4OX9T

Crystal structure of the aminoglycoside resistance methyltransferase npma bound to the 30s ribosomal subunit
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
publication title Molecular recognition and modification of the 30S ribosome by the aminoglycoside-resistance methyltransferase NpmA.
pubmed doi rcsb
source organism Escherichia coli
total genus 33
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2014-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 4ox9T00
1IBMT 4DR4T 4JI5T 4JI4T 4JV5T 1HNWT 4DV0T 4NXMT 1J5ET 2UUAT 4LF7T 4DV2T 4DUYT 4LF8T 4X66T 1XNQT 2UUCT 4JI7T 1IBKT 4DV6T 4DR1T 2UXCT 4JYAT 4DV3T 4X65T 4JI6T 4JI2T 5LMNT 4JI1T 4LFCT 4B3ST 4DR6T 4X62T 4DV1T 2UUBT 2UXBT 1IBLT 4KHPT 4DV7T 4B3RT 2VQFT 2ZM6T 1N34T 4NXNT 4LF4T 1XMQT 4OX9T 4GKJT 4DR5T 5IWAT 4DV4T 4LF9T 5LMUT 5BR8T 1XNRT 1N36T 4JI8T 4JI0T 3T1YT 4B3TT 4LFAT 2VQET 4LF5T 4LF6T 4X64T 4GKKT 1FJGT 1HNZT 1XMOT 2UU9T 1I94T 1HR0T 4DR7T 4DV5T 3T1HT 4DR3T 4YY3T 4DR2T 2HHHT 4K0KT 1N32T 4JI3T 2UXDT 3OTOT 4AQYT 4B3MT 1HNXT 4DUZT 2E5LT 4YHHT 2F4VT 1N33T 4LFBT
chains in the Genus database with same CATH superfamily
3SOLA 2N9DA 2FBWA 4HEAA 4YJ3E 5LNKA 5F3JA 5LGNB 2DI4A 3QUJA 2HN1A 2NR4A 2XQ5A 5AQVB 4ASKA 4I0UA 3TLUA 3P8CD 4Z8XA 3RLFF 3ANWB 4WYVA 1FMVA 1W9RA 2BG9B 2EHOC 2IUBA 2X67A 5LHGB 2IAKA 4ZOLE 5ADXL 4CZZB 4ZEYA 5JR9A 3CWZB 2ODUA 3ZT7A 3CQXC 3RI5A 3T1YT 4B3TT 4HE8A 5JVDE 2VQET 3JAFA 3OYZA 5C3JA 1NEKA 2I0MA 4GKKT 3RRCA 4DV5T 2IHR1 4CN6A 4QH5A 4K0KT 5L3BB 2LM2A 3VU7H 4JI3T 3FB2A 2ES0A 1IJ5A 1HX8A 4B3MT 2M67A 3IHRA 3FZMB 3ZT6A 4YHHT 5AFUL 1W09A 4IDPA 1BR1A 5AQFB 4IT4A 2CE7A 4DVDA 4IE6A 3AE5A 1D1AA 4JEHB 2UUAT 4YSXA 2K9AA 1D0XA 1FEWA 1MMDA 2ACZA 2CM0A 3A7MA 3PUSA 5FYMA 5H6RB 2CXFA 3ZPOA 3RKGA 2Y8DA 2KWHA 4KHPT 4DV7T 3ZJ2A 2E9XC 5FY0A 2ZM6T 5ETWA 3PE0A 4PW8A 5L4EA 2E8IA 3KINB 2AE9A 4LF4T 2BKOA 4UF0A 4X5TA 3C64A 4JI0T 5LA6E 2CXDA 4A98A 5J1GA 3AAEB 3GN5A 1WRDA 2IIUA 3PUWF 2A3DA 1FJGT 1QUUA 1I94T 3FBZA 1HR0T 2FUPA 4H63V 4TWDA 1LKXA 2XSAA 5DQWA 2EHOA 5IUXA 3RKOA 4PK5A 3AEDA 3UUNA 3TLTA 4XZCA 4DMVA 4EYYR 3FZLB 3C4XA 3EHZA 2AXDS 3IF8B 5JDMA 1HG5A 2PFVA 3JADA 3GWHA 1IBMT 4DR4T 2V6XA 2WAUA 3OJAA 5DQVA 3KBUA 5CGMA 3PUXF 2WY2A 1XNQT 4MHCA 4ILUA 2YU2A 2W67A 3LSVA 1U4QA 3H37A 4JI2T 5FP3A 5LMNT 3RC8A 2Q9QB 1ZV4X 3WAKA 1KF6A 5TAOA 4ZI3C 3KV6A 1D1BA 5HXHA 3KVBA 2CWYA 5ABFA 2W00A 5LMUT 1V9DA 4OYKA 5FL1A 3L3PA 4OYJA 3C98B 3X1DA 2WU2A 1QLBA 1WYCA 2CXLA 3Q5EA 2H89A 3LK42 3UQ7A 2RP4A 4JLEA 4A97A 2E2AA 1I6ZA 4P0AA 2E9XA 3O1JA 3RIFA 4DMWA 5HEJA 4PAGA 2WSSV 2XZEA 1AJ3A 3CIRA 4TV8E 4AKGA 1J1JA 2E5LT 3AEFA 5HEGA 3AE7A 4U2ZA 4ZZBA 3G06A 4YTPA 4HN9A 3C51A 2C5IT 3HKCE 5JDFA 1IZNB 3WI3A 4HFHA 3ESLA 5AQKB 4CN1A 3RQUA 4H9RC 2D9DA 3BQLA 3QB5A 5JDNA 4AIUA 1E7PA 3AE2A 4H63H 5KMGP 2Z6EA 3ONLC 3ZMSB 3P7IA 3NRXA 5JR9B 3HKBE 1OEDC 1B7TA 5AQOB 2QYWA 2A72A 3TKLB 5CA1E 4EGWA 4HFCA 3N9PA 3MACA 3AA6B 3K1SA 4JI8T 4U7IA 5LYJE 4ZI2C 2CEAA 4IDOA 3H3MA 4PK4A 3V5SA 1HNZT 3J9X1 1FIOA 3PV0F 3ZKRA 2KNDA 5DJQC 4EIWA 4CXXA 3F57A 4IE7A 3N2KE 3AVSA 2CRBA 2IC9A 4BJMA 1SA0E 4DR3T 2WDRA 4UVBB 3N9MA 4UV8B 4QH4A 3VHLA 4COFA 1IJ6A 4YHJA 3K8PC 2UXDT 2WB5A 2IW5B 2Q9QD 2V6YA 2H88A 4TNVA 5AQPB 5JQGE 2JMHA 3C4WA 3N9LA 4X20E 2LT3A 2PBIA 2IC6A 1QSDA 3AA7B 2FJAA 5CB4E 2XPKA 1E2AA 2LSJA 3AXJA 5ABHA 4TWHA 2H7OA 4AQGA 1Y64B 5LBMA 2UXCT 2XUEA 1SE7A 1DU2A 4DNDA 2H7VC 1MNDA 2X9WA 2VASA 2UXBT 3O4XE 3JAEA 2WMOA 1EZ3A 2PTFA 1HTJF 3UT5E 1N34T 3UU5A 3PUZF 3V5UA 3AE4A 4PFPA 2BZBA 3A8YC 1G73A 4P0BA 1VCSA 1MMAA 1LVFA 2LKHA 2X0YA 4J2CA 1L0VA 2BKPA 5AQRB 4HWHA 1N36T 1US7B 4H9OC 4BJNA 3ZEFB 2V7LA 3OKQA 5C8YE 3KDSE 3S4UA 4YJ2E 3LG7A 2XQ6A 3AA0B 4E7SA 2V7MA 4GIWA 3ZCJA 2LOSA 4IE4A 4UVCB 1ZHCA 1WR6A 2VVSA 1O3XA 5DABA 3EAMA 1KK7A 1OEDA 3AE6A 3AE1A 2XAQB 3UQ4A 2XTLA 2M6BA 4TZ4C 3MXZA 3UFGA 3E0ZA 1KFYA 4JV5T 3T8OA 1H7CA 4UEMA 2G0UA 4CI3B 3ZMUB 4LF7T 3ETUA 2WDVA 2WWUA 4GYSA 3RIAA 3M3ZB 3B13A 2CHNA 3PU8A 4ERRA 4AI6A 3CMLA 4JI1T 4HGAA 4Q25A 1BR0A 4B3RT 4X1KE 3JCFA 2BDEA 2V1DB 5A1LA 2VVNA 3NVOA 5AQSB 5LGTB 3NZPA 2BVMA 2NOXA 5FNVE 4LFAT 3QOFA 5AQJB 3P4RA 3RC3A 3AEGA 3KV9A 3ETVA 2J4GA 5FVLA 5AQIB 3VRBA 2MAWA 2E9XB 3OPCA 3RYHE 3HKDE 3F2EA 3RQWA 3ONXA 4G63A 2LSYA 4KP3C 3GA8A 3FBLA 2ZM8A 4NPPA 2VKJA 4MLKA 4EOZB 3VR8A 5JDGA 5LHHB 2ZMAA 3NKZA 3C4ZA 3HL6A 3HA4A 2NP9A 3CX7B 3TLWA 2Y48B 4NIQA 2X9YA 5HEUA 3W15B 3N5LA 2YOEA 4DV0T 1J5ET 3AAAB 4JUYA 5HXCA 2OV9A 1VCTA 5CFBA 2NW7A 2LE8A 3F31A 3UUMA 3B57A 4JYAT 4QX8B 3VKGA 3C50A 2K3WA 4IDQA 4MBQA 2RPAA 5IYZE 5JRCB 4KX6A 4HTEA 2B1EA 2EHOD 4NXNT 1XMQT 3P4PA 4GKJT 4IL4A 4ZI7E 3AE9A 4DR5T 5BR8T 4GOUA 1VRBA 3CQCB 4UR9A 2GK9A 4QHOA 1WLXA 2YU1A 2BG9E 2XQ9A 1WFDA 4YTMA 4QWNB 5JDHA 1W0BA 2XQAA 3DJBA 3U78A 2UU9T 2JQ9A 3ZLIA 3U3IA 3ZC0A 2VWAA 4IIJE 4ZS3A 3EDVA 4C90A 2CPTA 4LMJA 5HCMA 1ZOYA 4WNKA 2KMFA 5LB7B 2ZM0A 1GQEA 5FXWA 4ZS2A 5AQMB 5LGUB 2D2SA 3LBXB 3AXJB 3SFDA 5J2TE 4O4JE 3RYFE 4PJLA 3SS1A 5L47A 4I4TE 1HCIA 2XAJB 1JNZA 2W63A 4IE0A 3AAIA 4YXDA 3I1AA 2KWIB 2JJ9A 2WWVA 3FXEB 5JDLA 5AQLB 4O4HE 2W2UA 2E9XD 1BR4A 4LMLA 5LG4A 2LKGA 2C5JA 5HEOA 4GK0E 1ZP0A 4L0RA 1YKEB 3R6NA 3AVRA 3Q5DA 4LF9T 3NZQA 2JQKA 5IHYA 2VK9A 3ZJ1A 4UXNB 2OLTA 4V1Av 4X64T 1HFAA 4NUUA 4JEUB 2CBJA 2YDSA 3VRAA 1UX4A 1KNRA 4UELA 3LDQB 4CXWA 5LJNA 1E1HB 3NWIA 3CK6A 5F5WA 1UCUA 1N32T 4TNWA 3Q5XA 4PJNA 5AQQB 4U31A 2UXXB 3FZHB 3OTOT 3DTOA 4OK0A 2N1GA 3IEEA 2BS3A 1CHUA 2IDOB 2KXPB 4AKLA 4ZXLA 1X9BA 1T72A 1CUNA 2QVAA 3RX6A 4YSYA 2NWBA 2LJLA 4BAYB 3ZC1A 2WM9A 2XY8B 4E7ZA 3ANWA 4L5GA 4MALA 5HXEA 1S94A 2A2FX 3AEAA 3UU3A 5HWXA 1IAPA 2R6GF 2WMNA 1XDPA 2V7KA 4HWFA 1YW0A 2XAHB 2MPKA 4EXTA 3LK2B 2NW8A 5LOVE 3IBPA 2JQHA 5ABEA 2X9HA 4AQFC 5LXTE 3PJAA 2V26A 5FVKA 3QK6A 1FMWA 1KNZA 2YKSA 2I6HA 1SUMB 3OYXA 2J1DG 4QX7B 5JTGA 3MZKB 5HYAA 2LOPA 2Q9QC 4LF6T 4CI1B 3ZSTA 2Y6XA 3NBXX 1BR2A 5HXSA 1HS7A 2NW9A 2CBIA 3RYCE 5FMNA 4ILCA 5C2TA 4M1PA 1UK5A 2FJBA 4QKNA 3WAJA 4ADZA 3KVAA 1Y01A 3JC6C 4XBFB 3RRWA 4H9SE 4U2YA 2PJQA 2MYSA 5EK4A 3BK9A 4PK6A 2KINB 1MMNA 4G2AA 3UU6A 2KLQA 2YDQA 4XAXB 1UUSA 4IREA 4WW0A 3CX6B 2LLYA 4NUVA 5LCYA 5GONE 1X79A 4KBMB 2LRKA 4DV1T 2XQ3A 2YDRA 5FY7A 3R84B 3QB5K 2J47A 3D0TA 4UV9B 4KI0F 4FJOA 4IL9A 1XDOA 4DO0A 3UULA 4DIDB 1KNPA 3VR9A 4YFSA 1U5PA 5HEHA 2WU5A 4ZI2D 2WDQA 4KHZF 4UF0B 3M65A 4IGUA 3UFEA 4EZHA 5L3EB 4EYUA 1YD8G 5LHIB 1JNRA 3SRZA 4YT0A 4AQFA 2I59A 3GN5B 4HWDA 3RIUC 1ZEEA 2WP9A 2V7IA 4TN7B 2V7JA 2NTXA 1T8BA 2L9QA 4HKAA 5HWYA 3NRYA 4O2BE 3SWHA 4PNIA 2EHOB 3UTKA 2HN2A 2LRLA 2BBHA 5L3CB 2Q9QA 4LF8T 1D0ZA 2VKOA 3UU8A 3I9WA 4WBOA 5AQNB 4TX5A 2VKHA 5AQTB 2W0GA 4DV3T 2XQYA 2J62A 2D0UA 4LFCT 4AISA 1M7KA 3PUGA 3PDYA 3QC9A 3L09A 2VQFT 1MMGA 2ACXA 2BS4A 3L8RA 4OX9T 4EEBA 4EV6A 3ZN1B 3P4QA 5IWAT 4X1IE 3LJCA 1XZYA 5LBQB 2CLYC 2QRXA 4U72A 1UX5A 5KX5E 3LK3B 2LSKA 4A5XA 5AQHB 2XSBA 5ABFB 3FHNA 2WQYA 3ZCIA 3AB3B 2JRKA 3K3OA 4DR2T 3O9XA 4WBNE 3PTRB 5FXVA 3HR0A 4ZZCA 2LSGA 1HNXT 3PJAJ 4DUZT 2D0TA 3ZMTB 4H9PC 4O8SA 2KT9A 3CKDA 5L4HA 2YK0A 2HPLA 2KZ7B 2JQQA 5CJ5A 3AEEA 1IBKT 1WR0A 5AQGB 4AKHA 3K3QC 4JBWF 3B5MA 3N9NA 5FXXA 4ILAA 4WZXA 4L9IA 4P1NA 1VOMA 4IHJE 3RIUA 2WS3A 4PFOA 5LJMA 3ZYKA 4F8HA 5KXJA 3CPZA 2LEHA 4OHFA 1HG2A 4F6RC 5L3GB 3TLVA 3KV5A 3OBVE 1D1CA 3AE3A 3O1IA 2UXNB 2OA5A 2XHEB 3BQIA 4FI5A 4CXYA 4H9NC 3FZKB 3ZMZB 5FKYA 1Z0PA 3I0OA 3J7Yq 2JPFA 5BMVE 4HFEA 2PG8A 2D5UA 4HFBA 4OFZA 3HI2A 4O4IE 2DHRA 3T1HT 2W61A 2VL8A 2WBLA 2DCFA 4YY3T 3AA1B 4TV9E 2QGSA 3EI0A 1WYBA 3CX8B 1UGOA 3CVRA 3RPUA 2BG9C 3ZT5A 4ZHQE 3Q5WA 1HNWT 4NXMT 4A56A 4DV2T 2V6YB 3N9QA 1WCRA 4K0UA 2UUCT 5H6QB 4B3ST 3QNUA 3UUBA 3ZSSA 2ODVA 5KDMC 4MFRA 3RH3A 3P4WA 3KFWX 3CQGB 4ISSA 3LFMA 3UU4A 1NAFA 3MKDA 4UIGA 4U74A 3SFEA 4HFVA 3RF1A 4EAHA 3PUVF 5HCJA 5FL0A 2K5BB 2XQ7A 2B76A 4U33A 1YKHB 1J5WA 2M6IA 3Q9DA 2YEVC 3O1HA 2CWOA 3IA3A 1OXZA 3EUHA 2DL1A 2LHNA 3FXDB 4O2AE 3AE8A 2HH7A 2XASB 4YSZA 2LM9A 2HHHT 3KV4A 2WZIA 1XWMA 3AECA 3I9YA 2F4VT 4DBQA 4LFBT 3N2OA 4IDZA 5E0OA 4YLHA 4KMCA 4JI4T 2LSIA 4GYRA 1OEDB 1T7SA 3PUQA 2CMRA 5JDQA 2W62A 4GK5E 4DV6T 3OVUA 4X65T 4X62T 3TLSA 2SPCA 1IBLT 5FXZA 5L2LA 3N9OA 2V5CA 4IDNA 4I55E 2XQ8A 3E22E 2BG9A 2L3LA 2X68A 4PJJA 4N78D 2NTYA 2V8SV 1NWMX 2K24A 3AEBA 1XNRT 4EZ4A 4C91A 4P09A 2JMKA 2XJ7A 2H3RA 4ZI3D 2CCQA 3P4SA 1S35A 2E5VA 3ZYMA 4TUYE 3ONJA 4I43B 2VL0A 5EK3A 4U7YA 3PUYF 2BKNA 5JH7E 4QH1A 2BS2A 2BBJA 1OWAA 3RYIE 4BA9A 4HWIB 2ZM2A 3EVYA 2ZLYA 2W4XA 4JI5T 3ZYLA 1OEDE 2XM2A 2WCAA 4QXCB 5J2UE 2MOZA 4TWFA 1YQ3A 1MIYA 3HKEE 4DUYT 3RGLA 1R8IA 2VURA 2DLRA 5M4YA 4X66T 5JRCA 4JI7T 2IMLA 2C5KT 1ZKEA 4I50E 4DR1T 2JIWA 1UURA 4JI6T 4LMKA 2FJEA 2N2NA 4PJMA 4DBRA 4DR6T 1HX1B 2UUBT 4Z91A 1KEYA 3BQKA 2RA1A 1LRZA 2V5DA 2VKDA 4B6XA 5ABGA 3H3AA 4U3CA 4HWCA 3N2GE 5HXRA 3K3NA 2MBGA 2X0LB 1Z8UA 4LF5T 4X1YE 4CN4A 3ZMVB 1M62A 2BVLA 4EB6E 3RHWA 4EEDA 1LVKA 3PUAA 4HFIA 5EZYE 4DR7T 3MK7C 3P50A 4O4LE 3LBXA 2X9XA 4H9QC 5L3FB 2KSRA 4CI2B 2LHRA 2C0SA 2CLYB 5HAXA 3VKHA 3I0QA 3EDUA 2WZHA 3PURA 3JC6D 1HF8A 5JREA 4Z90A 3FZFB 4ILBA 3E08A 2DWKA 2MTQA 5JR9C 3Q2MA 1D0YA 4AXPA 4YTNA 5LP6E 3GMIA 3L39A 2X51A 5L3DB 2A9UA 5J0ZA 1YXRA 2K48A 2CA5A 5LG3A 3UUXB 3EABA 1MNEA 4ANJA 2XAGB 4KUMB 3PU3A 1W0AA 2YINA 2YN6A 4QXHB 2X66A 4AKRB 3MA9A 2CHOA 2VB6A 2XQ4A 4HFDA 3ABVA 4AKIA 4DV4T 4ISTA 5AQUB 4CQIA 4QXBB 1T98A 1MIVA 2DWGA 2L8KA 2DNXA 3A5XA 5EK2A 1XMOT 2P9BA 2XM1A 2QA7A 1SHZC 4UVAB 4IE5A 5F8PA 1YQ4A 1G8XA 3KBTA 2XAFB 3MJXA 2HPJA 2X0HA 4AQYT 2W66A 3ZN0B 1NENA 5FY1A 1N33T 1MIWA 3DP7A 5CA0E 2FJDA
chains in the Genus database with same CATH topology
1IBMT 4DR4T 4JI5T 4JI4T 4JV5T 1HNWT 4DV0T 4NXMT 1J5ET 2UUAT 4LF7T 4DV2T 4DUYT 4LF8T 4X66T 1XNQT 2UUCT 4JI7T 1IBKT 4DV6T 4DR1T 2UXCT 4JYAT 4DV3T 4X65T 4JI6T 4JI2T 5LMNT 4JI1T 4LFCT 4B3ST 4DR6T 4X62T 4DV1T 2UUBT 2UXBT 1IBLT 4KHPT 4DV7T 4B3RT 2VQFT 2ZM6T 1N34T 4NXNT 4LF4T 1XMQT 4OX9T 4GKJT 4DR5T 5IWAT 4DV4T 4LF9T 5LMUT 5BR8T 1XNRT 1N36T 4JI8T 4JI0T 3T1YT 4B3TT 4LFAT 2VQET 4LF5T 4LF6T 4X64T 4GKKT 1FJGT 1HNZT 1XMOT 2UU9T 1I94T 1HR0T 4DR7T 4DV5T 3T1HT 4DR3T 4YY3T 4DR2T 2HHHT 4K0KT 1N32T 4JI3T 2UXDT 3OTOT 4AQYT 4B3MT 1HNXT 4DUZT 2E5LT 4YHHT 2F4VT 1N33T 4LFBT
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IBM T;  4DR4 T;  4JI5 T;  4JI4 T;  4JV5 T;  1HNW T;  4DV0 T;  4NXM T;  1J5E T;  2UUA T;  4LF7 T;  4DV2 T;  4DUY T;  4LF8 T;  4X66 T;  1XNQ T;  2UUC T;  4JI7 T;  1IBK T;  4DV6 T;  4DR1 T;  2UXC T;  4JYA T;  4DV3 T;  4X65 T;  4JI6 T;  4JI2 T;  5LMN T;  4JI1 T;  4LFC T;  4B3S T;  4DR6 T;  4X62 T;  4DV1 T;  2UUB T;  2UXB T;  1IBL T;  4KHP T;  4DV7 T;  4B3R T;  2VQF T;  2ZM6 T;  1N34 T;  4NXN T;  4LF4 T;  1XMQ T;  4OX9 T;  4GKJ T;  4DR5 T;  5IWA T;  4DV4 T;  4LF9 T;  5LMU T;  5BR8 T;  1XNR T;  1N36 T;  4JI8 T;  4JI0 T;  3T1Y T;  4B3T T;  4LFA T;  2VQE T;  4LF5 T;  4LF6 T;  4X64 T;  4GKK T;  1FJG T;  1HNZ T;  1XMO T;  2UU9 T;  1I94 T;  1HR0 T;  4DR7 T;  4DV5 T;  3T1H T;  4DR3 T;  4YY3 T;  4DR2 T;  2HHH T;  4K0K T;  1N32 T;  4JI3 T;  2UXD T;  3OTO T;  4AQY T;  4B3M T;  1HNX T;  4DUZ T;  2E5L T;  4YHH T;  2F4V T;  1N33 T;  4LFB T; 
#chains in the Genus database with same CATH topology
 3SOL A;  2N9D A;  2FBW A;  4HEA A;  4YJ3 E;  5LNK A;  5F3J A;  5LGN B;  2DI4 A;  3QUJ A;  2HN1 A;  2NR4 A;  2XQ5 A;  5AQV B;  4ASK A;  4I0U A;  3TLU A;  3P8C D;  4Z8X A;  3RLF F;  3ANW B;  4WYV A;  1FMV A;  1W9R A;  2BG9 B;  2EHO C;  2IUB A;  2X67 A;  5LHG B;  2IAK A;  4ZOL E;  5ADX L;  4CZZ B;  4ZEY A;  5JR9 A;  3CWZ B;  2ODU A;  3ZT7 A;  3CQX C;  3RI5 A;  3T1Y T;  4B3T T;  4HE8 A;  5JVD E;  2VQE T;  3JAF A;  3OYZ A;  5C3J A;  1NEK A;  2I0M A;  4GKK T;  3RRC A;  4DV5 T;  2IHR 1;  4CN6 A;  4QH5 A;  4K0K T;  5L3B B;  2LM2 A;  3VU7 H;  4JI3 T;  3FB2 A;  2ES0 A;  1IJ5 A;  1HX8 A;  4B3M T;  2M67 A;  3IHR A;  3FZM B;  3ZT6 A;  4YHH T;  5AFU L;  1W09 A;  4IDP A;  1BR1 A;  5AQF B;  4IT4 A;  2CE7 A;  4DVD A;  4IE6 A;  3AE5 A;  1D1A A;  4JEH B;  2UUA T;  4YSX A;  2K9A A;  1D0X A;  1FEW A;  1MMD A;  2ACZ A;  2CM0 A;  3A7M A;  3PUS A;  5FYM A;  5H6R B;  2CXF A;  3ZPO A;  3RKG A;  2Y8D A;  2KWH A;  4KHP T;  4DV7 T;  3ZJ2 A;  2E9X C;  5FY0 A;  2ZM6 T;  5ETW A;  3PE0 A;  4PW8 A;  5L4E A;  2E8I A;  3KIN B;  2AE9 A;  4LF4 T;  2BKO A;  4UF0 A;  4X5T A;  3C64 A;  4JI0 T;  5LA6 E;  2CXD A;  4A98 A;  5J1G A;  3AAE B;  3GN5 A;  1WRD A;  2IIU A;  3PUW F;  2A3D A;  1FJG T;  1QUU A;  1I94 T;  3FBZ A;  1HR0 T;  2FUP A;  4H63 V;  4TWD A;  1LKX A;  2XSA A;  5DQW A;  2EHO A;  5IUX A;  3RKO A;  4PK5 A;  3AED A;  3UUN A;  3TLT A;  4XZC A;  4DMV A;  4EYY R;  3FZL B;  3C4X A;  3EHZ A;  2AXD S;  3IF8 B;  5JDM A;  1HG5 A;  2PFV A;  3JAD A;  3GWH A;  1IBM T;  4DR4 T;  2V6X A;  2WAU A;  3OJA A;  5DQV A;  3KBU A;  5CGM A;  3PUX F;  2WY2 A;  1XNQ T;  4MHC A;  4ILU A;  2YU2 A;  2W67 A;  3LSV A;  1U4Q A;  3H37 A;  4JI2 T;  5FP3 A;  5LMN T;  3RC8 A;  2Q9Q B;  1ZV4 X;  3WAK A;  1KF6 A;  5TAO A;  4ZI3 C;  3KV6 A;  1D1B A;  5HXH A;  3KVB A;  2CWY A;  5ABF A;  2W00 A;  5LMU T;  1V9D A;  4OYK A;  5FL1 A;  3L3P A;  4OYJ A;  3C98 B;  3X1D A;  2WU2 A;  1QLB A;  1WYC A;  2CXL A;  3Q5E A;  2H89 A;  3LK4 2;  3UQ7 A;  2RP4 A;  4JLE A;  4A97 A;  2E2A A;  1I6Z A;  4P0A A;  2E9X A;  3O1J A;  3RIF A;  4DMW A;  5HEJ A;  4PAG A;  2WSS V;  2XZE A;  1AJ3 A;  3CIR A;  4TV8 E;  4AKG A;  1J1J A;  2E5L T;  3AEF A;  5HEG A;  3AE7 A;  4U2Z A;  4ZZB A;  3G06 A;  4YTP A;  4HN9 A;  3C51 A;  2C5I T;  3HKC E;  5JDF A;  1IZN B;  3WI3 A;  4HFH A;  3ESL A;  5AQK B;  4CN1 A;  3RQU A;  4H9R C;  2D9D A;  3BQL A;  3QB5 A;  5JDN A;  4AIU A;  1E7P A;  3AE2 A;  4H63 H;  5KMG P;  2Z6E A;  3ONL C;  3ZMS B;  3P7I A;  3NRX A;  5JR9 B;  3HKB E;  1OED C;  1B7T A;  5AQO B;  2QYW A;  2A72 A;  3TKL B;  5CA1 E;  4EGW A;  4HFC A;  3N9P A;  3MAC A;  3AA6 B;  3K1S A;  4JI8 T;  4U7I A;  5LYJ E;  4ZI2 C;  2CEA A;  4IDO A;  3H3M A;  4PK4 A;  3V5S A;  1HNZ T;  3J9X 1;  1FIO A;  3PV0 F;  3ZKR A;  2KND A;  5DJQ C;  4EIW A;  4CXX A;  3F57 A;  4IE7 A;  3N2K E;  3AVS A;  2CRB A;  2IC9 A;  4BJM A;  1SA0 E;  4DR3 T;  2WDR A;  4UVB B;  3N9M A;  4UV8 B;  4QH4 A;  3VHL A;  4COF A;  1IJ6 A;  4YHJ A;  3K8P C;  2UXD T;  2WB5 A;  2IW5 B;  2Q9Q D;  2V6Y A;  2H88 A;  4TNV A;  5AQP B;  5JQG E;  2JMH A;  3C4W A;  3N9L A;  4X20 E;  2LT3 A;  2PBI A;  2IC6 A;  1QSD A;  3AA7 B;  2FJA A;  5CB4 E;  2XPK A;  1E2A A;  2LSJ A;  3AXJ A;  5ABH A;  4TWH A;  2H7O A;  4AQG A;  1Y64 B;  5LBM A;  2UXC T;  2XUE A;  1SE7 A;  1DU2 A;  4DND A;  2H7V C;  1MND A;  2X9W A;  2VAS A;  2UXB T;  3O4X E;  3JAE A;  2WMO A;  1EZ3 A;  2PTF A;  1HTJ F;  3UT5 E;  1N34 T;  3UU5 A;  3PUZ F;  3V5U A;  3AE4 A;  4PFP A;  2BZB A;  3A8Y C;  1G73 A;  4P0B A;  1VCS A;  1MMA A;  1LVF A;  2LKH A;  2X0Y A;  4J2C A;  1L0V A;  2BKP A;  5AQR B;  4HWH A;  1N36 T;  1US7 B;  4H9O C;  4BJN A;  3ZEF B;  2V7L A;  3OKQ A;  5C8Y E;  3KDS E;  3S4U A;  4YJ2 E;  3LG7 A;  2XQ6 A;  3AA0 B;  4E7S A;  2V7M A;  4GIW A;  3ZCJ A;  2LOS A;  4IE4 A;  4UVC B;  1ZHC A;  1WR6 A;  2VVS A;  1O3X A;  5DAB A;  3EAM A;  1KK7 A;  1OED A;  3AE6 A;  3AE1 A;  2XAQ B;  3UQ4 A;  2XTL A;  2M6B A;  4TZ4 C;  3MXZ A;  3UFG A;  3E0Z A;  1KFY A;  4JV5 T;  3T8O A;  1H7C A;  4UEM A;  2G0U A;  4CI3 B;  3ZMU B;  4LF7 T;  3ETU A;  2WDV A;  2WWU A;  4GYS A;  3RIA A;  3M3Z B;  3B13 A;  2CHN A;  3PU8 A;  4ERR A;  4AI6 A;  3CML A;  4JI1 T;  4HGA A;  4Q25 A;  1BR0 A;  4B3R T;  4X1K E;  3JCF A;  2BDE A;  2V1D B;  5A1L A;  2VVN A;  3NVO A;  5AQS B;  5LGT B;  3NZP A;  2BVM A;  2NOX A;  5FNV E;  4LFA T;  3QOF A;  5AQJ B;  3P4R A;  3RC3 A;  3AEG A;  3KV9 A;  3ETV A;  2J4G A;  5FVL A;  5AQI B;  3VRB A;  2MAW A;  2E9X B;  3OPC A;  3RYH E;  3HKD E;  3F2E A;  3RQW A;  3ONX A;  4G63 A;  2LSY A;  4KP3 C;  3GA8 A;  3FBL A;  2ZM8 A;  4NPP A;  2VKJ A;  4MLK A;  4EOZ B;  3VR8 A;  5JDG A;  5LHH B;  2ZMA A;  3NKZ A;  3C4Z A;  3HL6 A;  3HA4 A;  2NP9 A;  3CX7 B;  3TLW A;  2Y48 B;  4NIQ A;  2X9Y A;  5HEU A;  3W15 B;  3N5L A;  2YOE A;  4DV0 T;  1J5E T;  3AAA B;  4JUY A;  5HXC A;  2OV9 A;  1VCT A;  5CFB A;  2NW7 A;  2LE8 A;  3F31 A;  3UUM A;  3B57 A;  4JYA T;  4QX8 B;  3VKG A;  3C50 A;  2K3W A;  4IDQ A;  4MBQ A;  2RPA A;  5IYZ E;  5JRC B;  4KX6 A;  4HTE A;  2B1E A;  2EHO D;  4NXN T;  1XMQ T;  3P4P A;  4GKJ T;  4IL4 A;  4ZI7 E;  3AE9 A;  4DR5 T;  5BR8 T;  4GOU A;  1VRB A;  3CQC B;  4UR9 A;  2GK9 A;  4QHO A;  1WLX A;  2YU1 A;  2BG9 E;  2XQ9 A;  1WFD A;  4YTM A;  4QWN B;  5JDH A;  1W0B A;  2XQA A;  3DJB A;  3U78 A;  2UU9 T;  2JQ9 A;  3ZLI A;  3U3I A;  3ZC0 A;  2VWA A;  4IIJ E;  4ZS3 A;  3EDV A;  4C90 A;  2CPT A;  4LMJ A;  5HCM A;  1ZOY A;  4WNK A;  2KMF A;  5LB7 B;  2ZM0 A;  1GQE A;  5FXW A;  4ZS2 A;  5AQM B;  5LGU B;  2D2S A;  3LBX B;  3AXJ B;  3SFD A;  5J2T E;  4O4J E;  3RYF E;  4PJL A;  3SS1 A;  5L47 A;  4I4T E;  1HCI A;  2XAJ B;  1JNZ A;  2W63 A;  4IE0 A;  3AAI A;  4YXD A;  3I1A A;  2KWI B;  2JJ9 A;  2WWV A;  3FXE B;  5JDL A;  5AQL B;  4O4H E;  2W2U A;  2E9X D;  1BR4 A;  4LML A;  5LG4 A;  2LKG A;  2C5J A;  5HEO A;  4GK0 E;  1ZP0 A;  4L0R A;  1YKE B;  3R6N A;  3AVR A;  3Q5D A;  4LF9 T;  3NZQ A;  2JQK A;  5IHY A;  2VK9 A;  3ZJ1 A;  4UXN B;  2OLT A;  4V1A v;  4X64 T;  1HFA A;  4NUU A;  4JEU B;  2CBJ A;  2YDS A;  3VRA A;  1UX4 A;  1KNR A;  4UEL A;  3LDQ B;  4CXW A;  5LJN A;  1E1H B;  3NWI A;  3CK6 A;  5F5W A;  1UCU A;  1N32 T;  4TNW A;  3Q5X A;  4PJN A;  5AQQ B;  4U31 A;  2UXX B;  3FZH B;  3OTO T;  3DTO A;  4OK0 A;  2N1G A;  3IEE A;  2BS3 A;  1CHU A;  2IDO B;  2KXP B;  4AKL A;  4ZXL A;  1X9B A;  1T72 A;  1CUN A;  2QVA A;  3RX6 A;  4YSY A;  2NWB A;  2LJL A;  4BAY B;  3ZC1 A;  2WM9 A;  2XY8 B;  4E7Z A;  3ANW A;  4L5G A;  4MAL A;  5HXE A;  1S94 A;  2A2F X;  3AEA A;  3UU3 A;  5HWX A;  1IAP A;  2R6G F;  2WMN A;  1XDP A;  2V7K A;  4HWF A;  1YW0 A;  2XAH B;  2MPK A;  4EXT A;  3LK2 B;  2NW8 A;  5LOV E;  3IBP A;  2JQH A;  5ABE A;  2X9H A;  4AQF C;  5LXT E;  3PJA A;  2V26 A;  5FVK A;  3QK6 A;  1FMW A;  1KNZ A;  2YKS A;  2I6H A;  1SUM B;  3OYX A;  2J1D G;  4QX7 B;  5JTG A;  3MZK B;  5HYA A;  2LOP A;  2Q9Q C;  4LF6 T;  4CI1 B;  3ZST A;  2Y6X A;  3NBX X;  1BR2 A;  5HXS A;  1HS7 A;  2NW9 A;  2CBI A;  3RYC E;  5FMN A;  4ILC A;  5C2T A;  4M1P A;  1UK5 A;  2FJB A;  4QKN A;  3WAJ A;  4ADZ A;  3KVA A;  1Y01 A;  3JC6 C;  4XBF B;  3RRW A;  4H9S E;  4U2Y A;  2PJQ A;  2MYS A;  5EK4 A;  3BK9 A;  4PK6 A;  2KIN B;  1MMN A;  4G2A A;  3UU6 A;  2KLQ A;  2YDQ A;  4XAX B;  1UUS A;  4IRE A;  4WW0 A;  3CX6 B;  2LLY A;  4NUV A;  5LCY A;  5GON E;  1X79 A;  4KBM B;  2LRK A;  4DV1 T;  2XQ3 A;  2YDR A;  5FY7 A;  3R84 B;  3QB5 K;  2J47 A;  3D0T A;  4UV9 B;  4KI0 F;  4FJO A;  4IL9 A;  1XDO A;  4DO0 A;  3UUL A;  4DID B;  1KNP A;  3VR9 A;  4YFS A;  1U5P A;  5HEH A;  2WU5 A;  4ZI2 D;  2WDQ A;  4KHZ F;  4UF0 B;  3M65 A;  4IGU A;  3UFE A;  4EZH A;  5L3E B;  4EYU A;  1YD8 G;  5LHI B;  1JNR A;  3SRZ A;  4YT0 A;  4AQF A;  2I59 A;  3GN5 B;  4HWD A;  3RIU C;  1ZEE A;  2WP9 A;  2V7I A;  4TN7 B;  2V7J A;  2NTX A;  1T8B A;  2L9Q A;  4HKA A;  5HWY A;  3NRY A;  4O2B E;  3SWH A;  4PNI A;  2EHO B;  3UTK A;  2HN2 A;  2LRL A;  2BBH A;  5L3C B;  2Q9Q A;  4LF8 T;  1D0Z A;  2VKO A;  3UU8 A;  3I9W A;  4WBO A;  5AQN B;  4TX5 A;  2VKH A;  5AQT B;  2W0G A;  4DV3 T;  2XQY A;  2J62 A;  2D0U A;  4LFC T;  4AIS A;  1M7K A;  3PUG A;  3PDY A;  3QC9 A;  3L09 A;  2VQF T;  1MMG A;  2ACX A;  2BS4 A;  3L8R A;  4OX9 T;  4EEB A;  4EV6 A;  3ZN1 B;  3P4Q A;  5IWA T;  4X1I E;  3LJC A;  1XZY A;  5LBQ B;  2CLY C;  2QRX A;  4U72 A;  1UX5 A;  5KX5 E;  3LK3 B;  2LSK A;  4A5X A;  5AQH B;  2XSB A;  5ABF B;  3FHN A;  2WQY A;  3ZCI A;  3AB3 B;  2JRK A;  3K3O A;  4DR2 T;  3O9X A;  4WBN E;  3PTR B;  5FXV A;  3HR0 A;  4ZZC A;  2LSG A;  1HNX T;  3PJA J;  4DUZ T;  2D0T A;  3ZMT B;  4H9P C;  4O8S A;  2KT9 A;  3CKD A;  5L4H A;  2YK0 A;  2HPL A;  2KZ7 B;  2JQQ A;  5CJ5 A;  3AEE A;  1IBK T;  1WR0 A;  5AQG B;  4AKH A;  3K3Q C;  4JBW F;  3B5M A;  3N9N A;  5FXX A;  4ILA A;  4WZX A;  4L9I A;  4P1N A;  1VOM A;  4IHJ E;  3RIU A;  2WS3 A;  4PFO A;  5LJM A;  3ZYK A;  4F8H A;  5KXJ A;  3CPZ A;  2LEH A;  4OHF A;  1HG2 A;  4F6R C;  5L3G B;  3TLV A;  3KV5 A;  3OBV E;  1D1C A;  3AE3 A;  3O1I A;  2UXN B;  2OA5 A;  2XHE B;  3BQI A;  4FI5 A;  4CXY A;  4H9N C;  3FZK B;  3ZMZ B;  5FKY A;  1Z0P A;  3I0O A;  3J7Y q;  2JPF A;  5BMV E;  4HFE A;  2PG8 A;  2D5U A;  4HFB A;  4OFZ A;  3HI2 A;  4O4I E;  2DHR A;  3T1H T;  2W61 A;  2VL8 A;  2WBL A;  2DCF A;  4YY3 T;  3AA1 B;  4TV9 E;  2QGS A;  3EI0 A;  1WYB A;  3CX8 B;  1UGO A;  3CVR A;  3RPU A;  2BG9 C;  3ZT5 A;  4ZHQ E;  3Q5W A;  1HNW T;  4NXM T;  4A56 A;  4DV2 T;  2V6Y B;  3N9Q A;  1WCR A;  4K0U A;  2UUC T;  5H6Q B;  4B3S T;  3QNU A;  3UUB A;  3ZSS A;  2ODV A;  5KDM C;  4MFR A;  3RH3 A;  3P4W A;  3KFW X;  3CQG B;  4ISS A;  3LFM A;  3UU4 A;  1NAF A;  3MKD A;  4UIG A;  4U74 A;  3SFE A;  4HFV A;  3RF1 A;  4EAH A;  3PUV F;  5HCJ A;  5FL0 A;  2K5B B;  2XQ7 A;  2B76 A;  4U33 A;  1YKH B;  1J5W A;  2M6I A;  3Q9D A;  2YEV C;  3O1H A;  2CWO A;  3IA3 A;  1OXZ A;  3EUH A;  2DL1 A;  2LHN A;  3FXD B;  4O2A E;  3AE8 A;  2HH7 A;  2XAS B;  4YSZ A;  2LM9 A;  2HHH T;  3KV4 A;  2WZI A;  1XWM A;  3AEC A;  3I9Y A;  2F4V T;  4DBQ A;  4LFB T;  3N2O A;  4IDZ A;  5E0O A;  4YLH A;  4KMC A;  4JI4 T;  2LSI A;  4GYR A;  1OED B;  1T7S A;  3PUQ A;  2CMR A;  5JDQ A;  2W62 A;  4GK5 E;  4DV6 T;  3OVU A;  4X65 T;  4X62 T;  3TLS A;  2SPC A;  1IBL T;  5FXZ A;  5L2L A;  3N9O A;  2V5C A;  4IDN A;  4I55 E;  2XQ8 A;  3E22 E;  2BG9 A;  2L3L A;  2X68 A;  4PJJ A;  4N78 D;  2NTY A;  2V8S V;  1NWM X;  2K24 A;  3AEB A;  1XNR T;  4EZ4 A;  4C91 A;  4P09 A;  2JMK A;  2XJ7 A;  2H3R A;  4ZI3 D;  2CCQ A;  3P4S A;  1S35 A;  2E5V A;  3ZYM A;  4TUY E;  3ONJ A;  4I43 B;  2VL0 A;  5EK3 A;  4U7Y A;  3PUY F;  2BKN A;  5JH7 E;  4QH1 A;  2BS2 A;  2BBJ A;  1OWA A;  3RYI E;  4BA9 A;  4HWI B;  2ZM2 A;  3EVY A;  2ZLY A;  2W4X A;  4JI5 T;  3ZYL A;  1OED E;  2XM2 A;  2WCA A;  4QXC B;  5J2U E;  2MOZ A;  4TWF A;  1YQ3 A;  1MIY A;  3HKE E;  4DUY T;  3RGL A;  1R8I A;  2VUR A;  2DLR A;  5M4Y A;  4X66 T;  5JRC A;  4JI7 T;  2IML A;  2C5K T;  1ZKE A;  4I50 E;  4DR1 T;  2JIW A;  1UUR A;  4JI6 T;  4LMK A;  2FJE A;  2N2N A;  4PJM A;  4DBR A;  4DR6 T;  1HX1 B;  2UUB T;  4Z91 A;  1KEY A;  3BQK A;  2RA1 A;  1LRZ A;  2V5D A;  2VKD A;  4B6X A;  5ABG A;  3H3A A;  4U3C A;  4HWC A;  3N2G E;  5HXR A;  3K3N A;  2MBG A;  2X0L B;  1Z8U A;  4LF5 T;  4X1Y E;  4CN4 A;  3ZMV B;  1M62 A;  2BVL A;  4EB6 E;  3RHW A;  4EED A;  1LVK A;  3PUA A;  4HFI A;  5EZY E;  4DR7 T;  3MK7 C;  3P50 A;  4O4L E;  3LBX A;  2X9X A;  4H9Q C;  5L3F B;  2KSR A;  4CI2 B;  2LHR A;  2C0S A;  2CLY B;  5HAX A;  3VKH A;  3I0Q A;  3EDU A;  2WZH A;  3PUR A;  3JC6 D;  1HF8 A;  5JRE A;  4Z90 A;  3FZF B;  4ILB A;  3E08 A;  2DWK A;  2MTQ A;  5JR9 C;  3Q2M A;  1D0Y A;  4AXP A;  4YTN A;  5LP6 E;  3GMI A;  3L39 A;  2X51 A;  5L3D B;  2A9U A;  5J0Z A;  1YXR A;  2K48 A;  2CA5 A;  5LG3 A;  3UUX B;  3EAB A;  1MNE A;  4ANJ A;  2XAG B;  4KUM B;  3PU3 A;  1W0A A;  2YIN A;  2YN6 A;  4QXH B;  2X66 A;  4AKR B;  3MA9 A;  2CHO A;  2VB6 A;  2XQ4 A;  4HFD A;  3ABV A;  4AKI A;  4DV4 T;  4IST A;  5AQU B;  4CQI A;  4QXB B;  1T98 A;  1MIV A;  2DWG A;  2L8K A;  2DNX A;  3A5X A;  5EK2 A;  1XMO T;  2P9B A;  2XM1 A;  2QA7 A;  1SHZ C;  4UVA B;  4IE5 A;  5F8P A;  1YQ4 A;  1G8X A;  3KBT A;  2XAF B;  3MJX A;  2HPJ A;  2X0H A;  4AQY T;  2W66 A;  3ZN0 B;  1NEN A;  5FY1 A;  1N33 T;  1MIW A;  3DP7 A;  5CA0 E;  2FJD A; 
#chains in the Genus database with same CATH homology
 1IBM T;  4DR4 T;  4JI5 T;  4JI4 T;  4JV5 T;  1HNW T;  4DV0 T;  4NXM T;  1J5E T;  2UUA T;  4LF7 T;  4DV2 T;  4DUY T;  4LF8 T;  4X66 T;  1XNQ T;  2UUC T;  4JI7 T;  1IBK T;  4DV6 T;  4DR1 T;  2UXC T;  4JYA T;  4DV3 T;  4X65 T;  4JI6 T;  4JI2 T;  5LMN T;  4JI1 T;  4LFC T;  4B3S T;  4DR6 T;  4X62 T;  4DV1 T;  2UUB T;  2UXB T;  1IBL T;  4KHP T;  4DV7 T;  4B3R T;  2VQF T;  2ZM6 T;  1N34 T;  4NXN T;  4LF4 T;  1XMQ T;  4OX9 T;  4GKJ T;  4DR5 T;  5IWA T;  4DV4 T;  4LF9 T;  5LMU T;  5BR8 T;  1XNR T;  1N36 T;  4JI8 T;  4JI0 T;  3T1Y T;  4B3T T;  4LFA T;  2VQE T;  4LF5 T;  4LF6 T;  4X64 T;  4GKK T;  1FJG T;  1HNZ T;  1XMO T;  2UU9 T;  1I94 T;  1HR0 T;  4DR7 T;  4DV5 T;  3T1H T;  4DR3 T;  4YY3 T;  4DR2 T;  2HHH T;  4K0K T;  1N32 T;  4JI3 T;  2UXD T;  3OTO T;  4AQY T;  4B3M T;  1HNX T;  4DUZ T;  2E5L T;  4YHH T;  2F4V T;  1N33 T;  4LFB T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...