEA 3TKLB 5JH7E 2WCAA 3Q5EA 5JTGA 5KMGP 3ZKRA 5BR8T 1D1BA 4IDOA 3GMIA 3PUXF 4UVAB 2LJLA 4QXCB 4JV5T 2RP4A 4O8SA 2HHHT 1YW0A 4HEAA 5L3EB 3GA8A 2X0HA 4YTNA 5JR9B 2NOXA 3F31A 5LMNT 4PK5A 4QXHB 4YSZA 4DO0A 1I94T 4U31A 3CMLA 4TNWA 4PJLA 4HFHA 3B5MA 2WQYA 3TLUA 1XWMA 2DL1A 3ZLIA 4UR9A 4QKNA 2WZIA 3WAKA 2XTLA 3ZJ1A 2WMNA 3AAAB 4UIGA 5AQPB 2BS2A 2KSRA 3MK7C 3NVOA 2ZM6T 4HN9A 3QB5A 2JQKA 3PUVF 3L8RA 1HNZT 4ZS2A 3AECA 2V7MA 1YQ3A 4LF5T 4QHOA 4HFDA 2V26A 3CWZB 5IUXA 3PUZF 1Z0PA 4IHJE 3RPUA 3M3ZB 4X1YE 3LK2B 2HPLA 2XM1A 4U72A 1EZ3A 4YHHT 3MZKB 2NP9A 3PUGA 2LRKA 4HWIB 2MOZA 5HCJA 1QSDA 3R6NA 1JNRA 4YY3T 4DUYT 2WDRA 3UFGA 5AFUL 3C50A 5JDFA 3BQIA 4EYUA 4HWDA 4BJMA 3UU6A 4UVBB 3UQ7A 1CHUA 2E9XC 3HR0A 1ZEEA 2WWUA 4KHZF 5FMNA 1SUMB 4HFBA 2V5DA 2WAUA 3UUMA 2PFVA 2VVNA 3QOFA 5JDLA 3UFEA 4HFVA 4YT0A 2X0YA 4YFSA 3ZYLA 3HKDE 2FJBA 1WCRA 4CN4A 2M6BA 2UXCT 3CX8B 1UCUA 4EV6A 4C90A 4DIDB 4LMKA 3RX6A 1MMNA 3HA4A 4ISTA 3W15B 4TUYE 3RYFE 5FXVA 3VKHA 2Y8DA 2NWBA 3LJCA 1T72A 3Q5XA 3J7Yq 1H7CA 3AAIA 1IAPA 4B3MT 3KDSE 4TV9E 4H9QC 5JRCA 3DJBA 5J0ZA 3OPCA 3UU4A 4ASKA 1HX1B 2KWHA 4JBWF 1WYCA 4XAXB 3UTKA 1IBMT 4I43B 2A72A 2LHRA 5HWXA 4IDPA 5JDNA 4TX5A 4U3CA 2Q9QC 3PUYF 5LGNB 2DNXA 4B3RT 1XNQT 5M4YA 4X20E 3ZC0A 4O4LE 1HG2A 4CXWA 4LF9T 2QYWA 4QH5A 1B7TA 4CN6A 3KINB 5CB4E 3I9WA 5LJMA 1M7KA 2M6IA 1O3XA 2F4VT 2K3WA 4XBFB 3N9MA 3NKZA 2J4GA 4PFPA 3KBUA 1WYBA 2V5CA 2VKHA 2V7KA 3CK6A 2EHOB 2C5JA 2X9XA 2XHEB 1US7B 5HYAA 2V7IA 3SRZA 2RPAA 4AKIA 3AEAA 2UUAT 3ZT7A 3L3PA 4U2YA 3RC8A 3U3IA 2A3DA 4OX9T 2QVAA 3S4UA 4DR7T 5JR9A 4JI8T 3PJAJ 3UUXB 3FXEB 2D9DA 2DWGA 4Q25A 2L3LA 2XZEA 1HNXT 3FXDB 3M65A 3K3OA 3PU3A 4DV1T 4LF7T 2K48A 2XASB 5KXJA 3AXJA 3ZSTA 3OBVE 3L39A 4P0AA 3EVYA 2I6HA 4IE0A 5CA0E 3ZSSA 4EZHA 3WAJA 3AEBA 4IT4A 1LKXA 2MYSA 4LMJA 2W61A 3CIRA 1J1JA 1NWMX 1YD8G 4LF4T 2BS4A 2OA5A 4K0KT 1WRDA 5DABA 4WNKA 3ZYMA 4AQFA 3G06A 3KV9A 4DNDA 3F57A 2DWKA 1T98A 3Q5WA 3PDYA 1OEDC 3RYCE 5J1GA 5L3DB 4AISA 5JQGE 3UU5A 3RHWA 2MAWA 2XQ7A 2KWIB 3EAMA 4DR5T 3F2EA 3AE6A 2WWVA 2ZMAA 4HWHA 4F8HA 4X62T 3ABVA 4L9IA 1MMGA 2KT9A 4B3ST 2D0UA 5LBMA 4EZ4A 2V1DB 5LXTE 2V6XA 3OJAA 1MNEA 4B6XA 5E0OA 4DV7T 3A7MA 4DV6T 2Y6XA 5TAOA 1MIVA 3HI2A 2E9XB 1MIWA 2ZM2A 2XQ3A 2H3RA 3AEDA 3LFMA 4JLEA 4IREA 4MFRA 4MBQA 4EEDA 4OHFA 4FI5A 2EHOD 3JC6C 4ZI2D 2N1GA 3ZT6A 5AQNB 1KNPA 5J2UE 1NENA 2VKDA 3JCFA 1ZHCA 1XZYA 5FY0A 2BG9C 4ZI3C 4X5TA 3E0ZA 3ONLC 2CLYC 4WBOA 4ZZCA 1HTJF 1U4QA 2BG9E 1QLBA 3EDUA 1T8BA 3NWIA 2IIUA 3PU8A 4DV5T 3NZQA 3K1SA 4HFIA 3CVRA 4H9SE 4AQYT 4EXTA 5LGTB 5J2TE 3ONXA 1AJ3A 5CJ5A 5HEOA 1XDOA 2ZM0A 4EB6E 4TWDA 5JVDE 4X66T 2AXDS 5AQQB 1NAFA 2OV9A 2V8SV 4ILUA 4NIQA 2JIWA 4CI2B 4DR3T 4HE8A 4G2AA 4O2AE 2W0GA 3SOLA 2CRBA 3AE4A 1Y01A 2ACZA 3KVAA 2NTYA 3UU3A 2XSBA 1ZKEA 1N36T 3AE8A 3AB3B 4UEMA 2Q9QB 4UF0A 1UX5A 2I0MA 3ZMTB 2VURA 4EYYR 3AE7A 3UUBA 2WU5A 1DU2A 3EI0A 4P1NA 2LRLA 5CGMA 3QB5K 1KFYA 1T7SA 2EHOA 3V5SA 2JMKA 5HEJA 2D0TA 5AQOB 4A5XA 2JPFA 2CEAA 4GKKT 2LM2A 3KFWX 4CN1A 2E5LT 2KZ7B 2VKOA 2FJEA 4NXNT 3VRAA 4H63V 3MKDA 4ZZBA 2YK0A 3N9LA 2XQYA 1N32T 2W63A 4PJJA 3AVRA 3X1DA 3O1IA 5FNVE 3C51A 4JI7T 3RIUA 2W66A 2JQ9A 5LG4A 1VRBA 4Z8XA 2KMFA 2PJQA 3P4RA 2KNDA 5AQRB 5AQUB 3FBLA 3GWHA 2E9XD 3U78A 3D0TA 1KNRA 1D1AA 1BR0A 4TN7B 5EK3A 4YHJA 4TWFA 5HCMA 4JI2T 4YJ3E 3T1HT 2BVMA 1HG5A 1NEKA 2CPTA 2R6GF 4DV0T 1FMVA 2K9AA 2ZLYA 5DQVA 1L0VA 4GOUA 3BQKA 2IUBA 2UXBT 2C5IT 2IC9A 2J1DG 5JDGA 3ONJA 5FXZA 2K24A 4UELA 3ETUA 2ZM8A 3UU8A 3OTOT 3DTOA 2X67A 5AQKB 3TLSA 4JI0T 4LFAT 1MIYA 4DR6T 5EZYE 2XJ7A 2WDVA 2XQ6A 3C4XA 4PK4A 2VWAA 5LNKA 2CHOA 4YTPA 1MNDA 3HL6A 2WY2A 1OEDB 4EGWA 2CXFA 3JAFA 2XQ9A 1YXRA 3FB2A 4F6RC 3AE3A 4A56A 3A8YC 2N9DA 2Q9QD 3EUHA 5ABGA 4KBMB 4HKAA 4TNVA 1G8XA 3RIFA 3LK3B 1HS7A 3CPZA 3C4ZA 3JADA 4H9NC 3I0OA 2LSJA 4N78D 3EHZA 3GN5B 4GK0E 1D1CA 3DP7A 3K8PC 2CBJA 2IC6A 2BVLA 2CHNA 4HGAA 2BZBA 5C8YE 5LCYA 2YEVC 2YDQA 2B76A 3ZN1B 1E1HB 2H88A 4OYJA 5ETWA 1SE7A 3UQ4A 3RGLA 3RRCA 4NUVA 1JNZA 1ZOYA 2CLYB 3N2KE 5LB7B 3RYHE 4O2BE 5LMUT 3P8CD 2BBHA 4XZCA 1UUSA 2HN1A 1BR2A 1Y64B 3LBXA 2A2FX 2ODVA 3VKGA 4KI0F 4ZOLE 4LFCT 5LJNA 3PV0F 1WFDA 5LHGB 2GK9A 3ESLA 1FIOA 2BS3A 5JR9C 3E08A 3H3MA 2YOEA 3B57A 5LHIB 1W09A 3OKQA 4KUMB 3ZMZB 2OLTA 3O4XE 4AKLA 2QRXA 4AKGA 5JDHA 1XMOT 5LYJE 5IWAT 2XAHB 3PURA 2CCQA 4ISSA 3ANWB 5FY1A 4DR1T 2CMRA 2IDOB 2X9WA 3IF8B 5LHHB 3R84B 3RH3A 4KHPT 3ZN0B 3KBTA 3FZFB 4L5GA 5AQJB 3ZCJA 1MMDA 2E5VA 3KVBA 1IJ5A 4B3TT 4IDNA 4AQFC 1D0YA 2DHRA 2XUEA 3Q9DA 2XSAA 4ILBA 1V9DA 3N2GE 3RYIE 2NTXA 3SWHA 2BKNA 4NUUA 2ES0A 2XPKA 5EK2A 4MHCA 1VCTA 2XQ5A 4YXDA 4ADZA 4KP3C 5AQIB 2AE9A 4OYKA 1CUNA 3P4SA 2C5KT 4A97A 3ZEFB 1BR4A 2XAQB 5L4HA 2DCFA 4YTMA 3JC6D 3KV5A 2W62A 3K3QC 2W67A 3ZC1A 1UK5A 2JQQA 4ZI3D 4V1Av 1FMWA 5ABFB 4OFZA 2XAGB 3RC3A 1IJ6A 4I50E 2CWYA 1WR6A 4DMWA 3PE0A 1OEDA 5FVLA 5FKYA 5L4EA 4O4JE 1J5ET 2Z6EA 4U33A 1VOMA 3O9XA 4JUYA 4ZS3A 2LSGA 2J47A 4I0UA 4EAHA 4DV3T 2UXDT 4DBRA 4ZEYA 4QXBB 5HXSA 3UUNA 3PUWF 3RIAA 4KMCA 4GK5E 3SS1A 3AA1B 2N2NA 2V6YB 2VVSA 2H7VC 3CQCB 3GN5A 4KX6A 2WZHA 3LDQB 4DMVA 3WI3A 4MLKA 4U74A 2VQET 2JJ9A 2HN2A 2CBIA 3JAEA 5IYZE 5DJQC 4PW8A 5HEHA 2CA5A 5L3CB 4HFEA 2UXXB 3FZLB 3TLVA 3O1HA 4IL4A 4AKRB 3PUSA 5LBQB 4EOZB 4UVCB 4EIWA 1KK7A 2DLRA 4CI3B 5F5WA 1ZP0A 4BAYB 5AQGB 4MALA 1G73A 4IE4A 1GQEA 5AQTB 4HWCA 2FJDA 5F3JA 2XAFB 5HXCA 2BDEA 4PNIA 3ZPOA 4O4IE 3N5LA 1LVFA 4JI5T 1W9RA 1YKEB 1LRZA 2X0LB 3IHRA 3RKGA 1S94A 2YDSA 3ZMUB 4X65T 3VR8A 3AEEA 3VHLA 3ZYKA 5AQMB 2VQFT 4OK0A 4IGUA 5HWYA 3NRYA 3MXZA 3V5UA 4ILCA 3UULA 5FXWA 2B1EA 4JI3T 4PK6A 2LSKA 2QA7A 2SPCA 3HKCE 5L2LA 5FXXA 3RIUC 5JREA 2LE8A 1ZV4X 1E2AA 2BKOA 4E7ZA 4JEHB 3AE1A 3ANWA 4NXMT 2PTFA 2UXNB 5HXRA 4QH4A 4G63A 2IHR1 3PUQA 4H9PC 2WMOA 3FZMB 4AXPA 1U5PA 3BK9A 3QC9A 5C2TA 5FP3A 4IE5A 2XM2A 4JI6T 1WLXA 3UT5E 2XAJB 4K0UA 4H9RC 3AXJB 5HEUA 1D0XA 1J5WA 5AQVB 3Q5DA 2WBLA 4O4HE 4CXYA 3ZJ2A 4CZZB 3RI5A 5CFBA 3TLTA 3K3NA 4P0BA 2L9QA 5HXEA 3HKEE 4IE7A 3P4PA 3AAEB 2MPKA 3AE9A 2IAKA 3I9YA 1Z8UA
chains in the Genus database with same CATH topology
4OYJA 5ETWA 4H9OC 2P9BA 3C4WA 3RRCA 1HF8A 1NWMX 1YD8G 2VKJA 2YINA 2DI4A 4NUVA 2LSYA 4ZHQE 2YU1A 3MJXA 2OA5A 5ADXL 2KINB 1WRDA 2CLYB 2I59A 4E7SA 1MMAA 3N2KE 4IIJE 3Q2MA 3FBZA 4DVDA 2VB6A 5DABA 4WNKA 2PBIA 2LOPA 3ZYMA 3RYHE 3A5XA 4O2BE 4AQFA 2G0UA 3P8CD 2EHOC 2ACXA 3KV9A 4DNDA 4JEUB 3F57A 3J9X1 4CQIA 2DWKA 1OXZA 4L0RA 4XZCA 4ZI2C 3QUJA 3NRXA 1BR2A 4X1IE 1Y64B 5FYMA 1T98A 3LBXA 3Q5WA 3LBXB 2A2FX 2K5BB 2ODVA 4YLHA 3PDYA 3RYCE 2NW7A 3VKGA 3E22E 3OYXA 4IE6A 4ZOLE 2HPJA 5J1GA 2D2SA 5LJNA 2W00A 3MACA 5L3DB 4HTEA 5JQGE 3TKLB 5JH7E 5LHGB 2GK9A 3ESLA 1FIOA 5JDQA 5KMGP 1D1BA 1HX8A 2CM0A 5JR9C 3E08A 4YJ2E 2KWIB 3RKOA 3GMIA 4PJNA 4UVAB 3B57A 5LHIB 2LJLA 3F2EA 4QXCB 3OKQA 4KUMB 5L3FB 2ZMAA 3ETVA 3ZMZB 2RP4A 4L9IA 3O4XE 4AKLA 4O8SA 4AKGA 1MMGA 2KT9A 5DQWA 2D0UA 3AVSA 2MBGA 5LBMA 4EZ4A 1YW0A 4HEAA 5JDHA 2V1DB 5LXTE 5L3EB 5LYJE 3GA8A 3H37A 2LT3A 2X66A 3HKBE 2XAHB 3OJAA 4QWNB 5JR9B 2NOXA 1MNEA 3F31A 5E0OA 4B6XA 2H7OA 4PK5A 2C0SA 4QXHB 5F8PA 3PURA 3AA6B 4DO0A 2CCQA 4ISSA 2Y6XA 3ANWB 5TAOA 4AKHA 1MIVA 5FY1A 3HI2A 2E9XA 2E9XB 1MIWA 2ZM2A 3CMLA 2H3RA 2LHNA 2CMRA 3LFMA 3NZPA 4JLEA 4MFRA 4PJLA 4MBQA 5EK4A 4OHFA 2X9WA 3IF8B 4P09A 5LHHB 2RA1A 4FI5A 3ZMVB 3R84B 2EHOD 3JC6C 3ZLIA 4QKNA 4ZI2D 2X9YA 2MTQA 2N1GA 3RH3A 2XTLA 3WAKA 3ZJ1A 4I55E 2WMNA 3ZN0B 3KBTA 3AAAB 4UIGA 5J2UE 2VKDA 3MK7C 1ZHCA 5KDMC 4I4TE 2VL8A 5FY0A 4L5GA 4PAGA 4HN9A 4ZI3C 4GYRA 3CQXC 5JDMA 3E0ZA 2V7LA 3C64A 2CLYC 4WBOA 3ZCJA 1HTJF 4AI6A 1MMDA 2CE7A 1U4QA 3FHNA 3KVBA 1IJ5A 4ZS2A 2V7JA 2CXDA 3EDUA 1D0YA 2DHRA 4AQFC 2XUEA 2V7MA 3PU8A 3Q9DA 3NZQA 4C91A 3CVRA 4H9SE 4EXTA 5L3GB 1V9DA 3N2GE 5LGTB 3RYIE 2NTXA 5LA6E 5J2TE 3SWHA 4QHOA 3ONXA 1AJ3A 2V26A 4NUUA 3CWZB 2ES0A 3AA7B 1Z0PA 4IHJE 3RPUA 3N9QA 5EK2A 5IHYA 2ZM0A 4MHCA 4X1YE 3LK2B 4EB6E 2HPLA 5JVDE 1BR1A 2JMHA 4U72A 1NAFA 4CI1B 1EZ3A 3EDVA 3MZKB 2NP9A 4ADZA 4KP3C 3PUGA 4ILUA 2X9HA 4OYKA 1CUNA 2MOZA 1QSDA 3OYZA 3R6NA 4CI2B 2C5KT 3ZEFB 1BR4A 1SHZC 2XAQB 4HE8A 2DCFA 4G2AA 4O2AE 2W0GA 3IEEA 3SOLA 5AFUL 3C50A 5JDFA 3JC6D 3KV5A 3BQIA 3KVAA 2NTYA 2ODUA 2W62A 3K3QC 1ZKEA 4EYUA 3KV4A 3PUAA 4BJMA 2VK9A 2CXLA 3AB3B 4UEMA 2Q9QA 2Q9QB 4UVBB 1KNZA 3IBPA 4UF0A 4UF0B 1UX5A 3ZC1A 2E9XC 2JQQA 3HR0A 4ZI3D 3ZMTB 4V1Av 1FMWA 1FEWA 3PTRB 4EYYR 1ZEEA 2JRKA 2WWUA 4OFZA 5FMNA 5H6RB 4M1PA 2XAGB 3RC3A 2WAUA 3UUMA 2PFVA 5JDLA 1IJ6A 4I50E 3UFEA 4HFVA 2EHOA 3V5SA 2CWYA 1WR6A 4DMWA 2JMKA 4YFSA 3PE0A 2Y48B 2D0TA 3HKDE 3ZYLA 3H3AA 5LOVE 2JPFA 4IDZA 5GONE 2CEAA 3C98B 2QGSA 5H6QB 4BJNA 3KFWX 4O4JE 4PFOA 3CKDA 2Z6EA 3I0QA 3CX8B 1VOMA 1UCUA 2KZ7B 4C90A 2NW8A 3O9XA 2CWOA 1HCIA 2VKOA 2WSSV 3T8OA 4TV8E 3RX6A 4H63V 1MMNA 3HA4A 3MKDA 4JUYA 4DBQA 4ZS3A 2LSGA 4H63H 1UX4A 4EAHA 1X79A 4ISTA 3W15B 2YK0A 4TUYE 3N9LA 2XQYA 4UV9B 2W63A 3RYFE 4PJJA 5FXVA 3ZCIA 4DBRA 2WM9A 3AVRA 4UXNB 4QXBB 3VKHA 2Y8DA 3O1IA 2NWBA 5HXSA 3LJCA 5FNVE 3C51A 3UUNA 2VASA 2X51A 3Q5XA 3J7Yq 1QUUA 4KMCA 5LG4A 3CX6B 1H7CA 4GK5E 1VRBA 4Z8XA 3AAIA 3AA1B 3SS1A 1IZNB 2N2NA 1IAPA 2KMFA 3KDSE 2LOSA 2PG8A 4QX8B 2PJQA 4TV9E 3RRWA 4H9QC 2H7VC 2KNDA 2LM9A 3CQCB 3GN5A 5JRCA 3DJBA 3FBLA 3GWHA 4PJMA 2E9XD 3U78A 3D0TA 4DMVA 2KLQA 1D1AA 3WI3A 1BR0A 4TN7B 4ASKA 4ZI7E 4MLKA 4U74A 2KWHA 3UTKA 1WYCA 4XAXB 5EK3A 2KXPB 4YHJA 2JJ9A 4I43B 1LVKA 5HXHA 2HH7A 4YJ3E 5IYZE 5DJQC 2A72A 4CXXA 2BVMA 1HG5A 2LHRA 4PW8A 5HWXA 2M67A 2CA5A 5L3CB 5JDNA 2IW5B 4TX5A 1FMVA 2K9AA 2UXXB 2L8KA 2ZLYA 5DQVA 3MA9A 3BQLA 4GOUA 3BQKA 1S35A 3NBXX 3O1HA 4AKRB 2Q9QC 3PUSA 5LBQB 5LGNB 4EOZB 2C5IT 2DNXA 2IC9A 2J1DG 2X68A 4UVCB 5JDGA 5FXZA 4EIWA 1KK7A 2DLRA 5LGUB 2K24A 3LK42 3N9OA 2D5UA 5M4YA 4X20E 4UELA 3ZC0A 4O4LE 3ETUA 1HG2A 2ZM8A 4CI3B 4CXWA 3L09A 4BAYB 4MALA 1G73A 1YKHB 3DTOA 1B7TA 2X67A 3QK6A 4IE4A 4UV8B 1D0ZA 3KINB 5CB4E 3I9WA 5F3JA 2XAFB 5KX5E 5LJMA 3B13A 5HXCA 5CA1E 4WBNE 2BDEA 4PNIA 3ZPOA 1MIYA 4O4IE 3N5LA 1LVFA 4AQGA 4ERRA 4TZ4C 1O3XA 5EZYE 4XBFB 3N9MA 1YKEB 4PFPA 1LRZA 3CQGB 2X0LB 3C4XA 3IHRA 3KBUA 1WYBA 4PK4A 1S94A 2VWAA 2VKHA 3CX7B 2E8IA 3N9PA 3ZMUB 2V7KA 5LNKA 3VHLA 2EHOB 3ZYKA 2C5JA 2X9XA 2NW9A 4OK0A 2XHEB 1US7B 4IGUA 2V7IA 5HYAA 1MNDA 3SRZA 4ANJA 5HWYA 3NRYA 3MXZA 3V5UA 3UULA 3HL6A 5FXWA 2B1EA 4AKIA 4PK6A 2CXFA 3L3PA 3RC8A 2LSKA 2QA7A 2SPCA 3HKCE 3N2OA 5L2LA 3ZMSB 5FXXA 5L3BB 3FB2A 4WW0A 3U3IA 2A3DA 5JREA 4QX7B 4F6RC 2LE8A 3S4UA 2YU2A 3AA0B 1ZV4X 5JR9A 5BMVE 4E7ZA 3UUXB 3FXEB 4A56A 2DWGA 3O1JA 4GYSA 2L3LA 4JEHB 2N9DA 4GIWA 2Q9QD 5HAXA 3N9NA 3EUHA 3ANWA 5A1LA 2UXNB 4KBMB 4HKAA 5LP6E 5HXRA 1G8XA 1SA0E 3FXDB 4G63A 3M65A 4J2CA 3PUQA 3K3OA 2LSIA 3LK3B 1OWAA 2WMOA 3LG7A 4H9PC 4BA9A 1HS7A 3KV6A 3CPZA 4AXPA 1U5PA 3BK9A 3QC9A 3PU3A 5FP3A 3C4ZA 4IE5A 4H9NC 2K48A 3I0OA 1WLXA 3UT5E 3P7IA 2XASB 2XAJB 2LSJA 4K0UA 4N78D 4H9RC 4X1KE 3OBVE 3GN5B 1D0XA 4GK0E 5JRCB 1D1CA 3DP7A 3K8PC 4P0AA 2IC6A 2WBLA 4O4HE 4CXYA 3EVYA 3ZJ2A 2BVLA 4CZZB 4HGAA 2BZBA 4IE0A 3I1AA 2LEHA 5LCYA 5C8YE 3K3NA 5CA0E 4P0BA 2L9QA 2YEVC 5HXEA 3HKEE 4EZHA 3WAJA 1HFAA 4FJOA 3AAEB 4IE7A 1LKXA 2MYSA 3ZN1B 1E1HB 3I9YA 2IAKA 2W61A 3VU7H 5FY7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QUJ A;  3MXZ A;  2IC6 A;  1QSD A;  2C5I T;  2C5K T;  2IC9 A;  3FXD B;  3N5L A;  3L3P A;  1LVF A;  4J2C A;  4EYY R;  2KWH A;  3CKD A;  1Z0P A;  2MBG A;  3TKL B;  1H7C A;  1LRZ A;  3S4U A;  2X9W A;  1IJ6 A;  1IJ5 A;  4FI5 A;  3FXE B;  2KWI B;  2K48 A;  2CA5 A;  2G0U A;  4B6X A;  3P7I A;  2C5J A;  1ZKE A;  2X9Y A;  2X9X A;  4DND A;  2XTL A;  3QK6 A;  3CVR A;  4CQI A;  4L0R A; 
#chains in the Genus database with same CATH topology
 4H9O C;  2P9B A;  3C4W A;  1HF8 A;  2YIN A;  4YSX A;  2LSY A;  5ADX L;  3MJX A;  2KIN B;  1MMA A;  4IIJ E;  3Q2M A;  3FBZ A;  2LOP A;  2JQH A;  3J9X 1;  1OXZ A;  4L0R A;  3QUJ A;  4X1I E;  5FYM A;  4GKJ T;  2K5B B;  4DV4 T;  3OYX A;  4IE6 A;  2D2S A;  2W00 A;  3MAC A;  4HTE A;  5JDQ A;  1HX8 A;  2CM0 A;  2W4X A;  3RQU A;  3T1Y T;  4YJ2 E;  2W2U A;  3RKO A;  3PJA A;  2UUB T;  4PJN A;  5L3F B;  3ETV A;  2WP9 A;  2WDQ A;  5ABF A;  5DQW A;  3IA3 A;  3AVS A;  2MBG A;  2WU2 A;  3H37 A;  2LT3 A;  2X66 A;  3HKB E;  4TWH A;  4QWN B;  2H7O A;  2C0S A;  5F8P A;  3AA6 B;  3FZK B;  4AKH A;  2E9X A;  2LHN A;  3LSV A;  3NZP A;  4DV2 T;  3RQW A;  1IBL T;  5EK4 A;  4P09 A;  2RA1 A;  3ZMV B;  4WZX A;  2X9Y A;  2MTQ A;  2XQA A;  4I55 E;  4LML A;  5ABH A;  5KDM C;  4I4T E;  2VL8 A;  1I6Z A;  2UUC T;  5AQF B;  4PAG A;  4GYR A;  3CQX C;  5JDM A;  2V7L A;  3C64 A;  4AI6 A;  3RF1 A;  3OVU A;  2CE7 A;  3FHN A;  2V6Y A;  2V7J A;  2CXD A;  1E7P A;  4C91 A;  5L3G B;  2YN6 A;  5LA6 E;  1WR0 A;  3AEF A;  2BG9 B;  1KF6 A;  4X64 T;  4QH1 A;  3AA7 B;  3N9Q A;  5IHY A;  1M62 A;  1BR1 A;  2JMH A;  2YKS A;  4CI1 B;  3EDV A;  2NR4 A;  2X9H A;  1VCS A;  3OYZ A;  4WYV A;  1SHZ C;  2WS3 A;  1N33 T;  3IEE A;  3AE5 A;  4DR2 T;  2ODU A;  3KV4 A;  3PUA A;  4IL9 A;  2VK9 A;  3EAB A;  2CXL A;  2Q9Q A;  1W0B A;  1KNZ A;  3IBP A;  5AQH B;  4UF0 B;  3VRB A;  1FEW A;  3PTR B;  4Z91 A;  4JI4 T;  2JRK A;  2LLY A;  5H6R B;  4M1P A;  1XMQ T;  2H89 A;  3AEG A;  2Y48 B;  4ILA A;  3H3A A;  5LOV E;  2YDR A;  3P50 A;  4IDZ A;  5GON E;  3C98 B;  4EEB A;  2QGS A;  5FL0 A;  5H6Q B;  4BJN A;  4PFO A;  3CKD A;  3I0Q A;  5AQS B;  2NW8 A;  1UGO A;  2CWO A;  1HCI A;  2BBJ A;  2WSS V;  1UUR A;  4TV8 E;  3T8O A;  4DBQ A;  4A98 A;  4H63 H;  2J62 A;  3ZT5 A;  1UX4 A;  1X79 A;  2LKH A;  4UV9 B;  1FJG T;  4COF A;  3ZCI A;  2WM9 A;  4UXN B;  2VAS A;  3RLF F;  2X51 A;  4JI1 T;  1QUU A;  1W0A A;  4DUZ T;  2A9U A;  3CX6 B;  1IZN B;  4LF6 T;  2LOS A;  2PG8 A;  4QX8 B;  3RRW A;  2LM9 A;  4PJM A;  4HWF A;  2KLQ A;  4ZI7 E;  2KXP B;  1LVK A;  5FL1 A;  5HXH A;  2HH7 A;  4CXX A;  4Z90 A;  2WB5 A;  2M67 A;  3TLW A;  2IW5 B;  5HEG A;  2L8K A;  3MA9 A;  3BQL A;  1S35 A;  3NBX X;  4IDQ A;  2X68 A;  4NPP A;  5LGU B;  3LK4 2;  3N9O A;  4JYA T;  2D5U A;  2UU9 T;  3L09 A;  3AE2 A;  1YKH B;  3SFD A;  3QK6 A;  4UV8 B;  1D0Z A;  2VL0 A;  5KX5 E;  3B13 A;  2BKP A;  5CA1 E;  4WBN E;  4ZXL A;  4AQG A;  4ERR A;  4TZ4 C;  3FZH B;  3CQG B;  4U7I A;  1OED E;  5L47 A;  3CX7 B;  2E8I A;  3N9P A;  4U7Y A;  2FJA A;  4LF8 T;  2NW9 A;  4ANJ A;  4AIU A;  5C3J A;  1HNW T;  5ABE A;  4DR4 T;  1IBK T;  3N2O A;  3ZMS B;  5L3B B;  4WW0 A;  4QX7 B;  1XDP A;  1HR0 T;  2YU2 A;  3AA0 B;  5BMV E;  1XNR T;  4HFC A;  2XQ8 A;  3O1J A;  4GYS A;  1X9B A;  4GIW A;  5HAX A;  3N9N A;  5A1L A;  5LP6 E;  1YQ4 A;  1SA0 E;  2FUP A;  4J2C A;  2LKG A;  2LSI A;  1OWA A;  3LG7 A;  4BA9 A;  3KV6 A;  4U2Z A;  3P4Q A;  3P7I A;  1KEY A;  4X1K E;  5JRC B;  2XY8 B;  2IML A;  2FBW A;  5FVK A;  3I1A A;  2LEH A;  5AQL B;  1N34 T;  2XQ4 A;  1HFA A;  4YSY A;  4FJO A;  3VU7 H;  5FY7 A;  3VR9 A;  2VKJ A;  2BG9 A;  2DI4 A;  4ZHQ E;  2YU1 A;  3P4W A;  2I59 A;  4E7S A;  4DVD A;  2VB6 A;  2PBI A;  2E2A A;  5LG3 A;  3A5X A;  2G0U A;  2EHO C;  4LFB T;  2ACX A;  4JEU B;  3QNU A;  4CQI A;  4ZI2 C;  1R8I A;  3NRX A;  3LBX B;  4YLH A;  2NW7 A;  3E22 E;  2HPJ A;  3SFE A;  3TKL B;  5JH7 E;  2WCA A;  3Q5E A;  5JTG A;  5KMG P;  3ZKR A;  5BR8 T;  1D1B A;  4IDO A;  3GMI A;  3PUX F;  4UVA B;  2LJL A;  4QXC B;  4JV5 T;  2RP4 A;  4O8S A;  2HHH T;  1YW0 A;  4HEA A;  5L3E B;  3GA8 A;  2X0H A;  4YTN A;  5JR9 B;  2NOX A;  3F31 A;  5LMN T;  4PK5 A;  4QXH B;  4YSZ A;  4DO0 A;  1I94 T;  4U31 A;  3CML A;  4TNW A;  4PJL A;  4HFH A;  3B5M A;  2WQY A;  3TLU A;  1XWM A;  2DL1 A;  3ZLI A;  4UR9 A;  4QKN A;  2WZI A;  3WAK A;  2XTL A;  3ZJ1 A;  2WMN A;  3AAA B;  4UIG A;  5AQP B;  2BS2 A;  2KSR A;  3MK7 C;  3NVO A;  2ZM6 T;  4HN9 A;  3QB5 A;  2JQK A;  3PUV F;  3L8R A;  1HNZ T;  4ZS2 A;  3AEC A;  2V7M A;  1YQ3 A;  4LF5 T;  4QHO A;  4HFD A;  2V26 A;  3CWZ B;  5IUX A;  3PUZ F;  1Z0P A;  4IHJ E;  3RPU A;  3M3Z B;  4X1Y E;  3LK2 B;  2HPL A;  2XM1 A;  4U72 A;  1EZ3 A;  4YHH T;  3MZK B;  2NP9 A;  3PUG A;  2LRK A;  4HWI B;  2MOZ A;  5HCJ A;  1QSD A;  3R6N A;  1JNR A;  4YY3 T;  4DUY T;  2WDR A;  3UFG A;  5AFU L;  3C50 A;  5JDF A;  3BQI A;  4EYU A;  4HWD A;  4BJM A;  3UU6 A;  4UVB B;  3UQ7 A;  1CHU A;  2E9X C;  3HR0 A;  1ZEE A;  2WWU A;  4KHZ F;  5FMN A;  1SUM B;  4HFB A;  2V5D A;  2WAU A;  3UUM A;  2PFV A;  2VVN A;  3QOF A;  5JDL A;  3UFE A;  4HFV A;  4YT0 A;  2X0Y A;  4YFS A;  3ZYL A;  3HKD E;  2FJB A;  1WCR A;  4CN4 A;  2M6B A;  2UXC T;  3CX8 B;  1UCU A;  4EV6 A;  4C90 A;  4DID B;  4LMK A;  3RX6 A;  1MMN A;  3HA4 A;  4IST A;  3W15 B;  4TUY E;  3RYF E;  5FXV A;  3VKH A;  2Y8D A;  2NWB A;  3LJC A;  1T72 A;  3Q5X A;  3J7Y q;  1H7C A;  3AAI A;  1IAP A;  4B3M T;  3KDS E;  4TV9 E;  4H9Q C;  5JRC A;  3DJB A;  5J0Z A;  3OPC A;  3UU4 A;  4ASK A;  1HX1 B;  2KWH A;  4JBW F;  1WYC A;  4XAX B;  3UTK A;  1IBM T;  4I43 B;  2A72 A;  2LHR A;  5HWX A;  4IDP A;  5JDN A;  4TX5 A;  4U3C A;  2Q9Q C;  3PUY F;  5LGN B;  2DNX A;  4B3R T;  1XNQ T;  5M4Y A;  4X20 E;  3ZC0 A;  4O4L E;  1HG2 A;  4CXW A;  4LF9 T;  2QYW A;  4QH5 A;  1B7T A;  4CN6 A;  3KIN B;  5CB4 E;  3I9W A;  5LJM A;  1M7K A;  2M6I A;  1O3X A;  2F4V T;  2K3W A;  4XBF B;  3N9M A;  3NKZ A;  2J4G A;  4PFP A;  3KBU A;  1WYB A;  2V5C A;  2VKH A;  2V7K A;  3CK6 A;  2EHO B;  2C5J A;  2X9X A;  2XHE B;  1US7 B;  5HYA A;  2V7I A;  3SRZ A;  2RPA A;  4AKI A;  3AEA A;  2UUA T;  3ZT7 A;  3L3P A;  4U2Y A;  3RC8 A;  3U3I A;  2A3D A;  4OX9 T;  2QVA A;  3S4U A;  4DR7 T;  5JR9 A;  4JI8 T;  3PJA J;  3UUX B;  3FXE B;  2D9D A;  2DWG A;  4Q25 A;  2L3L A;  2XZE A;  1HNX T;  3FXD B;  3M65 A;  3K3O A;  3PU3 A;  4DV1 T;  4LF7 T;  2K48 A;  2XAS B;  5KXJ A;  3AXJ A;  3ZST A;  3OBV E;  3L39 A;  4P0A A;  3EVY A;  2I6H A;  4IE0 A;  5CA0 E;  3ZSS A;  4EZH A;  3WAJ A;  3AEB A;  4IT4 A;  1LKX A;  2MYS A;  4LMJ A;  2W61 A;  3CIR A;  1J1J A;  1NWM X;  1YD8 G;  4LF4 T;  2BS4 A;  2OA5 A;  4K0K T;  1WRD A;  5DAB A;  4WNK A;  3ZYM A;  4AQF A;  3G06 A;  3KV9 A;  4DND A;  3F57 A;  2DWK A;  1T98 A;  3Q5W A;  3PDY A;  1OED C;  3RYC E;  5J1G A;  5L3D B;  4AIS A;  5JQG E;  3UU5 A;  3RHW A;  2MAW A;  2XQ7 A;  2KWI B;  3EAM A;  4DR5 T;  3F2E A;  3AE6 A;  2WWV A;  2ZMA A;  4HWH A;  4F8H A;  4X62 T;  3ABV A;  4L9I A;  1MMG A;  2KT9 A;  4B3S T;  2D0U A;  5LBM A;  4EZ4 A;  2V1D B;  5LXT E;  2V6X A;  3OJA A;  1MNE A;  4B6X A;  5E0O A;  4DV7 T;  3A7M A;  4DV6 T;  2Y6X A;  5TAO A;  1MIV A;  3HI2 A;  2E9X B;  1MIW A;  2ZM2 A;  2XQ3 A;  2H3R A;  3AED A;  3LFM A;  4JLE A;  4IRE A;  4MFR A;  4MBQ A;  4EED A;  4OHF A;  4FI5 A;  2EHO D;  3JC6 C;  4ZI2 D;  2N1G A;  3ZT6 A;  5AQN B;  1KNP A;  5J2U E;  1NEN A;  2VKD A;  3JCF A;  1ZHC A;  1XZY A;  5FY0 A;  2BG9 C;  4ZI3 C;  4X5T A;  3E0Z A;  3ONL C;  2CLY C;  4WBO A;  4ZZC A;  1HTJ F;  1U4Q A;  2BG9 E;  1QLB A;  3EDU A;  1T8B A;  3NWI A;  2IIU A;  3PU8 A;  4DV5 T;  3NZQ A;  3K1S A;  4HFI A;  3CVR A;  4H9S E;  4AQY T;  4EXT A;  5LGT B;  5J2T E;  3ONX A;  1AJ3 A;  5CJ5 A;  5HEO A;  1XDO A;  2ZM0 A;  4EB6 E;  4TWD A;  5JVD E;  4X66 T;  2AXD S;  5AQQ B;  1NAF A;  2OV9 A;  2V8S V;  4ILU A;  4NIQ A;  2JIW A;  4CI2 B;  4DR3 T;  4HE8 A;  4G2A A;  4O2A E;  2W0G A;  3SOL A;  2CRB A;  3AE4 A;  1Y01 A;  2ACZ A;  3KVA A;  2NTY A;  3UU3 A;  2XSB A;  1ZKE A;  1N36 T;  3AE8 A;  3AB3 B;  4UEM A;  2Q9Q B;  4UF0 A;  1UX5 A;  2I0M A;  3ZMT B;  2VUR A;  4EYY R;  3AE7 A;  3UUB A;  2WU5 A;  1DU2 A;  3EI0 A;  4P1N A;  2LRL A;  5CGM A;  3QB5 K;  1KFY A;  1T7S A;  2EHO A;  3V5S A;  2JMK A;  5HEJ A;  2D0T A;  5AQO B;  4A5X A;  2JPF A;  2CEA A;  4GKK T;  2LM2 A;  3KFW X;  4CN1 A;  2E5L T;  2KZ7 B;  2VKO A;  2FJE A;  4NXN T;  3VRA A;  4H63 V;  3MKD A;  4ZZB A;  2YK0 A;  3N9L A;  2XQY A;  1N32 T;  2W63 A;  4PJJ A;  3AVR A;  3X1D A;  3O1I A;  5FNV E;  3C51 A;  4JI7 T;  3RIU A;  2W66 A;  2JQ9 A;  5LG4 A;  1VRB A;  4Z8X A;  2KMF A;  2PJQ A;  3P4R A;  2KND A;  5AQR B;  5AQU B;  3FBL A;  3GWH A;  2E9X D;  3U78 A;  3D0T A;  1KNR A;  1D1A A;  1BR0 A;  4TN7 B;  5EK3 A;  4YHJ A;  4TWF A;  5HCM A;  4JI2 T;  4YJ3 E;  3T1H T;  2BVM A;  1HG5 A;  1NEK A;  2CPT A;  2R6G F;  4DV0 T;  1FMV A;  2K9A A;  2ZLY A;  5DQV A;  1L0V A;  4GOU A;  3BQK A;  2IUB A;  2UXB T;  2C5I T;  2IC9 A;  2J1D G;  5JDG A;  3ONJ A;  5FXZ A;  2K24 A;  4UEL A;  3ETU A;  2ZM8 A;  3UU8 A;  3OTO T;  3DTO A;  2X67 A;  5AQK B;  3TLS A;  4JI0 T;  4LFA T;  1MIY A;  4DR6 T;  5EZY E;  2XJ7 A;  2WDV A;  2XQ6 A;  3C4X A;  4PK4 A;  2VWA A;  5LNK A;  2CHO A;  4YTP A;  1MND A;  3HL6 A;  2WY2 A;  1OED B;  4EGW A;  2CXF A;  3JAF A;  2XQ9 A;  1YXR A;  3FB2 A;  4F6R C;  3AE3 A;  4A56 A;  3A8Y C;  2N9D A;  2Q9Q D;  3EUH A;  5ABG A;  4KBM B;  4HKA A;  4TNV A;  1G8X A;  3RIF A;  3LK3 B;  1HS7 A;  3CPZ A;  3C4Z A;  3JAD A;  4H9N C;  3I0O A;  2LSJ A;  4N78 D;  3EHZ A;  3GN5 B;  4GK0 E;  1D1C A;  3DP7 A;  3K8P C;  2CBJ A;  2IC6 A;  2BVL A;  2CHN A;  4HGA A;  2BZB A;  5C8Y E;  5LCY A;  2YEV C;  2YDQ A;  2B76 A;  3ZN1 B;  1E1H B;  2H88 A;  4OYJ A;  5ETW A;  1SE7 A;  3UQ4 A;  3RGL A;  3RRC A;  4NUV A;  1JNZ A;  1ZOY A;  2CLY B;  3N2K E;  5LB7 B;  3RYH E;  4O2B E;  5LMU T;  3P8C D;  2BBH A;  4XZC A;  1UUS A;  2HN1 A;  1BR2 A;  1Y64 B;  3LBX A;  2A2F X;  2ODV A;  3VKG A;  4KI0 F;  4ZOL E;  4LFC T;  5LJN A;  3PV0 F;  1WFD A;  5LHG B;  2GK9 A;  3ESL A;  1FIO A;  2BS3 A;  5JR9 C;  3E08 A;  3H3M A;  2YOE A;  3B57 A;  5LHI B;  1W09 A;  3OKQ A;  4KUM B;  3ZMZ B;  2OLT A;  3O4X E;  4AKL A;  2QRX A;  4AKG A;  5JDH A;  1XMO T;  5LYJ E;  5IWA T;  2XAH B;  3PUR A;  2CCQ A;  4ISS A;  3ANW B;  5FY1 A;  4DR1 T;  2CMR A;  2IDO B;  2X9W A;  3IF8 B;  5LHH B;  3R84 B;  3RH3 A;  4KHP T;  3ZN0 B;  3KBT A;  3FZF B;  4L5G A;  5AQJ B;  3ZCJ A;  1MMD A;  2E5V A;  3KVB A;  1IJ5 A;  4B3T T;  4IDN A;  4AQF C;  1D0Y A;  2DHR A;  2XUE A;  3Q9D A;  2XSA A;  4ILB A;  1V9D A;  3N2G E;  3RYI E;  2NTX A;  3SWH A;  2BKN A;  4NUU A;  2ES0 A;  2XPK A;  5EK2 A;  4MHC A;  1VCT A;  2XQ5 A;  4YXD A;  4ADZ A;  4KP3 C;  5AQI B;  2AE9 A;  4OYK A;  1CUN A;  3P4S A;  2C5K T;  4A97 A;  3ZEF B;  1BR4 A;  2XAQ B;  5L4H A;  2DCF A;  4YTM A;  3JC6 D;  3KV5 A;  2W62 A;  3K3Q C;  2W67 A;  3ZC1 A;  1UK5 A;  2JQQ A;  4ZI3 D;  4V1A v;  1FMW A;  5ABF B;  4OFZ A;  2XAG B;  3RC3 A;  1IJ6 A;  4I50 E;  2CWY A;  1WR6 A;  4DMW A;  3PE0 A;  1OED A;  5FVL A;  5FKY A;  5L4E A;  4O4J E;  1J5E T;  2Z6E A;  4U33 A;  1VOM A;  3O9X A;  4JUY A;  4ZS3 A;  2LSG A;  2J47 A;  4I0U A;  4EAH A;  4DV3 T;  2UXD T;  4DBR A;  4ZEY A;  4QXB B;  5HXS A;  3UUN A;  3PUW F;  3RIA A;  4KMC A;  4GK5 E;  3SS1 A;  3AA1 B;  2N2N A;  2V6Y B;  2VVS A;  2H7V C;  3CQC B;  3GN5 A;  4KX6 A;  2WZH A;  3LDQ B;  4DMV A;  3WI3 A;  4MLK A;  4U74 A;  2VQE T;  2JJ9 A;  2HN2 A;  2CBI A;  3JAE A;  5IYZ E;  5DJQ C;  4PW8 A;  5HEH A;  2CA5 A;  5L3C B;  4HFE A;  2UXX B;  3FZL B;  3TLV A;  3O1H A;  4IL4 A;  4AKR B;  3PUS A;  5LBQ B;  4EOZ B;  4UVC B;  4EIW A;  1KK7 A;  2DLR A;  4CI3 B;  5F5W A;  1ZP0 A;  4BAY B;  5AQG B;  4MAL A;  1G73 A;  4IE4 A;  1GQE A;  5AQT B;  4HWC A;  2FJD A;  5F3J A;  2XAF B;  5HXC A;  2BDE A;  4PNI A;  3ZPO A;  4O4I E;  3N5L A;  1LVF A;  4JI5 T;  1W9R A;  1YKE B;  1LRZ A;  2X0L B;  3IHR A;  3RKG A;  1S94 A;  2YDS A;  3ZMU B;  4X65 T;  3VR8 A;  3AEE A;  3VHL A;  3ZYK A;  5AQM B;  2VQF T;  4OK0 A;  4IGU A;  5HWY A;  3NRY A;  3MXZ A;  3V5U A;  4ILC A;  3UUL A;  5FXW A;  2B1E A;  4JI3 T;  4PK6 A;  2LSK A;  2QA7 A;  2SPC A;  3HKC E;  5L2L A;  5FXX A;  3RIU C;  5JRE A;  2LE8 A;  1ZV4 X;  1E2A A;  2BKO A;  4E7Z A;  4JEH B;  3AE1 A;  3ANW A;  4NXM T;  2PTF A;  2UXN B;  5HXR A;  4QH4 A;  4G63 A;  2IHR 1;  3PUQ A;  4H9P C;  2WMO A;  3FZM B;  4AXP A;  1U5P A;  3BK9 A;  3QC9 A;  5C2T A;  5FP3 A;  4IE5 A;  2XM2 A;  4JI6 T;  1WLX A;  3UT5 E;  2XAJ B;  4K0U A;  4H9R C;  3AXJ B;  5HEU A;  1D0X A;  1J5W A;  5AQV B;  3Q5D A;  2WBL A;  4O4H E;  4CXY A;  3ZJ2 A;  4CZZ B;  3RI5 A;  5CFB A;  3TLT A;  3K3N A;  4P0B A;  2L9Q A;  5HXE A;  3HKE E;  4IE7 A;  3P4P A;  3AAE B;  2MPK A;  3AE9 A;  2IAK A;  3I9Y A;  1Z8U A; 
#chains in the Genus database with same CATH homology
 4OYJ A;  5ETW A;  4H9O C;  2P9B A;  3C4W A;  3RRC A;  1HF8 A;  1NWM X;  1YD8 G;  2VKJ A;  2YIN A;  2DI4 A;  4NUV A;  2LSY A;  4ZHQ E;  2YU1 A;  3MJX A;  2OA5 A;  5ADX L;  2KIN B;  1WRD A;  2CLY B;  2I59 A;  4E7S A;  1MMA A;  3N2K E;  4IIJ E;  3Q2M A;  3FBZ A;  4DVD A;  2VB6 A;  5DAB A;  4WNK A;  2PBI A;  2LOP A;  3ZYM A;  3RYH E;  3A5X A;  4O2B E;  4AQF A;  2G0U A;  3P8C D;  2EHO C;  2ACX A;  3KV9 A;  4DND A;  4JEU B;  3F57 A;  3J9X 1;  4CQI A;  2DWK A;  1OXZ A;  4L0R A;  4XZC A;  4ZI2 C;  3QUJ A;  3NRX A;  1BR2 A;  4X1I E;  1Y64 B;  5FYM A;  1T98 A;  3LBX A;  3Q5W A;  3LBX B;  2A2F X;  2K5B B;  2ODV A;  4YLH A;  3PDY A;  3RYC E;  2NW7 A;  3VKG A;  3E22 E;  3OYX A;  4IE6 A;  4ZOL E;  2HPJ A;  5J1G A;  2D2S A;  5LJN A;  2W00 A;  3MAC A;  5L3D B;  4HTE A;  5JQG E;  3TKL B;  5JH7 E;  5LHG B;  2GK9 A;  3ESL A;  1FIO A;  5JDQ A;  5KMG P;  1D1B A;  1HX8 A;  2CM0 A;  5JR9 C;  3E08 A;  4YJ2 E;  2KWI B;  3RKO A;  3GMI A;  4PJN A;  4UVA B;  3B57 A;  5LHI B;  2LJL A;  3F2E A;  4QXC B;  3OKQ A;  4KUM B;  5L3F B;  2ZMA A;  3ETV A;  3ZMZ B;  2RP4 A;  4L9I A;  3O4X E;  4AKL A;  4O8S A;  4AKG A;  1MMG A;  2KT9 A;  5DQW A;  2D0U A;  3AVS A;  2MBG A;  5LBM A;  4EZ4 A;  1YW0 A;  4HEA A;  5JDH A;  2V1D B;  5LXT E;  5L3E B;  5LYJ E;  3GA8 A;  3H37 A;  2LT3 A;  2X66 A;  3HKB E;  2XAH B;  3OJA A;  4QWN B;  5JR9 B;  2NOX A;  1MNE A;  3F31 A;  5E0O A;  4B6X A;  2H7O A;  4PK5 A;  2C0S A;  4QXH B;  5F8P A;  3PUR A;  3AA6 B;  4DO0 A;  2CCQ A;  4ISS A;  2Y6X A;  3ANW B;  5TAO A;  4AKH A;  1MIV A;  5FY1 A;  3HI2 A;  2E9X A;  2E9X B;  1MIW A;  2ZM2 A;  3CML A;  2H3R A;  2LHN A;  2CMR A;  3LFM A;  3NZP A;  4JLE A;  4MFR A;  4PJL A;  4MBQ A;  5EK4 A;  4OHF A;  2X9W A;  3IF8 B;  4P09 A;  5LHH B;  2RA1 A;  4FI5 A;  3ZMV B;  3R84 B;  2EHO D;  3JC6 C;  3ZLI A;  4QKN A;  4ZI2 D;  2X9Y A;  2MTQ A;  2N1G A;  3RH3 A;  2XTL A;  3WAK A;  3ZJ1 A;  4I55 E;  2WMN A;  3ZN0 B;  3KBT A;  3AAA B;  4UIG A;  5J2U E;  2VKD A;  3MK7 C;  1ZHC A;  5KDM C;  4I4T E;  2VL8 A;  5FY0 A;  4L5G A;  4PAG A;  4HN9 A;  4ZI3 C;  4GYR A;  3CQX C;  5JDM A;  3E0Z A;  2V7L A;  3C64 A;  2CLY C;  4WBO A;  3ZCJ A;  1HTJ F;  4AI6 A;  1MMD A;  2CE7 A;  1U4Q A;  3FHN A;  3KVB A;  1IJ5 A;  4ZS2 A;  2V7J A;  2CXD A;  3EDU A;  1D0Y A;  2DHR A;  4AQF C;  2XUE A;  2V7M A;  3PU8 A;  3Q9D A;  3NZQ A;  4C91 A;  3CVR A;  4H9S E;  4EXT A;  5L3G B;  1V9D A;  3N2G E;  5LGT B;  3RYI E;  2NTX A;  5LA6 E;  5J2T E;  3SWH A;  4QHO A;  3ONX A;  1AJ3 A;  2V26 A;  4NUU A;  3CWZ B;  2ES0 A;  3AA7 B;  1Z0P A;  4IHJ E;  3RPU A;  3N9Q A;  5EK2 A;  5IHY A;  2ZM0 A;  4MHC A;  4X1Y E;  3LK2 B;  4EB6 E;  2HPL A;  5JVD E;  1BR1 A;  2JMH A;  4U72 A;  1NAF A;  4CI1 B;  1EZ3 A;  3EDV A;  3MZK B;  2NP9 A;  4ADZ A;  4KP3 C;  3PUG A;  4ILU A;  2X9H A;  4OYK A;  1CUN A;  2MOZ A;  1QSD A;  3OYZ A;  3R6N A;  4CI2 B;  2C5K T;  3ZEF B;  1BR4 A;  1SHZ C;  2XAQ B;  4HE8 A;  2DCF A;  4G2A A;  4O2A E;  2W0G A;  3IEE A;  3SOL A;  5AFU L;  3C50 A;  5JDF A;  3JC6 D;  3KV5 A;  3BQI A;  3KVA A;  2NTY A;  2ODU A;  2W62 A;  3K3Q C;  1ZKE A;  4EYU A;  3KV4 A;  3PUA A;  4BJM A;  2VK9 A;  2CXL A;  3AB3 B;  4UEM A;  2Q9Q A;  2Q9Q B;  4UVB B;  1KNZ A;  3IBP A;  4UF0 A;  4UF0 B;  1UX5 A;  3ZC1 A;  2E9X C;  2JQQ A;  3HR0 A;  4ZI3 D;  3ZMT B;  4V1A v;  1FMW A;  1FEW A;  3PTR B;  4EYY R;  1ZEE A;  2JRK A;  2WWU A;  4OFZ A;  5FMN A;  5H6R B;  4M1P A;  2XAG B;  3RC3 A;  2WAU A;  3UUM A;  2PFV A;  5JDL A;  1IJ6 A;  4I50 E;  3UFE A;  4HFV A;  2EHO A;  3V5S A;  2CWY A;  1WR6 A;  4DMW A;  2JMK A;  4YFS A;  3PE0 A;  2Y48 B;  2D0T A;  3HKD E;  3ZYL A;  3H3A A;  5LOV E;  2JPF A;  4IDZ A;  5GON E;  2CEA A;  3C98 B;  2QGS A;  5H6Q B;  4BJN A;  3KFW X;  4O4J E;  4PFO A;  3CKD A;  2Z6E A;  3I0Q A;  3CX8 B;  1VOM A;  1UCU A;  2KZ7 B;  4C90 A;  2NW8 A;  3O9X A;  2CWO A;  1HCI A;  2VKO A;  2WSS V;  3T8O A;  4TV8 E;  3RX6 A;  4H63 V;  1MMN A;  3HA4 A;  3MKD A;  4JUY A;  4DBQ A;  4ZS3 A;  2LSG A;  4H63 H;  1UX4 A;  4EAH A;  1X79 A;  4IST A;  3W15 B;  2YK0 A;  4TUY E;  3N9L A;  2XQY A;  4UV9 B;  2W63 A;  3RYF E;  4PJJ A;  5FXV A;  3ZCI A;  4DBR A;  2WM9 A;  3AVR A;  4UXN B;  4QXB B;  3VKH A;  2Y8D A;  3O1I A;  2NWB A;  5HXS A;  3LJC A;  5FNV E;  3C51 A;  3UUN A;  2VAS A;  2X51 A;  3Q5X A;  3J7Y q;  1QUU A;  4KMC A;  5LG4 A;  3CX6 B;  1H7C A;  4GK5 E;  1VRB A;  4Z8X A;  3AAI A;  3AA1 B;  3SS1 A;  1IZN B;  2N2N A;  1IAP A;  2KMF A;  3KDS E;  2LOS A;  2PG8 A;  4QX8 B;  2PJQ A;  4TV9 E;  3RRW A;  4H9Q C;  2H7V C;  2KND A;  2LM9 A;  3CQC B;  3GN5 A;  5JRC A;  3DJB A;  3FBL A;  3GWH A;  4PJM A;  2E9X D;  3U78 A;  3D0T A;  4DMV A;  2KLQ A;  1D1A A;  3WI3 A;  1BR0 A;  4TN7 B;  4ASK A;  4ZI7 E;  4MLK A;  4U74 A;  2KWH A;  3UTK A;  1WYC A;  4XAX B;  5EK3 A;  2KXP B;  4YHJ A;  2JJ9 A;  4I43 B;  1LVK A;  5HXH A;  2HH7 A;  4YJ3 E;  5IYZ E;  5DJQ C;  2A72 A;  4CXX A;  2BVM A;  1HG5 A;  2LHR A;  4PW8 A;  5HWX A;  2M67 A;  2CA5 A;  5L3C B;  5JDN A;  2IW5 B;  4TX5 A;  1FMV A;  2K9A A;  2UXX B;  2L8K A;  2ZLY A;  5DQV A;  3MA9 A;  3BQL A;  4GOU A;  3BQK A;  1S35 A;  3NBX X;  3O1H A;  4AKR B;  2Q9Q C;  3PUS A;  5LBQ B;  5LGN B;  4EOZ B;  2C5I T;  2DNX A;  2IC9 A;  2J1D G;  2X68 A;  4UVC B;  5JDG A;  5FXZ A;  4EIW A;  1KK7 A;  2DLR A;  5LGU B;  2K24 A;  3LK4 2;  3N9O A;  2D5U A;  5M4Y A;  4X20 E;  4UEL A;  3ZC0 A;  4O4L E;  3ETU A;  1HG2 A;  2ZM8 A;  4CI3 B;  4CXW A;  3L09 A;  4BAY B;  4MAL A;  1G73 A;  1YKH B;  3DTO A;  1B7T A;  2X67 A;  3QK6 A;  4IE4 A;  4UV8 B;  1D0Z A;  3KIN B;  5CB4 E;  3I9W A;  5F3J A;  2XAF B;  5KX5 E;  5LJM A;  3B13 A;  5HXC A;  5CA1 E;  4WBN E;  2BDE A;  4PNI A;  3ZPO A;  1MIY A;  4O4I E;  3N5L A;  1LVF A;  4AQG A;  4ERR A;  4TZ4 C;  1O3X A;  5EZY E;  4XBF B;  3N9M A;  1YKE B;  4PFP A;  1LRZ A;  3CQG B;  2X0L B;  3C4X A;  3IHR A;  3KBU A;  1WYB A;  4PK4 A;  1S94 A;  2VWA A;  2VKH A;  3CX7 B;  2E8I A;  3N9P A;  3ZMU B;  2V7K A;  5LNK A;  3VHL A;  2EHO B;  3ZYK A;  2C5J A;  2X9X A;  2NW9 A;  4OK0 A;  2XHE B;  1US7 B;  4IGU A;  2V7I A;  5HYA A;  1MND A;  3SRZ A;  4ANJ A;  5HWY A;  3NRY A;  3MXZ A;  3V5U A;  3UUL A;  3HL6 A;  5FXW A;  2B1E A;  4AKI A;  4PK6 A;  2CXF A;  3L3P A;  3RC8 A;  2LSK A;  2QA7 A;  2SPC A;  3HKC E;  3N2O A;  5L2L A;  3ZMS B;  5FXX A;  5L3B B;  3FB2 A;  4WW0 A;  3U3I A;  2A3D A;  5JRE A;  4QX7 B;  4F6R C;  2LE8 A;  3S4U A;  2YU2 A;  3AA0 B;  1ZV4 X;  5JR9 A;  5BMV E;  4E7Z A;  3UUX B;  3FXE B;  4A56 A;  2DWG A;  3O1J A;  4GYS A;  2L3L A;  4JEH B;  2N9D A;  4GIW A;  2Q9Q D;  5HAX A;  3N9N A;  3EUH A;  3ANW A;  5A1L A;  2UXN B;  4KBM B;  4HKA A;  5LP6 E;  5HXR A;  1G8X A;  1SA0 E;  3FXD B;  4G63 A;  3M65 A;  4J2C A;  3PUQ A;  3K3O A;  2LSI A;  3LK3 B;  1OWA A;  2WMO A;  3LG7 A;  4H9P C;  4BA9 A;  1HS7 A;  3KV6 A;  3CPZ A;  4AXP A;  1U5P A;  3BK9 A;  3QC9 A;  3PU3 A;  5FP3 A;  3C4Z A;  4IE5 A;  4H9N C;  2K48 A;  3I0O A;  1WLX A;  3UT5 E;  3P7I A;  2XAS B;  2XAJ B;  2LSJ A;  4K0U A;  4N78 D;  4H9R C;  4X1K E;  3OBV E;  3GN5 B;  1D0X A;  4GK0 E;  5JRC B;  1D1C A;  3DP7 A;  3K8P C;  4P0A A;  2IC6 A;  2WBL A;  4O4H E;  4CXY A;  3EVY A;  3ZJ2 A;  2BVL A;  4CZZ B;  4HGA A;  2BZB A;  4IE0 A;  3I1A A;  2LEH A;  5LCY A;  5C8Y E;  3K3N A;  5CA0 E;  4P0B A;  2L9Q A;  2YEV C;  5HXE A;  3HKE E;  4EZH A;  3WAJ A;  1HFA A;  4FJO A;  3AAE B;  4IE7 A;  1LKX A;  2MYS A;  3ZN1 B;  1E1H B;  3I9Y A;  2IAK A;  2W61 A;  3VU7 H;  5FY7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...