4OX9T

Crystal structure of the aminoglycoside resistance methyltransferase npma bound to the 30s ribosomal subunit
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
99
structure length
99
Chain Sequence
b'RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
molecule tags Ribosome/antibiotic
source organism Escherichia coli
publication title Molecular recognition and modification of the 30S ribosome by the aminoglycoside-resistance methyltransferase NpmA.
pubmed doi rcsb
total genus 33
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2014-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 4ox9T00
4LFBT 4X62T 4DR3T 4OX9T 4DR2T 4DR1T 4B3RT 4B3MT 4LF8T 4DV2T 4LFAT 1J5ET 1N34T 4LF9T 4JI5T 4DR5T 1XNQT 1XNRT 1HNWT 2VQFT 4JI8T 2UXDT 4KHPT 4DUZT 2UUCT 5LMUT 4DV1T 4YHHT 2UXBT 1XMOT 4JI7T 3T1YT 5IWAT 4JI1T 4JI6T 4LF7T 4JI4T 4DUYT 5BR8T 4JI0T 1N32T 4DV3T 4JI2T 4NXMT 4LFCT 4NXNT 2VQET 2UU9T 4X65T 2E5LT 1HR0T 4DV0T 4X64T 4LF6T 5LMNT 4DV4T 4AQYT 2UXCT 4DV7T 4YY3T 4GKKT 4DR4T 1IBKT 1HNXT 4DV6T 4JYAT 4B3TT 4DR7T 1I94T 2UUBT 1FJGT 4LF5T 4GKJT 3OTOT 1N36T 2F4VT 4X66T 2ZM6T 1XMQT 4DV5T 3T1HT 4JV5T 1IBMT 1HNZT 4LF4T 2UUAT 4K0KT 4JI3T 1N33T 1IBLT 2HHHT 4B3ST 4DR6T
chains in the Genus database with same CATH superfamily
2CWYA 2XQYA 3JADA 1Y01A 4AKHA 5L3DB 4X62T 3ZEFB 4ZI3C 1U4QA 1Z8UA 2CLYB 2LOPA 5FL1A 2BG9A 5KDMC 3IBPA 1X9BA 2P9BA 4AKLA 4ZZBA 2LSKA 5JRCA 2GK9A 2LT3A 3LK2B 3EUHA 3Q5XA 4QXBB 3MJXA 4B3RT 3M3ZB 2KNDA 4U7IA 4PJJA 5HWYA 3JAFA 4QHOA 2XQ7A 3K3QC 1D0ZA 3SS1A 4PK4A 2JJ9A 4GIWA 4EZHA 1MNDA 3AE5A 4OHFA 4QX7B 3VU7H 4DR5T 1XNRT 5BMVE 2PBIA 2ZM8A 3RKGA 3UFEA 1HNWT 5DQVA 3V5SA 3QK6A 3AE3A 2MAWA 1OEDB 4HFIA 3C4WA 3VRAA 4TV8E 3ZMUB 5AQOB 2E5VA 3AAAB 3AEGA 4PK6A 2UUCT 3Q5DA 2A3DA 3O1JA 4WW0A 3SFDA 1N33T 4ERRA 4L5GA 2E8IA 3LDQB 3K3NA 3AEBA 3UTKA 4EB6E 2VKOA 4IE7A 3ETVA 5LGNB 1XDPA 3RX6A 4DV1T 2CA5A 3KV5A 3CKDA 2A9UA 2JIWA 2BKNA 4U72A 4O4IE 3TLUA 1MIVA 2LJLA 3MK7C 5HXHA 3ZMVB 1XMOT 3N9NA 4ILCA 4DBRA 4WNKA 4OYJA 2XJ7A 2KT9A 2G0UA 1WLXA 2CM0A 1VCSA 2BG9B 3AVRA 3FZMB 4U74A 3IHRA 2M67A 5H6RB 5JVDE 3ZSTA 5LG4A 3RC3A 3BQIA 1JNZA 3S4UA 4UVAB 2J1DG 3EHZA 3LK3B 5IYZE 3ZT6A 1IJ6A 2VB6A 3O9XA 1HFAA 3L09A 2YU1A 2D5UA 3N5LA 3RYFE 1E7PA 4AQGA 3A7MA 2WAUA 4U7YA 4QH1A 3RYCE 4QH4A 4CXWA 2CMRA 4AIUA 4PJMA 4EYYR 5JTGA 3P8CD 1IZNB 2R6GF 3UUMA 5ABEA 4CN6A 4WBNE 3PUSA 4LFCT 2BBHA 1YKEB 3AEFA 3HI2A 1WR0A 4FJOA 4KHZF 5HEOA 4IE0A 3RYIE 1OEDA 4G63A 5KX5E 1Z0PA 2E9XB 4H9PC 1MIYA 4TWHA 3UU6A 2UU9T 5LG3A 1G73A 2X0YA 3AEAA 3L8RA 4HFVA 3GWHA 3I0QA 2VWAA 2V7JA 4NUVA 5L3BB 2CRBA 3OVUA 2BZBA 4I0UA 1YXRA 4V1Av 4ILAA 2VK9A 2Q9QC 2JQ9A 3CPZA 3HR0A 5HEHA 1EZ3A 3AXJB 5LCYA 2XQ8A 3CX7B 2LLYA 2LOSA 5LMNT 3QB5K 3H3AA 1DU2A 5ABGA 3AAIA 4ZHQE 2NOXA 3C98B 5EZYE 5IHYA 4YY3T 3PJAA 3NKZA 2WY2A 3PUGA 1LRZA 3PE0A 4X1YE 2JQQA 2V5CA 4IDQA 2XQAA 2NW7A 3R84B 5L2LA 5FL0A 4H9RC 2LKGA 2QRXA 4DR7T 3MKDA 4E7SA 4HWDA 2UUBT 3I0OA 4HWHA 1AJ3A 1MMNA 3ZCJA 1FEWA 2VKHA 1KNPA 2CBIA 2LSIA 3AEDA 3UU8A 4BJNA 5TAOA 4A97A 2W62A 3L39A 1N36T 4BA9A 2VL0A 2WWUA 2MOZA 2QA7A 3KBUA 2DWGA 3N2KE 3PUXF 4X66T 2H88A 2YEVC 4OFZA 1D1CA 1OEDE 2IAKA 3ZC1A 5LA6E 3ZCIA 3E22E 3FBLA 4BJMA 4ASKA 3EI0A 2W67A 5FY1A 2WM9A 2XQ9A 3E08A 3GN5B 4TNVA 1UK5A 2C0SA 4ZXLA 3RYHE 2XAQB 2WP9A 3WI3A 3RQWA 1HNZT 2BKOA 2XSBA 1JNRA 3ZYKA 2WDQA 4GK5E 2DHRA 2JMHA 2HH7A 3QNUA 1S94A 4MLKA 3DP7A 3O1IA 4ZS2A 5CA1E 3CQCB 5J2TE 1IBLT 3PTRB 3L3PA 4I50E 4EGWA 5FY0A 4C91A 2QYWA 2ODVA 4EYUA 1M62A 2FUPA 2XSAA 4IDZA 4YJ3E 1LVKA 1VOMA 3AE6A 2CE7A 3ANWB 2LHNA 4I4TE 4LMKA 4MALA 4O2AE 1XDOA 3DTOA 3FZKB 1OWAA 4KI0F 4EEBA 2LE8A 5ABHA 4DR1T 3K8PC 2XY8B 4AKIA 3AE7A 4CI2B 2X9WA 2X66A 3ONLC 4P09A 2IC6A 1VCTA 4LF8T 3MZKB 3SOLA 4DR2T 3SRZA 2X67A 3B13A 1J5ET 1UX5A 3JC6C 2Z6EA 3KV9A 1MMDA 3PUVF 2VVNA 3ZT5A 5LXTE 4GYRA 2NWBA 3M65A 5FXVA 5AQRB 1NAFA 2AXDS 2YN6A 2Q9QA 3C4XA 3UUBA 5JH7E 2UXXB 5LP6E 4JI8T 2W4XA 5CB4E 1W0BA 4KHPT 2UXDT 1YD8G 1ZEEA 5AQNB 4JBWF 5FXWA 5HEJA 3FXEB 2YK0A 3CX6B 2XM1A 3PU8A 2CWOA 1FMVA 4UR9A 2WMOA 5AQFB 1XWMA 2I59A 4XAXB 4UVCB 2ES0A 2XTLA 3W15B 2K3WA 3NWIA 2LSYA 4LMJA 3CWZB 2NW8A 4GYSA 2W00A 2W0GA 4X1KE 5CGMA 1FIOA 1UX4A 3PU3A 2MPKA 2JMKA 2UXBT 4PW8A 2H7OA 1XZYA 3RH3A 3UFGA 3HA4A 2WWVA 4JI7T 3LG7A 3Q9DA 2LEHA 4I43B 5GONE 3CIRA 3RF1A 4YSZA 5CFBA 4DBQA 5LHGB 4LF7T 4L0RA 4JI4T 2N2NA 5EK4A 3O4XE 2MBGA 4DUYT 2YKSA 2IHR1 5BR8T 2JQKA 2H3RA 2NTYA 4A5XA 1WRDA 2I6HA 5C2TA 4MFRA 1ZKEA 4P0BA 2PTFA 5JDLA 2ACXA 2B1EA 3J7Yq 1US7B 2V7KA 3I1AA 3AECA 4EOZB 2QGSA 5C3JA 2W61A 2VKDA 3CK6A 4IGUA 1W09A 3IEEA 1U5PA 3NZQA 4PFOA 2CCQA 4TV9E 2HN2A 2EHOD 4IE6A 4TWDA 5JR9A 2MYSA 4A56A 2XQ3A 2LSGA 3I9WA 3AE8A 4J2CA 3O1HA 3PUAA 3RPUA 2VVSA 4X65T 3BQLA 1HX8A 3AA7B 4DV0T 1SHZC 4DR3T 3TLTA 2E9XA 2LSJA 3ONXA 4XZCA 4GOUA 4ISSA 5DJQC 5FKYA 2CBJA 3TLVA 3P7IA 3ESLA 3P4RA 2CEAA 2KXPB 4UV8B 5J1GA 1KF6A 3RGLA 3A5XA 4AXPA 2E2AA 3E0ZA 4O4LE 4G2AA 3KDSE 2WDRA 3Q5WA 4U2ZA 1Y64B 2D9DA 3IA3A 3ZYMA 3RLFF 4Z91A 1HF8A 2H7VC 4DV7T 4GKKT 2Y48B 3T8OA 2UXNB 4X20E 2XHEB 1IBKT 4CXXA 3VKGA 2D2SA 2IC9A 5AQUB 4DV6T 2JQHA 1HNXT 3CMLA 3QUJA 4YSYA 4B3TT 3AE9A 3PUQA 5CJ5A 1CUNA 5ADXL 5FYMA 5JDHA 1I94T 3VR9A 5M4YA 2DL1A 1MMAA 4QKNA 1YKHB 4LF5T 1SUMB 4U3CA 1X79A 3HL6A 4EEDA 4HWIB 4QWNB 4OK0A 4PJNA 3BQKA 1CHUA 5AQPB 4CN4A 5LYJE 5IWAT 4Z90A 1D1AA 3EABA 1IAPA 2ZM6T 4KP3C 1HX1B 3H37A 3FB2A 4ANJA 4I55E 2FJDA 2W2UA 4AKGA 4ZS3A 4E7ZA 3HKEE 4QH5A 2IMLA 2X0LB 3UT5E 4CXYA 2BKPA 2UUAT 3QB5A 4COFA 5KMGP 3RRWA 4UEMA 2X51A 1NEKA 5H6QB 2KMFA 3UQ4A 1YQ4A 3N9MA 3ZMTB 1BR2A 1W0AA 4WYVA 5L4EA 2CXDA 2V7IA 5L3EB 5LHHB 4DR6T 2EHOC 4HFCA 2IIUA 3IF8B 4AQFA 2V5DA 3UU3A 2W66A 4HN9A 4EIWA 4ZZCA 3PDYA 1FMWA 4DVDA 5HYAA 2FJBA 1UCUA 1B7TA 3D0TA 2WU5A 5AQLB 3SWHA 4ADZA 1R8IA 5JR9C 4JEUB 4YJ2E 3N9PA 5JREA 4B3MT 3DJBA 3NVOA 3OYZA 2V6XA 3RKOA 4JUYA 2K5BB 3ANWA 4IIJE 5JDQA 4DV2T 2BVMA 3RIAA 4JLEA 3UUNA 3KVAA 2ACZA 3PURA 3Q2MA 2HPJA 5LGUB 4LFAT 1N34T 2XM2A 4O8SA 5JDNA 2BS2A 4L9IA 2E9XC 3ZPOA 4TZ4C 2YINA 3HKDE 1NENA 1ZV4X 3TLSA 3MA9A 2CXLA 4LF6T 3TLWA 3ZLIA 4DO0A 4ZI2D 4IE4A 3LBXA 2XUEA 3VRBA 4F8HA 5LNKA 2ZM0A 3H3MA 2NR4A 3ZT7A 4QXCB 5FXXA 4UF0B 4N78D 2KINB 2YOEA 3RQUA 3HKCE 2C5JA 1V9DA 3AA6B 2WSSV 5HXCA 5HXSA 4H9QC 3P50A 2FJEA 5ABFA 5AQJB 3KINB 3PUWF 2CPTA 4U2YA 4B6XA 1YQ3A 4JI1T 3RRCA 2BS3A 3T1YT 4U33A 3OYXA 2RA1A 2FJAA 4PAGA 4JI6T 5JRCB 2H89A 1O3XA 1T72A 5DABA 4CQIA 5C8YE 2BDEA 2N1GA 2K9AA 1D0XA 4JI0T 2NTXA 3LK42 3N9OA 1S35A 2K24A 1WFDA 2CLYC 5AQKB 5LGTB 1QUUA 2DI4A 5FP3A 5FY7A 4JI2T 4AKRB 2KLQA 4C90A 2N9DA 1J1JA 3VHLA 5LJMA 3V5UA 5L3CB 2PFVA 2XZEA 4ISTA 4OYKA 3C50A 4UELA 5A1LA 4NXNT 4ZI2C 5JQGE 3F57A 4O4JE 2VQET 3K3OA 3LBXB 4TWFA 4YSXA 3PUZF 4QXHB 3RIUC 3ZN0B 2XAJB 2WU2A 2EHOA 1E1HB 1GQEA 1H7CA 3P4QA 4ZI3D 2W63A 2BS4A 4WBOA 3KV4A 1G8XA 4X64T 3KV6A 1HS7A 2KZ7B 2V7MA 3RIUA 1KK7A 1ZP0A 2ZMAA 2M6BA 3CQGB 3ONJA 1ZHCA 3SFEA 3N9QA 5AQGB 2V8SV 2XAFB 4KMCA 1J5WA 1QSDA 2J47A 2AE9A 3OBVE 4HE8A 4HKAA 5HCMA 2Y6XA 3ZJ2A 4DR4T 5FXZA 2IUBA 1KFYA 1KEYA 4KBMB 5FNVE 2F4VT 3WAKA 5AQVB 5JDGA 2KSRA 3CQXC 1MIWA 2WDVA 2M6IA 5L4HA 2KWIB 3F31A 2YDSA 2V1DB 2LKHA 2V6YB 5LOVE 1ZOYA 3K1SA 3OTOT 3RHWA 3ZN1B 2J62A 4Z8XA 3J9X1 3CVRA 2OA5A 2A72A 4HFHA 2XAGB 3AE4A 4DV5T 3T1HT 4YTMA 4JV5T 2IW5B 2Q9QB 2XPKA 4HTEA 5HCJA 3UULA 2XQ5A 1T7SA 1YW0A 3N2OA 3C51A 3C64A 4HWFA 3EDVA 3UU5A 4YTPA 2Q9QD 2L3LA 5F3JA 3QC9A 2DNXA 3X1DA 1D1BA 2KWHA 2LM9A 4AI6A 2XAHB 4YT0A 4NPPA 2QVAA 4ZEYA 4QX8B 3RI5A 2HHHT 4TNWA 4B3ST 4HEAA 3WAJA 5AQMB 3AVSA 5AFUL 2WCAA 1WYBA 2WQYA 4HWCA 3AEEA 4IDOA 4LFBT 3PUYF 4YFSA 5L3FB 1IJ5A 1HCIA 4K0KT 4CI3B 1WYCA 4OX9T 5EK3A 2CXFA 1WCRA 1QLBA 5CA0E 4H9OC 2LM2A 4IHJE 4IL9A 4DIDB 4UVBB 1UUSA 4EXTA 2RP4A 5JR9B 5L47A 4ZI7E 4NUUA 2J4GA 2X9YA 4O2BE 5AQIB 2ODUA 2WB5A 3ZKRA 5IUXA 2YU2A 5ETWA 1E2AA 2LRLA 5HEGA 3ZSSA 2JPFA 4JI5T 4LF9T 1NWMX 4PJLA 4TN7B 4H63V 5LBQB 2B76A 3RIFA 2WZIA 4EV6A 1XNQT 1UGOA 4MBQA 2HN1A 4IE5A 3PV0F 4H63H 5J0ZA 2K48A 1HTJF 5FVKA 4U31A 2MTQA 2VQFT 3GN5A 5KXJA 4YLHA 5HXRA 4DUZT 2C5KT 3UU4A 5ABFB 2PG8A 3KVBA 3NZPA 3KBTA 3MXZA 3N2GE 3NBXX 2CHNA 3ETUA 3P4SA 5AQSB 3AB3B 5LMUT 3Q5EA 5L3GB 3N9LA 5HAXA 4CN1A 4YHHT 3ZC0A 4WZXA 3AA0B 3B57A 2VL8A 3NRYA 1HG5A 1OXZA 4NIQA 1N32T 2X68A 2XASB 4DNDA 5AQHB 3ZMZB 4ILUA 4KX6A 3ZMSB 2IDOB 4P1NA 2A2FX 4AISA 2BG9E 3ZJ1A 2RPAA 3BK9A 3FZFB 1BR0A 3VKHA 2V26A 5LHIB 5F5WA 3P4WA 3F2EA 2PJQA 3FZLB 4EZ4A 4DMVA 3OJAA 4DV3T 3GMIA 4NXMT 4XBFB 3JC6D 2DLRA 3ZYLA 4P0AA 2I0MA 2D0UA 2V7LA 3HKBE 4K0UA 3TKLB 3ABVA 1BR1A 4YTNA 5AQTB 1OEDC 4CI1B 3LJCA 4PFPA 3VR8A 3U3IA 2X9HA 2C5IT 2JRKA 4GK0E 4PK5A 2BG9C 2D0TA 4MHCA 4IDNA 2XQ6A 3RC8A 3CX8B 1MMGA 4X1IE 1BR4A 2E5LT 5FVLA 1SA0E 2DCFA 3QOFA 5DQWA 1HR0T 2HPLA 5LB7B 3LFMA 1VRBA 1T98A 3OKQA 4IDPA 5HEUA 4UV9B 2VURA 1L0VA 5AQQB 2LHRA 4EAHA 4O4HE 5HWXA 4H9NC 1D0YA 4KUMB 4PNIA 4IREA 5JDFA 1MNEA 2SPCA 4BAYB 5J2UE 2LRKA 2DWKA 2EHOB 2YDRA 3LSVA 4DV4T 2L9QA 3G06A 4AQYT 2UXCT 3C4ZA 3KFWX 2E9XD 2FBWA 3AA1B 2NW9A 2Y8DA 3AXJA 3AAEB 4M1PA 4IT4A 5JDMA 2VASA 2X9XA 4HGAA 2V6YA 1UURA 3U78A 3AE2A 3JCFA 4JYAT 3FXDB 2YDQA 2ZM2A 4FI5A 3NRXA 4ILBA 3UQ7A 4IL4A 1KNZA 2WMNA 1SE7A 3EDUA 3MACA 5HXEA 5LJNA 1KNRA 3P4PA 1FJGT 4GKJT 2BBJA 3FZHB 3PJAJ 1LVFA 4Q25A 1LKXA 3A8YC 3I9YA 3JAEA 3FBZA 4HFBA 3B5MA 4H9SE 2WZHA 4ZOLE 1M7KA 4JEHB 2CHOA 5LBMA 1XMQT 2X0HA 4LMLA 3UUXB 3FHNA 5E0OA 4CZZB 1T8BA 4TX5A 3OPCA 2NP9A 2XQ4A 1I6ZA 2WBLA 3EVYA 4A98A 2VKJA 3R6NA 4YXDA 4UXNB 4DMWA 1IBMT 1HG2A 4X5TA 2BVLA 4TUYE 4F6RC 3EAMA 4YHJA 5EK2A 2OLTA 2OV9A 4LF4T 2L8KA 2ZLYA 3GA8A 1W9RA 4AQFC 2WS3A 4HFDA 4UF0A 5FMNA 3AE1A 1WR6A 4JI3T 4HFEA 4UIGA 5F8PA
chains in the Genus database with same CATH topology
4LFBT 4X62T 4DR3T 4OX9T 4DR2T 4DR1T 4B3RT 4B3MT 4LF8T 4DV2T 4LFAT 1J5ET 1N34T 4LF9T 4JI5T 4DR5T 1XNQT 1XNRT 1HNWT 2VQFT 4JI8T 2UXDT 4KHPT 4DUZT 2UUCT 5LMUT 4DV1T 4YHHT 2UXBT 1XMOT 4JI7T 3T1YT 5IWAT 4JI1T 4JI6T 4LF7T 4JI4T 4DUYT 5BR8T 4JI0T 1N32T 4DV3T 4JI2T 4NXMT 4LFCT 4NXNT 2VQET 2UU9T 4X65T 2E5LT 1HR0T 4DV0T 4X64T 4LF6T 5LMNT 4DV4T 4AQYT 2UXCT 4DV7T 4YY3T 4GKKT 4DR4T 1IBKT 1HNXT 4DV6T 4JYAT 4B3TT 4DR7T 1I94T 2UUBT 1FJGT 4LF5T 4GKJT 3OTOT 1N36T 2F4VT 4X66T 2ZM6T 1XMQT 4DV5T 3T1HT 4JV5T 1IBMT 1HNZT 4LF4T 2UUAT 4K0KT 4JI3T 1N33T 1IBLT 2HHHT 4B3ST 4DR6T
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LFB T;  4X62 T;  4DR3 T;  4OX9 T;  4DR2 T;  4DR1 T;  4B3R T;  4B3M T;  4LF8 T;  4DV2 T;  4LFA T;  1J5E T;  1N34 T;  4LF9 T;  4JI5 T;  4DR5 T;  1XNQ T;  1XNR T;  1HNW T;  2VQF T;  4JI8 T;  2UXD T;  4KHP T;  4DUZ T;  2UUC T;  5LMU T;  4DV1 T;  4YHH T;  2UXB T;  1XMO T;  4JI7 T;  3T1Y T;  5IWA T;  4JI1 T;  4JI6 T;  4LF7 T;  4JI4 T;  4DUY T;  5BR8 T;  4JI0 T;  1N32 T;  4DV3 T;  4JI2 T;  4NXM T;  4LFC T;  4NXN T;  2VQE T;  2UU9 T;  4X65 T;  2E5L T;  1HR0 T;  4DV0 T;  4X64 T;  4LF6 T;  5LMN T;  4DV4 T;  4AQY T;  2UXC T;  4DV7 T;  4YY3 T;  4GKK T;  4DR4 T;  1IBK T;  1HNX T;  4DV6 T;  4JYA T;  4B3T T;  4DR7 T;  1I94 T;  2UUB T;  1FJG T;  4LF5 T;  4GKJ T;  3OTO T;  1N36 T;  2F4V T;  4X66 T;  2ZM6 T;  1XMQ T;  4DV5 T;  3T1H T;  4JV5 T;  1IBM T;  1HNZ T;  4LF4 T;  2UUA T;  4K0K T;  4JI3 T;  1N33 T;  1IBL T;  2HHH T;  4B3S T;  4DR6 T; 
#chains in the Genus database with same CATH topology
 2CWY A;  2XQY A;  3JAD A;  1Y01 A;  4AKH A;  5L3D B;  4X62 T;  3ZEF B;  4ZI3 C;  1U4Q A;  1Z8U A;  2CLY B;  2LOP A;  5FL1 A;  2BG9 A;  5KDM C;  3IBP A;  1X9B A;  2P9B A;  4AKL A;  4ZZB A;  2LSK A;  5JRC A;  2GK9 A;  2LT3 A;  3LK2 B;  3EUH A;  3Q5X A;  4QXB B;  3MJX A;  4B3R T;  3M3Z B;  2KND A;  4U7I A;  4PJJ A;  5HWY A;  3JAF A;  4QHO A;  2XQ7 A;  3K3Q C;  1D0Z A;  3SS1 A;  4PK4 A;  2JJ9 A;  4GIW A;  4EZH A;  1MND A;  3AE5 A;  4OHF A;  4QX7 B;  3VU7 H;  4DR5 T;  1XNR T;  5BMV E;  2PBI A;  2ZM8 A;  3RKG A;  3UFE A;  1HNW T;  5DQV A;  3V5S A;  3QK6 A;  3AE3 A;  2MAW A;  1OED B;  4HFI A;  3C4W A;  3VRA A;  4TV8 E;  3ZMU B;  5AQO B;  2E5V A;  3AAA B;  3AEG A;  4PK6 A;  2UUC T;  3Q5D A;  2A3D A;  3O1J A;  4WW0 A;  3SFD A;  1N33 T;  4ERR A;  4L5G A;  2E8I A;  3LDQ B;  3K3N A;  3AEB A;  3UTK A;  4EB6 E;  2VKO A;  4IE7 A;  3ETV A;  5LGN B;  1XDP A;  3RX6 A;  4DV1 T;  2CA5 A;  3KV5 A;  3CKD A;  2A9U A;  2JIW A;  2BKN A;  4U72 A;  4O4I E;  3TLU A;  1MIV A;  2LJL A;  3MK7 C;  5HXH A;  3ZMV B;  1XMO T;  3N9N A;  4ILC A;  4DBR A;  4WNK A;  4OYJ A;  2XJ7 A;  2KT9 A;  2G0U A;  1WLX A;  2CM0 A;  1VCS A;  2BG9 B;  3AVR A;  3FZM B;  4U74 A;  3IHR A;  2M67 A;  5H6R B;  5JVD E;  3ZST A;  5LG4 A;  3RC3 A;  3BQI A;  1JNZ A;  3S4U A;  4UVA B;  2J1D G;  3EHZ A;  3LK3 B;  5IYZ E;  3ZT6 A;  1IJ6 A;  2VB6 A;  3O9X A;  1HFA A;  3L09 A;  2YU1 A;  2D5U A;  3N5L A;  3RYF E;  1E7P A;  4AQG A;  3A7M A;  2WAU A;  4U7Y A;  4QH1 A;  3RYC E;  4QH4 A;  4CXW A;  2CMR A;  4AIU A;  4PJM A;  4EYY R;  5JTG A;  3P8C D;  1IZN B;  2R6G F;  3UUM A;  5ABE A;  4CN6 A;  4WBN E;  3PUS A;  4LFC T;  2BBH A;  1YKE B;  3AEF A;  3HI2 A;  1WR0 A;  4FJO A;  4KHZ F;  5HEO A;  4IE0 A;  3RYI E;  1OED A;  4G63 A;  5KX5 E;  1Z0P A;  2E9X B;  4H9P C;  1MIY A;  4TWH A;  3UU6 A;  2UU9 T;  5LG3 A;  1G73 A;  2X0Y A;  3AEA A;  3L8R A;  4HFV A;  3GWH A;  3I0Q A;  2VWA A;  2V7J A;  4NUV A;  5L3B B;  2CRB A;  3OVU A;  2BZB A;  4I0U A;  1YXR A;  4V1A v;  4ILA A;  2VK9 A;  2Q9Q C;  2JQ9 A;  3CPZ A;  3HR0 A;  5HEH A;  1EZ3 A;  3AXJ B;  5LCY A;  2XQ8 A;  3CX7 B;  2LLY A;  2LOS A;  5LMN T;  3QB5 K;  3H3A A;  1DU2 A;  5ABG A;  3AAI A;  4ZHQ E;  2NOX A;  3C98 B;  5EZY E;  5IHY A;  4YY3 T;  3PJA A;  3NKZ A;  2WY2 A;  3PUG A;  1LRZ A;  3PE0 A;  4X1Y E;  2JQQ A;  2V5C A;  4IDQ A;  2XQA A;  2NW7 A;  3R84 B;  5L2L A;  5FL0 A;  4H9R C;  2LKG A;  2QRX A;  4DR7 T;  3MKD A;  4E7S A;  4HWD A;  2UUB T;  3I0O A;  4HWH A;  1AJ3 A;  1MMN A;  3ZCJ A;  1FEW A;  2VKH A;  1KNP A;  2CBI A;  2LSI A;  3AED A;  3UU8 A;  4BJN A;  5TAO A;  4A97 A;  2W62 A;  3L39 A;  1N36 T;  4BA9 A;  2VL0 A;  2WWU A;  2MOZ A;  2QA7 A;  3KBU A;  2DWG A;  3N2K E;  3PUX F;  4X66 T;  2H88 A;  2YEV C;  4OFZ A;  1D1C A;  1OED E;  2IAK A;  3ZC1 A;  5LA6 E;  3ZCI A;  3E22 E;  3FBL A;  4BJM A;  4ASK A;  3EI0 A;  2W67 A;  5FY1 A;  2WM9 A;  2XQ9 A;  3E08 A;  3GN5 B;  4TNV A;  1UK5 A;  2C0S A;  4ZXL A;  3RYH E;  2XAQ B;  2WP9 A;  3WI3 A;  3RQW A;  1HNZ T;  2BKO A;  2XSB A;  1JNR A;  3ZYK A;  2WDQ A;  4GK5 E;  2DHR A;  2JMH A;  2HH7 A;  3QNU A;  1S94 A;  4MLK A;  3DP7 A;  3O1I A;  4ZS2 A;  5CA1 E;  3CQC B;  5J2T E;  1IBL T;  3PTR B;  3L3P A;  4I50 E;  4EGW A;  5FY0 A;  4C91 A;  2QYW A;  2ODV A;  4EYU A;  1M62 A;  2FUP A;  2XSA A;  4IDZ A;  4YJ3 E;  1LVK A;  1VOM A;  3AE6 A;  2CE7 A;  3ANW B;  2LHN A;  4I4T E;  4LMK A;  4MAL A;  4O2A E;  1XDO A;  3DTO A;  3FZK B;  1OWA A;  4KI0 F;  4EEB A;  2LE8 A;  5ABH A;  4DR1 T;  3K8P C;  2XY8 B;  4AKI A;  3AE7 A;  4CI2 B;  2X9W A;  2X66 A;  3ONL C;  4P09 A;  2IC6 A;  1VCT A;  4LF8 T;  3MZK B;  3SOL A;  4DR2 T;  3SRZ A;  2X67 A;  3B13 A;  1J5E T;  1UX5 A;  3JC6 C;  2Z6E A;  3KV9 A;  1MMD A;  3PUV F;  2VVN A;  3ZT5 A;  5LXT E;  4GYR A;  2NWB A;  3M65 A;  5FXV A;  5AQR B;  1NAF A;  2AXD S;  2YN6 A;  2Q9Q A;  3C4X A;  3UUB A;  5JH7 E;  2UXX B;  5LP6 E;  4JI8 T;  2W4X A;  5CB4 E;  1W0B A;  4KHP T;  2UXD T;  1YD8 G;  1ZEE A;  5AQN B;  4JBW F;  5FXW A;  5HEJ A;  3FXE B;  2YK0 A;  3CX6 B;  2XM1 A;  3PU8 A;  2CWO A;  1FMV A;  4UR9 A;  2WMO A;  5AQF B;  1XWM A;  2I59 A;  4XAX B;  4UVC B;  2ES0 A;  2XTL A;  3W15 B;  2K3W A;  3NWI A;  2LSY A;  4LMJ A;  3CWZ B;  2NW8 A;  4GYS A;  2W00 A;  2W0G A;  4X1K E;  5CGM A;  1FIO A;  1UX4 A;  3PU3 A;  2MPK A;  2JMK A;  2UXB T;  4PW8 A;  2H7O A;  1XZY A;  3RH3 A;  3UFG A;  3HA4 A;  2WWV A;  4JI7 T;  3LG7 A;  3Q9D A;  2LEH A;  4I43 B;  5GON E;  3CIR A;  3RF1 A;  4YSZ A;  5CFB A;  4DBQ A;  5LHG B;  4LF7 T;  4L0R A;  4JI4 T;  2N2N A;  5EK4 A;  3O4X E;  2MBG A;  4DUY T;  2YKS A;  2IHR 1;  5BR8 T;  2JQK A;  2H3R A;  2NTY A;  4A5X A;  1WRD A;  2I6H A;  5C2T A;  4MFR A;  1ZKE A;  4P0B A;  2PTF A;  5JDL A;  2ACX A;  2B1E A;  3J7Y q;  1US7 B;  2V7K A;  3I1A A;  3AEC A;  4EOZ B;  2QGS A;  5C3J A;  2W61 A;  2VKD A;  3CK6 A;  4IGU A;  1W09 A;  3IEE A;  1U5P A;  3NZQ A;  4PFO A;  2CCQ A;  4TV9 E;  2HN2 A;  2EHO D;  4IE6 A;  4TWD A;  5JR9 A;  2MYS A;  4A56 A;  2XQ3 A;  2LSG A;  3I9W A;  3AE8 A;  4J2C A;  3O1H A;  3PUA A;  3RPU A;  2VVS A;  4X65 T;  3BQL A;  1HX8 A;  3AA7 B;  4DV0 T;  1SHZ C;  4DR3 T;  3TLT A;  2E9X A;  2LSJ A;  3ONX A;  4XZC A;  4GOU A;  4ISS A;  5DJQ C;  5FKY A;  2CBJ A;  3TLV A;  3P7I A;  3ESL A;  3P4R A;  2CEA A;  2KXP B;  4UV8 B;  5J1G A;  1KF6 A;  3RGL A;  3A5X A;  4AXP A;  2E2A A;  3E0Z A;  4O4L E;  4G2A A;  3KDS E;  2WDR A;  3Q5W A;  4U2Z A;  1Y64 B;  2D9D A;  3IA3 A;  3ZYM A;  3RLF F;  4Z91 A;  1HF8 A;  2H7V C;  4DV7 T;  4GKK T;  2Y48 B;  3T8O A;  2UXN B;  4X20 E;  2XHE B;  1IBK T;  4CXX A;  3VKG A;  2D2S A;  2IC9 A;  5AQU B;  4DV6 T;  2JQH A;  1HNX T;  3CML A;  3QUJ A;  4YSY A;  4B3T T;  3AE9 A;  3PUQ A;  5CJ5 A;  1CUN A;  5ADX L;  5FYM A;  5JDH A;  1I94 T;  3VR9 A;  5M4Y A;  2DL1 A;  1MMA A;  4QKN A;  1YKH B;  4LF5 T;  1SUM B;  4U3C A;  1X79 A;  3HL6 A;  4EED A;  4HWI B;  4QWN B;  4OK0 A;  4PJN A;  3BQK A;  1CHU A;  5AQP B;  4CN4 A;  5LYJ E;  5IWA T;  4Z90 A;  1D1A A;  3EAB A;  1IAP A;  2ZM6 T;  4KP3 C;  1HX1 B;  3H37 A;  3FB2 A;  4ANJ A;  4I55 E;  2FJD A;  2W2U A;  4AKG A;  4ZS3 A;  4E7Z A;  3HKE E;  4QH5 A;  2IML A;  2X0L B;  3UT5 E;  4CXY A;  2BKP A;  2UUA T;  3QB5 A;  4COF A;  5KMG P;  3RRW A;  4UEM A;  2X51 A;  1NEK A;  5H6Q B;  2KMF A;  3UQ4 A;  1YQ4 A;  3N9M A;  3ZMT B;  1BR2 A;  1W0A A;  4WYV A;  5L4E A;  2CXD A;  2V7I A;  5L3E B;  5LHH B;  4DR6 T;  2EHO C;  4HFC A;  2IIU A;  3IF8 B;  4AQF A;  2V5D A;  3UU3 A;  2W66 A;  4HN9 A;  4EIW A;  4ZZC A;  3PDY A;  1FMW A;  4DVD A;  5HYA A;  2FJB A;  1UCU A;  1B7T A;  3D0T A;  2WU5 A;  5AQL B;  3SWH A;  4ADZ A;  1R8I A;  5JR9 C;  4JEU B;  4YJ2 E;  3N9P A;  5JRE A;  4B3M T;  3DJB A;  3NVO A;  3OYZ A;  2V6X A;  3RKO A;  4JUY A;  2K5B B;  3ANW A;  4IIJ E;  5JDQ A;  4DV2 T;  2BVM A;  3RIA A;  4JLE A;  3UUN A;  3KVA A;  2ACZ A;  3PUR A;  3Q2M A;  2HPJ A;  5LGU B;  4LFA T;  1N34 T;  2XM2 A;  4O8S A;  5JDN A;  2BS2 A;  4L9I A;  2E9X C;  3ZPO A;  4TZ4 C;  2YIN A;  3HKD E;  1NEN A;  1ZV4 X;  3TLS A;  3MA9 A;  2CXL A;  4LF6 T;  3TLW A;  3ZLI A;  4DO0 A;  4ZI2 D;  4IE4 A;  3LBX A;  2XUE A;  3VRB A;  4F8H A;  5LNK A;  2ZM0 A;  3H3M A;  2NR4 A;  3ZT7 A;  4QXC B;  5FXX A;  4UF0 B;  4N78 D;  2KIN B;  2YOE A;  3RQU A;  3HKC E;  2C5J A;  1V9D A;  3AA6 B;  2WSS V;  5HXC A;  5HXS A;  4H9Q C;  3P50 A;  2FJE A;  5ABF A;  5AQJ B;  3KIN B;  3PUW F;  2CPT A;  4U2Y A;  4B6X A;  1YQ3 A;  4JI1 T;  3RRC A;  2BS3 A;  3T1Y T;  4U33 A;  3OYX A;  2RA1 A;  2FJA A;  4PAG A;  4JI6 T;  5JRC B;  2H89 A;  1O3X A;  1T72 A;  5DAB A;  4CQI A;  5C8Y E;  2BDE A;  2N1G A;  2K9A A;  1D0X A;  4JI0 T;  2NTX A;  3LK4 2;  3N9O A;  1S35 A;  2K24 A;  1WFD A;  2CLY C;  5AQK B;  5LGT B;  1QUU A;  2DI4 A;  5FP3 A;  5FY7 A;  4JI2 T;  4AKR B;  2KLQ A;  4C90 A;  2N9D A;  1J1J A;  3VHL A;  5LJM A;  3V5U A;  5L3C B;  2PFV A;  2XZE A;  4IST A;  4OYK A;  3C50 A;  4UEL A;  5A1L A;  4NXN T;  4ZI2 C;  5JQG E;  3F57 A;  4O4J E;  2VQE T;  3K3O A;  3LBX B;  4TWF A;  4YSX A;  3PUZ F;  4QXH B;  3RIU C;  3ZN0 B;  2XAJ B;  2WU2 A;  2EHO A;  1E1H B;  1GQE A;  1H7C A;  3P4Q A;  4ZI3 D;  2W63 A;  2BS4 A;  4WBO A;  3KV4 A;  1G8X A;  4X64 T;  3KV6 A;  1HS7 A;  2KZ7 B;  2V7M A;  3RIU A;  1KK7 A;  1ZP0 A;  2ZMA A;  2M6B A;  3CQG B;  3ONJ A;  1ZHC A;  3SFE A;  3N9Q A;  5AQG B;  2V8S V;  2XAF B;  4KMC A;  1J5W A;  1QSD A;  2J47 A;  2AE9 A;  3OBV E;  4HE8 A;  4HKA A;  5HCM A;  2Y6X A;  3ZJ2 A;  4DR4 T;  5FXZ A;  2IUB A;  1KFY A;  1KEY A;  4KBM B;  5FNV E;  2F4V T;  3WAK A;  5AQV B;  5JDG A;  2KSR A;  3CQX C;  1MIW A;  2WDV A;  2M6I A;  5L4H A;  2KWI B;  3F31 A;  2YDS A;  2V1D B;  2LKH A;  2V6Y B;  5LOV E;  1ZOY A;  3K1S A;  3OTO T;  3RHW A;  3ZN1 B;  2J62 A;  4Z8X A;  3J9X 1;  3CVR A;  2OA5 A;  2A72 A;  4HFH A;  2XAG B;  3AE4 A;  4DV5 T;  3T1H T;  4YTM A;  4JV5 T;  2IW5 B;  2Q9Q B;  2XPK A;  4HTE A;  5HCJ A;  3UUL A;  2XQ5 A;  1T7S A;  1YW0 A;  3N2O A;  3C51 A;  3C64 A;  4HWF A;  3EDV A;  3UU5 A;  4YTP A;  2Q9Q D;  2L3L A;  5F3J A;  3QC9 A;  2DNX A;  3X1D A;  1D1B A;  2KWH A;  2LM9 A;  4AI6 A;  2XAH B;  4YT0 A;  4NPP A;  2QVA A;  4ZEY A;  4QX8 B;  3RI5 A;  2HHH T;  4TNW A;  4B3S T;  4HEA A;  3WAJ A;  5AQM B;  3AVS A;  5AFU L;  2WCA A;  1WYB A;  2WQY A;  4HWC A;  3AEE A;  4IDO A;  4LFB T;  3PUY F;  4YFS A;  5L3F B;  1IJ5 A;  1HCI A;  4K0K T;  4CI3 B;  1WYC A;  4OX9 T;  5EK3 A;  2CXF A;  1WCR A;  1QLB A;  5CA0 E;  4H9O C;  2LM2 A;  4IHJ E;  4IL9 A;  4DID B;  4UVB B;  1UUS A;  4EXT A;  2RP4 A;  5JR9 B;  5L47 A;  4ZI7 E;  4NUU A;  2J4G A;  2X9Y A;  4O2B E;  5AQI B;  2ODU A;  2WB5 A;  3ZKR A;  5IUX A;  2YU2 A;  5ETW A;  1E2A A;  2LRL A;  5HEG A;  3ZSS A;  2JPF A;  4JI5 T;  4LF9 T;  1NWM X;  4PJL A;  4TN7 B;  4H63 V;  5LBQ B;  2B76 A;  3RIF A;  2WZI A;  4EV6 A;  1XNQ T;  1UGO A;  4MBQ A;  2HN1 A;  4IE5 A;  3PV0 F;  4H63 H;  5J0Z A;  2K48 A;  1HTJ F;  5FVK A;  4U31 A;  2MTQ A;  2VQF T;  3GN5 A;  5KXJ A;  4YLH A;  5HXR A;  4DUZ T;  2C5K T;  3UU4 A;  5ABF B;  2PG8 A;  3KVB A;  3NZP A;  3KBT A;  3MXZ A;  3N2G E;  3NBX X;  2CHN A;  3ETU A;  3P4S A;  5AQS B;  3AB3 B;  5LMU T;  3Q5E A;  5L3G B;  3N9L A;  5HAX A;  4CN1 A;  4YHH T;  3ZC0 A;  4WZX A;  3AA0 B;  3B57 A;  2VL8 A;  3NRY A;  1HG5 A;  1OXZ A;  4NIQ A;  1N32 T;  2X68 A;  2XAS B;  4DND A;  5AQH B;  3ZMZ B;  4ILU A;  4KX6 A;  3ZMS B;  2IDO B;  4P1N A;  2A2F X;  4AIS A;  2BG9 E;  3ZJ1 A;  2RPA A;  3BK9 A;  3FZF B;  1BR0 A;  3VKH A;  2V26 A;  5LHI B;  5F5W A;  3P4W A;  3F2E A;  2PJQ A;  3FZL B;  4EZ4 A;  4DMV A;  3OJA A;  4DV3 T;  3GMI A;  4NXM T;  4XBF B;  3JC6 D;  2DLR A;  3ZYL A;  4P0A A;  2I0M A;  2D0U A;  2V7L A;  3HKB E;  4K0U A;  3TKL B;  3ABV A;  1BR1 A;  4YTN A;  5AQT B;  1OED C;  4CI1 B;  3LJC A;  4PFP A;  3VR8 A;  3U3I A;  2X9H A;  2C5I T;  2JRK A;  4GK0 E;  4PK5 A;  2BG9 C;  2D0T A;  4MHC A;  4IDN A;  2XQ6 A;  3RC8 A;  3CX8 B;  1MMG A;  4X1I E;  1BR4 A;  2E5L T;  5FVL A;  1SA0 E;  2DCF A;  3QOF A;  5DQW A;  1HR0 T;  2HPL A;  5LB7 B;  3LFM A;  1VRB A;  1T98 A;  3OKQ A;  4IDP A;  5HEU A;  4UV9 B;  2VUR A;  1L0V A;  5AQQ B;  2LHR A;  4EAH A;  4O4H E;  5HWX A;  4H9N C;  1D0Y A;  4KUM B;  4PNI A;  4IRE A;  5JDF A;  1MNE A;  2SPC A;  4BAY B;  5J2U E;  2LRK A;  2DWK A;  2EHO B;  2YDR A;  3LSV A;  4DV4 T;  2L9Q A;  3G06 A;  4AQY T;  2UXC T;  3C4Z A;  3KFW X;  2E9X D;  2FBW A;  3AA1 B;  2NW9 A;  2Y8D A;  3AXJ A;  3AAE B;  4M1P A;  4IT4 A;  5JDM A;  2VAS A;  2X9X A;  4HGA A;  2V6Y A;  1UUR A;  3U78 A;  3AE2 A;  3JCF A;  4JYA T;  3FXD B;  2YDQ A;  2ZM2 A;  4FI5 A;  3NRX A;  4ILB A;  3UQ7 A;  4IL4 A;  1KNZ A;  2WMN A;  1SE7 A;  3EDU A;  3MAC A;  5HXE A;  5LJN A;  1KNR A;  3P4P A;  1FJG T;  4GKJ T;  2BBJ A;  3FZH B;  3PJA J;  1LVF A;  4Q25 A;  1LKX A;  3A8Y C;  3I9Y A;  3JAE A;  3FBZ A;  4HFB A;  3B5M A;  4H9S E;  2WZH A;  4ZOL E;  1M7K A;  4JEH B;  2CHO A;  5LBM A;  1XMQ T;  2X0H A;  4LML A;  3UUX B;  3FHN A;  5E0O A;  4CZZ B;  1T8B A;  4TX5 A;  3OPC A;  2NP9 A;  2XQ4 A;  1I6Z A;  2WBL A;  3EVY A;  4A98 A;  2VKJ A;  3R6N A;  4YXD A;  4UXN B;  4DMW A;  1IBM T;  1HG2 A;  4X5T A;  2BVL A;  4TUY E;  4F6R C;  3EAM A;  4YHJ A;  5EK2 A;  2OLT A;  2OV9 A;  4LF4 T;  2L8K A;  2ZLY A;  3GA8 A;  1W9R A;  4AQF C;  2WS3 A;  4HFD A;  4UF0 A;  5FMN A;  3AE1 A;  1WR6 A;  4JI3 T;  4HFE A;  4UIG A;  5F8P A; 
#chains in the Genus database with same CATH homology
 4LFB T;  4X62 T;  4DR3 T;  4OX9 T;  4DR2 T;  4DR1 T;  4B3R T;  4B3M T;  4LF8 T;  4DV2 T;  4LFA T;  1J5E T;  1N34 T;  4LF9 T;  4JI5 T;  4DR5 T;  1XNQ T;  1XNR T;  1HNW T;  2VQF T;  4JI8 T;  2UXD T;  4KHP T;  4DUZ T;  2UUC T;  5LMU T;  4DV1 T;  4YHH T;  2UXB T;  1XMO T;  4JI7 T;  3T1Y T;  5IWA T;  4JI1 T;  4JI6 T;  4LF7 T;  4JI4 T;  4DUY T;  5BR8 T;  4JI0 T;  1N32 T;  4DV3 T;  4JI2 T;  4NXM T;  4LFC T;  4NXN T;  2VQE T;  2UU9 T;  4X65 T;  2E5L T;  1HR0 T;  4DV0 T;  4X64 T;  4LF6 T;  5LMN T;  4DV4 T;  4AQY T;  2UXC T;  4DV7 T;  4YY3 T;  4GKK T;  4DR4 T;  1IBK T;  1HNX T;  4DV6 T;  4JYA T;  4B3T T;  4DR7 T;  1I94 T;  2UUB T;  1FJG T;  4LF5 T;  4GKJ T;  3OTO T;  1N36 T;  2F4V T;  4X66 T;  2ZM6 T;  1XMQ T;  4DV5 T;  3T1H T;  4JV5 T;  1IBM T;  1HNZ T;  4LF4 T;  2UUA T;  4K0K T;  4JI3 T;  1N33 T;  1IBL T;  2HHH T;  4B3S T;  4DR6 T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...