2NW9A

Crystal structure of tryptophan 2,3-dioxygenase (tdo) from xanthomonas campestris in complex with ferrous heme and 6-fluoro-tryptophan. northeast structural genomics target xcr13
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
265
structure length
265
Chain Sequence
b'GRLTYGGYLRLDQLLSAQQPLSEPAHHDEMLFIIQHQTSELWLKLLAHELRAAIVHLQRDEVWQCRKVLARSKQVLRQLTEQWSVLETLTPSEYMGFRDVLGPSSGFQSLQYRYIEFLLGNKNPQMLQVFAYDPAGQARLREVLEAPSLYEEFLRYLARFGHAIPQQYQARDWTAAHVADDTLRPVFERIYENTDRYWREYSLCEDLVDVETQFQLWRFRHMRTVMRVIGFKRGTGGSSGVGFLQQALALTFFPELFDVRTSVGV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tryptophan 2,3-dioxygenase
publication title Molecular insights into substrate recognition and catalysis by tryptophan 2,3-dioxygenase.
pubmed doi rcsb
source organism Xanthomonas campestris pv. campestris
molecule tags Oxidoreductase
total genus 110
structure length 265
sequence length 265
chains with identical sequence B
ec nomenclature ec 1.13.11.11: Tryptophan 2,3-dioxygenase.
pdb deposition date 2006-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03301 Trp_dioxygenase Tryptophan 2,3-dioxygenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.480 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2nw9A00
4HKAA 2V7LA 4PW8A 2NWBA 2X67A 2V7KA 4U72A 2NW7A 4PK5A 2V7JA 5ETWA 2V7MA 5EK3A 2NW9A 3E08A 2D0TA 2V7IA 2D0UA 3BK9A 1YW0A 4U74A 2X68A 2NW8A 4PK6A 1ZEEA 2NOXA 5EK2A 2X66A 5EK4A
chains in the Genus database with same CATH superfamily
4HKAA 2KWHA 1FIOA 2KZ7B 3UUXB 2IC9A 2IMLA 3WAJA 3Q9DA 4CI1B 3AEDA 4ZI3D 1LVFA 4ZZBA 5LHIB 3SFDA 2KNDA 3HA4A 3H3AA 4JI7T 1YKHB 3AE9A 4N78D 4UVCB 2YN6A 1AJ3A 1ZP0A 3ZJ2A 4IDPA 3N9QA 3RYCE 2LSYA 3AEFA 5LYJE 3DTOA 3I1AA 2WMOA 3IBPA 5LHHB 2VKDA 4ZXLA 2VB6A 1HNXT 4WNKA 4U2ZA 3JADA 4U7YA 3ZPOA 4GK5E 3U3IA 4JYAT 3NZQA 1FMVA 3IF8B 4KI0F 2PTFA 2Y6XA 3V5SA 4QX8B 3Q2MA 2W67A 3AAAB 4Z90A 3C50A 2FUPA 4PK4A 4DR6T 3AB3B 4GKJT 2DL1A 2DLRA 5IYZE 4ZS2A 2ZLYA 2CWYA 2PBIA 5JDFA 2D0TA 4CXXA 2LT3A 4H63V 3GN5A 4NXMT 2VURA 5HXRA 2DNXA 2XAHB 4HWIB 2B76A 2CHNA 1IZNB 5HCMA 4DR7T 2V6YA 4DV2T 4LF4T 2BVLA 3HKCE 5AQPB 3RIUA 5EK4A 3AE4A 4QKNA 2NTYA 3PUQA 5C2TA 4JBWF 2N9DA 5FXWA 3ZYMA 5ABFA 2WB5A 3ZMTB 5M4YA 1T8BA 3KVAA 1OXZA 5LBQB 3RC8A 2HH7A 1HTJF 2A72A 3NWIA 5AQFB 4ZHQE 5AFUL 1VOMA 4QXCB 5AQIB 1BR1A 2JIWA 5LMNT 5LJNA 4HFEA 2RP4A 3RQWA 2E9XC 3N9MA 4EAHA 3O1JA 3Q5XA 2LRKA 3ANWB 3C4WA 1T98A 2WQYA 4YT0A 5FL1A 5LG4A 2D2SA 4AQGA 2PG8A 2IUBA 4LF9T 2JRKA 2WDVA 1WRDA 4QWNB 5BR8T 2NP9A 2YINA 2NW7A 4QHOA 2ODVA 4IDQA 5ABGA 2WU2A 3UQ7A 2XPKA 3UUMA 3RYHE 5HEOA 1BR4A 2LOPA 3VHLA 3VRBA 4AXPA 2YU1A 2ZM6T 3RIAA 2IDOB 1WR0A 4I0UA 4O4HE 3R84B 4PAGA 4AKLA 4KX6A 4MFRA 5AQVB 2BZBA 4XBFB 1MMDA 2CM0A 4Z91A 4QXBB 1CHUA 3FZKB 3QB5A 2BS2A 3HI2A 3PUZF 1X79A 2J1DG 1MIYA 2XSAA 3UFEA 5LGNB 2XHEB 4B3TT 5DJQC 2VKJA 4U33A 3GMIA 4I43B 2FJEA 4CXYA 4X1KE 4I55E 3ZCJA 2ZM0A 3B5MA 5FY1A 2UUCT 2H88A 5GONE 4NIQA 3VKHA 4B3ST 2NW9A 4YJ2E 4JEHB 2WS3A 2CXDA 5JQGE 2E2AA 4X65T 2WSSV 3O9XA 3PU3A 1BR2A 2UU9T 5DABA 4PNIA 3X1DA 4HFDA 2UUBT 2L9QA 3AXJB 3N2KE 4UXNB 4AKGA 3H3MA 4TWFA 3C98B 5FP3A 4HEAA 3ZMSB 4ZOLE 2QA7A 3AE8A 1ZKEA 1ZOYA 2ODUA 2E5VA 2QGSA 3LBXB 2MAWA 5ETWA 3MKDA 5L3DB 2OV9A 3ZC1A 1FJGT 1Y01A 2W62A 3PJAA 3KVBA 5JR9B 2XQ6A 2M6IA 2Z6EA 4GIWA 4B3RT 3OJAA 5AQOB 4YSYA 4DIDB 3CQGB 2NOXA 2RPAA 2XTLA 4YLHA 3NZPA 3IHRA 1WLXA 1HX8A 2FJAA 2LM2A 1X9BA 3MXZA 1MMGA 2XQ9A 4KUMB 2DWGA 4HWCA 4AQFC 4HFHA 3ETUA 2IC6A 4UF0B 4UVBB 4LMJA 4F8HA 1E1HB 2BS4A 4ZI2D 4TWHA 3CWZB 4X5TA 2Q9QC 2UXBT 1OEDA 2FBWA 4AQYT 1Y64B 5JRCB 2YKSA 3PUXF 3SS1A 4WBOA 2GK9A 5EZYE 4X62T 1Z0PA 2H89A 3RKGA 3ABVA 1UK5A 4L5GA 5HYAA 5KXJA 5FXVA 3GWHA 4F6RC 2C5KT 4O4IE 3RQUA 2VK9A 3I0OA 3PUGA 2LM9A 5LJMA 2J62A 3N5LA 4LF8T 1N33T 3ZMUB 1W0BA 4H9NC 1Z8UA 4WW0A 4ADZA 2VVSA 2WDRA 4HFBA 2C5JA 3AECA 2X68A 2LLYA 4EYUA 2LE8A 2BG9A 5HXEA 2CXLA 4LFAT 2KWIB 3ZKRA 4TUYE 2KLQA 3EUHA 3ESLA 5J2TE 2WWVA 3JC6D 2V26A 2M67A 2JQQA 4YTMA 4CQIA 4WZXA 2UXDT 5KX5E 1IBMT 3FZLB 3RF1A 4EGWA 3A8YC 3NRYA 2D9DA 5FNVE 2VQFT 5CGMA 1IJ5A 2XQ8A 5HXSA 4CXWA 2LHNA 4OK0A 4EIWA 1KNPA 4K0KT 5IUXA 5ABHA 4HWFA 3CPZA 2JMKA 2NR4A 4PJLA 4FI5A 1ZHCA 3EDUA 5EK3A 2UXCT 5HXHA 5KMGP 2A9UA 3V5UA 2E9XB 4DR4T 3EHZA 3CK6A 3O1HA 3M65A 5FXXA 3RIUC 1D0XA 5HWXA 1MNDA 5JR9C 5AQTB 2CRBA 4G2AA 4PFPA 3FXEB 2CLYB 4DMVA 3PU8A 2ES0A 2HPLA 2K3WA 4O8SA 3TLWA 3R6NA 1WFDA 5JDHA 2XQ5A 5FY7A 2W0GA 3ONJA 4X20E 3AE6A 2H3RA 4H9SE 5J1GA 4AKIA 1NWMX 1XDPA 3C51A 2H7VC 3CX7B 4J2CA 4DV1T 3LFMA 2X9HA 4XZCA 4C91A 5AQNB 3ZT5A 3ZSTA 5IWAT 4U3CA 4IE7A 5ABEA 1T7SA 4KMCA 4U74A 2YDSA 4ISTA 1UGOA 5AQHB 2ACZA 5J0ZA 2X9XA 5HWYA 4H9QC 3K8PC 5FKYA 2CMRA 1XNQT 3AEGA 1BR0A 4I50E 3BQIA 4LMLA 3OYZA 4UVAB 2K24A 5HEHA 4U7IA 3LG7A 4EZHA 2K9AA 4MALA 2W61A 3LK2B 4PK5A 5CB4E 2LRLA 4DV4T 3AE1A 3E08A 3D0TA 4LF6T 3RLFF 5H6QB 1SA0E 1VCTA 4YSZA 3AA6B 5L3FB 3UTKA 5CA0E 2BDEA 4P1NA 4OHFA 5BMVE 3L8RA 4LMKA 2MPKA 1XWMA 5LNKA 5L4HA 2N1GA 4UIGA 5DQWA 3JCFA 5J2UE 3TLTA 1KFYA 5KDMC 2MBGA 4YY3T 2X0YA 4TV8E 4IGUA 1WYCA 3QK6A 3RGLA 3RHWA 3CIRA 1WCRA 5FVLA 5AQJB 2RA1A 3PUYF 5LHGB 5LB7B 2DI4A 3G06A 2UXXB 1MIVA 2WZIA 4LFBT 4E7SA 2QVAA 2LSKA 5JTGA 3Q5WA 2XAGB 4NUUA 3EABA 2DWKA 4DVDA 1IAPA 4GOUA 2JMHA 4HGAA 4IE4A 3ONLC 4HWHA 5EK2A 3PURA 1M7KA 2J47A 5C3JA 3VR9A 2DHRA 1SE7A 2F4VT 3ZEFB 4UF0A 4DV5T 5JH7E 2V6XA 2EHOB 3K3NA 2CLYC 4P0BA 3ZT7A 4U2YA 3RPUA 2WDQA 4AKHA 4HWDA 4Z8XA 3CQXC 2Q9QB 3OYXA 4CN6A 3EDVA 2MYSA 1MMNA 5HEGA 4H9OC 2XQAA 3SFEA 2AE9A 4IHJE 2NWBA 3DJBA 2IAKA 5L3BB 3BQLA 3PDYA 4EEDA 4IE5A 3I9YA 4HFVA 3P4RA 2VL0A 2W66A 2D0UA 5E0OA 3UFGA 3UULA 1HG2A 2LSJA 4PFOA 2KINB 2XAJB 3EVYA 2BBJA 3RIFA 3KV6A 1KK7A 1E7PA 3VRAA 1W9RA 5JDQA 2V7MA 5HAXA 2CEAA 5AQRB 1N34T 2WM9A 1OEDC 4DV7T 2DCFA 3CVRA 3OBVE 4JEUB 1HNWT 2JQ9A 1I6ZA 5C8YE 3FB2A 3QC9A 5FMNA 4EXTA 5JVDE 4U31A 3NKZA 2BBHA 4L9IA 4IDZA 2G0UA 1XMOT 4O4JE 1MMAA 2MTQA 1U4QA 5F3JA 2XQ4A 4KHPT 4QH1A 4JI1T 2FJBA 1XMQT 3N9OA 2VVNA 3GN5B 1KNRA 4YSXA 3AA0B 3AEBA 5CJ5A 2XUEA 2JJ9A 1YW0A 3M3ZB 1HF8A 4PK6A 2E9XA 5L3GB 4WBNE 2V6YB 2BG9C 4PJJA 2KSRA 2IW5B 2LKGA 5LMUT 1D1CA 3QOFA 2N2NA 2I59A 2ZM2A 5F8PA 1MNEA 2VWAA 4JV5T 1UUSA 3FZMB 2X66A 2YDQA 5FXZA 4JUYA 1SHZC 2LSGA 2IIUA 2IHR1 4X64T 2QRXA 2XY8B 4IE6A 3OVUA 3KV4A 3I0QA 3ONXA 4QX7B 1KF6A 3Q5DA 2EHOC 3UQ4A 4YHHT 2BVMA 2LOSA 4IL9A 1B7TA 3FBZA 3A5XA 3IEEA 3RI5A 4CN4A 2JPFA 2NTXA 3KBUA 4HE8A 5FY0A 4UELA 3UU6A 3LDQB 4Q25A 4A56A 2BKNA 3N9LA 2V7LA 3ZJ1A 1US7B 4AKRB 1CUNA 4CZZB 1QLBA 3LK3B 4P09A 1R8IA 4ILAA 4ISSA 4OFZA 2XZEA 4JI2T 4K0UA 5LGUB 2CBIA 5JDMA 4V1Av 4EYYR 4EB6E 4P0AA 1XNRT 2X0LB 4M1PA 4TN7B 3F31A 4EEBA 1QSDA 2XM1A 2XSBA 4GYSA 4UR9A 2WMNA 3L39A 4DR2T 2VQET 1V9DA 4ILCA 2LSIA 4H63H 2R6GF 2V7JA 3KINB 2C5IT 3A7MA 5JDLA 2I0MA 3LSVA 2YK0A 1T72A 3L3PA 5JREA 2WCAA 4ILUA 1J5WA 1YQ4A 2MOZA 1QUUA 4U72A 3SOLA 4YFSA 3AE7A 4H9RC 2XASB 4YJ3E 5L3CB 1W09A 1ZV4X 5L2LA 4OYKA 3AE5A 4UV9B 4ZI3C 3KFWX 3TLUA 3ANWA 4ZEYA 4DV3T 1S94A 3CKDA 4AQFA 5DQVA 2LHRA 2X67A 3CQCB 1XZYA 2ZM8A 1SUMB 2W00A 3JAFA 5F5WA 3L09A 3AA1B 3N2OA 3RKOA 3OTOT 3E0ZA 2Q9QA 2H7OA 2M6BA 4IIJE 5AQQB 4DNDA 3KV5A 1JNZA 3RRCA 3P4SA 1KEYA 3ZLIA 3PTRB 2W4XA 2J4GA 2LJLA 2V5CA 3RRWA 3C4XA 1G8XA 1HFAA 2BS3A 5CA1E 1FMWA 1UCUA 1HR0T 4JI4T 1OEDE 4OYJA 3S4UA 1HS7A 1DU2A 4CN1A 2ACXA 2V7IA 1L0VA 4X1YE 1N36T 2YOEA 3UUBA 4DBQA 4L0RA 4A98A 3P8CD 5AQUB 5L47A 4CI3B 2XQ3A 1OEDB 1M62A 5LG3A 2SPCA 5CFBA 1GQEA 2D5UA 4TV9E 2KMFA 2BG9E 2JQHA 1G73A 1NENA 4DR5T 4MBQA 3AAEB 5LP6E 4FJOA 3AXJA 4MLKA 3TLVA 2B1EA 1LVKA 4WYVA 1WYBA 3N2GE 3MZKB 1LKXA 2UXNB 4DV0T 3ZC0A 3LBXA 2BG9B 2VKHA 4B3MT 4IL4A 3PUSA 5JR9A 4XAXB 2BKPA 4NXNT 3T1HT 1UX5A 3TKLB 3P4QA 4ILBA 3CMLA 3KDSE 4DBRA 3O1IA 3KBTA 4COFA 4E7ZA 4TNWA 2WBLA 4BJNA 3WI3A 3PUWF 5HEJA 3FXDB 4ASKA 4GK0E 3GA8A 4HTEA 2X0HA 2XM2A 1EZ3A 1D1AA 4ERRA 3IA3A 3OKQA 3RH3A 4JI8T 2CWOA 3HKEE 3QNUA 1LRZA 2HN1A 4DO0A 3K3OA 3ZN1B 3ETVA 4G63A 3BK9A 4ZS3A 4JI3T 2C0SA 4QXHB 4UV8B 4KP3C 4BAYB 3MJXA 2BKOA 3AEEA 5IHYA 4O2BE 2CA5A 5LXTE 4KBMB 3ZMVB 5JRCA 1S35A 3UU5A 3U78A 2K48A 5LA6E 4TZ4C 1O3XA 4YHJA 1HG5A 3PE0A 2WP9A 5L4EA 3ZT6A 2NW8A 5FYMA 2E9XD 2L8KA 1YXRA 1D1BA 4PW8A 3OPCA 2ZMAA 3CX8B 1I94T 3F2EA 1FEWA 3F57A 4DUYT 3LJCA 3ZYKA 4IDOA 3P4PA 2E8IA 2XQ7A 1ZEEA 1VRBA 1NEKA 2X51A 4JI5T 3P7IA 3H37A 4AISA 3TLSA 3O4XE 2LEHA 2UUAT 3ZSSA 1KNZA 4QH4A 1IJ6A 5LCYA 5LOVE 3RYIE 3AA7B 3MK7C 2VKOA 3ZMZB 4H9PC 3ZCIA 3NBXX 2OLTA 1E2AA 3MACA 5HEUA 3JAEA 3HKBE 4NPPA 2XQYA 3DP7A 3UU8A 5FL0A 1XDOA 2V1DB 2L3LA 3PUAA 3W15B 1J5ET 1IBLT 3AEAA 2V5DA 5TAOA 4A5XA 4MHCA 2WWUA 4TWDA 1U5PA 1YD8G 2Y8DA 5L3EB 2QYWA 4TX5A 2CPTA 2JQKA 3RC3A 4HN9A 3QUJA 2WY2A 2HN2A 3P50A 2LKHA 3RYFE 2P9BA 4YTNA 5LGTB 4CI2B 2K5BB 2W63A 1D0ZA 3AVSA 3C4ZA 4PJMA 3PJAJ 4ANJA 3QB5K 1YKEB 2WAUA 3B57A 3NRXA 3HKDE 3FZFB 3T1YT 4NUVA 2WU5A 3AE2A 3AVRA 4LF5T 2KT9A 2WZHA 4X1IE 4YTPA 5ABFB 4IDNA 4DMWA 3J9X1 4ZI7E 3EI0A 4ZI2C 2E5LT 3MA9A 4O4LE 2HPJA 2A3DA 4C90A 3FZHB 2CHOA 4UEMA 3HL6A 3UU4A 3ZYLA 3FBLA 1W0AA 2CCQA 2Y48B 2W2UA 4A97A 4X66T 4O2AE 4EOZB 3KV9A 3EAMA 3PV0F 3BQKA 4HFCA 5AQKB 2OA5A 5LBMA 5AQSB 1H7CA 5AQGB 4QH5A 3WAKA 2YDRA 3VR8A 4LFCT 4ZZCA 3ZN0B 2VASA 2PJQA 3B13A 5AQLB 1IBKT 4HFIA 2CBJA 4EV6A 3Q5EA 1HNZT 2V7KA 3NVOA 2EHOD 5A1LA 2YU2A 5JDGA 4I4TE 3UU3A 2YEVC 3JC6C 2X9YA 4OX9T 4JLEA 2XAFB 3T8OA 2Q9QD 3AAIA 4TNVA 4JI6T 4IE0A 2VL8A 5ADXL 2X9WA 3AE3A 4GKKT 4AIUA 1J1JA 5AQMB 3SWHA 3P4WA 1UURA 2CE7A 2KXPB 3VKGA 1YQ3A 2I6HA 3N9NA 2FJDA 4IT4A 4KHZF 4BA9A 1MIWA 4EZ4A 3C64A 4YXDA 3HR0A 3FHNA 2AXDS 4B6XA 3LK42 1N32T 4GYRA 3SRZA 3PUVF 4DR1T 2A2FX 3N9PA 2XJ7A 3UT5E 4LF7T 4DV6T 1NAFA 3CX6B 1UX4A 5FVKA 2PFVA 5H6RB 4DUZT 1VCSA 3E22E 2XAQB 3VU7H 3I9WA 5JDNA 2V8SV 1HX1B 4AI6A 3K3QC 3UUNA 4DR3T 1JNRA 2EHOA 5HXCA 5HCJA 1D0YA 3RX6A 2HHHT 4JI0T 3K1SA 2CXFA 3J7Yq 4PJNA 1WR6A 4IREA 1OWAA 1HCIA 4BJMA
chains in the Genus database with same CATH topology
4HKAA 4XAXB 5JRCB 5C8YE 1UX5A 3FB2A 3TKLB 2KWHA 3QC9A 1FIOA 5FMNA 3SS1A 4WBOA 4EXTA 2KZ7B 5JVDE 3CMLA 3UUXB 2IC9A 2GK9A 3KDSE 4DBRA 5EZYE 3WAJA 3O1IA 3Q9DA 1Z0PA 4CI1B 4L9IA 3KBTA 4IDZA 2G0UA 4E7ZA 4O4JE 4L5GA 1MMAA 2MTQA 5HYAA 1U4QA 5F3JA 2WBLA 4BJNA 5FXVA 3GWHA 4ZI3D 4F6RC 3WI3A 1LVFA 5LHIB 2C5KT 4O4IE 2KNDA 3HA4A 3H3AA 2VK9A 1YKHB 3FXDB 3I0OA 4GK0E 4N78D 4ASKA 3GA8A 3PUGA 4HTEA 1EZ3A 1D1AA 4UVCB 3N9OA 4ERRA 2LM9A 1AJ3A 3ZJ2A 3GN5B 3OKQA 3RH3A 3AA0B 5LJMA 2CWOA 3N5LA 3HKEE 1LRZA 4DO0A 3N9QA 3K3OA 3ZMUB 2XUEA 4H9NC 2LSYA 3RYCE 4WW0A 3ZN1B 3ETVA 4G63A 4ADZA 5LYJE 3BK9A 4ZS3A 3DTOA 3I1AA 2C0SA 2JJ9A 1YW0A 4QXHB 4UV8B 2C5JA 2WMOA 1HF8A 2X68A 4PK6A 2E9XA 3IBPA 4KP3C 4BAYB 4EYUA 4WBNE 3MJXA 5L3GB 2LE8A 5LHHB 2VKDA 5HXEA 2CXLA 4PJJA 2VB6A 2KWIB 4TUYE 4WNKA 5IHYA 2IW5B 2KLQA 4O2BE 3EUHA 1D1CA 2CA5A 2N2NA 5LXTE 3ESLA 3ZPOA 4GK5E 4KBMB 3U3IA 2I59A 3NZQA 3ZMVB 5J2TE 3JC6D 1FMVA 2V26A 2M67A 1S35A 2JQQA 3IF8B 5JRCA 3U78A 2K48A 5LA6E 4TZ4C 1O3XA 4YHJA 1HG5A 3PE0A 4CQIA 2Y6XA 2ZM2A 5F8PA 1MNEA 2VWAA 3V5SA 4QX8B 3Q2MA 3AAAB 2NW8A 5KX5E 3C50A 2E9XD 5FYMA 2X66A 4PK4A 2L8KA 5FXZA 1D1BA 3NRYA 5FNVE 4PW8A 4JUYA 1SHZC 3AB3B 2LSGA 1IJ5A 2DLRA 2ZMAA 5HXSA 3CX8B 5IYZE 4CXWA 4ZS2A 2ZLYA 2CWYA 2LHNA 3F2EA 4OK0A 2PBIA 1FEWA 5JDFA 4EIWA 3F57A 2D0TA 4CXXA 2LT3A 4H63V 3GN5A 3LJCA 3ZYKA 5HXRA 4IE6A 2E8IA 3CPZA 2JMKA 1ZEEA 1VRBA 2DNXA 3KV4A 2X51A 2XAHB 3P7IA 3I0QA 3ONXA 4PJLA 4QX7B 3H37A 1IZNB 2EHOC 4FI5A 3O4XE 1ZHCA 2LEHA 3EDUA 5EK3A 5HXHA 2BVMA 2LOSA 5KMGP 1KNZA 3V5UA 2E9XB 1B7TA 2BVLA 3A5XA 3FBZA 1IJ6A 3IEEA 5LCYA 3HKCE 5LOVE 3RYIE 3AA7B 2JPFA 3MK7C 2VKOA 3O1HA 3M65A 2NTXA 5FXXA 1D0XA 5HWXA 5EK4A 1MNDA 4H9PC 3ZMZB 5JR9C 3ZCIA 3NBXX 4QKNA 2NTYA 3KBUA 4HE8A 5FY0A 4G2AA 3PUQA 3MACA 4PFPA 3FXEB 2CLYB 4UELA 4DMVA 3PU8A 2ES0A 2HPLA 3HKBE 2XQYA 4O8SA 3DP7A 2N9DA 3R6NA 4A56A 5FXWA 3ZYMA 5JDHA 2V1DB 5FY7A 3ZMTB 5M4YA 2W0GA 2L3LA 3PUAA 3N9LA 4X20E 3KVAA 1OXZA 2H3RA 4H9SE 5J1GA 2V7LA 1NWMX 5LBQB 4AKIA 3RC8A 3W15B 3C51A 2HH7A 2H7VC 1HTJF 3CX7B 4J2CA 3ZJ1A 2A72A 1US7B 4AKRB 3LFMA 1CUNA 2X9HA 4XZCA 5TAOA 4CZZB 4C91A 4ZHQE 3LK3B 4P09A 4MHCA 5AFUL 1VOMA 2WWUA 4QXCB 1U5PA 1BR1A 1YD8G 4ISSA 4OFZA 4IE7A 2Y8DA 5L3EB 4K0UA 5LJNA 5LGUB 4KMCA 4TX5A 4U74A 2RP4A 4ISTA 5JDMA 2E9XC 4V1Av 3RC3A 4EYYR 2X9XA 4HN9A 3N9MA 3QUJA 4EB6E 4EAHA 5HWYA 2X0LB 4P0AA 3RYFE 4H9QC 4M1PA 3O1JA 3K8PC 3Q5XA 2CMRA 3F31A 4TN7B 2P9BA 1QSDA 5LGTB 3ANWB 3C4WA 4CI2B 1T98A 2K5BB 2W63A 1BR0A 1D0ZA 3AVSA 3C4ZA 4PJMA 4I50E 5LG4A 2D2SA 4AQGA 3BQIA 4GYSA 4ANJA 3OYZA 2PG8A 4UVAB 1YKEB 2K24A 2WMNA 2WAUA 3B57A 3NRXA 2JRKA 3LG7A 3HKDE 4EZHA 1WRDA 4NUVA 4QWNB 2K9AA 1V9DA 4MALA 2NP9A 2W61A 2YINA 2LSIA 3AVRA 2NW7A 3LK2B 4PK5A 4H63H 4QHOA 5CB4E 2KT9A 2ODVA 2V7JA 3KINB 4X1IE 2C5IT 4DMWA 3E08A 5JDLA 3D0TA 3J9X1 4ZI7E 3UUMA 4ZI2C 3MA9A 4O4LE 2HPJA 2YK0A 3RYHE 1BR4A 2A3DA 5H6QB 3L3PA 4C90A 5JREA 2LOPA 3VHLA 4AXPA 1SA0E 4UEMA 2YU1A 3HL6A 3AA6B 4ILUA 3ZYLA 5L3FB 4O4HE 2MOZA 3FBLA 3UTKA 5CA0E 3R84B 4PAGA 1QUUA 2BDEA 2CCQA 4AKLA 4U72A 3SOLA 4YFSA 4YJ3E 4H9RC 2XASB 4MFRA 2Y48B 4OHFA 5L3CB 5BMVE 2BZBA 4O2AE 4EOZB 3KV9A 4XBFB 1ZV4X 5LNKA 1MMDA 2CM0A 5L2LA 4OYKA 4QXBB 4UV9B 3BQKA 2N1GA 4UIGA 4ZI3C 5DQWA 3KFWX 2OA5A 3ANWA 3HI2A 5J2UE 5LBMA 1S94A 5KDMC 1X79A 3CKDA 2MBGA 4AQFA 1H7CA 5DQVA 2LHRA 2J1DG 1MIYA 2X67A 3CQCB 3UFEA 4TV8E 4IGUA 2ZM8A 5LGNB 2W00A 1WYCA 3QK6A 2XHEB 5DJQC 2VKJA 3WAKA 3L09A 3AA1B 2RA1A 3GMIA 3N2OA 4I43B 3ZN0B 2VASA 3RKOA 2PJQA 4CXYA 3B13A 3E0ZA 5LHGB 2Q9QA 4X1KE 4I55E 2H7OA 3ZCJA 2DI4A 4IIJE 2UXXB 4DNDA 3KV5A 2ZM0A 5FY1A 1MIVA 3RRCA 5GONE 2V7KA 4E7SA 3ZLIA 2EHOD 2LSKA 5A1LA 2YU2A 3PTRB 3Q5WA 5JDGA 4I4TE 2XAGB 2LJLA 3VKHA 4NUUA 2NW9A 2YEVC 4YJ2E 3RRWA 3JC6C 4JEHB 3C4XA 2X9YA 1G8XA 1HFAA 2CXDA 4JLEA 5JQGE 2DWKA 5CA1E 1FMWA 2XAFB 3T8OA 1IAPA 2Q9QD 2JMHA 3AAIA 4GOUA 4DVDA 4IE0A 4HGAA 4IE4A 2WSSV 1UCUA 4BJMA 2VL8A 5EK2A 3O9XA 3PU3A 3PURA 1BR2A 5ADXL 5DABA 2X9WA 4OYJA 4PNIA 3S4UA 2L9QA 2DHRA 3N2KE 1HS7A 3SWHA 2ACXA 2CE7A 3ZEFB 2KXPB 4UF0A 2V7IA 4UXNB 3VKGA 5JH7E 4AKGA 2EHOB 3C98B 3K3NA 5FP3A 4HEAA 2CLYC 3ZMSB 3N9NA 4P0BA 4ZOLE 2QA7A 4X1YE 3RPUA 1ZKEA 4AKHA 2ODUA 4BA9A 1MIWA 4DBQA 4Z8XA 2QGSA 3LBXB 4L0RA 3P8CD 3CQXC 5ETWA 4CI3B 2Q9QB 3C64A 3MKDA 3ZC1A 4EZ4A 3OYXA 3HR0A 5L3DB 3FHNA 2W62A 4B6XA 3KVBA 3EDVA 3LK42 2MYSA 5JR9B 2SPCA 1MMNA 2Z6EA 4GIWA 4GYRA 3SRZA 3OJAA 2D5UA 2A2FX 3N9PA 3CQGB 4H9OC 2NOXA 3UT5E 2XTLA 4TV9E 4YLHA 4IHJE 2NWBA 3DJBA 2IAKA 5L3BB 2KMFA 3BQLA 3NZPA 3IHRA 3PDYA 4IE5A 1NAFA 1G73A 1WLXA 3CX6B 1UX4A 1HX8A 3I9YA 4HFVA 4MBQA 2PFVA 3MXZA 5H6RB 3AAEB 1MMGA 2D0UA 3E22E 5E0OA 5LP6E 4FJOA 4KUMB 3UULA 1HG2A 2XAQB 4MLKA 3VU7H 3I9WA 2LSJA 2B1EA 1LVKA 5JDNA 2DWGA 4PFOA 4AI6A 2KINB 1WYBA 3K3QC 2XAJB 3N2GE 4AQFC 3EVYA 3MZKB 3UUNA 3ETUA 3KV6A 1LKXA 2IC6A 1KK7A 2EHOA 4UF0B 4UVBB 5HXCA 5JDQA 1D0YA 3RX6A 2V7MA 2UXNB 2CEAA 5HAXA 1E1HB 3ZC0A 4ZI2D 2CXFA 3LBXA 3J7Yq 3CWZB 2VKHA 2WM9A 2Q9QC 4PJNA 3PUSA 1WR6A 2DCFA 3CVRA 3OBVE 1OWAA 1HCIA 4JEUB 1Y64B 5JR9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HKA A;  2V7L A;  4PW8 A;  2NWB A;  2X67 A;  2V7K A;  4U72 A;  2NW7 A;  4PK5 A;  2V7J A;  5ETW A;  2V7M A;  5EK3 A;  2NW9 A;  3E08 A;  2D0T A;  2V7I A;  2D0U A;  3BK9 A;  1YW0 A;  4U74 A;  2X68 A;  2NW8 A;  4PK6 A;  1ZEE A;  2NOX A;  5EK2 A;  2X66 A;  5EK4 A; 
#chains in the Genus database with same CATH topology
 4HKA A;  2KWH A;  1FIO A;  2KZ7 B;  3UUX B;  2IC9 A;  2IML A;  3WAJ A;  3Q9D A;  4CI1 B;  3AED A;  4ZI3 D;  1LVF A;  4ZZB A;  5LHI B;  3SFD A;  2KND A;  3HA4 A;  3H3A A;  4JI7 T;  1YKH B;  3AE9 A;  4N78 D;  4UVC B;  2YN6 A;  1AJ3 A;  1ZP0 A;  3ZJ2 A;  4IDP A;  3N9Q A;  3RYC E;  2LSY A;  3AEF A;  5LYJ E;  3DTO A;  3I1A A;  2WMO A;  3IBP A;  5LHH B;  2VKD A;  4ZXL A;  2VB6 A;  1HNX T;  4WNK A;  4U2Z A;  3JAD A;  4U7Y A;  3ZPO A;  4GK5 E;  3U3I A;  4JYA T;  3NZQ A;  1FMV A;  3IF8 B;  4KI0 F;  2PTF A;  2Y6X A;  3V5S A;  4QX8 B;  3Q2M A;  2W67 A;  3AAA B;  4Z90 A;  3C50 A;  2FUP A;  4PK4 A;  4DR6 T;  3AB3 B;  4GKJ T;  2DL1 A;  2DLR A;  5IYZ E;  4ZS2 A;  2ZLY A;  2CWY A;  2PBI A;  5JDF A;  2D0T A;  4CXX A;  2LT3 A;  4H63 V;  3GN5 A;  4NXM T;  2VUR A;  5HXR A;  2DNX A;  2XAH B;  4HWI B;  2B76 A;  2CHN A;  1IZN B;  5HCM A;  4DR7 T;  2V6Y A;  4DV2 T;  4LF4 T;  2BVL A;  3HKC E;  5AQP B;  3RIU A;  5EK4 A;  3AE4 A;  4QKN A;  2NTY A;  3PUQ A;  5C2T A;  4JBW F;  2N9D A;  5FXW A;  3ZYM A;  5ABF A;  2WB5 A;  3ZMT B;  5M4Y A;  1T8B A;  3KVA A;  1OXZ A;  5LBQ B;  3RC8 A;  2HH7 A;  1HTJ F;  2A72 A;  3NWI A;  5AQF B;  4ZHQ E;  5AFU L;  1VOM A;  4QXC B;  5AQI B;  1BR1 A;  2JIW A;  5LMN T;  5LJN A;  4HFE A;  2RP4 A;  3RQW A;  2E9X C;  3N9M A;  4EAH A;  3O1J A;  3Q5X A;  2LRK A;  3ANW B;  3C4W A;  1T98 A;  2WQY A;  4YT0 A;  5FL1 A;  5LG4 A;  2D2S A;  4AQG A;  2PG8 A;  2IUB A;  4LF9 T;  2JRK A;  2WDV A;  1WRD A;  4QWN B;  5BR8 T;  2NP9 A;  2YIN A;  2NW7 A;  4QHO A;  2ODV A;  4IDQ A;  5ABG A;  2WU2 A;  3UQ7 A;  2XPK A;  3UUM A;  3RYH E;  5HEO A;  1BR4 A;  2LOP A;  3VHL A;  3VRB A;  4AXP A;  2YU1 A;  2ZM6 T;  3RIA A;  2IDO B;  1WR0 A;  4I0U A;  4O4H E;  3R84 B;  4PAG A;  4AKL A;  4KX6 A;  4MFR A;  5AQV B;  2BZB A;  4XBF B;  1MMD A;  2CM0 A;  4Z91 A;  4QXB B;  1CHU A;  3FZK B;  3QB5 A;  2BS2 A;  3HI2 A;  3PUZ F;  1X79 A;  2J1D G;  1MIY A;  2XSA A;  3UFE A;  5LGN B;  2XHE B;  4B3T T;  5DJQ C;  2VKJ A;  4U33 A;  3GMI A;  4I43 B;  2FJE A;  4CXY A;  4X1K E;  4I55 E;  3ZCJ A;  2ZM0 A;  3B5M A;  5FY1 A;  2UUC T;  2H88 A;  5GON E;  4NIQ A;  3VKH A;  4B3S T;  2NW9 A;  4YJ2 E;  4JEH B;  2WS3 A;  2CXD A;  5JQG E;  2E2A A;  4X65 T;  2WSS V;  3O9X A;  3PU3 A;  1BR2 A;  2UU9 T;  5DAB A;  4PNI A;  3X1D A;  4HFD A;  2UUB T;  2L9Q A;  3AXJ B;  3N2K E;  4UXN B;  4AKG A;  3H3M A;  4TWF A;  3C98 B;  5FP3 A;  4HEA A;  3ZMS B;  4ZOL E;  2QA7 A;  3AE8 A;  1ZKE A;  1ZOY A;  2ODU A;  2E5V A;  2QGS A;  3LBX B;  2MAW A;  5ETW A;  3MKD A;  5L3D B;  2OV9 A;  3ZC1 A;  1FJG T;  1Y01 A;  2W62 A;  3PJA A;  3KVB A;  5JR9 B;  2XQ6 A;  2M6I A;  2Z6E A;  4GIW A;  4B3R T;  3OJA A;  5AQO B;  4YSY A;  4DID B;  3CQG B;  2NOX A;  2RPA A;  2XTL A;  4YLH A;  3NZP A;  3IHR A;  1WLX A;  1HX8 A;  2FJA A;  2LM2 A;  1X9B A;  3MXZ A;  1MMG A;  2XQ9 A;  4KUM B;  2DWG A;  4HWC A;  4AQF C;  4HFH A;  3ETU A;  2IC6 A;  4UF0 B;  4UVB B;  4LMJ A;  4F8H A;  1E1H B;  2BS4 A;  4ZI2 D;  4TWH A;  3CWZ B;  4X5T A;  2Q9Q C;  2UXB T;  1OED A;  2FBW A;  4AQY T;  1Y64 B;  5JRC B;  2YKS A;  3PUX F;  3SS1 A;  4WBO A;  2GK9 A;  5EZY E;  4X62 T;  1Z0P A;  2H89 A;  3RKG A;  3ABV A;  1UK5 A;  4L5G A;  5HYA A;  5KXJ A;  5FXV A;  3GWH A;  4F6R C;  2C5K T;  4O4I E;  3RQU A;  2VK9 A;  3I0O A;  3PUG A;  2LM9 A;  5LJM A;  2J62 A;  3N5L A;  4LF8 T;  1N33 T;  3ZMU B;  1W0B A;  4H9N C;  1Z8U A;  4WW0 A;  4ADZ A;  2VVS A;  2WDR A;  4HFB A;  2C5J A;  3AEC A;  2X68 A;  2LLY A;  4EYU A;  2LE8 A;  2BG9 A;  5HXE A;  2CXL A;  4LFA T;  2KWI B;  3ZKR A;  4TUY E;  2KLQ A;  3EUH A;  3ESL A;  5J2T E;  2WWV A;  3JC6 D;  2V26 A;  2M67 A;  2JQQ A;  4YTM A;  4CQI A;  4WZX A;  2UXD T;  5KX5 E;  1IBM T;  3FZL B;  3RF1 A;  4EGW A;  3A8Y C;  3NRY A;  2D9D A;  5FNV E;  2VQF T;  5CGM A;  1IJ5 A;  2XQ8 A;  5HXS A;  4CXW A;  2LHN A;  4OK0 A;  4EIW A;  1KNP A;  4K0K T;  5IUX A;  5ABH A;  4HWF A;  3CPZ A;  2JMK A;  2NR4 A;  4PJL A;  4FI5 A;  1ZHC A;  3EDU A;  5EK3 A;  2UXC T;  5HXH A;  5KMG P;  2A9U A;  3V5U A;  2E9X B;  4DR4 T;  3EHZ A;  3CK6 A;  3O1H A;  3M65 A;  5FXX A;  3RIU C;  1D0X A;  5HWX A;  1MND A;  5JR9 C;  5AQT B;  2CRB A;  4G2A A;  4PFP A;  3FXE B;  2CLY B;  4DMV A;  3PU8 A;  2ES0 A;  2HPL A;  2K3W A;  4O8S A;  3TLW A;  3R6N A;  1WFD A;  5JDH A;  2XQ5 A;  5FY7 A;  2W0G A;  3ONJ A;  4X20 E;  3AE6 A;  2H3R A;  4H9S E;  5J1G A;  4AKI A;  1NWM X;  1XDP A;  3C51 A;  2H7V C;  3CX7 B;  4J2C A;  4DV1 T;  3LFM A;  2X9H A;  4XZC A;  4C91 A;  5AQN B;  3ZT5 A;  3ZST A;  5IWA T;  4U3C A;  4IE7 A;  5ABE A;  1T7S A;  4KMC A;  4U74 A;  2YDS A;  4IST A;  1UGO A;  5AQH B;  2ACZ A;  5J0Z A;  2X9X A;  5HWY A;  4H9Q C;  3K8P C;  5FKY A;  2CMR A;  1XNQ T;  3AEG A;  1BR0 A;  4I50 E;  3BQI A;  4LML A;  3OYZ A;  4UVA B;  2K24 A;  5HEH A;  4U7I A;  3LG7 A;  4EZH A;  2K9A A;  4MAL A;  2W61 A;  3LK2 B;  4PK5 A;  5CB4 E;  2LRL A;  4DV4 T;  3AE1 A;  3E08 A;  3D0T A;  4LF6 T;  3RLF F;  5H6Q B;  1SA0 E;  1VCT A;  4YSZ A;  3AA6 B;  5L3F B;  3UTK A;  5CA0 E;  2BDE A;  4P1N A;  4OHF A;  5BMV E;  3L8R A;  4LMK A;  2MPK A;  1XWM A;  5LNK A;  5L4H A;  2N1G A;  4UIG A;  5DQW A;  3JCF A;  5J2U E;  3TLT A;  1KFY A;  5KDM C;  2MBG A;  4YY3 T;  2X0Y A;  4TV8 E;  4IGU A;  1WYC A;  3QK6 A;  3RGL A;  3RHW A;  3CIR A;  1WCR A;  5FVL A;  5AQJ B;  2RA1 A;  3PUY F;  5LHG B;  5LB7 B;  2DI4 A;  3G06 A;  2UXX B;  1MIV A;  2WZI A;  4LFB T;  4E7S A;  2QVA A;  2LSK A;  5JTG A;  3Q5W A;  2XAG B;  4NUU A;  3EAB A;  2DWK A;  4DVD A;  1IAP A;  4GOU A;  2JMH A;  4HGA A;  4IE4 A;  3ONL C;  4HWH A;  5EK2 A;  3PUR A;  1M7K A;  2J47 A;  5C3J A;  3VR9 A;  2DHR A;  1SE7 A;  2F4V T;  3ZEF B;  4UF0 A;  4DV5 T;  5JH7 E;  2V6X A;  2EHO B;  3K3N A;  2CLY C;  4P0B A;  3ZT7 A;  4U2Y A;  3RPU A;  2WDQ A;  4AKH A;  4HWD A;  4Z8X A;  3CQX C;  2Q9Q B;  3OYX A;  4CN6 A;  3EDV A;  2MYS A;  1MMN A;  5HEG A;  4H9O C;  2XQA A;  3SFE A;  2AE9 A;  4IHJ E;  2NWB A;  3DJB A;  2IAK A;  5L3B B;  3BQL A;  3PDY A;  4EED A;  4IE5 A;  3I9Y A;  4HFV A;  3P4R A;  2VL0 A;  2W66 A;  2D0U A;  5E0O A;  3UFG A;  3UUL A;  1HG2 A;  2LSJ A;  4PFO A;  2KIN B;  2XAJ B;  3EVY A;  2BBJ A;  3RIF A;  3KV6 A;  1KK7 A;  1E7P A;  3VRA A;  1W9R A;  5JDQ A;  2V7M A;  5HAX A;  2CEA A;  5AQR B;  1N34 T;  2WM9 A;  1OED C;  4DV7 T;  2DCF A;  3CVR A;  3OBV E;  4JEU B;  1HNW T;  2JQ9 A;  1I6Z A;  5C8Y E;  3FB2 A;  3QC9 A;  5FMN A;  4EXT A;  5JVD E;  4U31 A;  3NKZ A;  2BBH A;  4L9I A;  4IDZ A;  2G0U A;  1XMO T;  4O4J E;  1MMA A;  2MTQ A;  1U4Q A;  5F3J A;  2XQ4 A;  4KHP T;  4QH1 A;  4JI1 T;  2FJB A;  1XMQ T;  3N9O A;  2VVN A;  3GN5 B;  1KNR A;  4YSX A;  3AA0 B;  3AEB A;  5CJ5 A;  2XUE A;  2JJ9 A;  1YW0 A;  3M3Z B;  1HF8 A;  4PK6 A;  2E9X A;  5L3G B;  4WBN E;  2V6Y B;  2BG9 C;  4PJJ A;  2KSR A;  2IW5 B;  2LKG A;  5LMU T;  1D1C A;  3QOF A;  2N2N A;  2I59 A;  2ZM2 A;  5F8P A;  1MNE A;  2VWA A;  4JV5 T;  1UUS A;  3FZM B;  2X66 A;  2YDQ A;  5FXZ A;  4JUY A;  1SHZ C;  2LSG A;  2IIU A;  2IHR 1;  4X64 T;  2QRX A;  2XY8 B;  4IE6 A;  3OVU A;  3KV4 A;  3I0Q A;  3ONX A;  4QX7 B;  1KF6 A;  3Q5D A;  2EHO C;  3UQ4 A;  4YHH T;  2BVM A;  2LOS A;  4IL9 A;  1B7T A;  3FBZ A;  3A5X A;  3IEE A;  3RI5 A;  4CN4 A;  2JPF A;  2NTX A;  3KBU A;  4HE8 A;  5FY0 A;  4UEL A;  3UU6 A;  3LDQ B;  4Q25 A;  4A56 A;  2BKN A;  3N9L A;  2V7L A;  3ZJ1 A;  1US7 B;  4AKR B;  1CUN A;  4CZZ B;  1QLB A;  3LK3 B;  4P09 A;  1R8I A;  4ILA A;  4ISS A;  4OFZ A;  2XZE A;  4JI2 T;  4K0U A;  5LGU B;  2CBI A;  5JDM A;  4V1A v;  4EYY R;  4EB6 E;  4P0A A;  1XNR T;  2X0L B;  4M1P A;  4TN7 B;  3F31 A;  4EEB A;  1QSD A;  2XM1 A;  2XSB A;  4GYS A;  4UR9 A;  2WMN A;  3L39 A;  4DR2 T;  2VQE T;  1V9D A;  4ILC A;  2LSI A;  4H63 H;  2R6G F;  2V7J A;  3KIN B;  2C5I T;  3A7M A;  5JDL A;  2I0M A;  3LSV A;  2YK0 A;  1T72 A;  3L3P A;  5JRE A;  2WCA A;  4ILU A;  1J5W A;  1YQ4 A;  2MOZ A;  1QUU A;  4U72 A;  3SOL A;  4YFS A;  3AE7 A;  4H9R C;  2XAS B;  4YJ3 E;  5L3C B;  1W09 A;  1ZV4 X;  5L2L A;  4OYK A;  3AE5 A;  4UV9 B;  4ZI3 C;  3KFW X;  3TLU A;  3ANW A;  4ZEY A;  4DV3 T;  1S94 A;  3CKD A;  4AQF A;  5DQV A;  2LHR A;  2X67 A;  3CQC B;  1XZY A;  2ZM8 A;  1SUM B;  2W00 A;  3JAF A;  5F5W A;  3L09 A;  3AA1 B;  3N2O A;  3RKO A;  3OTO T;  3E0Z A;  2Q9Q A;  2H7O A;  2M6B A;  4IIJ E;  5AQQ B;  4DND A;  3KV5 A;  1JNZ A;  3RRC A;  3P4S A;  1KEY A;  3ZLI A;  3PTR B;  2W4X A;  2J4G A;  2LJL A;  2V5C A;  3RRW A;  3C4X A;  1G8X A;  1HFA A;  2BS3 A;  5CA1 E;  1FMW A;  1UCU A;  1HR0 T;  4JI4 T;  1OED E;  4OYJ A;  3S4U A;  1HS7 A;  1DU2 A;  4CN1 A;  2ACX A;  2V7I A;  1L0V A;  4X1Y E;  1N36 T;  2YOE A;  3UUB A;  4DBQ A;  4L0R A;  4A98 A;  3P8C D;  5AQU B;  5L47 A;  4CI3 B;  2XQ3 A;  1OED B;  1M62 A;  5LG3 A;  2SPC A;  5CFB A;  1GQE A;  2D5U A;  4TV9 E;  2KMF A;  2BG9 E;  2JQH A;  1G73 A;  1NEN A;  4DR5 T;  4MBQ A;  3AAE B;  5LP6 E;  4FJO A;  3AXJ A;  4MLK A;  3TLV A;  2B1E A;  1LVK A;  4WYV A;  1WYB A;  3N2G E;  3MZK B;  1LKX A;  2UXN B;  4DV0 T;  3ZC0 A;  3LBX A;  2BG9 B;  2VKH A;  4B3M T;  4IL4 A;  3PUS A;  5JR9 A;  4XAX B;  2BKP A;  4NXN T;  3T1H T;  1UX5 A;  3TKL B;  3P4Q A;  4ILB A;  3CML A;  3KDS E;  4DBR A;  3O1I A;  3KBT A;  4COF A;  4E7Z A;  4TNW A;  2WBL A;  4BJN A;  3WI3 A;  3PUW F;  5HEJ A;  3FXD B;  4ASK A;  4GK0 E;  3GA8 A;  4HTE A;  2X0H A;  2XM2 A;  1EZ3 A;  1D1A A;  4ERR A;  3IA3 A;  3OKQ A;  3RH3 A;  4JI8 T;  2CWO A;  3HKE E;  3QNU A;  1LRZ A;  2HN1 A;  4DO0 A;  3K3O A;  3ZN1 B;  3ETV A;  4G63 A;  3BK9 A;  4ZS3 A;  4JI3 T;  2C0S A;  4QXH B;  4UV8 B;  4KP3 C;  4BAY B;  3MJX A;  2BKO A;  3AEE A;  5IHY A;  4O2B E;  2CA5 A;  5LXT E;  4KBM B;  3ZMV B;  5JRC A;  1S35 A;  3UU5 A;  3U78 A;  2K48 A;  5LA6 E;  4TZ4 C;  1O3X A;  4YHJ A;  1HG5 A;  3PE0 A;  2WP9 A;  5L4E A;  3ZT6 A;  2NW8 A;  5FYM A;  2E9X D;  2L8K A;  1YXR A;  1D1B A;  4PW8 A;  3OPC A;  2ZMA A;  3CX8 B;  1I94 T;  3F2E A;  1FEW A;  3F57 A;  4DUY T;  3LJC A;  3ZYK A;  4IDO A;  3P4P A;  2E8I A;  2XQ7 A;  1ZEE A;  1VRB A;  1NEK A;  2X51 A;  4JI5 T;  3P7I A;  3H37 A;  4AIS A;  3TLS A;  3O4X E;  2LEH A;  2UUA T;  3ZSS A;  1KNZ A;  4QH4 A;  1IJ6 A;  5LCY A;  5LOV E;  3RYI E;  3AA7 B;  3MK7 C;  2VKO A;  3ZMZ B;  4H9P C;  3ZCI A;  3NBX X;  2OLT A;  1E2A A;  3MAC A;  5HEU A;  3JAE A;  3HKB E;  4NPP A;  2XQY A;  3DP7 A;  3UU8 A;  5FL0 A;  1XDO A;  2V1D B;  2L3L A;  3PUA A;  3W15 B;  1J5E T;  1IBL T;  3AEA A;  2V5D A;  5TAO A;  4A5X A;  4MHC A;  2WWU A;  4TWD A;  1U5P A;  1YD8 G;  2Y8D A;  5L3E B;  2QYW A;  4TX5 A;  2CPT A;  2JQK A;  3RC3 A;  4HN9 A;  3QUJ A;  2WY2 A;  2HN2 A;  3P50 A;  2LKH A;  3RYF E;  2P9B A;  4YTN A;  5LGT B;  4CI2 B;  2K5B B;  2W63 A;  1D0Z A;  3AVS A;  3C4Z A;  4PJM A;  3PJA J;  4ANJ A;  3QB5 K;  1YKE B;  2WAU A;  3B57 A;  3NRX A;  3HKD E;  3FZF B;  3T1Y T;  4NUV A;  2WU5 A;  3AE2 A;  3AVR A;  4LF5 T;  2KT9 A;  2WZH A;  4X1I E;  4YTP A;  5ABF B;  4IDN A;  4DMW A;  3J9X 1;  4ZI7 E;  3EI0 A;  4ZI2 C;  2E5L T;  3MA9 A;  4O4L E;  2HPJ A;  2A3D A;  4C90 A;  3FZH B;  2CHO A;  4UEM A;  3HL6 A;  3UU4 A;  3ZYL A;  3FBL A;  1W0A A;  2CCQ A;  2Y48 B;  2W2U A;  4A97 A;  4X66 T;  4O2A E;  4EOZ B;  3KV9 A;  3EAM A;  3PV0 F;  3BQK A;  4HFC A;  5AQK B;  2OA5 A;  5LBM A;  5AQS B;  1H7C A;  5AQG B;  4QH5 A;  3WAK A;  2YDR A;  3VR8 A;  4LFC T;  4ZZC A;  3ZN0 B;  2VAS A;  2PJQ A;  3B13 A;  5AQL B;  1IBK T;  4HFI A;  2CBJ A;  4EV6 A;  3Q5E A;  1HNZ T;  2V7K A;  3NVO A;  2EHO D;  5A1L A;  2YU2 A;  5JDG A;  4I4T E;  3UU3 A;  2YEV C;  3JC6 C;  2X9Y A;  4OX9 T;  4JLE A;  2XAF B;  3T8O A;  2Q9Q D;  3AAI A;  4TNV A;  4JI6 T;  4IE0 A;  2VL8 A;  5ADX L;  2X9W A;  3AE3 A;  4GKK T;  4AIU A;  1J1J A;  5AQM B;  3SWH A;  3P4W A;  1UUR A;  2CE7 A;  2KXP B;  3VKG A;  1YQ3 A;  2I6H A;  3N9N A;  2FJD A;  4IT4 A;  4KHZ F;  4BA9 A;  1MIW A;  4EZ4 A;  3C64 A;  4YXD A;  3HR0 A;  3FHN A;  2AXD S;  4B6X A;  3LK4 2;  1N32 T;  4GYR A;  3SRZ A;  3PUV F;  4DR1 T;  2A2F X;  3N9P A;  2XJ7 A;  3UT5 E;  4LF7 T;  4DV6 T;  1NAF A;  3CX6 B;  1UX4 A;  5FVK A;  2PFV A;  5H6R B;  4DUZ T;  1VCS A;  3E22 E;  2XAQ B;  3VU7 H;  3I9W A;  5JDN A;  2V8S V;  1HX1 B;  4AI6 A;  3K3Q C;  3UUN A;  4DR3 T;  1JNR A;  2EHO A;  5HXC A;  5HCJ A;  1D0Y A;  3RX6 A;  2HHH T;  4JI0 T;  3K1S A;  2CXF A;  3J7Y q;  4PJN A;  1WR6 A;  4IRE A;  1OWA A;  1HCI A;  4BJM A; 
#chains in the Genus database with same CATH homology
 4HKA A;  4XAX B;  5JRC B;  5C8Y E;  1UX5 A;  3FB2 A;  3TKL B;  2KWH A;  3QC9 A;  1FIO A;  5FMN A;  3SS1 A;  4WBO A;  4EXT A;  2KZ7 B;  5JVD E;  3CML A;  3UUX B;  2IC9 A;  2GK9 A;  3KDS E;  4DBR A;  5EZY E;  3WAJ A;  3O1I A;  3Q9D A;  1Z0P A;  4CI1 B;  4L9I A;  3KBT A;  4IDZ A;  2G0U A;  4E7Z A;  4O4J E;  4L5G A;  1MMA A;  2MTQ A;  5HYA A;  1U4Q A;  5F3J A;  2WBL A;  4BJN A;  5FXV A;  3GWH A;  4ZI3 D;  4F6R C;  3WI3 A;  1LVF A;  5LHI B;  2C5K T;  4O4I E;  2KND A;  3HA4 A;  3H3A A;  2VK9 A;  1YKH B;  3FXD B;  3I0O A;  4GK0 E;  4N78 D;  4ASK A;  3GA8 A;  3PUG A;  4HTE A;  1EZ3 A;  1D1A A;  4UVC B;  3N9O A;  4ERR A;  2LM9 A;  1AJ3 A;  3ZJ2 A;  3GN5 B;  3OKQ A;  3RH3 A;  3AA0 B;  5LJM A;  2CWO A;  3N5L A;  3HKE E;  1LRZ A;  4DO0 A;  3N9Q A;  3K3O A;  3ZMU B;  2XUE A;  4H9N C;  2LSY A;  3RYC E;  4WW0 A;  3ZN1 B;  3ETV A;  4G63 A;  4ADZ A;  5LYJ E;  3BK9 A;  4ZS3 A;  3DTO A;  3I1A A;  2C0S A;  2JJ9 A;  1YW0 A;  4QXH B;  4UV8 B;  2C5J A;  2WMO A;  1HF8 A;  2X68 A;  4PK6 A;  2E9X A;  3IBP A;  4KP3 C;  4BAY B;  4EYU A;  4WBN E;  3MJX A;  5L3G B;  2LE8 A;  5LHH B;  2VKD A;  5HXE A;  2CXL A;  4PJJ A;  2VB6 A;  2KWI B;  4TUY E;  4WNK A;  5IHY A;  2IW5 B;  2KLQ A;  4O2B E;  3EUH A;  1D1C A;  2CA5 A;  2N2N A;  5LXT E;  3ESL A;  3ZPO A;  4GK5 E;  4KBM B;  3U3I A;  2I59 A;  3NZQ A;  3ZMV B;  5J2T E;  3JC6 D;  1FMV A;  2V26 A;  2M67 A;  1S35 A;  2JQQ A;  3IF8 B;  5JRC A;  3U78 A;  2K48 A;  5LA6 E;  4TZ4 C;  1O3X A;  4YHJ A;  1HG5 A;  3PE0 A;  4CQI A;  2Y6X A;  2ZM2 A;  5F8P A;  1MNE A;  2VWA A;  3V5S A;  4QX8 B;  3Q2M A;  3AAA B;  2NW8 A;  5KX5 E;  3C50 A;  2E9X D;  5FYM A;  2X66 A;  4PK4 A;  2L8K A;  5FXZ A;  1D1B A;  3NRY A;  5FNV E;  4PW8 A;  4JUY A;  1SHZ C;  3AB3 B;  2LSG A;  1IJ5 A;  2DLR A;  2ZMA A;  5HXS A;  3CX8 B;  5IYZ E;  4CXW A;  4ZS2 A;  2ZLY A;  2CWY A;  2LHN A;  3F2E A;  4OK0 A;  2PBI A;  1FEW A;  5JDF A;  4EIW A;  3F57 A;  2D0T A;  4CXX A;  2LT3 A;  4H63 V;  3GN5 A;  3LJC A;  3ZYK A;  5HXR A;  4IE6 A;  2E8I A;  3CPZ A;  2JMK A;  1ZEE A;  1VRB A;  2DNX A;  3KV4 A;  2X51 A;  2XAH B;  3P7I A;  3I0Q A;  3ONX A;  4PJL A;  4QX7 B;  3H37 A;  1IZN B;  2EHO C;  4FI5 A;  3O4X E;  1ZHC A;  2LEH A;  3EDU A;  5EK3 A;  5HXH A;  2BVM A;  2LOS A;  5KMG P;  1KNZ A;  3V5U A;  2E9X B;  1B7T A;  2BVL A;  3A5X A;  3FBZ A;  1IJ6 A;  3IEE A;  5LCY A;  3HKC E;  5LOV E;  3RYI E;  3AA7 B;  2JPF A;  3MK7 C;  2VKO A;  3O1H A;  3M65 A;  2NTX A;  5FXX A;  1D0X A;  5HWX A;  5EK4 A;  1MND A;  4H9P C;  3ZMZ B;  5JR9 C;  3ZCI A;  3NBX X;  4QKN A;  2NTY A;  3KBU A;  4HE8 A;  5FY0 A;  4G2A A;  3PUQ A;  3MAC A;  4PFP A;  3FXE B;  2CLY B;  4UEL A;  4DMV A;  3PU8 A;  2ES0 A;  2HPL A;  3HKB E;  2XQY A;  4O8S A;  3DP7 A;  2N9D A;  3R6N A;  4A56 A;  5FXW A;  3ZYM A;  5JDH A;  2V1D B;  5FY7 A;  3ZMT B;  5M4Y A;  2W0G A;  2L3L A;  3PUA A;  3N9L A;  4X20 E;  3KVA A;  1OXZ A;  2H3R A;  4H9S E;  5J1G A;  2V7L A;  1NWM X;  5LBQ B;  4AKI A;  3RC8 A;  3W15 B;  3C51 A;  2HH7 A;  2H7V C;  1HTJ F;  3CX7 B;  4J2C A;  3ZJ1 A;  2A72 A;  1US7 B;  4AKR B;  3LFM A;  1CUN A;  2X9H A;  4XZC A;  5TAO A;  4CZZ B;  4C91 A;  4ZHQ E;  3LK3 B;  4P09 A;  4MHC A;  5AFU L;  1VOM A;  2WWU A;  4QXC B;  1U5P A;  1BR1 A;  1YD8 G;  4ISS A;  4OFZ A;  4IE7 A;  2Y8D A;  5L3E B;  4K0U A;  5LJN A;  5LGU B;  4KMC A;  4TX5 A;  4U74 A;  2RP4 A;  4IST A;  5JDM A;  2E9X C;  4V1A v;  3RC3 A;  4EYY R;  2X9X A;  4HN9 A;  3N9M A;  3QUJ A;  4EB6 E;  4EAH A;  5HWY A;  2X0L B;  4P0A A;  3RYF E;  4H9Q C;  4M1P A;  3O1J A;  3K8P C;  3Q5X A;  2CMR A;  3F31 A;  4TN7 B;  2P9B A;  1QSD A;  5LGT B;  3ANW B;  3C4W A;  4CI2 B;  1T98 A;  2K5B B;  2W63 A;  1BR0 A;  1D0Z A;  3AVS A;  3C4Z A;  4PJM A;  4I50 E;  5LG4 A;  2D2S A;  4AQG A;  3BQI A;  4GYS A;  4ANJ A;  3OYZ A;  2PG8 A;  4UVA B;  1YKE B;  2K24 A;  2WMN A;  2WAU A;  3B57 A;  3NRX A;  2JRK A;  3LG7 A;  3HKD E;  4EZH A;  1WRD A;  4NUV A;  4QWN B;  2K9A A;  1V9D A;  4MAL A;  2NP9 A;  2W61 A;  2YIN A;  2LSI A;  3AVR A;  2NW7 A;  3LK2 B;  4PK5 A;  4H63 H;  4QHO A;  5CB4 E;  2KT9 A;  2ODV A;  2V7J A;  3KIN B;  4X1I E;  2C5I T;  4DMW A;  3E08 A;  5JDL A;  3D0T A;  3J9X 1;  4ZI7 E;  3UUM A;  4ZI2 C;  3MA9 A;  4O4L E;  2HPJ A;  2YK0 A;  3RYH E;  1BR4 A;  2A3D A;  5H6Q B;  3L3P A;  4C90 A;  5JRE A;  2LOP A;  3VHL A;  4AXP A;  1SA0 E;  4UEM A;  2YU1 A;  3HL6 A;  3AA6 B;  4ILU A;  3ZYL A;  5L3F B;  4O4H E;  2MOZ A;  3FBL A;  3UTK A;  5CA0 E;  3R84 B;  4PAG A;  1QUU A;  2BDE A;  2CCQ A;  4AKL A;  4U72 A;  3SOL A;  4YFS A;  4YJ3 E;  4H9R C;  2XAS B;  4MFR A;  2Y48 B;  4OHF A;  5L3C B;  5BMV E;  2BZB A;  4O2A E;  4EOZ B;  3KV9 A;  4XBF B;  1ZV4 X;  5LNK A;  1MMD A;  2CM0 A;  5L2L A;  4OYK A;  4QXB B;  4UV9 B;  3BQK A;  2N1G A;  4UIG A;  4ZI3 C;  5DQW A;  3KFW X;  2OA5 A;  3ANW A;  3HI2 A;  5J2U E;  5LBM A;  1S94 A;  5KDM C;  1X79 A;  3CKD A;  2MBG A;  4AQF A;  1H7C A;  5DQV A;  2LHR A;  2J1D G;  1MIY A;  2X67 A;  3CQC B;  3UFE A;  4TV8 E;  4IGU A;  2ZM8 A;  5LGN B;  2W00 A;  1WYC A;  3QK6 A;  2XHE B;  5DJQ C;  2VKJ A;  3WAK A;  3L09 A;  3AA1 B;  2RA1 A;  3GMI A;  3N2O A;  4I43 B;  3ZN0 B;  2VAS A;  3RKO A;  2PJQ A;  4CXY A;  3B13 A;  3E0Z A;  5LHG B;  2Q9Q A;  4X1K E;  4I55 E;  2H7O A;  3ZCJ A;  2DI4 A;  4IIJ E;  2UXX B;  4DND A;  3KV5 A;  2ZM0 A;  5FY1 A;  1MIV A;  3RRC A;  5GON E;  2V7K A;  4E7S A;  3ZLI A;  2EHO D;  2LSK A;  5A1L A;  2YU2 A;  3PTR B;  3Q5W A;  5JDG A;  4I4T E;  2XAG B;  2LJL A;  3VKH A;  4NUU A;  2NW9 A;  2YEV C;  4YJ2 E;  3RRW A;  3JC6 C;  4JEH B;  3C4X A;  2X9Y A;  1G8X A;  1HFA A;  2CXD A;  4JLE A;  5JQG E;  2DWK A;  5CA1 E;  1FMW A;  2XAF B;  3T8O A;  1IAP A;  2Q9Q D;  2JMH A;  3AAI A;  4GOU A;  4DVD A;  4IE0 A;  4HGA A;  4IE4 A;  2WSS V;  1UCU A;  4BJM A;  2VL8 A;  5EK2 A;  3O9X A;  3PU3 A;  3PUR A;  1BR2 A;  5ADX L;  5DAB A;  2X9W A;  4OYJ A;  4PNI A;  3S4U A;  2L9Q A;  2DHR A;  3N2K E;  1HS7 A;  3SWH A;  2ACX A;  2CE7 A;  3ZEF B;  2KXP B;  4UF0 A;  2V7I A;  4UXN B;  3VKG A;  5JH7 E;  4AKG A;  2EHO B;  3C98 B;  3K3N A;  5FP3 A;  4HEA A;  2CLY C;  3ZMS B;  3N9N A;  4P0B A;  4ZOL E;  2QA7 A;  4X1Y E;  3RPU A;  1ZKE A;  4AKH A;  2ODU A;  4BA9 A;  1MIW A;  4DBQ A;  4Z8X A;  2QGS A;  3LBX B;  4L0R A;  3P8C D;  3CQX C;  5ETW A;  4CI3 B;  2Q9Q B;  3C64 A;  3MKD A;  3ZC1 A;  4EZ4 A;  3OYX A;  3HR0 A;  5L3D B;  3FHN A;  2W62 A;  4B6X A;  3KVB A;  3EDV A;  3LK4 2;  2MYS A;  5JR9 B;  2SPC A;  1MMN A;  2Z6E A;  4GIW A;  4GYR A;  3SRZ A;  3OJA A;  2D5U A;  2A2F X;  3N9P A;  3CQG B;  4H9O C;  2NOX A;  3UT5 E;  2XTL A;  4TV9 E;  4YLH A;  4IHJ E;  2NWB A;  3DJB A;  2IAK A;  5L3B B;  2KMF A;  3BQL A;  3NZP A;  3IHR A;  3PDY A;  4IE5 A;  1NAF A;  1G73 A;  1WLX A;  3CX6 B;  1UX4 A;  1HX8 A;  3I9Y A;  4HFV A;  4MBQ A;  2PFV A;  3MXZ A;  5H6R B;  3AAE B;  1MMG A;  2D0U A;  3E22 E;  5E0O A;  5LP6 E;  4FJO A;  4KUM B;  3UUL A;  1HG2 A;  2XAQ B;  4MLK A;  3VU7 H;  3I9W A;  2LSJ A;  2B1E A;  1LVK A;  5JDN A;  2DWG A;  4PFO A;  4AI6 A;  2KIN B;  1WYB A;  3K3Q C;  2XAJ B;  3N2G E;  4AQF C;  3EVY A;  3MZK B;  3UUN A;  3ETU A;  3KV6 A;  1LKX A;  2IC6 A;  1KK7 A;  2EHO A;  4UF0 B;  4UVB B;  5HXC A;  5JDQ A;  1D0Y A;  3RX6 A;  2V7M A;  2UXN B;  2CEA A;  5HAX A;  1E1H B;  3ZC0 A;  4ZI2 D;  2CXF A;  3LBX A;  3J7Y q;  3CWZ B;  2VKH A;  2WM9 A;  2Q9Q C;  4PJN A;  3PUS A;  1WR6 A;  2DCF A;  3CVR A;  3OBV E;  1OWA A;  1HCI A;  4JEU B;  1Y64 B;  5JR9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...