2NW9A

Crystal structure of tryptophan 2,3-dioxygenase (tdo) from xanthomonas campestris in complex with ferrous heme and 6-fluoro-tryptophan. northeast structural genomics target xcr13
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
265
structure length
265
Chain Sequence
GRLTYGGYLRLDQLLSAQQPLSEPAHHDEMLFIIQHQTSELWLKLLAHELRAAIVHLQRDEVWQCRKVLARSKQVLRQLTEQWSVLETLTPSEYMGFRDVLGPSSGFQSLQYRYIEFLLGNKNPQMLQVFAYDPAGQARLREVLEAPSLYEEFLRYLARFGHAIPQQYQARDWTAAHVADDTLRPVFERIYENTDRYWREYSLCEDLVDVETQFQLWRFRHMRTVMRVIGFKRGTGGSSGVGFLQQALALTFFPELFDVRTSVGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular insights into substrate recognition and catalysis by tryptophan 2,3-dioxygenase.
pubmed doi rcsb
source organism Xanthomonas campestris pv. campestris
molecule tags Oxidoreductase
molecule keywords Tryptophan 2,3-dioxygenase
total genus 110
structure length 265
sequence length 265
chains with identical sequence B
ec nomenclature ec 1.13.11.11: Tryptophan 2,3-dioxygenase.
pdb deposition date 2006-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03301 Trp_dioxygenase Tryptophan 2,3-dioxygenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.480 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2nw9A00
4PK5A 2D0UA 2NOXA 2V7IA 3E08A 4U74A 4PW8A 2V7KA 2NW7A 2NW8A 2D0TA 2X67A 2V7JA 1YW0A 5ETWA 2V7MA 3BK9A 2X68A 5EK2A 2NW9A 2V7LA 5EK3A 1ZEEA 4U72A 4HKAA 5EK4A 4PK6A 2NWBA 2X66A
chains in the Genus database with same CATH superfamily
3FB2A 2VK9A 3AA1B 3CMLA 3SFDA 2V7IA 4TUYE 4TWHA 3MKDA 2WWVA 3FBZA 1KNRA 2XJ7A 3ZJ1A 3FXDB 3RH3A 4IHJE 5DJQC 5FXXA 2JJ9A 3PUZF 1UCUA 2K24A 2WDRA 4X20E 3TLWA 4CI3B 3C4ZA 3ZT6A 4YSXA 5JRCA 2WY2A 2JIWA 2K48A 3PUVF 4O4JE 2J4GA 1IBMT 3UFEA 4PFPA 3GN5A 4J2CA 5ETWA 4F6RC 2WMNA 3T1YT 1HNWT 4MHCA 4YSZA 3UU8A 3ZJ2A 3O1HA 3O9XA 4AKRB 3AEGA 2X0HA 4GK0E 3UUXB 4ASKA 5IWAT 3SFEA 2KWIB 4U33A 2J47A 2XAQB 4IE6A 4DR2T 3C4WA 4TWDA 5HXRA 5LXTE 4QH4A 4HFBA 2Y6XA 4HFEA 3QNUA 2BG9E 2NTXA 3CVRA 3OYXA 4Z91A 4K0KT 3UFGA 2X0YA 2RPAA 1Z0PA 3EUHA 2Q9QA 4IIJE 3FZLB 4QH5A 3Q5XA 4TV8E 4YLHA 5AQTB 3TLVA 4DR1T 4KHZF 1CUNA 2BG9A 3BQKA 4HEAA 5DQVA 4YJ2E 5LP6E 5FVKA 1HG2A 4CN4A 1KK7A 4UEMA 3CX7B 2BBJA 3P4PA 1OXZA 3ZYMA 4IDOA 2LSJA 1FMVA 4UF0A 5CA0E 5L4EA 4DV5T 2CMRA 1W09A 2X67A 4IGUA 4QKNA 4TZ4C 5L47A 2KXPB 4DR4T 4ZI3D 4YHHT 2EHOB 3RF1A 3FXEB 3P50A 2C5IT 3LJCA 3KV4A 3PUGA 2DL1A 3HKCE 2OLTA 5L3CB 3VR8A 3KINB 5F5WA 3N5LA 3AE6A 3ZCIA 1E1HB 3NRYA 4JI1T 5LBMA 2NW9A 3A7MA 4A5XA 3ZCJA 3CIRA 4CQIA 4U72A 5ABFA 2D2SA 2XM2A 4DUYT 4NUVA 4O8SA 4DO0A 2LOPA 2WS3A 2WU2A 3ZYKA 4PJNA 3N2OA 3N9NA 5JR9B 4LF6T 2JRKA 2VURA 3I9YA 4DR3T 3HKEE 3N9OA 4FJOA 1U5PA 3NRXA 4OX9T 2C0SA 3UU4A 2XAHB 5LOVE 1WR6A 1D1CA 2XZEA 3LBXB 1OEDB 1VCTA 4Z90A 2I0MA 5KMGP 5FXWA 2WZIA 3BQIA 1XWMA 3UUMA 3MK7C 1NENA 4QWNB 3MZKB 1XDOA 4O4LE 1N36T 1EZ3A 4H9PC 2XM1A 4HFCA 4DIDB 3RI5A 4ZI3C 1X79A 1M62A 3P7IA 4NXNT 4DMWA 2DHRA 1XNRT 1ZV4X 2OV9A 2JQHA 3AEFA 4HKAA 2PBIA 4I4TE 1W0AA 2FUPA 3U78A 2WB5A 5JDGA 4LF9T 5AQLB 1WRDA 1LVFA 5HCMA 3TLSA 2CPTA 2FJEA 4IDZA 3RC3A 3PUWF 4BAYB 2MAWA 2H3RA 4YTPA 3HKBE 1FMWA 2CXFA 2DLRA 3N2GE 3K1SA 1MIVA 4O2BE 5LGNB 5LG4A 2XQ5A 2BDEA 2K9AA 4H9QC 3TKLB 5J0ZA 5LHGB 3AEEA 2WDQA 3IF8B 3UQ4A 4NXMT 2OA5A 4HFHA 5AQVB 4DV1T 3CQCB 2A2FX 2EHOD 3AE5A 2H7OA 1BR4A 3JC6C 2YU2A 2YKSA 4GYSA 4DV3T 1MIYA 3AA0B 3HL6A 3PJAJ 1T72A 5JTGA 4CXYA 3ZSTA 3ZN0B 2WCAA 2CWOA 3FZMB 3H3AA 2PJQA 4ILAA 4JI2T 3NKZA 2KWHA 3ANWB 4UV8B 5EK3A 2CBIA 5L4HA 3AVSA 3RIFA 2DWGA 5JQGE 3SOLA 4LFAT 2ES0A 3M65A 4QXBB 5JDMA 2DI4A 3N9LA 4EOZB 3ZPOA 3P4WA 1JNZA 3Q2MA 4ZI2C 5L3GB 3AECA 3KVBA 5FP3A 3RC8A 2KZ7B 2WWUA 4P0BA 5FNVE 2LRKA 2W00A 2CCQA 5HEHA 2Y48B 2BS4A 3P4QA 4AKLA 5AQFB 3KBTA 3SS1A 1YD8G 2XASB 5F3JA 2ZM0A 2D0TA 4U31A 1BR2A 3RLFF 2WZHA 5AFUL 4OK0A 3FZKB 2Z6EA 5C8YE 2W67A 1ZOYA 4LF7T 4HFDA 3Q5WA 1UX4A 2D5UA 3AB3B 4PAGA 4UIGA 4NUUA 5H6QB 3V5UA 2WAUA 4EZHA 5LHIB 2LKGA 2XQ7A 3AE4A 1XZYA 2X51A 1WLXA 4EB6E 3TLUA 4UELA 4KUMB 2A72A 3ZYLA 5LB7B 4YHJA 4JI4T 3C51A 4DR6T 4ZXLA 2JQKA 4XAXB 4MFRA 4DVDA 3WAJA 2HHHT 2E9XA 3UU3A 2NOXA 4IDQA 2PG8A 4HFVA 4DBRA 4DV0T 2UUCT 2YINA 1OEDA 3KVAA 1HCIA 1US7B 2CBJA 3ZT5A 5HYAA 3QUJA 4A97A 2LJLA 2V8SV 1XMOT 4HTEA 4B3MT 2H89A 4K0UA 2VVNA 4BA9A 4EYUA 2IC9A 5J2UE 1XNQT 2YN6A 5HEGA 4EGWA 3ZEFB 3C4XA 1W9RA 3LSVA 3M3ZB 3CWZB 4LMLA 1HF8A 1YW0A 1J1JA 3IBPA 4B3ST 2V6YA 1W0BA 4L9IA 3G06A 2DCFA 4HWHA 5AQIB 4H9RC 4ZZCA 1WYCA 5HEJA 4YSYA 4JI3T 5HCJA 3ETVA 1SHZC 2V5CA 2J62A 1LRZA 2K5BB 3OPCA 4V1Av 3SWHA 2VKDA 2A3DA 1BR0A 1D0ZA 3LDQB 2RP4A 5HEUA 3I1AA 4GIWA 1MMAA 2QVAA 2H7VC 2ZM2A 2X66A 3D0TA 3PE0A 4KX6A 5IYZE 4ILUA 4JI6T 2DNXA 2YDRA 1VCSA 2JMKA 2Q9QD 3K3QC 4LF4T 2ACZA 2FJDA 2VKHA 3Q9DA 2SPCA 4HN9A 4IL9A 4ISSA 4OFZA 4DBQA 3VU7H 5LGTB 4U2YA 2K3WA 4X5TA 3RKGA 4CXXA 5LYJE 4XBFB 4E7ZA 2LM9A 3C64A 3GA8A 4YTMA 5JH7E 3LK42 1HR0T 1R8IA 2N1GA 4ISTA 1HTJF 5LCYA 2JMHA 4Q25A 3B13A 4CN1A 4PJLA 4X62T 2WMOA 5H6RB 2XQ3A 3AE2A 5AQPB 2XQ8A 3O1IA 3T1HT 1YKEB 4PJMA 2XAGB 3AXJA 2AE9A 2WP9A 3B5MA 4JI0T 3QC9A 1UURA 4X1IE 3VHLA 4I50E 1QLBA 4HWIB 3IHRA 3ZKRA 2CLYB 3AXJB 4JLEA 3T8OA 5FL0A 4AQGA 2QRXA 4C91A 4UVCB 3MJXA 4L0RA 1ZHCA 3RYIE 4JI8T 3ESLA 4P1NA 4JV5T 1KEYA 5AQQB 4ILCA 4EZ4A 4ZEYA 2C5KT 4WZXA 2Y8DA 1KF6A 4AQYT 4DUZT 3AAAB 2B1EA 1Z8UA 1I6ZA 2XTLA 1IJ6A 1MNDA 2VL0A 3AA6B 2MBGA 3UQ7A 1D0XA 2LSKA 5CA1E 4IL4A 2CXLA 4HFIA 5FYMA 4TNWA 5JDHA 3PURA 5FVLA 1I94T 2KINB 1FJGT 2YU1A 2I6HA 2NWBA 2WSSV 4H9OC 2E8IA 4DNDA 1H7CA 4QH1A 4LF5T 4MBQA 1HX1B 1J5WA 2GK9A 2XY8B 4GK5E 5LJNA 2Q9QB 2D9DA 4U74A 2UUAT 1NEKA 2XUEA 3C50A 3CX6B 2ZM8A 3AE9A 3HR0A 4WW0A 4YT0A 1QSDA 3EDVA 3PUSA 4YY3T 5AQUB 1D1BA 1JNRA 2FJBA 4ZS2A 3GWHA 2VQET 2BKOA 1SE7A 1UK5A 2EHOC 5C3JA 3AE8A 1MNEA 3GMIA 2PTFA 4TV9E 5FY0A 3K8PC 1OEDE 2V1DB 4WNKA 4YFSA 5AQKB 1HS7A 3FZHB 3J9X1 3L8RA 4DR7T 3U3IA 3OTOT 5LMUT 4HGAA 5HAXA 5JREA 2XPKA 2ZLYA 4OHFA 5HWYA 2W4XA 5CJ5A 4KI0F 1AJ3A 1KNZA 3QB5A 2XHEB 1X9BA 2VL8A 3I9WA 2BVLA 4X1KE 2B76A 3VKGA 3ZMTB 5AQJB 1ZEEA 4AI6A 1YQ3A 3AEDA 3AE3A 1B7TA 4QHOA 3RQWA 1QUUA 2D0UA 3CX8B 2MOZA 3F2EA 1V9DA 3OJAA 4IE0A 2JPFA 3ZC1A 4ADZA 4DV2T 4NIQA 2BG9C 2X9XA 5LMNT 2CHOA 3DTOA 4KHPT 2BKPA 2UUBT 5TAOA 1HX8A 5IHYA 2NW7A 3RKOA 2IDOB 2QGSA 2FJAA 2UXXB 4M1PA 5FKYA 3AEBA 5ADXL 2MYSA 5M4YA 5JR9C 4JEHB 4OYJA 1ZKEA 4DMVA 3LK3B 3R6NA 4KBMB 5HWXA 4I55E 5FL1A 4AKGA 2N9DA 2VASA 4ZHQE 1XMQT 5AQRB 4EYYR 1S35A 2V6XA 3A8YC 5FY1A 3NVOA 2YEVC 2MTQA 3ABVA 2W61A 3ZMVB 3FBLA 5LG3A 2X68A 4FI5A 4G2AA 3RQUA 5BR8T 2HN1A 2CXDA 2YK0A 4E7SA 2KT9A 3SRZA 4LMKA 2X9YA 1D0YA 3F31A 3I0QA 3JC6D 2MPKA 2JQ9A 4PK6A 1IBKT 1FEWA 5HXEA 3RYHE 3UT5E 1N33T 3OBVE 5CGMA 4AKHA 3RYCE 5AQSB 1YQ4A 3MA9A 5FY7A 4OYKA 2E9XD 1N32T 3BQLA 4PW8A 2BVMA 1LVKA 2LOSA 3HI2A 2IW5B 2W62A 4C90A 5J2TE 3RYFE 3AE1A 3CPZA 3PUQA 4ZI7E 2W63A 2JQQA 1YKHB 2XSBA 4B3RT 2VWAA 2AXDS 2CLYC 2LM2A 3PU8A 2IUBA 4IE7A 4PFOA 4U7IA 3PDYA 5FMNA 5FXVA 3VRAA 4CI1B 1HNXT 3H37A 2LRLA 2ODVA 2DWKA 2LE8A 2LSGA 4IE5A 5ABEA 4JYAT 2PFVA 4AQFC 1MMGA 3RRCA 1WCRA 4DV6T 1WYBA 1XDPA 3LBXA 5J1GA 5AQNB 5ABFB 4IDPA 2KSRA 4UXNB 3RX6A 2LT3A 2V7LA 2XQ9A 2J1DG 4H9NC 3AVRA 4KP3C 5LHHB 4TWFA 4EV6A 4X66T 2LSYA 3VRBA 2RA1A 2YDSA 1M7KA 4H63H 3O1JA 4JUYA 5HXSA 2HPJA 4H9SE 2KNDA 4UR9A 1GQEA 2NR4A 3FHNA 3ZSSA 2N2NA 3EDUA 3ZN1B 5LGUB 5F8PA 1LKXA 2VKOA 1SUMB 2XAFB 2E9XC 4AXPA 4A56A 4BJMA 3O4XE 1MMNA 2W66A 5A1LA 2KLQA 3J7Yq 1OEDC 2BS3A 2P9BA 2V5DA 3DJBA 3EHZA 3IA3A 4MLKA 4HE8A 4KMCA 2CA5A 4X1YE 4QXHB 3KV9A 4ZS3A 5LA6E 5LJMA 2CEAA 4DV7T 2R6GF 2E5VA 4CI2B 3AAIA 1Y01A 3OYZA 4O4IE 2CE7A 2YDQA 5JVDE 4A98A 4QXCB 5KXJA 1N34T 2ODUA 1G8XA 2H88A 2W0GA 3JAFA 3ONLC 1T98A 3TLTA 4AISA 4U7YA 3N2KE 5EK4A 3UULA 4ZI2D 2XAJB 3E0ZA 1UGOA 2BG9B 4GOUA 3UUBA 3RPUA 4X64T 1UUSA 2KMFA 1IAPA 4IREA 1J5ET 4F8HA 2E9XB 3E08A 1MMDA 3EVYA 3L09A 3ONXA 4P0AA 4UF0B 2L8KA 4ZOLE 3RRWA 2VB6A 3CQXC 3RIUA 3S4UA 5LBQB 2EHOA 1D1AA 2FBWA 4EXTA 4G63A 3KV6A 3ZMUB 4WBNE 5JDNA 3VKHA 3AA7B 3L3PA 4P09A 2A9UA 5L3BB 3KFWX 3NZPA 5AQHB 1IBLT 3JADA 4I43B 4DR5T 4GKJT 1WR0A 2V7MA 3BK9A 4Z8XA 1Y64B 5EK2A 2HH7A 5BMVE 2BBHA 1U4QA 3QOFA 4BJNA 2UU9T 2LEHA 2M6BA 3C98B 4N78D 3PU3A 1HG5A 3PV0F 3RIAA 2CHNA 2E2AA 1BR1A 2LHNA 5GONE 3JCFA 4HWCA 3UUNA 2UXCT 4PK5A 2VKJA 1KNPA 1FIOA 1WFDA 2WU5A 3CKDA 3CQGB 4UV9B 4TX5A 5AQMB 3K3OA 2CRBA 2V6YB 2L3LA 3VR9A 3WAKA 4AQFA 1T8BA 2UXNB 3OKQA 2LLYA 2X0LB 3ONJA 3F57A 5LNKA 3AAEB 1VOMA 4CN6A 4AKIA 2NW8A 4O4HE 2WBLA 4IT4A 2IHR1 2XQ6A 4MALA 2XSAA 5ABGA 5L3EB 2V7JA 5DABA 2NP9A 3JAEA 2IIUA 3H3MA 3OVUA 4WBOA 2LSIA 4HWDA 5JR9A 1G73A 3IEEA 5DQWA 5JRCB 2LKHA 3L39A 3MACA 3CK6A 2BKNA 4EAHA 5L2LA 2UXDT 1S94A 2VVSA 5HXCA 3K3NA 1NWMX 4TNVA 3I0OA 4O2AE 5HEOA 4X65T 4I0UA 4JEUB 4WYVA 4EEDA 4LFCT 5EZYE 3N9PA 2QA7A 5L3FB 3UTKA 3NWIA 3P8CD 3Q5DA 3NZQA 4PJJA 4PNIA 3WI3A 4HWFA 3PJAA 5CB4E 5AQOB 5JDQA 2VQFT 3HA4A 5CFBA 4L5GA 2XQAA 2XQYA 3QB5K 4COFA 4QX7B 2ZM6T 3B57A 3DP7A 3KV5A 3LG7A 5C2TA 4NPPA 3GN5B 2F4VT 3E22E 2ACXA 2BZBA 3NBXX 1HNZT 3MXZA 1L0VA 4YTNA 3KBUA 4GKKT 2I59A 4IDNA 4QX8B 3EAMA 2WQYA 3R84B 3ZMZB 2HPLA 3AE7A 2W2UA 4U2ZA 4UVBB 4XZCA 4YJ3E 4LF8T 3RGLA 3RIUC 3UU6A 4ANJA 2BS2A 2L9QA 3QK6A 2UXBT 3HKDE 4AIUA 2M6IA 1DU2A 4EIWA 4TN7B 2M67A 3X1DA 3AEAA 3ZC0A 4JI7T 4ILBA 1ZP0A 4B3TT 3PTRB 3W15B 2HN2A 2LHRA 3N9MA 4H63V 5L3DB 3ZMSB 4CXWA 1UX5A 2IC6A 2X9HA 2YOEA 3N9QA 3ZT7A 5KDMC 5JDFA 1NAFA 5HXHA 1HFAA 3ZLIA 2G0UA 3P4SA 4LMJA 2QYWA 3ANWA 1E7PA 2IMLA 1KFYA 3FZFB 3PUXF 4JBWF 1T7SA 2V7KA 5IUXA 1YXRA 2IAKA 3EABA 2XQ4A 3PUYF 5JDLA 4B6XA 2CWYA 2NTYA 3P4RA 4IE4A 2Q9QC 3Q5EA 3RHWA 3LK2B 1SA0E 3PUAA 5AQGB 5FXZA 5ABHA 4JI5T 1CHUA 4CZZB 4U3CA 1IJ5A 3ETUA 5KX5E 4ERRA 4EEBA 2WDVA 3UU5A 1O3XA 4YXDA 1IZNB 2E5LT 4LFBT 1OWAA 2ZMAA 2WM9A 1MIWA 2V26A 3EI0A 2C5JA 4UVAB 2CM0A 4ZZBA 2X9WA 1E2AA 3KDSE 3LFMA 4PK4A 3A5XA 4DV4T 1VRBA 5E0OA 4GYRA 3V5SA
chains in the Genus database with same CATH topology
3FB2A 2VK9A 3AA1B 3CMLA 2V7IA 4TUYE 3MKDA 3FBZA 3ZJ1A 3FXDB 3RH3A 4IHJE 5DJQC 5FXXA 2JJ9A 1UCUA 2K24A 4X20E 4CI3B 5JRCA 3C4ZA 2K48A 4O4JE 3UFEA 4PFPA 3GN5A 4J2CA 5ETWA 4F6RC 2WMNA 4MHCA 3ZJ2A 3O9XA 3O1HA 4AKRB 3UUXB 4GK0E 4ASKA 2KWIB 2XAQB 4IE6A 3C4WA 5LXTE 5HXRA 2Y6XA 3CVRA 2NTXA 3OYXA 5KDMC 1Z0PA 3EUHA 2Q9QA 4IIJE 4TV8E 4YLHA 3Q5XA 5DQVA 1CUNA 3BQKA 4HEAA 5LP6E 4YJ2E 1HG2A 1KK7A 4UEMA 3CX7B 1OXZA 3ZYMA 4UF0A 2LSJA 1FMVA 5CA0E 2CMRA 2X67A 4IGUA 4QKNA 4TZ4C 2KXPB 4ZI3D 2EHOB 3FXEB 2C5IT 3LJCA 3KV4A 3PUGA 3HKCE 5L3CB 3KINB 3N5LA 3ZCIA 1E1HB 3NRYA 5LBMA 2NW9A 3ZCJA 4CQIA 4U72A 2D2SA 4NUVA 4O8SA 4DO0A 2LOPA 3ZYKA 4PJNA 3N2OA 3N9NA 5JR9B 2JRKA 3I9YA 3HKEE 3N9OA 4FJOA 1U5PA 3NRXA 2C0SA 2XAHB 5LOVE 1WR6A 1D1CA 3LBXB 5KMGP 5FXWA 3BQIA 3UUMA 3MK7C 4QWNB 3MZKB 4O4LE 1EZ3A 4H9PC 4ZI3C 1X79A 3P7IA 4DMWA 2DHRA 1ZV4X 4HKAA 4I4TE 2PBIA 3U78A 5JDGA 1WRDA 1LVFA 3RC3A 4IDZA 4BAYB 2H3RA 3HKBE 1FMWA 2CXFA 2DLRA 3N2GE 1MIVA 4O2BE 5LGNB 5LG4A 2BDEA 2K9AA 4H9QC 3TKLB 5LHGB 3IF8B 2OA5A 3CQCB 2A2FX 2EHOD 2H7OA 1BR4A 3JC6C 2YU2A 4GYSA 3AA0B 1MIYA 3HL6A 4CXYA 3ZN0B 2CWOA 3H3AA 2PJQA 4UV8B 3ANWB 2KWHA 5EK3A 3AVSA 2DWGA 5JQGE 3SOLA 2ES0A 3M65A 4QXBB 5JDMA 2DI4A 3N9LA 4EOZB 3ZPOA 3Q2MA 4ZI2C 5L3GB 3KVBA 5FP3A 3RC8A 2KZ7B 2WWUA 4P0BA 5FNVE 2W00A 2CCQA 2Y48B 4AKLA 3KBTA 3SS1A 1YD8G 2XASB 5F3JA 2ZM0A 2D0TA 1BR2A 5AFUL 4OK0A 2Z6EA 5C8YE 3V5UA 3Q5WA 1UX4A 2D5UA 3AB3B 4PAGA 4UIGA 4NUUA 5H6QB 4EZHA 2WAUA 2X51A 1WLXA 4EB6E 4UELA 4KUMB 2A72A 3ZYLA 4YHJA 3C51A 4XAXB 4MFRA 4DVDA 3WAJA 2E9XA 2NOXA 2PG8A 4HFVA 2YINA 3KVAA 1HCIA 1US7B 5HYAA 3QUJA 2LJLA 4HTEA 4K0UA 4BA9A 4EYUA 2IC9A 5J2UE 3ZEFB 3C4XA 3CWZB 1HF8A 1YW0A 3IBPA 4L9IA 2DCFA 4H9RC 1WYCA 3ETVA 1SHZC 1LRZA 2K5BB 4V1Av 3SWHA 2VKDA 2A3DA 1BR0A 1D0ZA 2RP4A 3I1AA 4GIWA 1MMAA 3D0TA 2H7VC 2ZM2A 2X66A 3PE0A 5IYZE 3WI3A 4ILUA 2DNXA 2JMKA 2Q9QD 3K3QC 2VKHA 3Q9DA 4HN9A 2SPCA 4ISSA 4DBQA 5LGTB 4OFZA 3VU7H 4CXXA 5LYJE 4XBFB 4E7ZA 2LM9A 3C64A 3GA8A 5JH7E 3LK42 2N1GA 4ISTA 1HTJF 5LCYA 2JMHA 3B13A 4PJLA 2WMOA 5H6RB 3O1IA 1YKEB 4PJMA 2XAGB 3QC9A 4X1IE 3VHLA 4I50E 3IHRA 2CLYB 4JLEA 3T8OA 4AQGA 4C91A 4UVCB 3MJXA 4L0RA 1ZHCA 3RYIE 3ESLA 4EZ4A 2C5KT 2Y8DA 3AAAB 2B1EA 2XTLA 1IJ6A 1MNDA 2MBGA 3AA6B 1D0XA 2LSKA 5CA1E 2CXLA 5FYMA 5JDHA 3PURA 2KINB 2YU1A 2WSSV 2NWBA 4H9OC 2E8IA 4DNDA 1H7CA 4MBQA 5LJNA 2GK9A 4GK5E 2Q9QB 4U74A 3C50A 2XUEA 3CX6B 2ZM8A 3HR0A 4WW0A 1QSDA 3EDVA 3PUSA 1D1BA 4ZS2A 3GWHA 2EHOC 1MNEA 3GMIA 5FY0A 4TV9E 1HS7A 3K8PC 2V1DB 4WNKA 4YFSA 3J9X1 3U3IA 4HGAA 5HAXA 5JREA 2ZLYA 4OHFA 5HWYA 1AJ3A 1KNZA 2XHEB 2VL8A 3I9WA 2BVLA 4X1KE 3VKGA 3ZMTB 4AI6A 1ZEEA 1B7TA 4QHOA 3CX8B 1QUUA 2D0UA 2MOZA 3F2EA 1V9DA 3OJAA 4IE0A 2JPFA 3ZC1A 4ADZA 2X9XA 3DTOA 5TAOA 1HX8A 5IHYA 2NW7A 3RKOA 2QGSA 2UXXB 4M1PA 5ADXL 2MYSA 5M4YA 5JR9C 4JEHB 4OYJA 1ZKEA 4DMVA 3LK3B 3R6NA 4KBMB 5HWXA 4I55E 4AKGA 2N9DA 2VASA 4ZHQE 4EYYR 1S35A 3ZMVB 5FY1A 2YEVC 2MTQA 2W61A 3FBLA 2X68A 4FI5A 4G2AA 2CXDA 2YK0A 4E7SA 2KT9A 3SRZA 2X9YA 1D0YA 3F31A 3I0QA 3JC6D 4PK6A 1FEWA 5HXEA 3RYHE 3UT5E 4AKHA 3OBVE 3RYCE 3MA9A 5FY7A 4OYKA 2E9XD 3BQLA 4PW8A 3HI2A 2BVMA 1LVKA 2LOSA 2IW5B 2W62A 4C90A 5J2TE 3RYFE 3PUQA 3CPZA 4ZI7E 2W63A 2JQQA 1YKHB 2VWAA 2CLYC 4IE7A 3PU8A 4CI1B 5FMNA 4PFOA 5FXVA 3PDYA 3H37A 2ODVA 4IE5A 2DWKA 2LE8A 2LSGA 2PFVA 4AQFC 1MMGA 3RRCA 1WYBA 5J1GA 3LBXA 3RX6A 4UXNB 2LT3A 2V7LA 4H9NC 2J1DG 4KP3C 3AVRA 5LHHB 2LSYA 2RA1A 4H63H 3O1JA 4JUYA 5HXSA 2HPJA 4H9SE 2KNDA 3FHNA 2N2NA 3EDUA 3ZN1B 5LGUB 5F8PA 1LKXA 2VKOA 2XAFB 2E9XC 4AXPA 4A56A 4BJMA 3O4XE 1MMNA 5A1LA 3J7Yq 2KLQA 2P9BA 3DJBA 4MLKA 4TX5A 5LHIB 4ZS3A 4HE8A 4KMCA 2CA5A 4X1YE 4QXHB 3KV9A 5LA6E 5LJMA 2CEAA 4CI2B 3AAIA 3OYZA 4O4IE 5JVDE 2CE7A 4QXCB 2ODUA 1G8XA 2W0GA 1T98A 3UULA 3N2KE 5EK4A 4ZI2D 2XAJB 3E0ZA 4GOUA 3RPUA 2KMFA 1IAPA 2E9XB 3E08A 1MMDA 3EVYA 3L09A 3ONXA 4P0AA 4UF0B 2L8KA 4ZOLE 3RRWA 2VB6A 3CQXC 3S4UA 5LBQB 2EHOA 1D1AA 4EXTA 4G63A 3KV6A 3ZMUB 4WBNE 5JDNA 3VKHA 3AA7B 3L3PA 4P09A 5L3BB 3KFWX 3NZPA 4I43B 2V7MA 3BK9A 4Z8XA 1Y64B 5EK2A 2HH7A 5BMVE 1U4QA 4BJNA 2LEHA 3C98B 4N78D 3PU3A 1HG5A 1BR1A 2LHNA 5GONE 3UUNA 4PK5A 2VKJA 1FIOA 4UV9B 3CQGB 3CKDA 3WAKA 4AQFA 3K3OA 2L3LA 2UXNB 3OKQA 2X0LB 5LNKA 3F57A 3AAEB 1VOMA 4AKIA 2NW8A 4O4HE 2WBLA 4MALA 5L3EB 2V7JA 5DABA 2NP9A 4WBOA 5JR9A 2LSIA 1G73A 3IEEA 5DQWA 5JRCB 3MACA 4EAHA 5L2LA 1S94A 5HXCA 3K3NA 1NWMX 3I0OA 4O2AE 4JEUB 5EZYE 3N9PA 2QA7A 5L3FB 3UTKA 3P8CD 4PJJA 3NZQA 4PNIA 5JDQA 5CB4E 3HA4A 4L5GA 2XQYA 4QX7B 3B57A 3DP7A 3KV5A 3LG7A 3GN5B 3E22E 2ACXA 2BZBA 3NBXX 3MXZA 3KBUA 2I59A 4QX8B 3R84B 3ZMZB 2HPLA 4UVBB 4YJ3E 4ANJA 4DBRA 4XZCA 2L9QA 3QK6A 3HKDE 4EIWA 4TN7B 2M67A 3ZC0A 3PTRB 3W15B 3N9MA 2LHRA 4H63V 5L3DB 3ZMSB 4CXWA 1UX5A 2IC6A 2X9HA 3N9QA 5JDFA 1NAFA 5HXHA 1HFAA 3ZLIA 2G0UA 3ANWA 2V7KA 2IAKA 5JDLA 4B6XA 2CWYA 2NTYA 4IE4A 2Q9QC 3LK2B 1SA0E 3PUAA 5FXZA 4CZZB 1IJ5A 3ETUA 5KX5E 4ERRA 1O3XA 1IZNB 1OWAA 2ZMAA 2WM9A 1MIWA 2V26A 4UVAB 2C5JA 2CM0A 2X9WA 3KDSE 3LFMA 4PK4A 3A5XA 1VRBA 5E0OA 4GYRA 3V5SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PK5 A;  2D0U A;  2NOX A;  2V7I A;  3E08 A;  4U74 A;  4PW8 A;  2V7K A;  2NW7 A;  2NW8 A;  2D0T A;  2X67 A;  2V7J A;  1YW0 A;  5ETW A;  2V7M A;  3BK9 A;  2X68 A;  5EK2 A;  2NW9 A;  2V7L A;  5EK3 A;  1ZEE A;  4U72 A;  4HKA A;  5EK4 A;  4PK6 A;  2NWB A;  2X66 A; 
#chains in the Genus database with same CATH topology
 3FB2 A;  2VK9 A;  3AA1 B;  3CML A;  3SFD A;  2V7I A;  4TUY E;  4TWH A;  3MKD A;  2WWV A;  3FBZ A;  1KNR A;  2XJ7 A;  3ZJ1 A;  3FXD B;  3RH3 A;  4IHJ E;  5DJQ C;  5FXX A;  2JJ9 A;  3PUZ F;  1UCU A;  2K24 A;  2WDR A;  4X20 E;  3TLW A;  4CI3 B;  3C4Z A;  3ZT6 A;  4YSX A;  5JRC A;  2WY2 A;  2JIW A;  2K48 A;  3PUV F;  4O4J E;  2J4G A;  1IBM T;  3UFE A;  4PFP A;  3GN5 A;  4J2C A;  5ETW A;  4F6R C;  2WMN A;  3T1Y T;  1HNW T;  4MHC A;  4YSZ A;  3UU8 A;  3ZJ2 A;  3O1H A;  3O9X A;  4AKR B;  3AEG A;  2X0H A;  4GK0 E;  3UUX B;  4ASK A;  5IWA T;  3SFE A;  2KWI B;  4U33 A;  2J47 A;  2XAQ B;  4IE6 A;  4DR2 T;  3C4W A;  4TWD A;  5HXR A;  5LXT E;  4QH4 A;  4HFB A;  2Y6X A;  4HFE A;  3QNU A;  2BG9 E;  2NTX A;  3CVR A;  3OYX A;  4Z91 A;  4K0K T;  3UFG A;  2X0Y A;  2RPA A;  1Z0P A;  3EUH A;  2Q9Q A;  4IIJ E;  3FZL B;  4QH5 A;  3Q5X A;  4TV8 E;  4YLH A;  5AQT B;  3TLV A;  4DR1 T;  4KHZ F;  1CUN A;  2BG9 A;  3BQK A;  4HEA A;  5DQV A;  4YJ2 E;  5LP6 E;  5FVK A;  1HG2 A;  4CN4 A;  1KK7 A;  4UEM A;  3CX7 B;  2BBJ A;  3P4P A;  1OXZ A;  3ZYM A;  4IDO A;  2LSJ A;  1FMV A;  4UF0 A;  5CA0 E;  5L4E A;  4DV5 T;  2CMR A;  1W09 A;  2X67 A;  4IGU A;  4QKN A;  4TZ4 C;  5L47 A;  2KXP B;  4DR4 T;  4ZI3 D;  4YHH T;  2EHO B;  3RF1 A;  3FXE B;  3P50 A;  2C5I T;  3LJC A;  3KV4 A;  3PUG A;  2DL1 A;  3HKC E;  2OLT A;  5L3C B;  3VR8 A;  3KIN B;  5F5W A;  3N5L A;  3AE6 A;  3ZCI A;  1E1H B;  3NRY A;  4JI1 T;  5LBM A;  2NW9 A;  3A7M A;  4A5X A;  3ZCJ A;  3CIR A;  4CQI A;  4U72 A;  5ABF A;  2D2S A;  2XM2 A;  4DUY T;  4NUV A;  4O8S A;  4DO0 A;  2LOP A;  2WS3 A;  2WU2 A;  3ZYK A;  4PJN A;  3N2O A;  3N9N A;  5JR9 B;  4LF6 T;  2JRK A;  2VUR A;  3I9Y A;  4DR3 T;  3HKE E;  3N9O A;  4FJO A;  1U5P A;  3NRX A;  4OX9 T;  2C0S A;  3UU4 A;  2XAH B;  5LOV E;  1WR6 A;  1D1C A;  2XZE A;  3LBX B;  1OED B;  1VCT A;  4Z90 A;  2I0M A;  5KMG P;  5FXW A;  2WZI A;  3BQI A;  1XWM A;  3UUM A;  3MK7 C;  1NEN A;  4QWN B;  3MZK B;  1XDO A;  4O4L E;  1N36 T;  1EZ3 A;  4H9P C;  2XM1 A;  4HFC A;  4DID B;  3RI5 A;  4ZI3 C;  1X79 A;  1M62 A;  3P7I A;  4NXN T;  4DMW A;  2DHR A;  1XNR T;  1ZV4 X;  2OV9 A;  2JQH A;  3AEF A;  4HKA A;  2PBI A;  4I4T E;  1W0A A;  2FUP A;  3U78 A;  2WB5 A;  5JDG A;  4LF9 T;  5AQL B;  1WRD A;  1LVF A;  5HCM A;  3TLS A;  2CPT A;  2FJE A;  4IDZ A;  3RC3 A;  3PUW F;  4BAY B;  2MAW A;  2H3R A;  4YTP A;  3HKB E;  1FMW A;  2CXF A;  2DLR A;  3N2G E;  3K1S A;  1MIV A;  4O2B E;  5LGN B;  5LG4 A;  2XQ5 A;  2BDE A;  2K9A A;  4H9Q C;  3TKL B;  5J0Z A;  5LHG B;  3AEE A;  2WDQ A;  3IF8 B;  3UQ4 A;  4NXM T;  2OA5 A;  4HFH A;  5AQV B;  4DV1 T;  3CQC B;  2A2F X;  2EHO D;  3AE5 A;  2H7O A;  1BR4 A;  3JC6 C;  2YU2 A;  2YKS A;  4GYS A;  4DV3 T;  1MIY A;  3AA0 B;  3HL6 A;  3PJA J;  1T72 A;  5JTG A;  4CXY A;  3ZST A;  3ZN0 B;  2WCA A;  2CWO A;  3FZM B;  3H3A A;  2PJQ A;  4ILA A;  4JI2 T;  3NKZ A;  2KWH A;  3ANW B;  4UV8 B;  5EK3 A;  2CBI A;  5L4H A;  3AVS A;  3RIF A;  2DWG A;  5JQG E;  3SOL A;  4LFA T;  2ES0 A;  3M65 A;  4QXB B;  5JDM A;  2DI4 A;  3N9L A;  4EOZ B;  3ZPO A;  3P4W A;  1JNZ A;  3Q2M A;  4ZI2 C;  5L3G B;  3AEC A;  3KVB A;  5FP3 A;  3RC8 A;  2KZ7 B;  2WWU A;  4P0B A;  5FNV E;  2LRK A;  2W00 A;  2CCQ A;  5HEH A;  2Y48 B;  2BS4 A;  3P4Q A;  4AKL A;  5AQF B;  3KBT A;  3SS1 A;  1YD8 G;  2XAS B;  5F3J A;  2ZM0 A;  2D0T A;  4U31 A;  1BR2 A;  3RLF F;  2WZH A;  5AFU L;  4OK0 A;  3FZK B;  2Z6E A;  5C8Y E;  2W67 A;  1ZOY A;  4LF7 T;  4HFD A;  3Q5W A;  1UX4 A;  2D5U A;  3AB3 B;  4PAG A;  4UIG A;  4NUU A;  5H6Q B;  3V5U A;  2WAU A;  4EZH A;  5LHI B;  2LKG A;  2XQ7 A;  3AE4 A;  1XZY A;  2X51 A;  1WLX A;  4EB6 E;  3TLU A;  4UEL A;  4KUM B;  2A72 A;  3ZYL A;  5LB7 B;  4YHJ A;  4JI4 T;  3C51 A;  4DR6 T;  4ZXL A;  2JQK A;  4XAX B;  4MFR A;  4DVD A;  3WAJ A;  2HHH T;  2E9X A;  3UU3 A;  2NOX A;  4IDQ A;  2PG8 A;  4HFV A;  4DBR A;  4DV0 T;  2UUC T;  2YIN A;  1OED A;  3KVA A;  1HCI A;  1US7 B;  2CBJ A;  3ZT5 A;  5HYA A;  3QUJ A;  4A97 A;  2LJL A;  2V8S V;  1XMO T;  4HTE A;  4B3M T;  2H89 A;  4K0U A;  2VVN A;  4BA9 A;  4EYU A;  2IC9 A;  5J2U E;  1XNQ T;  2YN6 A;  5HEG A;  4EGW A;  3ZEF B;  3C4X A;  1W9R A;  3LSV A;  3M3Z B;  3CWZ B;  4LML A;  1HF8 A;  1YW0 A;  1J1J A;  3IBP A;  4B3S T;  2V6Y A;  1W0B A;  4L9I A;  3G06 A;  2DCF A;  4HWH A;  5AQI B;  4H9R C;  4ZZC A;  1WYC A;  5HEJ A;  4YSY A;  4JI3 T;  5HCJ A;  3ETV A;  1SHZ C;  2V5C A;  2J62 A;  1LRZ A;  2K5B B;  3OPC A;  4V1A v;  3SWH A;  2VKD A;  2A3D A;  1BR0 A;  1D0Z A;  3LDQ B;  2RP4 A;  5HEU A;  3I1A A;  4GIW A;  1MMA A;  2QVA A;  2H7V C;  2ZM2 A;  2X66 A;  3D0T A;  3PE0 A;  4KX6 A;  5IYZ E;  4ILU A;  4JI6 T;  2DNX A;  2YDR A;  1VCS A;  2JMK A;  2Q9Q D;  3K3Q C;  4LF4 T;  2ACZ A;  2FJD A;  2VKH A;  3Q9D A;  2SPC A;  4HN9 A;  4IL9 A;  4ISS A;  4OFZ A;  4DBQ A;  3VU7 H;  5LGT B;  4U2Y A;  2K3W A;  4X5T A;  3RKG A;  4CXX A;  5LYJ E;  4XBF B;  4E7Z A;  2LM9 A;  3C64 A;  3GA8 A;  4YTM A;  5JH7 E;  3LK4 2;  1HR0 T;  1R8I A;  2N1G A;  4IST A;  1HTJ F;  5LCY A;  2JMH A;  4Q25 A;  3B13 A;  4CN1 A;  4PJL A;  4X62 T;  2WMO A;  5H6R B;  2XQ3 A;  3AE2 A;  5AQP B;  2XQ8 A;  3O1I A;  3T1H T;  1YKE B;  4PJM A;  2XAG B;  3AXJ A;  2AE9 A;  2WP9 A;  3B5M A;  4JI0 T;  3QC9 A;  1UUR A;  4X1I E;  3VHL A;  4I50 E;  1QLB A;  4HWI B;  3IHR A;  3ZKR A;  2CLY B;  3AXJ B;  4JLE A;  3T8O A;  5FL0 A;  4AQG A;  2QRX A;  4C91 A;  4UVC B;  3MJX A;  4L0R A;  1ZHC A;  3RYI E;  4JI8 T;  3ESL A;  4P1N A;  4JV5 T;  1KEY A;  5AQQ B;  4ILC A;  4EZ4 A;  4ZEY A;  2C5K T;  4WZX A;  2Y8D A;  1KF6 A;  4AQY T;  4DUZ T;  3AAA B;  2B1E A;  1Z8U A;  1I6Z A;  2XTL A;  1IJ6 A;  1MND A;  2VL0 A;  3AA6 B;  2MBG A;  3UQ7 A;  1D0X A;  2LSK A;  5CA1 E;  4IL4 A;  2CXL A;  4HFI A;  5FYM A;  4TNW A;  5JDH A;  3PUR A;  5FVL A;  1I94 T;  2KIN B;  1FJG T;  2YU1 A;  2I6H A;  2NWB A;  2WSS V;  4H9O C;  2E8I A;  4DND A;  1H7C A;  4QH1 A;  4LF5 T;  4MBQ A;  1HX1 B;  1J5W A;  2GK9 A;  2XY8 B;  4GK5 E;  5LJN A;  2Q9Q B;  2D9D A;  4U74 A;  2UUA T;  1NEK A;  2XUE A;  3C50 A;  3CX6 B;  2ZM8 A;  3AE9 A;  3HR0 A;  4WW0 A;  4YT0 A;  1QSD A;  3EDV A;  3PUS A;  4YY3 T;  5AQU B;  1D1B A;  1JNR A;  2FJB A;  4ZS2 A;  3GWH A;  2VQE T;  2BKO A;  1SE7 A;  1UK5 A;  2EHO C;  5C3J A;  3AE8 A;  1MNE A;  3GMI A;  2PTF A;  4TV9 E;  5FY0 A;  3K8P C;  1OED E;  2V1D B;  4WNK A;  4YFS A;  5AQK B;  1HS7 A;  3FZH B;  3J9X 1;  3L8R A;  4DR7 T;  3U3I A;  3OTO T;  5LMU T;  4HGA A;  5HAX A;  5JRE A;  2XPK A;  2ZLY A;  4OHF A;  5HWY A;  2W4X A;  5CJ5 A;  4KI0 F;  1AJ3 A;  1KNZ A;  3QB5 A;  2XHE B;  1X9B A;  2VL8 A;  3I9W A;  2BVL A;  4X1K E;  2B76 A;  3VKG A;  3ZMT B;  5AQJ B;  1ZEE A;  4AI6 A;  1YQ3 A;  3AED A;  3AE3 A;  1B7T A;  4QHO A;  3RQW A;  1QUU A;  2D0U A;  3CX8 B;  2MOZ A;  3F2E A;  1V9D A;  3OJA A;  4IE0 A;  2JPF A;  3ZC1 A;  4ADZ A;  4DV2 T;  4NIQ A;  2BG9 C;  2X9X A;  5LMN T;  2CHO A;  3DTO A;  4KHP T;  2BKP A;  2UUB T;  5TAO A;  1HX8 A;  5IHY A;  2NW7 A;  3RKO A;  2IDO B;  2QGS A;  2FJA A;  2UXX B;  4M1P A;  5FKY A;  3AEB A;  5ADX L;  2MYS A;  5M4Y A;  5JR9 C;  4JEH B;  4OYJ A;  1ZKE A;  4DMV A;  3LK3 B;  3R6N A;  4KBM B;  5HWX A;  4I55 E;  5FL1 A;  4AKG A;  2N9D A;  2VAS A;  4ZHQ E;  1XMQ T;  5AQR B;  4EYY R;  1S35 A;  2V6X A;  3A8Y C;  5FY1 A;  3NVO A;  2YEV C;  2MTQ A;  3ABV A;  2W61 A;  3ZMV B;  3FBL A;  5LG3 A;  2X68 A;  4FI5 A;  4G2A A;  3RQU A;  5BR8 T;  2HN1 A;  2CXD A;  2YK0 A;  4E7S A;  2KT9 A;  3SRZ A;  4LMK A;  2X9Y A;  1D0Y A;  3F31 A;  3I0Q A;  3JC6 D;  2MPK A;  2JQ9 A;  4PK6 A;  1IBK T;  1FEW A;  5HXE A;  3RYH E;  3UT5 E;  1N33 T;  3OBV E;  5CGM A;  4AKH A;  3RYC E;  5AQS B;  1YQ4 A;  3MA9 A;  5FY7 A;  4OYK A;  2E9X D;  1N32 T;  3BQL A;  4PW8 A;  2BVM A;  1LVK A;  2LOS A;  3HI2 A;  2IW5 B;  2W62 A;  4C90 A;  5J2T E;  3RYF E;  3AE1 A;  3CPZ A;  3PUQ A;  4ZI7 E;  2W63 A;  2JQQ A;  1YKH B;  2XSB A;  4B3R T;  2VWA A;  2AXD S;  2CLY C;  2LM2 A;  3PU8 A;  2IUB A;  4IE7 A;  4PFO A;  4U7I A;  3PDY A;  5FMN A;  5FXV A;  3VRA A;  4CI1 B;  1HNX T;  3H37 A;  2LRL A;  2ODV A;  2DWK A;  2LE8 A;  2LSG A;  4IE5 A;  5ABE A;  4JYA T;  2PFV A;  4AQF C;  1MMG A;  3RRC A;  1WCR A;  4DV6 T;  1WYB A;  1XDP A;  3LBX A;  5J1G A;  5AQN B;  5ABF B;  4IDP A;  2KSR A;  4UXN B;  3RX6 A;  2LT3 A;  2V7L A;  2XQ9 A;  2J1D G;  4H9N C;  3AVR A;  4KP3 C;  5LHH B;  4TWF A;  4EV6 A;  4X66 T;  2LSY A;  3VRB A;  2RA1 A;  2YDS A;  1M7K A;  4H63 H;  3O1J A;  4JUY A;  5HXS A;  2HPJ A;  4H9S E;  2KND A;  4UR9 A;  1GQE A;  2NR4 A;  3FHN A;  3ZSS A;  2N2N A;  3EDU A;  3ZN1 B;  5LGU B;  5F8P A;  1LKX A;  2VKO A;  1SUM B;  2XAF B;  2E9X C;  4AXP A;  4A56 A;  4BJM A;  3O4X E;  1MMN A;  2W66 A;  5A1L A;  2KLQ A;  3J7Y q;  1OED C;  2BS3 A;  2P9B A;  2V5D A;  3DJB A;  3EHZ A;  3IA3 A;  4MLK A;  4HE8 A;  4KMC A;  2CA5 A;  4X1Y E;  4QXH B;  3KV9 A;  4ZS3 A;  5LA6 E;  5LJM A;  2CEA A;  4DV7 T;  2R6G F;  2E5V A;  4CI2 B;  3AAI A;  1Y01 A;  3OYZ A;  4O4I E;  2CE7 A;  2YDQ A;  5JVD E;  4A98 A;  4QXC B;  5KXJ A;  1N34 T;  2ODU A;  1G8X A;  2H88 A;  2W0G A;  3JAF A;  3ONL C;  1T98 A;  3TLT A;  4AIS A;  4U7Y A;  3N2K E;  5EK4 A;  3UUL A;  4ZI2 D;  2XAJ B;  3E0Z A;  1UGO A;  2BG9 B;  4GOU A;  3UUB A;  3RPU A;  4X64 T;  1UUS A;  2KMF A;  1IAP A;  4IRE A;  1J5E T;  4F8H A;  2E9X B;  3E08 A;  1MMD A;  3EVY A;  3L09 A;  3ONX A;  4P0A A;  4UF0 B;  2L8K A;  4ZOL E;  3RRW A;  2VB6 A;  3CQX C;  3RIU A;  3S4U A;  5LBQ B;  2EHO A;  1D1A A;  2FBW A;  4EXT A;  4G63 A;  3KV6 A;  3ZMU B;  4WBN E;  5JDN A;  3VKH A;  3AA7 B;  3L3P A;  4P09 A;  2A9U A;  5L3B B;  3KFW X;  3NZP A;  5AQH B;  1IBL T;  3JAD A;  4I43 B;  4DR5 T;  4GKJ T;  1WR0 A;  2V7M A;  3BK9 A;  4Z8X A;  1Y64 B;  5EK2 A;  2HH7 A;  5BMV E;  2BBH A;  1U4Q A;  3QOF A;  4BJN A;  2UU9 T;  2LEH A;  2M6B A;  3C98 B;  4N78 D;  3PU3 A;  1HG5 A;  3PV0 F;  3RIA A;  2CHN A;  2E2A A;  1BR1 A;  2LHN A;  5GON E;  3JCF A;  4HWC A;  3UUN A;  2UXC T;  4PK5 A;  2VKJ A;  1KNP A;  1FIO A;  1WFD A;  2WU5 A;  3CKD A;  3CQG B;  4UV9 B;  4TX5 A;  5AQM B;  3K3O A;  2CRB A;  2V6Y B;  2L3L A;  3VR9 A;  3WAK A;  4AQF A;  1T8B A;  2UXN B;  3OKQ A;  2LLY A;  2X0L B;  3ONJ A;  3F57 A;  5LNK A;  3AAE B;  1VOM A;  4CN6 A;  4AKI A;  2NW8 A;  4O4H E;  2WBL A;  4IT4 A;  2IHR 1;  2XQ6 A;  4MAL A;  2XSA A;  5ABG A;  5L3E B;  2V7J A;  5DAB A;  2NP9 A;  3JAE A;  2IIU A;  3H3M A;  3OVU A;  4WBO A;  2LSI A;  4HWD A;  5JR9 A;  1G73 A;  3IEE A;  5DQW A;  5JRC B;  2LKH A;  3L39 A;  3MAC A;  3CK6 A;  2BKN A;  4EAH A;  5L2L A;  2UXD T;  1S94 A;  2VVS A;  5HXC A;  3K3N A;  1NWM X;  4TNV A;  3I0O A;  4O2A E;  5HEO A;  4X65 T;  4I0U A;  4JEU B;  4WYV A;  4EED A;  4LFC T;  5EZY E;  3N9P A;  2QA7 A;  5L3F B;  3UTK A;  3NWI A;  3P8C D;  3Q5D A;  3NZQ A;  4PJJ A;  4PNI A;  3WI3 A;  4HWF A;  3PJA A;  5CB4 E;  5AQO B;  5JDQ A;  2VQF T;  3HA4 A;  5CFB A;  4L5G A;  2XQA A;  2XQY A;  3QB5 K;  4COF A;  4QX7 B;  2ZM6 T;  3B57 A;  3DP7 A;  3KV5 A;  3LG7 A;  5C2T A;  4NPP A;  3GN5 B;  2F4V T;  3E22 E;  2ACX A;  2BZB A;  3NBX X;  1HNZ T;  3MXZ A;  1L0V A;  4YTN A;  3KBU A;  4GKK T;  2I59 A;  4IDN A;  4QX8 B;  3EAM A;  2WQY A;  3R84 B;  3ZMZ B;  2HPL A;  3AE7 A;  2W2U A;  4U2Z A;  4UVB B;  4XZC A;  4YJ3 E;  4LF8 T;  3RGL A;  3RIU C;  3UU6 A;  4ANJ A;  2BS2 A;  2L9Q A;  3QK6 A;  2UXB T;  3HKD E;  4AIU A;  2M6I A;  1DU2 A;  4EIW A;  4TN7 B;  2M67 A;  3X1D A;  3AEA A;  3ZC0 A;  4JI7 T;  4ILB A;  1ZP0 A;  4B3T T;  3PTR B;  3W15 B;  2HN2 A;  2LHR A;  3N9M A;  4H63 V;  5L3D B;  3ZMS B;  4CXW A;  1UX5 A;  2IC6 A;  2X9H A;  2YOE A;  3N9Q A;  3ZT7 A;  5KDM C;  5JDF A;  1NAF A;  5HXH A;  1HFA A;  3ZLI A;  2G0U A;  3P4S A;  4LMJ A;  2QYW A;  3ANW A;  1E7P A;  2IML A;  1KFY A;  3FZF B;  3PUX F;  4JBW F;  1T7S A;  2V7K A;  5IUX A;  1YXR A;  2IAK A;  3EAB A;  2XQ4 A;  3PUY F;  5JDL A;  4B6X A;  2CWY A;  2NTY A;  3P4R A;  4IE4 A;  2Q9Q C;  3Q5E A;  3RHW A;  3LK2 B;  1SA0 E;  3PUA A;  5AQG B;  5FXZ A;  5ABH A;  4JI5 T;  1CHU A;  4CZZ B;  4U3C A;  1IJ5 A;  3ETU A;  5KX5 E;  4ERR A;  4EEB A;  2WDV A;  3UU5 A;  1O3X A;  4YXD A;  1IZN B;  2E5L T;  4LFB T;  1OWA A;  2ZMA A;  2WM9 A;  1MIW A;  2V26 A;  3EI0 A;  2C5J A;  4UVA B;  2CM0 A;  4ZZB A;  2X9W A;  1E2A A;  3KDS E;  3LFM A;  4PK4 A;  3A5X A;  4DV4 T;  1VRB A;  5E0O A;  4GYR A;  3V5S A; 
#chains in the Genus database with same CATH homology
 3FB2 A;  2VK9 A;  3AA1 B;  3CML A;  2V7I A;  4TUY E;  3MKD A;  3FBZ A;  3ZJ1 A;  3FXD B;  3RH3 A;  4IHJ E;  5DJQ C;  5FXX A;  2JJ9 A;  1UCU A;  2K24 A;  4X20 E;  4CI3 B;  5JRC A;  3C4Z A;  2K48 A;  4O4J E;  3UFE A;  4PFP A;  3GN5 A;  4J2C A;  5ETW A;  4F6R C;  2WMN A;  4MHC A;  3ZJ2 A;  3O9X A;  3O1H A;  4AKR B;  3UUX B;  4GK0 E;  4ASK A;  2KWI B;  2XAQ B;  4IE6 A;  3C4W A;  5LXT E;  5HXR A;  2Y6X A;  3CVR A;  2NTX A;  3OYX A;  5KDM C;  1Z0P A;  3EUH A;  2Q9Q A;  4IIJ E;  4TV8 E;  4YLH A;  3Q5X A;  5DQV A;  1CUN A;  3BQK A;  4HEA A;  5LP6 E;  4YJ2 E;  1HG2 A;  1KK7 A;  4UEM A;  3CX7 B;  1OXZ A;  3ZYM A;  4UF0 A;  2LSJ A;  1FMV A;  5CA0 E;  2CMR A;  2X67 A;  4IGU A;  4QKN A;  4TZ4 C;  2KXP B;  4ZI3 D;  2EHO B;  3FXE B;  2C5I T;  3LJC A;  3KV4 A;  3PUG A;  3HKC E;  5L3C B;  3KIN B;  3N5L A;  3ZCI A;  1E1H B;  3NRY A;  5LBM A;  2NW9 A;  3ZCJ A;  4CQI A;  4U72 A;  2D2S A;  4NUV A;  4O8S A;  4DO0 A;  2LOP A;  3ZYK A;  4PJN A;  3N2O A;  3N9N A;  5JR9 B;  2JRK A;  3I9Y A;  3HKE E;  3N9O A;  4FJO A;  1U5P A;  3NRX A;  2C0S A;  2XAH B;  5LOV E;  1WR6 A;  1D1C A;  3LBX B;  5KMG P;  5FXW A;  3BQI A;  3UUM A;  3MK7 C;  4QWN B;  3MZK B;  4O4L E;  1EZ3 A;  4H9P C;  4ZI3 C;  1X79 A;  3P7I A;  4DMW A;  2DHR A;  1ZV4 X;  4HKA A;  4I4T E;  2PBI A;  3U78 A;  5JDG A;  1WRD A;  1LVF A;  3RC3 A;  4IDZ A;  4BAY B;  2H3R A;  3HKB E;  1FMW A;  2CXF A;  2DLR A;  3N2G E;  1MIV A;  4O2B E;  5LGN B;  5LG4 A;  2BDE A;  2K9A A;  4H9Q C;  3TKL B;  5LHG B;  3IF8 B;  2OA5 A;  3CQC B;  2A2F X;  2EHO D;  2H7O A;  1BR4 A;  3JC6 C;  2YU2 A;  4GYS A;  3AA0 B;  1MIY A;  3HL6 A;  4CXY A;  3ZN0 B;  2CWO A;  3H3A A;  2PJQ A;  4UV8 B;  3ANW B;  2KWH A;  5EK3 A;  3AVS A;  2DWG A;  5JQG E;  3SOL A;  2ES0 A;  3M65 A;  4QXB B;  5JDM A;  2DI4 A;  3N9L A;  4EOZ B;  3ZPO A;  3Q2M A;  4ZI2 C;  5L3G B;  3KVB A;  5FP3 A;  3RC8 A;  2KZ7 B;  2WWU A;  4P0B A;  5FNV E;  2W00 A;  2CCQ A;  2Y48 B;  4AKL A;  3KBT A;  3SS1 A;  1YD8 G;  2XAS B;  5F3J A;  2ZM0 A;  2D0T A;  1BR2 A;  5AFU L;  4OK0 A;  2Z6E A;  5C8Y E;  3V5U A;  3Q5W A;  1UX4 A;  2D5U A;  3AB3 B;  4PAG A;  4UIG A;  4NUU A;  5H6Q B;  4EZH A;  2WAU A;  2X51 A;  1WLX A;  4EB6 E;  4UEL A;  4KUM B;  2A72 A;  3ZYL A;  4YHJ A;  3C51 A;  4XAX B;  4MFR A;  4DVD A;  3WAJ A;  2E9X A;  2NOX A;  2PG8 A;  4HFV A;  2YIN A;  3KVA A;  1HCI A;  1US7 B;  5HYA A;  3QUJ A;  2LJL A;  4HTE A;  4K0U A;  4BA9 A;  4EYU A;  2IC9 A;  5J2U E;  3ZEF B;  3C4X A;  3CWZ B;  1HF8 A;  1YW0 A;  3IBP A;  4L9I A;  2DCF A;  4H9R C;  1WYC A;  3ETV A;  1SHZ C;  1LRZ A;  2K5B B;  4V1A v;  3SWH A;  2VKD A;  2A3D A;  1BR0 A;  1D0Z A;  2RP4 A;  3I1A A;  4GIW A;  1MMA A;  3D0T A;  2H7V C;  2ZM2 A;  2X66 A;  3PE0 A;  5IYZ E;  3WI3 A;  4ILU A;  2DNX A;  2JMK A;  2Q9Q D;  3K3Q C;  2VKH A;  3Q9D A;  4HN9 A;  2SPC A;  4ISS A;  4DBQ A;  5LGT B;  4OFZ A;  3VU7 H;  4CXX A;  5LYJ E;  4XBF B;  4E7Z A;  2LM9 A;  3C64 A;  3GA8 A;  5JH7 E;  3LK4 2;  2N1G A;  4IST A;  1HTJ F;  5LCY A;  2JMH A;  3B13 A;  4PJL A;  2WMO A;  5H6R B;  3O1I A;  1YKE B;  4PJM A;  2XAG B;  3QC9 A;  4X1I E;  3VHL A;  4I50 E;  3IHR A;  2CLY B;  4JLE A;  3T8O A;  4AQG A;  4C91 A;  4UVC B;  3MJX A;  4L0R A;  1ZHC A;  3RYI E;  3ESL A;  4EZ4 A;  2C5K T;  2Y8D A;  3AAA B;  2B1E A;  2XTL A;  1IJ6 A;  1MND A;  2MBG A;  3AA6 B;  1D0X A;  2LSK A;  5CA1 E;  2CXL A;  5FYM A;  5JDH A;  3PUR A;  2KIN B;  2YU1 A;  2WSS V;  2NWB A;  4H9O C;  2E8I A;  4DND A;  1H7C A;  4MBQ A;  5LJN A;  2GK9 A;  4GK5 E;  2Q9Q B;  4U74 A;  3C50 A;  2XUE A;  3CX6 B;  2ZM8 A;  3HR0 A;  4WW0 A;  1QSD A;  3EDV A;  3PUS A;  1D1B A;  4ZS2 A;  3GWH A;  2EHO C;  1MNE A;  3GMI A;  5FY0 A;  4TV9 E;  1HS7 A;  3K8P C;  2V1D B;  4WNK A;  4YFS A;  3J9X 1;  3U3I A;  4HGA A;  5HAX A;  5JRE A;  2ZLY A;  4OHF A;  5HWY A;  1AJ3 A;  1KNZ A;  2XHE B;  2VL8 A;  3I9W A;  2BVL A;  4X1K E;  3VKG A;  3ZMT B;  4AI6 A;  1ZEE A;  1B7T A;  4QHO A;  3CX8 B;  1QUU A;  2D0U A;  2MOZ A;  3F2E A;  1V9D A;  3OJA A;  4IE0 A;  2JPF A;  3ZC1 A;  4ADZ A;  2X9X A;  3DTO A;  5TAO A;  1HX8 A;  5IHY A;  2NW7 A;  3RKO A;  2QGS A;  2UXX B;  4M1P A;  5ADX L;  2MYS A;  5M4Y A;  5JR9 C;  4JEH B;  4OYJ A;  1ZKE A;  4DMV A;  3LK3 B;  3R6N A;  4KBM B;  5HWX A;  4I55 E;  4AKG A;  2N9D A;  2VAS A;  4ZHQ E;  4EYY R;  1S35 A;  3ZMV B;  5FY1 A;  2YEV C;  2MTQ A;  2W61 A;  3FBL A;  2X68 A;  4FI5 A;  4G2A A;  2CXD A;  2YK0 A;  4E7S A;  2KT9 A;  3SRZ A;  2X9Y A;  1D0Y A;  3F31 A;  3I0Q A;  3JC6 D;  4PK6 A;  1FEW A;  5HXE A;  3RYH E;  3UT5 E;  4AKH A;  3OBV E;  3RYC E;  3MA9 A;  5FY7 A;  4OYK A;  2E9X D;  3BQL A;  4PW8 A;  3HI2 A;  2BVM A;  1LVK A;  2LOS A;  2IW5 B;  2W62 A;  4C90 A;  5J2T E;  3RYF E;  3PUQ A;  3CPZ A;  4ZI7 E;  2W63 A;  2JQQ A;  1YKH B;  2VWA A;  2CLY C;  4IE7 A;  3PU8 A;  4CI1 B;  5FMN A;  4PFO A;  5FXV A;  3PDY A;  3H37 A;  2ODV A;  4IE5 A;  2DWK A;  2LE8 A;  2LSG A;  2PFV A;  4AQF C;  1MMG A;  3RRC A;  1WYB A;  5J1G A;  3LBX A;  3RX6 A;  4UXN B;  2LT3 A;  2V7L A;  4H9N C;  2J1D G;  4KP3 C;  3AVR A;  5LHH B;  2LSY A;  2RA1 A;  4H63 H;  3O1J A;  4JUY A;  5HXS A;  2HPJ A;  4H9S E;  2KND A;  3FHN A;  2N2N A;  3EDU A;  3ZN1 B;  5LGU B;  5F8P A;  1LKX A;  2VKO A;  2XAF B;  2E9X C;  4AXP A;  4A56 A;  4BJM A;  3O4X E;  1MMN A;  5A1L A;  3J7Y q;  2KLQ A;  2P9B A;  3DJB A;  4MLK A;  4TX5 A;  5LHI B;  4ZS3 A;  4HE8 A;  4KMC A;  2CA5 A;  4X1Y E;  4QXH B;  3KV9 A;  5LA6 E;  5LJM A;  2CEA A;  4CI2 B;  3AAI A;  3OYZ A;  4O4I E;  5JVD E;  2CE7 A;  4QXC B;  2ODU A;  1G8X A;  2W0G A;  1T98 A;  3UUL A;  3N2K E;  5EK4 A;  4ZI2 D;  2XAJ B;  3E0Z A;  4GOU A;  3RPU A;  2KMF A;  1IAP A;  2E9X B;  3E08 A;  1MMD A;  3EVY A;  3L09 A;  3ONX A;  4P0A A;  4UF0 B;  2L8K A;  4ZOL E;  3RRW A;  2VB6 A;  3CQX C;  3S4U A;  5LBQ B;  2EHO A;  1D1A A;  4EXT A;  4G63 A;  3KV6 A;  3ZMU B;  4WBN E;  5JDN A;  3VKH A;  3AA7 B;  3L3P A;  4P09 A;  5L3B B;  3KFW X;  3NZP A;  4I43 B;  2V7M A;  3BK9 A;  4Z8X A;  1Y64 B;  5EK2 A;  2HH7 A;  5BMV E;  1U4Q A;  4BJN A;  2LEH A;  3C98 B;  4N78 D;  3PU3 A;  1HG5 A;  1BR1 A;  2LHN A;  5GON E;  3UUN A;  4PK5 A;  2VKJ A;  1FIO A;  4UV9 B;  3CQG B;  3CKD A;  3WAK A;  4AQF A;  3K3O A;  2L3L A;  2UXN B;  3OKQ A;  2X0L B;  5LNK A;  3F57 A;  3AAE B;  1VOM A;  4AKI A;  2NW8 A;  4O4H E;  2WBL A;  4MAL A;  5L3E B;  2V7J A;  5DAB A;  2NP9 A;  4WBO A;  5JR9 A;  2LSI A;  1G73 A;  3IEE A;  5DQW A;  5JRC B;  3MAC A;  4EAH A;  5L2L A;  1S94 A;  5HXC A;  3K3N A;  1NWM X;  3I0O A;  4O2A E;  4JEU B;  5EZY E;  3N9P A;  2QA7 A;  5L3F B;  3UTK A;  3P8C D;  4PJJ A;  3NZQ A;  4PNI A;  5JDQ A;  5CB4 E;  3HA4 A;  4L5G A;  2XQY A;  4QX7 B;  3B57 A;  3DP7 A;  3KV5 A;  3LG7 A;  3GN5 B;  3E22 E;  2ACX A;  2BZB A;  3NBX X;  3MXZ A;  3KBU A;  2I59 A;  4QX8 B;  3R84 B;  3ZMZ B;  2HPL A;  4UVB B;  4YJ3 E;  4ANJ A;  4DBR A;  4XZC A;  2L9Q A;  3QK6 A;  3HKD E;  4EIW A;  4TN7 B;  2M67 A;  3ZC0 A;  3PTR B;  3W15 B;  3N9M A;  2LHR A;  4H63 V;  5L3D B;  3ZMS B;  4CXW A;  1UX5 A;  2IC6 A;  2X9H A;  3N9Q A;  5JDF A;  1NAF A;  5HXH A;  1HFA A;  3ZLI A;  2G0U A;  3ANW A;  2V7K A;  2IAK A;  5JDL A;  4B6X A;  2CWY A;  2NTY A;  4IE4 A;  2Q9Q C;  3LK2 B;  1SA0 E;  3PUA A;  5FXZ A;  4CZZ B;  1IJ5 A;  3ETU A;  5KX5 E;  4ERR A;  1O3X A;  1IZN B;  1OWA A;  2ZMA A;  2WM9 A;  1MIW A;  2V26 A;  4UVA B;  2C5J A;  2CM0 A;  2X9W A;  3KDS E;  3LFM A;  4PK4 A;  3A5X A;  1VRB A;  5E0O A;  4GYR A;  3V5S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...