4OX9T

Crystal structure of the aminoglycoside resistance methyltransferase npma bound to the 30s ribosomal subunit
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular recognition and modification of the 30S ribosome by the aminoglycoside-resistance methyltransferase NpmA.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 33
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2014-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 4ox9T00
4JI3T 4JV5T 2UXBT 4B3ST 4B3MT 2UUAT 1J5ET 4JI0T 4DR5T 1N34T 3OTOT 2UUCT 1FJGT 4DR3T 1HNXT 4JI6T 4LF8T 4LF6T 2HHHT 4AQYT 2ZM6T 4X65T 4DV3T 4LFAT 3T1HT 4JYAT 4JI4T 1HNZT 4LF7T 4B3TT 4DR4T 4DR6T 4DV0T 1XNRT 4DV2T 2F4VT 1HNWT 1XMOT 4DUYT 4LF5T 4LFBT 1N33T 5LMUT 4JI8T 4LF9T 3T1YT 4DV7T 1IBKT 1I94T 4DV5T 4KHPT 1HR0T 4X64T 1XMQT 4LF4T 4DR1T 4X66T 4LFCT 5IWAT 4JI5T 4YHHT 4NXMT 4DUZT 1XNQT 2UU9T 1IBMT 4DR2T 4DV6T 4OX9T 1N32T 1IBLT 4K0KT 4YY3T 4GKKT 4X62T 4JI2T 4DV1T 4NXNT 2VQET 2UUBT 4JI7T 2UXDT 4DR7T 4JI1T 2E5LT 5BR8T 5LMNT 4DV4T 1N36T 4GKJT 2UXCT 4B3RT 2VQFT
chains in the Genus database with same CATH superfamily
2KNDA 4PFOA 2LRLA 4U2YA 1WLXA 4G2AA 4DBRA 4YSXA 3A8YC 3CK6A 2UUAT 2RPAA 3ZLIA 4IE4A 3RIUA 4LMJA 4QHOA 5AQNB 5JDLA 2NOXA 1BR2A 2WB5A 2EHOB 3ZYMA 1LVKA 1HG2A 1MMAA 1WYBA 2BKPA 3E0ZA 1AJ3A 2BBJA 3N9QA 3RKGA 1IJ6A 3QB5K 3ZEFB 2BS4A 4IE0A 2NP9A 2PBIA 1JNZA 3AA7B 1HNXT 2FJAA 4ZI2D 4XBFB 1NWMX 1D0XA 1SUMB 1ZP0A 2CXLA 5L2LA 3ZMVB 3CPZA 1YKEB 5ABHA 2Y8DA 1UK5A 3N2OA 2D5UA 5AQLB 1MIWA 3EI0A 3VKGA 1X9BA 2JMHA 3D0TA 3I0OA 2BS2A 3NVOA 2J62A 2H3RA 3ONLC 3HI2A 5FMNA 4X65T 1WR0A 3PU8A 4PW8A 1R8IA 5F8PA 1HX8A 3UU3A 3L09A 4DO0A 4YSYA 5LYJE 5AQJB 2N2NA 4JUYA 1W0AA 2V6XA 2XAFB 2N9DA 3AB3B 3AE4A 1OEDB 2FJDA 3S4UA 5L3CB 4GIWA 4ISTA 4GYRA 4DR4T 2XQ4A 2D0TA 1S35A 3BK9A 1XNRT 2A72A 3MXZA 4HFDA 5J0ZA 4YTNA 1HNWT 1KFYA 2YEVC 1XMOT 3O1IA 5L3FB 2Q9QC 4IDQA 2KWHA 2NTYA 3R6NA 5C3JA 3OYZA 5LG4A 4JEUB 3RYCE 3AEEA 2LT3A 2VKOA 4TX5A 3AA6B 2XY8B 4NIQA 3WAKA 2LKHA 2VVSA 2CXDA 1T72A 1QSDA 1W9RA 2YU1A 2Z6EA 4ZI2C 5L3EB 3DTOA 3AEAA 2IW5B 2WP9A 3P50A 5HAXA 3VR9A 4AKRB 4WBNE 5CGMA 5JDQA 1I94T 5TAOA 3RRCA 3SRZA 5HYAA 3PJAJ 3UU5A 1WYCA 4X64T 1XMQT 3FXEB 5IHYA 5FY7A 2LOPA 2LJLA 3RIAA 5L4EA 4LFCT 1XZYA 2W66A 5C8YE 1IAPA 4Z90A 4IDZA 2H7OA 3R84B 4CQIA 4DBQA 3NKZA 2QVAA 5BMVE 3AAAB 3B57A 3QB5A 2BG9A 4LMKA 3AE7A 2LLYA 1HCIA 4YXDA 3J9X1 4KBMB 3ZSSA 2KINB 3RIUC 4NXMT 2XQ6A 2V1DB 2PJQA 4AIUA 2FUPA 2W61A 3QK6A 4CI2B 2C5IT 4BA9A 4ZZBA 3AE1A 2UU9T 4HTEA 2X9YA 4CXXA 1UCUA 2LEHA 4DR2T 1YD8G 2Q9QD 2WM9A 3KV6A 1YQ4A 2CE7A 4Z91A 4H9PC 5AQTB 3ZC0A 1US7B 1U5PA 4WYVA 4YHJA 2V7MA 3LG7A 2Y6XA 3LDQB 4ZS3A 2KMFA 2WZHA 3O4XE 4IL4A 4UF0A 3UULA 3ZMZB 2UXCT 2XHEB 4K0KT 1GQEA 2KXPB 2LSYA 1ZKEA 2CMRA 2WSSV 3LBXB 4QH4A 2WQYA 3AXJA 4UV8B 4UXNB 5FKYA 3AEDA 5FVKA 4JI2T 5JTGA 5AQSB 4BAYB 4NXNT 2VQET 3K1SA 5FYMA 2EHOA 4IE6A 2BS3A 2DL1A 2Q9QB 2WWUA 3IA3A 4I0UA 3TLVA 2ODVA 3QOFA 4CN6A 2UUBT 2UXDT 3AE2A 3UU8A 4LF4T 4UEMA 2XQYA 3GN5B 3EABA 3ZCJA 3VKHA 2V7JA 5LMNT 4DV4T 4HKAA 4UF0B 4ASKA 2HN1A 5H6RB 3EVYA 4NUUA 1OEDC 4QX7B 2W67A 4AKLA 3I1AA 1FEWA 3OYXA 2IAKA 3MZKB 4TWFA 3EDVA 5FXVA 3I0QA 5FXXA 5AQOB 5HEHA 3TLTA 4IDOA 4B3RT 1Y01A 3RC3A 2E5VA 5HEGA 4JI3T 4UV9B 2CPTA 4P0BA 2DWGA 4H9QC 1NEKA 2RA1A 4C90A 1ZOYA 5LBMA 4CXYA 2KZ7B 2X9XA 2D0UA 2E9XA 4ILBA 3RYFE 4B3MT 4KUMB 4MFRA 5HXRA 3KFWX 1KF6A 1QUUA 5FL0A 5H6QB 5LBQB 2CBIA 3OTOT 2M67A 4YFSA 1BR4A 3AAIA 4TN7B 3F31A 2XUEA 3KVBA 2UUCT 1FJGT 4HWHA 3WAJA 3SFEA 1Z8UA 4GK0E 3LSVA 2CXFA 2LM2A 4N78D 2V8SV 2QGSA 3CWZB 1IZNB 4UIGA 5HWYA 2WAUA 3PU3A 4ANJA 2W4XA 4ZXLA 1MNDA 4EYYR 4JI6T 1MMDA 2UXNB 2HH7A 3CX7B 3LFMA 2EHOC 3RKOA 3ZCIA 5L3GB 3PUSA 2BG9E 1MNEA 4AQFA 5EK3A 1JNRA 4P09A 4HFHA 3Q9DA 3AEGA 5LNKA 3H37A 3KV5A 3ZMSB 1ZV4X 4LMLA 2G0UA 2XAJB 3UUXB 3TLUA 4ZHQE 2ZMAA 4DV3T 4LFAT 4X1YE 3PJAA 3EDUA 3ZN0B 4YSZA 3FXDB 5KXJA 4O8SA 3QNUA 4PFPA 4PAGA 4QH5A 4IGUA 3CQCB 4LF7T 3K3NA 4EAHA 3SOLA 1SE7A 2WBLA 3JADA 1T8BA 4HGAA 3MK7C 1J5WA 1WCRA 4OFZA 2LHRA 4DV2T 2VKJA 3BQIA 3VR8A 1M62A 3HR0A 4KHZF 4CN1A 2XZEA 2V6YA 5JDHA 5JREA 4WNKA 3LJCA 3PUQA 3Q5EA 1N33T 4DMVA 4HWDA 5FXZA 5LMUT 3A5XA 2XQ5A 4CI1B 3FHNA 3AEFA 2B1EA 2JPFA 4LF9T 3Q2MA 4DVDA 1G73A 3UTKA 4AISA 3VRBA 3L8RA 3N2GE 4DV7T 1MIYA 4JBWF 4JLEA 5DJQC 3VRAA 4TV9E 3P4QA 2DLRA 3W15B 1HR0T 5LCYA 4YTMA 2CBJA 3UFEA 3LBXA 4X1KE 2BKNA 3LK2B 5HCMA 3V5UA 4DR1T 4IREA 5IYZE 2FJBA 1J1JA 3JAEA 5FP3A 4EOZB 2V7IA 4F8HA 4FJOA 4O4LE 2YOEA 5JR9C 3CMLA 4ERRA 5HXSA 4JI5T 3JCFA 2Q9QA 5DQVA 2E2AA 2M6IA 5CJ5A 2XQ3A 1UX5A 4H9SE 3G06A 3LK42 2V26A 2H7VC 4GOUA 1UURA 2VVNA 2CRBA 4HFCA 2XM1A 3FZMB 3UT5E 5EK4A 2QA7A 5HXCA 4DUZT 5A1LA 3UFGA 3QUJA 4U7IA 3F57A 2IC6A 2XSAA 4UVBB 5LB7B 3IF8B 1IBMT 3AE9A 3C64A 3HL6A 4GK5E 4ZI3C 5L47A 2VASA 2VKHA 3CX8B 4UVAB 4OX9T 5JDGA 5DABA 5HWXA 2ODUA 1XDOA 2W63A 4WW0A 3U78A 1IBLT 3ESLA 5HXHA 2XSBA 4PK5A 4PNIA 1D0YA 2A2FX 2E9XB 2R6GF 1Y64B 2SPCA 3ONJA 3NZPA 2VQFT 4GKKT 2CHNA 1WR6A 4BJNA 1WFDA 5L4HA 2K5BB 5JVDE 3ANWA 5CFBA 3A7MA 2XQ8A 4IIJE 5LHGB 4PK6A 4DV1T 4U31A 3RGLA 3AXJB 4DR7T 2H89A 4FI5A 2KSRA 3MKDA 2K24A 3C51A 2WU2A 3Q5WA 1NENA 4ZOLE 4C91A 1MIVA 1EZ3A 2BBHA 2ZM0A 3HKBE 3K8PC 3UU6A 4EV6A 1NAFA 4U33A 3X1DA 3VHLA 4AKIA 5LGTB 1N36T 2V7LA 2XQ7A 1UX4A 1FIOA 4O2BE 3ZJ1A 5M4YA 1HF8A 2X0HA 3ZSTA 3RRWA 4MALA 2PG8A 2WCAA 5LG3A 3FZFB 5J1GA 2A9UA 2WMNA 3AEBA 3UUMA 2I59A 1Z0PA 3OBVE 4PK4A 1X79A 4X5TA 3ONXA 4WZXA 4QH1A 1KNPA 3TKLB 3ZPOA 4ADZA 3PUWF 4B3ST 1S94A 5F5WA 5LJNA 1J5ET 2W62A 3P4PA 5JDNA 1N34T 3ANWB 5KDMC 4QX8B 5FNVE 3B5MA 2Y48B 2K48A 3HKEE 4GYSA 1T7SA 1KEYA 1OWAA 4EZ4A 4DR3T 4H9RC 3O9XA 3MJXA 1YXRA 2C5KT 2XASB 4AQGA 2XQ9A 3E22E 2YK0A 2V7KA 5HCJA 3BQKA 2JMKA 4P0AA 4IE5A 2X67A 1MMNA 3PURA 2V6YB 3RQUA 3IHRA 3AAEB 5AQUB 3UQ7A 4LF6T 4J2CA 2OA5A 3ZT5A 3PUAA 3CKDA 3WI3A 1D0ZA 1D1AA 2CA5A 3C50A 3DP7A 5LOVE 4AQYT 1DU2A 4ISSA 4HEAA 4PJJA 5E0OA 4H63H 4PJNA 3SS1A 2K3WA 4A56A 3I9YA 2C0SA 2JJ9A 3GMIA 4P1NA 5HEOA 5CA0E 5LP6E 2HPLA 2QRXA 5EZYE 4ZZCA 3T1HT 5FXWA 1H7CA 4OHFA 3EAMA 5LA6E 1U4QA 2BG9B 4JYAT 3KBTA 4AXPA 4IHJE 2YDQA 3OPCA 4V1Av 4I43B 3KVAA 3AVRA 4I50E 4OYJA 2NTXA 4EB6E 3ZYKA 5ABFA 3AVSA 5JR9A 2CWYA 5AFUL 4B3TT 5L3DB 2VL8A 4F6RC 4DV0T 3N9MA 4TWDA 2F4VT 2VL0A 5JRCA 3JAFA 5HEUA 5JRCB 4QWNB 2WU5A 4LF5T 4AKGA 3AE3A 3HA4A 3KDSE 2XM2A 5J2TE 4L0RA 4HWFA 5LXTE 2ZM2A 2ACZA 3MA9A 3N9PA 3RYIE 4JI8T 3AA1B 4H63V 4EIWA 4EZHA 3JC6D 5J2UE 3T8OA 5F3JA 3CQXC 4HFVA 3L39A 3TLSA 1LKXA 4IDPA 2N1GA 5AQMB 4CXWA 3RC8A 2MPKA 3MACA 3ABVA 4HWIB 1CHUA 2YINA 2X0LB 4OK0A 1IBKT 2BVLA 2LM9A 5GONE 3HKCE 2LHNA 2CLYB 4YJ2E 1HG5A 3KV9A 4TUYE 5ABEA 3V5SA 2AE9A 3E08A 3AECA 4QXBB 2FJEA 5KX5E 5LGUB 2J47A 2W0GA 2NW7A 4HFBA 3RF1A 4X66T 3NRXA 3Q5XA 5IWAT 3AE8A 2BZBA 2JIWA 4UELA 1BR0A 4U3CA 4DIDB 3EHZA 3ZJ2A 2QYWA 1ZHCA 1KK7A 3ZKRA 3NBXX 4YHHT 3P4RA 2L9QA 2X9HA 3ZYLA 4ILAA 3KBUA 2WDRA 4YJ3E 3ZT6A 5KMGP 4WBOA 1QLBA 2VB6A 1IJ5A 3NRYA 4DV6T 2CLYC 2LSGA 1N32T 2XTLA 2LSJA 3L3PA 3LK3B 1YQ3A 2IIUA 4QKNA 3C4ZA 2JQKA 2WMOA 4O4HE 4YY3T 3PUGA 2CWOA 4TNVA 4TNWA 2X0YA 1E2AA 3CQGB 2W2UA 3ZMTB 2KT9A 2ZM8A 3ZN1B 4MLKA 3GN5A 2XJ7A 4IE7A 4KMCA 4UVCB 4Z8XA 5DQWA 3RHWA 1FMWA 1UGOA 5AQFB 4JI7T 2DHRA 4PJMA 2VURA 3UU4A 4JI1T 2P9BA 3ZC1A 4JV5T 3O1JA 4X20E 3M65A 1KNRA 5ABGA 4HN9A 4E7SA 2WDQA 3CVRA 2MAWA 2X66A 3O1HA 1YKHB 3P4SA 4ILCA 4U74A 2BVMA 2K9AA 4DMWA 2BG9C 3N2KE 4M1PA 2A3DA 5JH7E 2J1DG 2YDSA 2XAHB 3FZLB 2LSKA 2WDVA 3AE6A 3M3ZB 3ZT7A 1KNZA 1O3XA 2XAQB 4X1IE 3TLWA 2UXBT 3UQ4A 5ETWA 4NUVA 2IMLA 1XWMA 4JI0T 2B76A 2I6HA 2NR4A 3ZMUB 2YDRA 4DR5T 2DWKA 2MOZA 2AXDS 3H3AA 1E7PA 3I9WA 4U2ZA 5ABFB 4EEDA 2IDOB 2NWBA 4QXHB 3RLFF 1SA0E 4KP3C 5FY1A 2LE8A 3K3QC 2HPJA 2FBWA 1HX1B 4DNDA 2CCQA 2PFVA 2XQAA 2E9XD 3ETVA 3FBZA 2ACXA 4H9NC 4PJLA 2NW9A 1VCSA 4LF8T 3UUBA 2YN6A 2OLTA 3OJAA 4K0UA 2CM0A 5IUXA 4EXTA 3N9OA 4L5GA 5CA1E 4KI0F 5EK2A 2HHHT 4Q25A 2DI4A 2PTFA 2X68A 3H3MA 4HE8A 3RPUA 3U3IA 4BJMA 2ZM6T 5JDMA 4EYUA 4YT0A 3PE0A 2JQHA 3QC9A 5C2TA 4ZEYA 2BKOA 1OEDA 2YKSA 3Q5DA 3N5LA 1M7KA 2XAGB 3FZKB 4B6XA 1D1CA 2WY2A 2BDEA 1HNZT 1T98A 3B13A 1OXZA 4A5XA 4DR6T 3PV0F 2LKGA 1HS7A 2V5CA 2V5DA 4U72A 1UUSA 3GWHA 5ADXL 1XDPA 3RH3A 2IC9A 2OV9A 3SWHA 4AI6A 4DUYT 4XAXB 2IHR1 4IDNA 1WRDA 3BQLA 5AQGB 3OVUA 4LFBT 4O2AE 1W0BA 2L3LA 2LRKA 3GA8A 3NZQA 4G63A 1VOMA 2C5JA 4TV8E 2W00A 2DNXA 2E9XC 1SHZC 2VWAA 5AQPB 3J7Yq 3T1YT 2NW8A 3N9NA 2LOSA 4ILUA 3RYHE 3HKDE 4AQFC 4CN4A 4CI3B 2M6BA 3OKQA 2X9WA 3PTRB 3IEEA 4ZS2A 3FZHB 4I55E 3PUZF 2VK9A 2JRKA 4QXCB 5AQHB 4DV5T 4KHPT 4O4IE 4IT4A 3UUNA 1LRZA 2JQQA 2L8KA 3CX6B 3P4WA 2YU2A 3SFDA 4EEBA 5FL1A 4ZI3D 2UXXB 4I4TE 4KX6A 2KWIB 1E1HB 2H88A 2RP4A 2LSIA 4HFIA 4COFA 2VKDA 4YLHA 1OEDE 5AQQB 2CHOA 4YTPA 3CIRA 1HFAA 2J4GA 5LHIB 4XZCA 2HN2A 1HTJF 5FY0A 2I0MA 4MHCA 1W09A 4CZZB 2MTQA 2ZLYA 3C98B 3DJBA 1MMGA 3RX6A 4UR9A 2D2SA 3C4WA 5FVLA 1LVFA 3ETUA 3PUVF 4A97A 5JR9B 5LGNB 1FMVA 1VRBA 5JDFA 5LHHB 1XNQT 3EUHA 3JC6C 2WS3A 5HEJA 1V9DA 1VCTA 2CEAA 3AA0B 2WZIA 2XPKA 2WWVA 4TZ4C 4GKJT 4EGWA 1CUNA 3FBLA 2ES0A 3P8CD 3NWIA 4NPPA 3F2EA 3PDYA 5CB4E 5HXEA 5AQKB 3K3OA 3RIFA 4X62T 1BR1A 2D9DA 2E8IA 2IUBA 3FB2A 3IBPA 2X51A 3PUYF 4E7ZA 1I6ZA 4L9IA 1B7TA 3KV4A 2JQ9A 1G8XA 4O4JE 3C4XA 4ZI7E 4HWCA 3RI5A 5JQGE 4JEHB 3PUXF 1ZEEA 2GK9A 5AQIB 2E5LT 3N9LA 5LJMA 5BR8T 3RQWA 2DCFA 4AKHA 4JI4T 1YW0A 2MYSA 3VU7H 1D1BA 4H9OC 5AQVB 3P7IA 1L0VA 4HFEA 4U7YA 5AQRB 5L3BB 2EHOD 4IL9A 4MBQA 4TWHA 4OYKA 3KINB 3AE5A 4A98A 2KLQA 2MBGA
chains in the Genus database with same CATH topology
4JI3T 4JV5T 2UXBT 4B3ST 4B3MT 2UUAT 1J5ET 4JI0T 4DR5T 1N34T 3OTOT 2UUCT 1FJGT 4DR3T 1HNXT 4JI6T 4LF8T 4LF6T 2HHHT 4AQYT 2ZM6T 4X65T 4DV3T 4LFAT 3T1HT 4JYAT 4JI4T 1HNZT 4LF7T 4B3TT 4DR4T 4DR6T 4DV0T 1XNRT 4DV2T 2F4VT 1HNWT 1XMOT 4DUYT 4LF5T 4LFBT 1N33T 5LMUT 4JI8T 4LF9T 3T1YT 4DV7T 1IBKT 1I94T 4DV5T 4KHPT 1HR0T 4X64T 1XMQT 4LF4T 4DR1T 4X66T 4LFCT 5IWAT 4JI5T 4YHHT 4NXMT 4DUZT 1XNQT 2UU9T 1IBMT 4DR2T 4DV6T 4OX9T 1N32T 1IBLT 4K0KT 4YY3T 4GKKT 4X62T 4JI2T 4DV1T 4NXNT 2VQET 2UUBT 4JI7T 2UXDT 4DR7T 4JI1T 2E5LT 5BR8T 5LMNT 4DV4T 1N36T 4GKJT 2UXCT 4B3RT 2VQFT
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI3 T;  4JV5 T;  2UXB T;  4B3S T;  4B3M T;  2UUA T;  1J5E T;  4JI0 T;  4DR5 T;  1N34 T;  3OTO T;  2UUC T;  1FJG T;  4DR3 T;  1HNX T;  4JI6 T;  4LF8 T;  4LF6 T;  2HHH T;  4AQY T;  2ZM6 T;  4X65 T;  4DV3 T;  4LFA T;  3T1H T;  4JYA T;  4JI4 T;  1HNZ T;  4LF7 T;  4B3T T;  4DR4 T;  4DR6 T;  4DV0 T;  1XNR T;  4DV2 T;  2F4V T;  1HNW T;  1XMO T;  4DUY T;  4LF5 T;  4LFB T;  1N33 T;  5LMU T;  4JI8 T;  4LF9 T;  3T1Y T;  4DV7 T;  1IBK T;  1I94 T;  4DV5 T;  4KHP T;  1HR0 T;  4X64 T;  1XMQ T;  4LF4 T;  4DR1 T;  4X66 T;  4LFC T;  5IWA T;  4JI5 T;  4YHH T;  4NXM T;  4DUZ T;  1XNQ T;  2UU9 T;  1IBM T;  4DR2 T;  4DV6 T;  4OX9 T;  1N32 T;  1IBL T;  4K0K T;  4YY3 T;  4GKK T;  4X62 T;  4JI2 T;  4DV1 T;  4NXN T;  2VQE T;  2UUB T;  4JI7 T;  2UXD T;  4DR7 T;  4JI1 T;  2E5L T;  5BR8 T;  5LMN T;  4DV4 T;  1N36 T;  4GKJ T;  2UXC T;  4B3R T;  2VQF T; 
#chains in the Genus database with same CATH topology
 2KND A;  4PFO A;  2LRL A;  4U2Y A;  1WLX A;  4G2A A;  4DBR A;  4YSX A;  3A8Y C;  3CK6 A;  2UUA T;  2RPA A;  3ZLI A;  4IE4 A;  3RIU A;  4LMJ A;  4QHO A;  5AQN B;  5JDL A;  2NOX A;  1BR2 A;  2WB5 A;  2EHO B;  3ZYM A;  1LVK A;  1HG2 A;  1MMA A;  1WYB A;  2BKP A;  3E0Z A;  1AJ3 A;  2BBJ A;  3N9Q A;  3RKG A;  1IJ6 A;  3QB5 K;  3ZEF B;  2BS4 A;  4IE0 A;  2NP9 A;  2PBI A;  1JNZ A;  3AA7 B;  1HNX T;  2FJA A;  4ZI2 D;  4XBF B;  1NWM X;  1D0X A;  1SUM B;  1ZP0 A;  2CXL A;  5L2L A;  3ZMV B;  3CPZ A;  1YKE B;  5ABH A;  2Y8D A;  1UK5 A;  3N2O A;  2D5U A;  5AQL B;  1MIW A;  3EI0 A;  3VKG A;  1X9B A;  2JMH A;  3D0T A;  3I0O A;  2BS2 A;  3NVO A;  2J62 A;  2H3R A;  3ONL C;  3HI2 A;  5FMN A;  4X65 T;  1WR0 A;  3PU8 A;  4PW8 A;  1R8I A;  5F8P A;  1HX8 A;  3UU3 A;  3L09 A;  4DO0 A;  4YSY A;  5LYJ E;  5AQJ B;  2N2N A;  4JUY A;  1W0A A;  2V6X A;  2XAF B;  2N9D A;  3AB3 B;  3AE4 A;  1OED B;  2FJD A;  3S4U A;  5L3C B;  4GIW A;  4IST A;  4GYR A;  4DR4 T;  2XQ4 A;  2D0T A;  1S35 A;  3BK9 A;  1XNR T;  2A72 A;  3MXZ A;  4HFD A;  5J0Z A;  4YTN A;  1HNW T;  1KFY A;  2YEV C;  1XMO T;  3O1I A;  5L3F B;  2Q9Q C;  4IDQ A;  2KWH A;  2NTY A;  3R6N A;  5C3J A;  3OYZ A;  5LG4 A;  4JEU B;  3RYC E;  3AEE A;  2LT3 A;  2VKO A;  4TX5 A;  3AA6 B;  2XY8 B;  4NIQ A;  3WAK A;  2LKH A;  2VVS A;  2CXD A;  1T72 A;  1QSD A;  1W9R A;  2YU1 A;  2Z6E A;  4ZI2 C;  5L3E B;  3DTO A;  3AEA A;  2IW5 B;  2WP9 A;  3P50 A;  5HAX A;  3VR9 A;  4AKR B;  4WBN E;  5CGM A;  5JDQ A;  1I94 T;  5TAO A;  3RRC A;  3SRZ A;  5HYA A;  3PJA J;  3UU5 A;  1WYC A;  4X64 T;  1XMQ T;  3FXE B;  5IHY A;  5FY7 A;  2LOP A;  2LJL A;  3RIA A;  5L4E A;  4LFC T;  1XZY A;  2W66 A;  5C8Y E;  1IAP A;  4Z90 A;  4IDZ A;  2H7O A;  3R84 B;  4CQI A;  4DBQ A;  3NKZ A;  2QVA A;  5BMV E;  3AAA B;  3B57 A;  3QB5 A;  2BG9 A;  4LMK A;  3AE7 A;  2LLY A;  1HCI A;  4YXD A;  3J9X 1;  4KBM B;  3ZSS A;  2KIN B;  3RIU C;  4NXM T;  2XQ6 A;  2V1D B;  2PJQ A;  4AIU A;  2FUP A;  2W61 A;  3QK6 A;  4CI2 B;  2C5I T;  4BA9 A;  4ZZB A;  3AE1 A;  2UU9 T;  4HTE A;  2X9Y A;  4CXX A;  1UCU A;  2LEH A;  4DR2 T;  1YD8 G;  2Q9Q D;  2WM9 A;  3KV6 A;  1YQ4 A;  2CE7 A;  4Z91 A;  4H9P C;  5AQT B;  3ZC0 A;  1US7 B;  1U5P A;  4WYV A;  4YHJ A;  2V7M A;  3LG7 A;  2Y6X A;  3LDQ B;  4ZS3 A;  2KMF A;  2WZH A;  3O4X E;  4IL4 A;  4UF0 A;  3UUL A;  3ZMZ B;  2UXC T;  2XHE B;  4K0K T;  1GQE A;  2KXP B;  2LSY A;  1ZKE A;  2CMR A;  2WSS V;  3LBX B;  4QH4 A;  2WQY A;  3AXJ A;  4UV8 B;  4UXN B;  5FKY A;  3AED A;  5FVK A;  4JI2 T;  5JTG A;  5AQS B;  4BAY B;  4NXN T;  2VQE T;  3K1S A;  5FYM A;  2EHO A;  4IE6 A;  2BS3 A;  2DL1 A;  2Q9Q B;  2WWU A;  3IA3 A;  4I0U A;  3TLV A;  2ODV A;  3QOF A;  4CN6 A;  2UUB T;  2UXD T;  3AE2 A;  3UU8 A;  4LF4 T;  4UEM A;  2XQY A;  3GN5 B;  3EAB A;  3ZCJ A;  3VKH A;  2V7J A;  5LMN T;  4DV4 T;  4HKA A;  4UF0 B;  4ASK A;  2HN1 A;  5H6R B;  3EVY A;  4NUU A;  1OED C;  4QX7 B;  2W67 A;  4AKL A;  3I1A A;  1FEW A;  3OYX A;  2IAK A;  3MZK B;  4TWF A;  3EDV A;  5FXV A;  3I0Q A;  5FXX A;  5AQO B;  5HEH A;  3TLT A;  4IDO A;  4B3R T;  1Y01 A;  3RC3 A;  2E5V A;  5HEG A;  4JI3 T;  4UV9 B;  2CPT A;  4P0B A;  2DWG A;  4H9Q C;  1NEK A;  2RA1 A;  4C90 A;  1ZOY A;  5LBM A;  4CXY A;  2KZ7 B;  2X9X A;  2D0U A;  2E9X A;  4ILB A;  3RYF E;  4B3M T;  4KUM B;  4MFR A;  5HXR A;  3KFW X;  1KF6 A;  1QUU A;  5FL0 A;  5H6Q B;  5LBQ B;  2CBI A;  3OTO T;  2M67 A;  4YFS A;  1BR4 A;  3AAI A;  4TN7 B;  3F31 A;  2XUE A;  3KVB A;  2UUC T;  1FJG T;  4HWH A;  3WAJ A;  3SFE A;  1Z8U A;  4GK0 E;  3LSV A;  2CXF A;  2LM2 A;  4N78 D;  2V8S V;  2QGS A;  3CWZ B;  1IZN B;  4UIG A;  5HWY A;  2WAU A;  3PU3 A;  4ANJ A;  2W4X A;  4ZXL A;  1MND A;  4EYY R;  4JI6 T;  1MMD A;  2UXN B;  2HH7 A;  3CX7 B;  3LFM A;  2EHO C;  3RKO A;  3ZCI A;  5L3G B;  3PUS A;  2BG9 E;  1MNE A;  4AQF A;  5EK3 A;  1JNR A;  4P09 A;  4HFH A;  3Q9D A;  3AEG A;  5LNK A;  3H37 A;  3KV5 A;  3ZMS B;  1ZV4 X;  4LML A;  2G0U A;  2XAJ B;  3UUX B;  3TLU A;  4ZHQ E;  2ZMA A;  4DV3 T;  4LFA T;  4X1Y E;  3PJA A;  3EDU A;  3ZN0 B;  4YSZ A;  3FXD B;  5KXJ A;  4O8S A;  3QNU A;  4PFP A;  4PAG A;  4QH5 A;  4IGU A;  3CQC B;  4LF7 T;  3K3N A;  4EAH A;  3SOL A;  1SE7 A;  2WBL A;  3JAD A;  1T8B A;  4HGA A;  3MK7 C;  1J5W A;  1WCR A;  4OFZ A;  2LHR A;  4DV2 T;  2VKJ A;  3BQI A;  3VR8 A;  1M62 A;  3HR0 A;  4KHZ F;  4CN1 A;  2XZE A;  2V6Y A;  5JDH A;  5JRE A;  4WNK A;  3LJC A;  3PUQ A;  3Q5E A;  1N33 T;  4DMV A;  4HWD A;  5FXZ A;  5LMU T;  3A5X A;  2XQ5 A;  4CI1 B;  3FHN A;  3AEF A;  2B1E A;  2JPF A;  4LF9 T;  3Q2M A;  4DVD A;  1G73 A;  3UTK A;  4AIS A;  3VRB A;  3L8R A;  3N2G E;  4DV7 T;  1MIY A;  4JBW F;  4JLE A;  5DJQ C;  3VRA A;  4TV9 E;  3P4Q A;  2DLR A;  3W15 B;  1HR0 T;  5LCY A;  4YTM A;  2CBJ A;  3UFE A;  3LBX A;  4X1K E;  2BKN A;  3LK2 B;  5HCM A;  3V5U A;  4DR1 T;  4IRE A;  5IYZ E;  2FJB A;  1J1J A;  3JAE A;  5FP3 A;  4EOZ B;  2V7I A;  4F8H A;  4FJO A;  4O4L E;  2YOE A;  5JR9 C;  3CML A;  4ERR A;  5HXS A;  4JI5 T;  3JCF A;  2Q9Q A;  5DQV A;  2E2A A;  2M6I A;  5CJ5 A;  2XQ3 A;  1UX5 A;  4H9S E;  3G06 A;  3LK4 2;  2V26 A;  2H7V C;  4GOU A;  1UUR A;  2VVN A;  2CRB A;  4HFC A;  2XM1 A;  3FZM B;  3UT5 E;  5EK4 A;  2QA7 A;  5HXC A;  4DUZ T;  5A1L A;  3UFG A;  3QUJ A;  4U7I A;  3F57 A;  2IC6 A;  2XSA A;  4UVB B;  5LB7 B;  3IF8 B;  1IBM T;  3AE9 A;  3C64 A;  3HL6 A;  4GK5 E;  4ZI3 C;  5L47 A;  2VAS A;  2VKH A;  3CX8 B;  4UVA B;  4OX9 T;  5JDG A;  5DAB A;  5HWX A;  2ODU A;  1XDO A;  2W63 A;  4WW0 A;  3U78 A;  1IBL T;  3ESL A;  5HXH A;  2XSB A;  4PK5 A;  4PNI A;  1D0Y A;  2A2F X;  2E9X B;  2R6G F;  1Y64 B;  2SPC A;  3ONJ A;  3NZP A;  2VQF T;  4GKK T;  2CHN A;  1WR6 A;  4BJN A;  1WFD A;  5L4H A;  2K5B B;  5JVD E;  3ANW A;  5CFB A;  3A7M A;  2XQ8 A;  4IIJ E;  5LHG B;  4PK6 A;  4DV1 T;  4U31 A;  3RGL A;  3AXJ B;  4DR7 T;  2H89 A;  4FI5 A;  2KSR A;  3MKD A;  2K24 A;  3C51 A;  2WU2 A;  3Q5W A;  1NEN A;  4ZOL E;  4C91 A;  1MIV A;  1EZ3 A;  2BBH A;  2ZM0 A;  3HKB E;  3K8P C;  3UU6 A;  4EV6 A;  1NAF A;  4U33 A;  3X1D A;  3VHL A;  4AKI A;  5LGT B;  1N36 T;  2V7L A;  2XQ7 A;  1UX4 A;  1FIO A;  4O2B E;  3ZJ1 A;  5M4Y A;  1HF8 A;  2X0H A;  3ZST A;  3RRW A;  4MAL A;  2PG8 A;  2WCA A;  5LG3 A;  3FZF B;  5J1G A;  2A9U A;  2WMN A;  3AEB A;  3UUM A;  2I59 A;  1Z0P A;  3OBV E;  4PK4 A;  1X79 A;  4X5T A;  3ONX A;  4WZX A;  4QH1 A;  1KNP A;  3TKL B;  3ZPO A;  4ADZ A;  3PUW F;  4B3S T;  1S94 A;  5F5W A;  5LJN A;  1J5E T;  2W62 A;  3P4P A;  5JDN A;  1N34 T;  3ANW B;  5KDM C;  4QX8 B;  5FNV E;  3B5M A;  2Y48 B;  2K48 A;  3HKE E;  4GYS A;  1T7S A;  1KEY A;  1OWA A;  4EZ4 A;  4DR3 T;  4H9R C;  3O9X A;  3MJX A;  1YXR A;  2C5K T;  2XAS B;  4AQG A;  2XQ9 A;  3E22 E;  2YK0 A;  2V7K A;  5HCJ A;  3BQK A;  2JMK A;  4P0A A;  4IE5 A;  2X67 A;  1MMN A;  3PUR A;  2V6Y B;  3RQU A;  3IHR A;  3AAE B;  5AQU B;  3UQ7 A;  4LF6 T;  4J2C A;  2OA5 A;  3ZT5 A;  3PUA A;  3CKD A;  3WI3 A;  1D0Z A;  1D1A A;  2CA5 A;  3C50 A;  3DP7 A;  5LOV E;  4AQY T;  1DU2 A;  4ISS A;  4HEA A;  4PJJ A;  5E0O A;  4H63 H;  4PJN A;  3SS1 A;  2K3W A;  4A56 A;  3I9Y A;  2C0S A;  2JJ9 A;  3GMI A;  4P1N A;  5HEO A;  5CA0 E;  5LP6 E;  2HPL A;  2QRX A;  5EZY E;  4ZZC A;  3T1H T;  5FXW A;  1H7C A;  4OHF A;  3EAM A;  5LA6 E;  1U4Q A;  2BG9 B;  4JYA T;  3KBT A;  4AXP A;  4IHJ E;  2YDQ A;  3OPC A;  4V1A v;  4I43 B;  3KVA A;  3AVR A;  4I50 E;  4OYJ A;  2NTX A;  4EB6 E;  3ZYK A;  5ABF A;  3AVS A;  5JR9 A;  2CWY A;  5AFU L;  4B3T T;  5L3D B;  2VL8 A;  4F6R C;  4DV0 T;  3N9M A;  4TWD A;  2F4V T;  2VL0 A;  5JRC A;  3JAF A;  5HEU A;  5JRC B;  4QWN B;  2WU5 A;  4LF5 T;  4AKG A;  3AE3 A;  3HA4 A;  3KDS E;  2XM2 A;  5J2T E;  4L0R A;  4HWF A;  5LXT E;  2ZM2 A;  2ACZ A;  3MA9 A;  3N9P A;  3RYI E;  4JI8 T;  3AA1 B;  4H63 V;  4EIW A;  4EZH A;  3JC6 D;  5J2U E;  3T8O A;  5F3J A;  3CQX C;  4HFV A;  3L39 A;  3TLS A;  1LKX A;  4IDP A;  2N1G A;  5AQM B;  4CXW A;  3RC8 A;  2MPK A;  3MAC A;  3ABV A;  4HWI B;  1CHU A;  2YIN A;  2X0L B;  4OK0 A;  1IBK T;  2BVL A;  2LM9 A;  5GON E;  3HKC E;  2LHN A;  2CLY B;  4YJ2 E;  1HG5 A;  3KV9 A;  4TUY E;  5ABE A;  3V5S A;  2AE9 A;  3E08 A;  3AEC A;  4QXB B;  2FJE A;  5KX5 E;  5LGU B;  2J47 A;  2W0G A;  2NW7 A;  4HFB A;  3RF1 A;  4X66 T;  3NRX A;  3Q5X A;  5IWA T;  3AE8 A;  2BZB A;  2JIW A;  4UEL A;  1BR0 A;  4U3C A;  4DID B;  3EHZ A;  3ZJ2 A;  2QYW A;  1ZHC A;  1KK7 A;  3ZKR A;  3NBX X;  4YHH T;  3P4R A;  2L9Q A;  2X9H A;  3ZYL A;  4ILA A;  3KBU A;  2WDR A;  4YJ3 E;  3ZT6 A;  5KMG P;  4WBO A;  1QLB A;  2VB6 A;  1IJ5 A;  3NRY A;  4DV6 T;  2CLY C;  2LSG A;  1N32 T;  2XTL A;  2LSJ A;  3L3P A;  3LK3 B;  1YQ3 A;  2IIU A;  4QKN A;  3C4Z A;  2JQK A;  2WMO A;  4O4H E;  4YY3 T;  3PUG A;  2CWO A;  4TNV A;  4TNW A;  2X0Y A;  1E2A A;  3CQG B;  2W2U A;  3ZMT B;  2KT9 A;  2ZM8 A;  3ZN1 B;  4MLK A;  3GN5 A;  2XJ7 A;  4IE7 A;  4KMC A;  4UVC B;  4Z8X A;  5DQW A;  3RHW A;  1FMW A;  1UGO A;  5AQF B;  4JI7 T;  2DHR A;  4PJM A;  2VUR A;  3UU4 A;  4JI1 T;  2P9B A;  3ZC1 A;  4JV5 T;  3O1J A;  4X20 E;  3M65 A;  1KNR A;  5ABG A;  4HN9 A;  4E7S A;  2WDQ A;  3CVR A;  2MAW A;  2X66 A;  3O1H A;  1YKH B;  3P4S A;  4ILC A;  4U74 A;  2BVM A;  2K9A A;  4DMW A;  2BG9 C;  3N2K E;  4M1P A;  2A3D A;  5JH7 E;  2J1D G;  2YDS A;  2XAH B;  3FZL B;  2LSK A;  2WDV A;  3AE6 A;  3M3Z B;  3ZT7 A;  1KNZ A;  1O3X A;  2XAQ B;  4X1I E;  3TLW A;  2UXB T;  3UQ4 A;  5ETW A;  4NUV A;  2IML A;  1XWM A;  4JI0 T;  2B76 A;  2I6H A;  2NR4 A;  3ZMU B;  2YDR A;  4DR5 T;  2DWK A;  2MOZ A;  2AXD S;  3H3A A;  1E7P A;  3I9W A;  4U2Z A;  5ABF B;  4EED A;  2IDO B;  2NWB A;  4QXH B;  3RLF F;  1SA0 E;  4KP3 C;  5FY1 A;  2LE8 A;  3K3Q C;  2HPJ A;  2FBW A;  1HX1 B;  4DND A;  2CCQ A;  2PFV A;  2XQA A;  2E9X D;  3ETV A;  3FBZ A;  2ACX A;  4H9N C;  4PJL A;  2NW9 A;  1VCS A;  4LF8 T;  3UUB A;  2YN6 A;  2OLT A;  3OJA A;  4K0U A;  2CM0 A;  5IUX A;  4EXT A;  3N9O A;  4L5G A;  5CA1 E;  4KI0 F;  5EK2 A;  2HHH T;  4Q25 A;  2DI4 A;  2PTF A;  2X68 A;  3H3M A;  4HE8 A;  3RPU A;  3U3I A;  4BJM A;  2ZM6 T;  5JDM A;  4EYU A;  4YT0 A;  3PE0 A;  2JQH A;  3QC9 A;  5C2T A;  4ZEY A;  2BKO A;  1OED A;  2YKS A;  3Q5D A;  3N5L A;  1M7K A;  2XAG B;  3FZK B;  4B6X A;  1D1C A;  2WY2 A;  2BDE A;  1HNZ T;  1T98 A;  3B13 A;  1OXZ A;  4A5X A;  4DR6 T;  3PV0 F;  2LKG A;  1HS7 A;  2V5C A;  2V5D A;  4U72 A;  1UUS A;  3GWH A;  5ADX L;  1XDP A;  3RH3 A;  2IC9 A;  2OV9 A;  3SWH A;  4AI6 A;  4DUY T;  4XAX B;  2IHR 1;  4IDN A;  1WRD A;  3BQL A;  5AQG B;  3OVU A;  4LFB T;  4O2A E;  1W0B A;  2L3L A;  2LRK A;  3GA8 A;  3NZQ A;  4G63 A;  1VOM A;  2C5J A;  4TV8 E;  2W00 A;  2DNX A;  2E9X C;  1SHZ C;  2VWA A;  5AQP B;  3J7Y q;  3T1Y T;  2NW8 A;  3N9N A;  2LOS A;  4ILU A;  3RYH E;  3HKD E;  4AQF C;  4CN4 A;  4CI3 B;  2M6B A;  3OKQ A;  2X9W A;  3PTR B;  3IEE A;  4ZS2 A;  3FZH B;  4I55 E;  3PUZ F;  2VK9 A;  2JRK A;  4QXC B;  5AQH B;  4DV5 T;  4KHP T;  4O4I E;  4IT4 A;  3UUN A;  1LRZ A;  2JQQ A;  2L8K A;  3CX6 B;  3P4W A;  2YU2 A;  3SFD A;  4EEB A;  5FL1 A;  4ZI3 D;  2UXX B;  4I4T E;  4KX6 A;  2KWI B;  1E1H B;  2H88 A;  2RP4 A;  2LSI A;  4HFI A;  4COF A;  2VKD A;  4YLH A;  1OED E;  5AQQ B;  2CHO A;  4YTP A;  3CIR A;  1HFA A;  2J4G A;  5LHI B;  4XZC A;  2HN2 A;  1HTJ F;  5FY0 A;  2I0M A;  4MHC A;  1W09 A;  4CZZ B;  2MTQ A;  2ZLY A;  3C98 B;  3DJB A;  1MMG A;  3RX6 A;  4UR9 A;  2D2S A;  3C4W A;  5FVL A;  1LVF A;  3ETU A;  3PUV F;  4A97 A;  5JR9 B;  5LGN B;  1FMV A;  1VRB A;  5JDF A;  5LHH B;  1XNQ T;  3EUH A;  3JC6 C;  2WS3 A;  5HEJ A;  1V9D A;  1VCT A;  2CEA A;  3AA0 B;  2WZI A;  2XPK A;  2WWV A;  4TZ4 C;  4GKJ T;  4EGW A;  1CUN A;  3FBL A;  2ES0 A;  3P8C D;  3NWI A;  4NPP A;  3F2E A;  3PDY A;  5CB4 E;  5HXE A;  5AQK B;  3K3O A;  3RIF A;  4X62 T;  1BR1 A;  2D9D A;  2E8I A;  2IUB A;  3FB2 A;  3IBP A;  2X51 A;  3PUY F;  4E7Z A;  1I6Z A;  4L9I A;  1B7T A;  3KV4 A;  2JQ9 A;  1G8X A;  4O4J E;  3C4X A;  4ZI7 E;  4HWC A;  3RI5 A;  5JQG E;  4JEH B;  3PUX F;  1ZEE A;  2GK9 A;  5AQI B;  2E5L T;  3N9L A;  5LJM A;  5BR8 T;  3RQW A;  2DCF A;  4AKH A;  4JI4 T;  1YW0 A;  2MYS A;  3VU7 H;  1D1B A;  4H9O C;  5AQV B;  3P7I A;  1L0V A;  4HFE A;  4U7Y A;  5AQR B;  5L3B B;  2EHO D;  4IL9 A;  4MBQ A;  4TWH A;  4OYK A;  3KIN B;  3AE5 A;  4A98 A;  2KLQ A;  2MBG A; 
#chains in the Genus database with same CATH homology
 4JI3 T;  4JV5 T;  2UXB T;  4B3S T;  4B3M T;  2UUA T;  1J5E T;  4JI0 T;  4DR5 T;  1N34 T;  3OTO T;  2UUC T;  1FJG T;  4DR3 T;  1HNX T;  4JI6 T;  4LF8 T;  4LF6 T;  2HHH T;  4AQY T;  2ZM6 T;  4X65 T;  4DV3 T;  4LFA T;  3T1H T;  4JYA T;  4JI4 T;  1HNZ T;  4LF7 T;  4B3T T;  4DR4 T;  4DR6 T;  4DV0 T;  1XNR T;  4DV2 T;  2F4V T;  1HNW T;  1XMO T;  4DUY T;  4LF5 T;  4LFB T;  1N33 T;  5LMU T;  4JI8 T;  4LF9 T;  3T1Y T;  4DV7 T;  1IBK T;  1I94 T;  4DV5 T;  4KHP T;  1HR0 T;  4X64 T;  1XMQ T;  4LF4 T;  4DR1 T;  4X66 T;  4LFC T;  5IWA T;  4JI5 T;  4YHH T;  4NXM T;  4DUZ T;  1XNQ T;  2UU9 T;  1IBM T;  4DR2 T;  4DV6 T;  4OX9 T;  1N32 T;  1IBL T;  4K0K T;  4YY3 T;  4GKK T;  4X62 T;  4JI2 T;  4DV1 T;  4NXN T;  2VQE T;  2UUB T;  4JI7 T;  2UXD T;  4DR7 T;  4JI1 T;  2E5L T;  5BR8 T;  5LMN T;  4DV4 T;  1N36 T;  4GKJ T;  2UXC T;  4B3R T;  2VQF T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...