2NW9A

Crystal structure of tryptophan 2,3-dioxygenase (tdo) from xanthomonas campestris in complex with ferrous heme and 6-fluoro-tryptophan. northeast structural genomics target xcr13
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
265
structure length
265
Chain Sequence
GRLTYGGYLRLDQLLSAQQPLSEPAHHDEMLFIIQHQTSELWLKLLAHELRAAIVHLQRDEVWQCRKVLARSKQVLRQLTEQWSVLETLTPSEYMGFRDVLGPSSGFQSLQYRYIEFLLGNKNPQMLQVFAYDPAGQARLREVLEAPSLYEEFLRYLARFGHAIPQQYQARDWTAAHVADDTLRPVFERIYENTDRYWREYSLCEDLVDVETQFQLWRFRHMRTVMRVIGFKRGTGGSSGVGFLQQALALTFFPELFDVRTSVGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Tryptophan 2,3-dioxygenase
publication title Molecular insights into substrate recognition and catalysis by tryptophan 2,3-dioxygenase.
pubmed doi rcsb
source organism Xanthomonas campestris pv. campestris
total genus 110
structure length 265
sequence length 265
chains with identical sequence B
ec nomenclature ec 1.13.11.11: Tryptophan 2,3-dioxygenase.
pdb deposition date 2006-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03301 Trp_dioxygenase Tryptophan 2,3-dioxygenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.480 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2nw9A00
2NW8A 2V7MA 5EK3A 2NW9A 5EK4A 2NOXA 2X68A 2NW7A 2V7LA 3E08A 2D0UA 2NWBA 4U74A 4PW8A 5ETWA 1YW0A 2X66A 2D0TA 2X67A 5EK2A 4U72A 2V7KA 4PK5A 1ZEEA 2V7IA 3BK9A 4HKAA 4PK6A 2V7JA
chains in the Genus database with same CATH superfamily
1JNZA 1U4QA 3P4QA 1X79A 2V7MA 2E9XD 4NIQA 4EV6A 4X1KE 3KV5A 4XAXB 4DV1T 3I9YA 4WW0A 2L8KA 2XUEA 5AQOB 3O4XE 2KLQA 5LMNT 5CA0E 4LMKA 4P1NA 1MIYA 1LVFA 2J1DG 3ZYMA 1L0VA 2CBJA 1E7PA 2QGSA 3KBTA 2V5DA 2XAHB 4KI0F 3T1HT 3F2EA 5F8PA 1IBMT 2OA5A 3LBXA 3F57A 1E2AA 2V7KA 4LF7T 5F3JA 4YSZA 3RKGA 5JDLA 3ZMTB 3AE5A 3UUXB 2A3DA 1SUMB 3S4UA 4L0RA 1M7KA 5CB4E 4JUYA 5ETWA 1UCUA 2BG9A 3ZMUB 1FEWA 3I9WA 3CIRA 5L4HA 1KF6A 2V7IA 4U3CA 3HI2A 3ZCIA 4L9IA 4ILAA 2PTFA 1BR1A 4YTNA 2ZLYA 4U2YA 3EHZA 4X1YE 4YSXA 4JEUB 2WWVA 4Z91A 3CKDA 4O4JE 3EAMA 3N9NA 2K5BB 1IZNB 2IUBA 2XQYA 4HFVA 2W4XA 2UXXB 3EVYA 4QXHB 4QHOA 5LMUT 3QB5A 5HYAA 4DV4T 3PUSA 5ABFB 5DABA 3VU7H 3AE3A 2LE8A 2W00A 5DJQC 5IUXA 2HN2A 4IDNA 4JI2T 5L3EB 2BKNA 4I4TE 4JI1T 3H37A 3Q5EA 4TWFA 4ILBA 5HWXA 5LGUB 3C51A 4GKJT 2W63A 4V1Av 1MMNA 4AKGA 1AJ3A 1IBLT 4LF9T 3HKDE 5HEHA 5AQQB 3PUQA 2X0YA 5AQPB 1Y64B 3RQUA 1JNRA 3N9PA 1SE7A 3LG7A 4TX5A 3PV0F 3FZHB 4EGWA 4O2AE 4DUYT 3VKHA 2A2FX 1IJ5A 4G63A 1KNZA 2CXFA 2MOZA 1UX4A 3UUNA 1HF8A 2OLTA 3HKBE 4YTMA 3M3ZB 4I50E 3PE0A 4ADZA 4NXNT 4CXXA 3GN5A 1XNQT 2DLRA 4OYJA 2DHRA 4AISA 4B3MT 4X65T 3J9X1 2V8SV 3CMLA 2V6XA 2VQFT 3ZCJA 3SRZA 4TV8E 2X0LB 4DUZT 1VRBA 2MYSA 1FMVA 3IBPA 3ZPOA 3ESLA 2DCFA 3ZSSA 3ONLC 2WBLA 4PNIA 1UURA 1MMDA 2XTLA 2UXBT 2XQ9A 4EOZB 4CXYA 4IGUA 2D9DA 2ZM8A 5AQIB 4NUUA 2B76A 3TLSA 3PUAA 1YQ3A 2JRKA 3AXJB 3AE6A 4HEAA 3NRYA 2YK0A 2WMNA 1T98A 4HWIB 1VCTA 3SOLA 3FHNA 4LMLA 4GYRA 3O1JA 4ZS2A 4JI3T 4H9PC 4DV7T 1KEYA 1HX8A 5AQSB 5J1GA 4ZI7E 4AI6A 3AEBA 5CJ5A 3T1YT 4WYVA 4YT0A 4IE6A 5HCJA 1G73A 2YN6A 1IAPA 3UQ4A 4JBWF 2A9UA 3TKLB 4Q25A 4DV3T 2CCQA 5LBQB 3ZKRA 4PJMA 4ZI2C 5GONE 4U2ZA 5FY7A 2D0TA 1R8IA 2LSGA 2MBGA 2RP4A 4ASKA 2FJBA 2E5VA 3CQGB 3FXEB 4Z90A 1OEDC 3RIAA 2KSRA 4H9OC 4AKRB 3WAKA 2D0UA 4C90A 2CWYA 2FUPA 2XSBA 4U72A 2IDOB 4YHHT 3MACA 3L8RA 1HG2A 2WM9A 4H9RC 2XAFB 2F4VT 2FJAA 5LG4A 3NVOA 1XZYA 3TLWA 2W61A 2X9WA 4O8SA 1SA0E 1HS7A 4EIWA 2SPCA 4IL9A 3OPCA 3ZT5A 1KNPA 3C4XA 5LCYA 5JRCA 2BKPA 4PAGA 3E08A 1HG5A 2Y8DA 1BR2A 3CQXC 4TN7B 1WR0A 5JDFA 4DBQA 4HGAA 3N5LA 3J7Yq 5FL0A 4IREA 3PU3A 3SWHA 3Q5XA 3RRCA 4DR2T 2IAKA 4X64T 3AE1A 2DWKA 3PJAJ 2X68A 3O9XA 1J5WA 4ISTA 2V5CA 1HNWT 4EEBA 3MA9A 1NWMX 4B3ST 2K48A 2LLYA 2Q9QA 5LA6E 3ONJA 4HN9A 3RGLA 3D0TA 2FJDA 3CWZB 1B7TA 3G06A 3HKEE 5HXCA 1SHZC 2YOEA 4EZ4A 5EK2A 5LGNB 1FMWA 2E9XA 5ABGA 3MKDA 2XJ7A 3AA1B 3SFEA 5LHHB 5JDHA 3I1AA 2NTYA 4WBOA 3N2KE 1Z0PA 3EABA 4HWDA 3AAIA 1WCRA 4IDPA 5DQVA 1YW0A 4H9NC 2DNXA 3I0QA 2E5LT 2Z6EA 1YQ4A 2WDVA 1MNEA 4HFCA 5JH7E 4UELA 5AQVB 3GMIA 4P0BA 3UTKA 4AKIA 4P09A 3OVUA 1VCSA 5JQGE 4IDZA 5JDGA 4IT4A 1UX5A 4ZI3C 2YKSA 2V6YA 3AVSA 2X9HA 4I0UA 5LHGB 2VVNA 3AEFA 2VL8A 4CQIA 4ZHQE 4DMVA 2H88A 4X5TA 5LGTB 2LOSA 2CEAA 1HNXT 4KP3C 2WSSV 4COFA 4LF4T 1HTJF 2X9XA 5KXJA 3UU5A 2R6GF 4OK0A 1QSDA 3AECA 2ZMAA 4UVCB 2L3LA 2NW7A 2XASB 3ONXA 3ZLIA 5L3CB 2JMKA 3RKOA 4AQGA 2IC6A 5ADXL 1UGOA 2XY8B 2XQ5A 5AQNB 1WLXA 2CM0A 3EUHA 1XMQT 3FZMB 5LNKA 5F5WA 2EHOC 2LM9A 2X66A 1J1JA 3VRAA 3AAEB 3U3IA 4PK5A 1ZEEA 5JR9A 4OX9T 4DNDA 4PFOA 4UVAB 2MTQA 3I0OA 3Q9DA 4EAHA 4YY3T 4DR4T 3DP7A 1ZHCA 4HFIA 4O4LE 4YTPA 4IDOA 3N9MA 2QA7A 4A98A 1S94A 3ETUA 3RIFA 3ZT7A 3AE8A 3A8YC 4AKLA 3K3NA 3Q2MA 4I43B 5HXRA 2BVLA 1MNDA 1OEDB 2LT3A 2I59A 3P8CD 5FP3A 2XAJB 2XQ4A 1W0AA 5FVLA 4X66T 2D2SA 3PURA 2VK9A 2V1DB 3RIUC 3ZJ1A 4DV5T 5J0ZA 2YINA 3O1IA 3AE9A 4FJOA 3MZKB 4DR6T 4E7ZA 5FXVA 2MPKA 4XZCA 4ISSA 5L3BB 4CI1B 3GN5B 3L09A 3N2OA 5HXHA 1WR6A 2VKOA 4U7YA 1OXZA 1W9RA 2H7OA 4IE7A 5EZYE 2VKDA 1G8XA 3ANWB 2WMOA 2W62A 4HKAA 3QC9A 3FZLB 3RC3A 1ZP0A 3Q5WA 3RYHE 2CXLA 2LKHA 3W15B 2KINB 1WYBA 1LRZA 2VQET 3AE7A 1I6ZA 3AB3B 4CI3B 3BK9A 4Z8XA 5J2TE 4TV9E 3PDYA 3RPUA 5L2LA 4A56A 3OJAA 1HX1B 3C4ZA 2VURA 1UK5A 3BQIA 2LSJA 3JC6C 3GA8A 1Y01A 3RI5A 3E0ZA 2ZM0A 4DR7T 3C50A 5CA1E 4LF6T 2BZBA 4AXPA 3PUVF 2DL1A 4AIUA 2CLYC 3EDVA 3FBLA 2GK9A 1BR4A 2CRBA 1W0BA 1US7B 3K8PC 4P0AA 3KV9A 5ABFA 2CXDA 4MFRA 3JAEA 2PBIA 2E8IA 3KBUA 4O4HE 1HFAA 4ZI2D 2KNDA 1W09A 4TWHA 4L5GA 4O2BE 3AVRA 4EYYR 5FMNA 2DWGA 2DI4A 3NWIA 4LF8T 2BBJA 5LXTE 5LHIB 2J47A 4ZZCA 3PUZF 4JI6T 5AQKB 3FBZA 4B3RT 1N36T 5EK3A 2LRLA 4EZHA 3MXZA 5AQGB 4CXWA 2FJEA 1YKHB 4HWCA 4QH5A 3UQ7A 5BR8T 3AEGA 4H63V 4UEMA 2HPLA 3CQCB 2IC9A 4UXNB 3CX8B 2ODUA 4X62T 3FB2A 4LFBT 3QUJA 2JQ9A 5IHYA 5HWYA 3OTOT 4B6XA 1ZKEA 3RF1A 4UVBB 3AA0B 4FI5A 3RC8A 1XDPA 1D0XA 3OYZA 5KDMC 2V26A 2LHRA 2BVMA 4AQFA 3IA3A 3RYCE 2LSKA 3RX6A 2WAUA 2EHOB 4TNVA 4M1PA 5AQFB 2QYWA 5FL1A 2E2AA 3L3PA 3NBXX 4QWNB 2CBIA 1D1AA 4UIGA 5FYMA 1T8BA 4C91A 4QXCB 2Q9QB 2XQ6A 4ERRA 2BDEA 2PJQA 5JVDE 2MAWA 2NOXA 3AXJA 3T8OA 1HR0T 3P4RA 2VL0A 2QVAA 5KX5E 1VOMA 3P4PA 3N9LA 2E9XB 3KV4A 2N1GA 5HXEA 4QH1A 2LJLA 4ZZBA 4K0KT 4KHZF 2RPAA 4GK5E 4GYSA 3UFEA 2W67A 4ZOLE 4QX8B 1LVKA 2I6HA 3ZN0B 4HFHA 4OFZA 5LOVE 2X9YA 4KUMB 2NTXA 3ZJ2A 4AKHA 2UXNB 2AXDS 1N33T 4HFBA 2W2UA 5FKYA 3JADA 2YDQA 3CX6B 4ZI3D 4H9SE 3A7MA 2OV9A 2V6YB 2M67A 1V9DA 4U31A 3NRXA 2X67A 1KNRA 4XBFB 2M6IA 5C8YE 2L9QA 4UF0B 2V7JA 1NENA 1OEDE 2CPTA 5LB7B 3CPZA 2J62A 2KZ7B 4QH4A 2YU2A 3O1HA 3KFWX 1N34T 2BKOA 5HEJA 2KWHA 4JI8T 2VASA 2UUBT 2LSIA 3LK3B 3PUWF 1EZ3A 3WI3A 5IWAT 1KK7A 1M62A 2BS4A 3QB5K 4MBQA 4HTEA 4MALA 1KFYA 5LJNA 3ZN1B 2A72A 3L39A 2YDSA 4N78D 4UV9B 2WU2A 2UUCT 3DTOA 2EHOD 3LBXB 3E22E 3JAFA 5JDQA 4QXBB 2CLYB 4NPPA 4JI0T 2XAGB 3U78A 2CHNA 2LEHA 1HNZT 4JI5T 2LOPA 3R84B 2XQ8A 3AE4A 3LSVA 2BG9B 4YLHA 1LKXA 5L3FB 3SS1A 3HKCE 4TWDA 3PUXF 3IEEA 2NR4A 4TZ4C 3CX7B 3K3OA 2JQKA 2NWBA 4ILCA 5IYZE 2WS3A 2BBHA 3ZC1A 1MMAA 4PJNA 3VRBA 1NEKA 5AQTB 5JTGA 2ACZA 1D0ZA 3UU4A 3NZQA 3RRWA 5ABHA 4YHJA 4A97A 2WZIA 3NZPA 3C64A 4PW8A 3QOFA 2KT9A 3AEEA 2LRKA 3BQKA 3ZEFB 1DU2A 2B1EA 2PFVA 2ACXA 5JDMA 5A1LA 2BS2A 1MMGA 2XPKA 5C3JA 4LF5T 3ZC0A 4CN6A 3UUMA 2WY2A 3MK7C 3ZMZB 2CE7A 2G0UA 2IHR1 2Q9QC 2BS3A 3AEDA 4JYAT 4G2AA 3OYXA 3AAAB 2XHEB 2JPFA 3ZT6A 3PUGA 4JV5T 1BR0A 1S35A 3RYFE 1WRDA 4KBMB 3R6NA 5HCMA 2E9XC 1N32T 2WQYA 2JMHA 4H63H 4MHCA 4DIDB 1IBKT 1OWAA 3VKGA 3CVRA 4PJLA 3ZYLA 4YJ3E 4TNWA 5M4YA 5AQLB 5L3GB 1H7CA 1WFDA 2UU9T 3ZMSB 3AA7B 1U5PA 3WAJA 4B3TT 4YXDA 3V5SA 3JC6D 4DR3T 4DR5T 4CN4A 3ZSTA 3Q5DA 3KV6A 4PJJA 4IL4A 5HAXA 4JLEA 3TLUA 3B5MA 4CN1A 3TLVA 3NKZA 4GOUA 4CI2B 3N2GE 4EEDA 2CWOA 3UU8A 5FNVE 4EB6E 2VB6A 2PG8A 1QUUA 3IHRA 4JI7T 2Y48B 4KMCA 5DQWA 3SFDA 1D1BA 5FXXA 3RLFF 5LYJE 3MJXA 5HEGA 3EDUA 2KMFA 3AE2A 3OBVE 1Z8UA 3A5XA 4U74A 3IF8B 5AQJB 5KMGP 3B57A 3H3AA 4DVDA 4UV8B 2WDRA 1UUSA 4J2CA 4LFCT 4IDQA 2XAQB 2H3RA 3AA6B 2UXDT 1YKEB 5FY1A 2C5JA 5FXZA 2J4GA 4HFDA 4YSYA 4YJ2E 1OEDA 4ILUA 2ODVA 5L4EA 4UR9A 4DV2T 3P50A 5H6QB 3KVBA 3ABVA 4DV6T 3RHWA 3DJBA 3LK42 3N9OA 5FXWA 1MIVA 5CGMA 2W0GA 1MIWA 4MLKA 2HHHT 3UU3A 3RYIE 2FBWA 5JR9C 3UT5E 3TLTA 2HPJA 4WNKA 3ZMVB 1O3XA 2C0SA 5HEOA 3LJCA 2P9BA 2LSYA 1T72A 5J2UE 5AQMB 3LFMA 3C98B 2BG9C 4EYUA 2NW9A 2K3WA 2V7LA 4WZXA 2IIUA 4YFSA 3C4WA 4OHFA 3GWHA 4DV0T 3PUYF 2CMRA 4IE0A 3ANWA 5L3DB 4AQYT 3PU8A 4TUYE 2N2NA 2WP9A 1XMOT 2VVSA 3UFGA 1XWMA 2D5UA 3FZKB 4LMJA 3H3MA 3QNUA 3ZYKA 2YU1A 2HN1A 1YXRA 1XNRT 4F8HA 4ANJA 5AQUB 3K3QC 4PK6A 3ETVA 2WZHA 5HXSA 4GKKT 4O4IE 2W66A 3P4SA 4DR1T 3RH3A 2JQQA 4DO0A 5LBMA 4IHJE 2C5IT 2LKGA 5H6RB 4GK0E 4HWFA 2CHOA 2LHNA 2M6BA 5JRCB 4K0UA 4HE8A 4EXTA 2UUAT 5AQHB 5C2TA 5CFBA 2YEVC 4IIJE 2IW5B 3KVAA 2JIWA 2UXCT 3LDQB 5HEUA 2BG9E 4DBRA 2WCAA 4U7IA 4DMWA 1D0YA 4OYKA 2H7VC 1CUNA 2YDRA 4KHPT 5FVKA 1NAFA 2WB5A 3PJAA 3KINB 5LP6E 2KWIB 4JEHB 2VKJA 2KXPB 4BJMA 4H9QC 4I55E 5LG3A 4F6RC 5LJMA 1IJ6A 4IE5A 3VHLA 5AFUL 4KX6A 4E7SA 2N9DA 3CK6A 4PK4A 4IE4A 1YD8G 3HR0A 5L47A 4GIWA 2NP9A 2HH7A 3JCFA 3BQLA 2VWAA 2K24A 1HCIA 2XM2A 3UULA 2I0MA 4LFAT 1J5ET 3VR9A 2XZEA 3EI0A 3X1DA 2CA5A 2XSAA 2WU5A 3K1SA 3UUBA 4ZEYA 1FJGT 5E0OA 3OKQA 3M65A 2EHOA 2JQHA 3F31A 1T7SA 2NW8A 4HFEA 4CZZB 5ABEA 1D1CA 2VKHA 5TAOA 3V5UA 1CHUA 3B13A 2XQ3A 3QK6A 3PTRB 2LM2A 1X9BA 2ZM6T 1FIOA 4ZS3A 2C5KT 4HWHA 3VR8A 3HA4A 2IMLA 5JDNA 4A5XA 2XM1A 5EK4A 4QX7B 4X20E 4BA9A 1ZOYA 4ZXLA 2K9AA 2JJ9A 2X51A 5BMVE 2X0HA 2XQAA 1E1HB 4BJNA 4JI4T 1WYCA 2RA1A 3AEAA 5JREA 4AQFC 3FZFB 4NXMT 1GQEA 1XDOA 3P4WA 2H89A 3RIUA 2QRXA 3FXDB 5JR9B 1ZV4X 3RQWA 4U33A 3P7IA 3LK2B 4X1IE 3KDSE 5AQRB 4QKNA 2Q9QD 2WDQA 2AE9A 3UU6A 3N9QA 4WBNE 2Y6XA 3HL6A 4NUVA 5FY0A 4PFPA 1I94T 1QLBA 2ES0A 2ZM2A 2XQ7A 4UF0A 4BAYB 2WWUA
chains in the Genus database with same CATH topology
1U4QA 4JLEA 3FBZA 5LCYA 1X79A 2V7MA 5EK3A 2E9XD 4EZHA 3MXZA 4GOUA 4X1KE 5JRCA 3KV5A 4XAXB 4CI2B 4CXWA 3N2GE 4PAGA 3E08A 2CWOA 1YKHB 3I9YA 4WW0A 5FNVE 1HG5A 2Y8DA 1BR2A 4EB6E 2VB6A 3CQXC 4TN7B 2L8KA 2PG8A 5JDFA 4H63V 4UEMA 1QUUA 3IHRA 4DBQA 4HGAA 2XUEA 3N5LA 2Y48B 3J7Yq 2HPLA 3CQCB 3PU3A 4KMCA 3O4XE 2KLQA 3Q5XA 2IC9A 4UXNB 5DQWA 3SWHA 5CA0E 3CX8B 1D1BA 5FXXA 5LYJE 2ODUA 3RRCA 1MIYA 2IAKA 3MJXA 2DWKA 1LVFA 2J1DG 2X68A 3ZYMA 3O9XA 3EDUA 2KMFA 3FB2A 3OBVE 4U74A 3A5XA 4ISTA 3IF8B 3MA9A 2QGSA 5KMGP 3KBTA 3QUJA 1NWMX 3B57A 3H3AA 5IHYA 4DVDA 5HWYA 4UV8B 2XAHB 4B6XA 2K48A 3F2EA 2Q9QA 5F8PA 1ZKEA 4J2CA 2XAQB 2H3RA 4HN9A 3AA6B 4UVBB 5LA6E 3AA0B 3D0TA 4FI5A 1YKEB 2OA5A 3RC8A 5FY1A 2C5JA 5FXZA 1D0XA 3CWZB 1B7TA 3OYZA 3LBXA 3F57A 5KDMC 2V26A 2LHRA 3HKEE 4ILUA 4YJ2E 2BVMA 5HXCA 1SHZC 4AQFA 4EZ4A 5EK2A 5LGNB 3RYCE 2ODVA 2LSKA 1FMWA 2E9XA 2V7KA 5F3JA 3RX6A 2WAUA 2EHOB 3MKDA 5JDLA 5H6QB 3KVBA 3ZMTB 3AA1B 5LHHB 5JDHA 3DJBA 3UUXB 4M1PA 3LK42 3I1AA 3N9OA 2NTYA 2A3DA 4WBOA 3N2KE 1Z0PA 5FXWA 3S4UA 4L0RA 1MIVA 2W0GA 1MIWA 3AAIA 3L3PA 5CB4E 4MLKA 3NBXX 5DQVA 4QWNB 3RYIE 4JUYA 5ETWA 1YW0A 4H9NC 1D1AA 1UCUA 2DNXA 4UIGA 5FYMA 3ZMUB 5JR9C 1FEWA 3I0QA 3UT5E 2Z6EA 4C91A 3I9WA 2HPJA 4WNKA 3ZMVB 4QXCB 1O3XA 2C0SA 3LJCA 2P9BA 2Q9QB 1MNEA 2LSYA 2V7IA 3HI2A 5JH7E 4UELA 3ZCIA 4ERRA 2BDEA 3GMIA 4L9IA 2PJQA 4P0BA 3UTKA 5J2UE 4AKIA 3LFMA 3C98B 5JVDE 4EYUA 4P09A 1BR1A 2NW9A 2NOXA 3T8OA 5JQGE 4IDZA 5JDGA 2V7LA 4ZI3C 1UX5A 4YFSA 2ZLYA 5KX5E 3C4WA 3AVSA 1VOMA 2X9HA 3GWHA 4OHFA 4X1YE 5LHGB 3N9LA 2E9XB 3KV4A 2N1GA 4JEUB 2CMRA 2VL8A 3CKDA 4IE0A 4O4JE 4CQIA 3N9NA 2K5BB 3ANWA 5HXEA 5L3DB 2LJLA 1IZNB 2XQYA 3PU8A 4TUYE 4HFVA 2N2NA 4GK5E 2UXXB 4ZHQE 4GYSA 3UFEA 4DMVA 4ZOLE 3EVYA 4QX8B 1LVKA 5LGTB 3ZN0B 2D5UA 3ZYKA 2YU1A 4OFZA 4QXHB 5LOVE 4QHOA 2LOSA 5HYAA 2CEAA 2X9YA 4ANJA 3PUSA 4KUMB 2NTXA 3ZJ2A 5DABA 4KP3C 4AKHA 2UXNB 2WSSV 3K3QC 3VU7H 1HTJF 2X9XA 2LE8A 4PK6A 2W00A 3ETVA 4OK0A 5DJQC 5L3EB 1QSDA 5HXSA 4O4IE 2ZMAA 4UVCB 3CX6B 4ZI3D 2L3LA 2NW7A 2XASB 4H9SE 4I4TE 3ONXA 3RH3A 3H37A 2JQQA 2M67A 1V9DA 3ZLIA 5L3CB 2JMKA 3RKOA 4AQGA 5HWXA 3NRXA 5LGUB 2X67A 4DO0A 5LBMA 4XBFB 2IC6A 3C51A 5ADXL 4IHJE 2W63A 4V1Av 2C5IT 5H6RB 5C8YE 1MMNA 2L9QA 4AKGA 1AJ3A 4GK0E 4UF0B 1WLXA 2V7JA 2CM0A 3HKDE 2LHNA 3EUHA 3PUQA 5JRCB 1Y64B 4K0UA 5LNKA 4HE8A 3N9PA 2EHOC 4EXTA 2LM9A 2X66A 3CPZA 2KZ7B 3LG7A 2YU2A 3AAEB 3O1HA 3KFWX 4TX5A 3U3IA 2YEVC 4IIJE 4PK5A 2IW5B 1ZEEA 2KWHA 2VASA 3KVAA 5JR9A 2LSIA 3LK3B 4O2AE 4DNDA 1EZ3A 3WI3A 3VKHA 4PFOA 4UVAB 4DBRA 2MTQA 3I0OA 3Q9DA 4EAHA 4DMWA 1D0YA 2A2FX 2H7VC 4OYKA 1CUNA 1KK7A 1IJ5A 3DP7A 1ZHCA 4G63A 1KNZA 4MBQA 4HTEA 2CXFA 4O4LE 1NAFA 3N9MA 4MALA 3KINB 5LJNA 2KWIB 2MOZA 5LP6E 1UX4A 4JEHB 3ZN1B 2QA7A 1HF8A 2KXPB 2VKJA 3UUNA 3HKBE 4BJMA 2A72A 1S94A 3ETUA 4I50E 3PE0A 4N78D 4UV9B 4ADZA 4H9QC 4I55E 4F6RC 3DTOA 5LJMA 4CXXA 1IJ6A 4AKLA 4IE5A 3GN5A 3K3NA 2DLRA 4OYJA 2EHOD 3LBXB 2DHRA 3Q2MA 2BVLA 4I43B 5HXRA 3VHLA 3E22E 1MNDA 5AFUL 4E7SA 2N9DA 3J9X1 4QXBB 5JDQA 2CLYB 3CMLA 2LT3A 4PK4A 4IE4A 1YD8G 2I59A 3HR0A 3P8CD 3ZCJA 5FP3A 2XAJB 2XAGB 3U78A 3SRZA 4TV8E 2X0LB 4GIWA 1VRBA 2LEHA 2NP9A 2LOPA 2MYSA 2HH7A 2D2SA 3PURA 2VK9A 3R84B 3BQLA 2VWAA 2K24A 1FMVA 2V1DB 3IBPA 3ZPOA 3ESLA 2DCFA 3ZJ1A 1HCIA 2WBLA 4PNIA 4YLHA 1MMDA 1LKXA 2XTLA 5L3FB 2YINA 3UULA 4EOZB 3O1IA 3SS1A 4FJOA 3HKCE 4CXYA 3MZKB 4IGUA 4E7ZA 2ZM8A 5FXVA 4XZCA 4NUUA 4ISSA 3IEEA 5L3BB 4CI1B 2CA5A 4TZ4C 3GN5B 3L09A 3PUAA 2JRKA 3N2OA 5HXHA 3CX7B 3K3OA 2NWBA 4HEAA 1WR6A 2VKOA 3NRYA 2YK0A 2WMNA 1T98A 1OXZA 5IYZE 3SOLA 3FHNA 2H7OA 1MMAA 4IE7A 5EZYE 3ZC1A 2VKDA 4GYRA 3O1JA 4PJNA 5E0OA 3OKQA 3M65A 4ZS2A 2EHOA 1G8XA 3ANWB 4H9PC 2WMOA 2W62A 3F31A 4HKAA 1HX8A 1D0ZA 3QC9A 5J1GA 4ZI7E 2NW8A 3RC3A 3Q5WA 3NZQA 3RRWA 4CZZB 3RYHE 4AI6A 4YHJA 2CXLA 1D1CA 2VKHA 5TAOA 3NZPA 3V5UA 3B13A 3W15B 3C64A 2KINB 4PW8A 2KT9A 1WYBA 1LRZA 3BQKA 3QK6A 4IE6A 3PTRB 3ZEFB 1FIOA 3AB3B 2B1EA 4CI3B 2PFVA 4ZS3A 1G73A 2C5KT 2ACXA 3BK9A 5JDMA 5A1LA 4Z8XA 1MMGA 5J2TE 1IAPA 3TKLB 3ZC0A 4TV9E 3HA4A 3PDYA 3UUMA 5JDNA 2CCQA 3RPUA 5L2LA 5EK4A 3OJAA 4A56A 4QX7B 3MK7C 3ZMZB 5LBQB 2CE7A 4X20E 4BA9A 3C4ZA 2G0UA 4PJMA 5GONE 4ZI2C 2K9AA 2JJ9A 2X51A 3BQIA 5FY7A 2Q9QC 2LSJA 5BMVE 2D0TA 3JC6C 2LSGA 4G2AA 2MBGA 3GA8A 2RP4A 4ASKA 1E1HB 4BJNA 3OYXA 1WYCA 3E0ZA 3AAAB 2RA1A 2ZM0A 2XHEB 3C50A 2JPFA 5CA1E 2BZBA 3PUGA 4AXPA 3CQGB 3FXEB 1BR0A 1S35A 5JREA 4H9OC 3RYFE 1WRDA 2CLYC 4AKRB 4AQFC 4KBMB 3R6NA 2E9XC 3EDVA 3FBLA 3WAKA 2GK9A 2D0UA 4C90A 1BR4A 2JMHA 2CWYA 1US7B 4H63H 4MHCA 4U72A 3K8PC 4P0AA 1OWAA 3KV9A 3VKGA 3MACA 3CVRA 4PJLA 1HG2A 3ZYLA 4YJ3E 2CXDA 3FXDB 4MFRA 5JR9B 2PBIA 1ZV4X 2E8IA 2WM9A 4H9RC 2XAFB 5M4YA 5L3GB 5LG4A 1H7CA 3P7IA 3LK2B 4X1IE 3KBUA 3ZMSB 4O4HE 2W61A 3KDSE 1HFAA 4ZI2D 2X9WA 3AA7B 1U5PA 2KNDA 4QKNA 2Q9QD 3WAJA 3V5SA 3JC6D 4L5GA 4O8SA 3N9QA 1SA0E 3AVRA 4O2BE 1HS7A 4WBNE 4EYYR 2Y6XA 3HL6A 2DWGA 4NUVA 2DI4A 5FMNA 5FY0A 4EIWA 2SPCA 4PFPA 3KV6A 5LXTE 5LHIB 2ES0A 2ZM2A 3C4XA 4PJJA 4UF0A 4BAYB 5HAXA 2WWUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NW8 A;  2V7M A;  5EK3 A;  2NW9 A;  5EK4 A;  2NOX A;  2X68 A;  2NW7 A;  2V7L A;  3E08 A;  2D0U A;  2NWB A;  4U74 A;  4PW8 A;  5ETW A;  1YW0 A;  2X66 A;  2D0T A;  2X67 A;  5EK2 A;  4U72 A;  2V7K A;  4PK5 A;  1ZEE A;  2V7I A;  3BK9 A;  4HKA A;  4PK6 A;  2V7J A; 
#chains in the Genus database with same CATH topology
 1JNZ A;  1U4Q A;  3P4Q A;  1X79 A;  2V7M A;  2E9X D;  4NIQ A;  4EV6 A;  4X1K E;  3KV5 A;  4XAX B;  4DV1 T;  3I9Y A;  4WW0 A;  2L8K A;  2XUE A;  5AQO B;  3O4X E;  2KLQ A;  5LMN T;  5CA0 E;  4LMK A;  4P1N A;  1MIY A;  1LVF A;  2J1D G;  3ZYM A;  1L0V A;  2CBJ A;  1E7P A;  2QGS A;  3KBT A;  2V5D A;  2XAH B;  4KI0 F;  3T1H T;  3F2E A;  5F8P A;  1IBM T;  2OA5 A;  3LBX A;  3F57 A;  1E2A A;  2V7K A;  4LF7 T;  5F3J A;  4YSZ A;  3RKG A;  5JDL A;  3ZMT B;  3AE5 A;  3UUX B;  2A3D A;  1SUM B;  3S4U A;  4L0R A;  1M7K A;  5CB4 E;  4JUY A;  5ETW A;  1UCU A;  2BG9 A;  3ZMU B;  1FEW A;  3I9W A;  3CIR A;  5L4H A;  1KF6 A;  2V7I A;  4U3C A;  3HI2 A;  3ZCI A;  4L9I A;  4ILA A;  2PTF A;  1BR1 A;  4YTN A;  2ZLY A;  4U2Y A;  3EHZ A;  4X1Y E;  4YSX A;  4JEU B;  2WWV A;  4Z91 A;  3CKD A;  4O4J E;  3EAM A;  3N9N A;  2K5B B;  1IZN B;  2IUB A;  2XQY A;  4HFV A;  2W4X A;  2UXX B;  3EVY A;  4QXH B;  4QHO A;  5LMU T;  3QB5 A;  5HYA A;  4DV4 T;  3PUS A;  5ABF B;  5DAB A;  3VU7 H;  3AE3 A;  2LE8 A;  2W00 A;  5DJQ C;  5IUX A;  2HN2 A;  4IDN A;  4JI2 T;  5L3E B;  2BKN A;  4I4T E;  4JI1 T;  3H37 A;  3Q5E A;  4TWF A;  4ILB A;  5HWX A;  5LGU B;  3C51 A;  4GKJ T;  2W63 A;  4V1A v;  1MMN A;  4AKG A;  1AJ3 A;  1IBL T;  4LF9 T;  3HKD E;  5HEH A;  5AQQ B;  3PUQ A;  2X0Y A;  5AQP B;  1Y64 B;  3RQU A;  1JNR A;  3N9P A;  1SE7 A;  3LG7 A;  4TX5 A;  3PV0 F;  3FZH B;  4EGW A;  4O2A E;  4DUY T;  3VKH A;  2A2F X;  1IJ5 A;  4G63 A;  1KNZ A;  2CXF A;  2MOZ A;  1UX4 A;  3UUN A;  1HF8 A;  2OLT A;  3HKB E;  4YTM A;  3M3Z B;  4I50 E;  3PE0 A;  4ADZ A;  4NXN T;  4CXX A;  3GN5 A;  1XNQ T;  2DLR A;  4OYJ A;  2DHR A;  4AIS A;  4B3M T;  4X65 T;  3J9X 1;  2V8S V;  3CML A;  2V6X A;  2VQF T;  3ZCJ A;  3SRZ A;  4TV8 E;  2X0L B;  4DUZ T;  1VRB A;  2MYS A;  1FMV A;  3IBP A;  3ZPO A;  3ESL A;  2DCF A;  3ZSS A;  3ONL C;  2WBL A;  4PNI A;  1UUR A;  1MMD A;  2XTL A;  2UXB T;  2XQ9 A;  4EOZ B;  4CXY A;  4IGU A;  2D9D A;  2ZM8 A;  5AQI B;  4NUU A;  2B76 A;  3TLS A;  3PUA A;  1YQ3 A;  2JRK A;  3AXJ B;  3AE6 A;  4HEA A;  3NRY A;  2YK0 A;  2WMN A;  1T98 A;  4HWI B;  1VCT A;  3SOL A;  3FHN A;  4LML A;  4GYR A;  3O1J A;  4ZS2 A;  4JI3 T;  4H9P C;  4DV7 T;  1KEY A;  1HX8 A;  5AQS B;  5J1G A;  4ZI7 E;  4AI6 A;  3AEB A;  5CJ5 A;  3T1Y T;  4WYV A;  4YT0 A;  4IE6 A;  5HCJ A;  1G73 A;  2YN6 A;  1IAP A;  3UQ4 A;  4JBW F;  2A9U A;  3TKL B;  4Q25 A;  4DV3 T;  2CCQ A;  5LBQ B;  3ZKR A;  4PJM A;  4ZI2 C;  5GON E;  4U2Z A;  5FY7 A;  2D0T A;  1R8I A;  2LSG A;  2MBG A;  2RP4 A;  4ASK A;  2FJB A;  2E5V A;  3CQG B;  3FXE B;  4Z90 A;  1OED C;  3RIA A;  2KSR A;  4H9O C;  4AKR B;  3WAK A;  2D0U A;  4C90 A;  2CWY A;  2FUP A;  2XSB A;  4U72 A;  2IDO B;  4YHH T;  3MAC A;  3L8R A;  1HG2 A;  2WM9 A;  4H9R C;  2XAF B;  2F4V T;  2FJA A;  5LG4 A;  3NVO A;  1XZY A;  3TLW A;  2W61 A;  2X9W A;  4O8S A;  1SA0 E;  1HS7 A;  4EIW A;  2SPC A;  4IL9 A;  3OPC A;  3ZT5 A;  1KNP A;  3C4X A;  5LCY A;  5JRC A;  2BKP A;  4PAG A;  3E08 A;  1HG5 A;  2Y8D A;  1BR2 A;  3CQX C;  4TN7 B;  1WR0 A;  5JDF A;  4DBQ A;  4HGA A;  3N5L A;  3J7Y q;  5FL0 A;  4IRE A;  3PU3 A;  3SWH A;  3Q5X A;  3RRC A;  4DR2 T;  2IAK A;  4X64 T;  3AE1 A;  2DWK A;  3PJA J;  2X68 A;  3O9X A;  1J5W A;  4IST A;  2V5C A;  1HNW T;  4EEB A;  3MA9 A;  1NWM X;  4B3S T;  2K48 A;  2LLY A;  2Q9Q A;  5LA6 E;  3ONJ A;  4HN9 A;  3RGL A;  3D0T A;  2FJD A;  3CWZ B;  1B7T A;  3G06 A;  3HKE E;  5HXC A;  1SHZ C;  2YOE A;  4EZ4 A;  5EK2 A;  5LGN B;  1FMW A;  2E9X A;  5ABG A;  3MKD A;  2XJ7 A;  3AA1 B;  3SFE A;  5LHH B;  5JDH A;  3I1A A;  2NTY A;  4WBO A;  3N2K E;  1Z0P A;  3EAB A;  4HWD A;  3AAI A;  1WCR A;  4IDP A;  5DQV A;  1YW0 A;  4H9N C;  2DNX A;  3I0Q A;  2E5L T;  2Z6E A;  1YQ4 A;  2WDV A;  1MNE A;  4HFC A;  5JH7 E;  4UEL A;  5AQV B;  3GMI A;  4P0B A;  3UTK A;  4AKI A;  4P09 A;  3OVU A;  1VCS A;  5JQG E;  4IDZ A;  5JDG A;  4IT4 A;  1UX5 A;  4ZI3 C;  2YKS A;  2V6Y A;  3AVS A;  2X9H A;  4I0U A;  5LHG B;  2VVN A;  3AEF A;  2VL8 A;  4CQI A;  4ZHQ E;  4DMV A;  2H88 A;  4X5T A;  5LGT B;  2LOS A;  2CEA A;  1HNX T;  4KP3 C;  2WSS V;  4COF A;  4LF4 T;  1HTJ F;  2X9X A;  5KXJ A;  3UU5 A;  2R6G F;  4OK0 A;  1QSD A;  3AEC A;  2ZMA A;  4UVC B;  2L3L A;  2NW7 A;  2XAS B;  3ONX A;  3ZLI A;  5L3C B;  2JMK A;  3RKO A;  4AQG A;  2IC6 A;  5ADX L;  1UGO A;  2XY8 B;  2XQ5 A;  5AQN B;  1WLX A;  2CM0 A;  3EUH A;  1XMQ T;  3FZM B;  5LNK A;  5F5W A;  2EHO C;  2LM9 A;  2X66 A;  1J1J A;  3VRA A;  3AAE B;  3U3I A;  4PK5 A;  1ZEE A;  5JR9 A;  4OX9 T;  4DND A;  4PFO A;  4UVA B;  2MTQ A;  3I0O A;  3Q9D A;  4EAH A;  4YY3 T;  4DR4 T;  3DP7 A;  1ZHC A;  4HFI A;  4O4L E;  4YTP A;  4IDO A;  3N9M A;  2QA7 A;  4A98 A;  1S94 A;  3ETU A;  3RIF A;  3ZT7 A;  3AE8 A;  3A8Y C;  4AKL A;  3K3N A;  3Q2M A;  4I43 B;  5HXR A;  2BVL A;  1MND A;  1OED B;  2LT3 A;  2I59 A;  3P8C D;  5FP3 A;  2XAJ B;  2XQ4 A;  1W0A A;  5FVL A;  4X66 T;  2D2S A;  3PUR A;  2VK9 A;  2V1D B;  3RIU C;  3ZJ1 A;  4DV5 T;  5J0Z A;  2YIN A;  3O1I A;  3AE9 A;  4FJO A;  3MZK B;  4DR6 T;  4E7Z A;  5FXV A;  2MPK A;  4XZC A;  4ISS A;  5L3B B;  4CI1 B;  3GN5 B;  3L09 A;  3N2O A;  5HXH A;  1WR6 A;  2VKO A;  4U7Y A;  1OXZ A;  1W9R A;  2H7O A;  4IE7 A;  5EZY E;  2VKD A;  1G8X A;  3ANW B;  2WMO A;  2W62 A;  4HKA A;  3QC9 A;  3FZL B;  3RC3 A;  1ZP0 A;  3Q5W A;  3RYH E;  2CXL A;  2LKH A;  3W15 B;  2KIN B;  1WYB A;  1LRZ A;  2VQE T;  3AE7 A;  1I6Z A;  3AB3 B;  4CI3 B;  3BK9 A;  4Z8X A;  5J2T E;  4TV9 E;  3PDY A;  3RPU A;  5L2L A;  4A56 A;  3OJA A;  1HX1 B;  3C4Z A;  2VUR A;  1UK5 A;  3BQI A;  2LSJ A;  3JC6 C;  3GA8 A;  1Y01 A;  3RI5 A;  3E0Z A;  2ZM0 A;  4DR7 T;  3C50 A;  5CA1 E;  4LF6 T;  2BZB A;  4AXP A;  3PUV F;  2DL1 A;  4AIU A;  2CLY C;  3EDV A;  3FBL A;  2GK9 A;  1BR4 A;  2CRB A;  1W0B A;  1US7 B;  3K8P C;  4P0A A;  3KV9 A;  5ABF A;  2CXD A;  4MFR A;  3JAE A;  2PBI A;  2E8I A;  3KBU A;  4O4H E;  1HFA A;  4ZI2 D;  2KND A;  1W09 A;  4TWH A;  4L5G A;  4O2B E;  3AVR A;  4EYY R;  5FMN A;  2DWG A;  2DI4 A;  3NWI A;  4LF8 T;  2BBJ A;  5LXT E;  5LHI B;  2J47 A;  4ZZC A;  3PUZ F;  4JI6 T;  5AQK B;  3FBZ A;  4B3R T;  1N36 T;  5EK3 A;  2LRL A;  4EZH A;  3MXZ A;  5AQG B;  4CXW A;  2FJE A;  1YKH B;  4HWC A;  4QH5 A;  3UQ7 A;  5BR8 T;  3AEG A;  4H63 V;  4UEM A;  2HPL A;  3CQC B;  2IC9 A;  4UXN B;  3CX8 B;  2ODU A;  4X62 T;  3FB2 A;  4LFB T;  3QUJ A;  2JQ9 A;  5IHY A;  5HWY A;  3OTO T;  4B6X A;  1ZKE A;  3RF1 A;  4UVB B;  3AA0 B;  4FI5 A;  3RC8 A;  1XDP A;  1D0X A;  3OYZ A;  5KDM C;  2V26 A;  2LHR A;  2BVM A;  4AQF A;  3IA3 A;  3RYC E;  2LSK A;  3RX6 A;  2WAU A;  2EHO B;  4TNV A;  4M1P A;  5AQF B;  2QYW A;  5FL1 A;  2E2A A;  3L3P A;  3NBX X;  4QWN B;  2CBI A;  1D1A A;  4UIG A;  5FYM A;  1T8B A;  4C91 A;  4QXC B;  2Q9Q B;  2XQ6 A;  4ERR A;  2BDE A;  2PJQ A;  5JVD E;  2MAW A;  2NOX A;  3AXJ A;  3T8O A;  1HR0 T;  3P4R A;  2VL0 A;  2QVA A;  5KX5 E;  1VOM A;  3P4P A;  3N9L A;  2E9X B;  3KV4 A;  2N1G A;  5HXE A;  4QH1 A;  2LJL A;  4ZZB A;  4K0K T;  4KHZ F;  2RPA A;  4GK5 E;  4GYS A;  3UFE A;  2W67 A;  4ZOL E;  4QX8 B;  1LVK A;  2I6H A;  3ZN0 B;  4HFH A;  4OFZ A;  5LOV E;  2X9Y A;  4KUM B;  2NTX A;  3ZJ2 A;  4AKH A;  2UXN B;  2AXD S;  1N33 T;  4HFB A;  2W2U A;  5FKY A;  3JAD A;  2YDQ A;  3CX6 B;  4ZI3 D;  4H9S E;  3A7M A;  2OV9 A;  2V6Y B;  2M67 A;  1V9D A;  4U31 A;  3NRX A;  2X67 A;  1KNR A;  4XBF B;  2M6I A;  5C8Y E;  2L9Q A;  4UF0 B;  2V7J A;  1NEN A;  1OED E;  2CPT A;  5LB7 B;  3CPZ A;  2J62 A;  2KZ7 B;  4QH4 A;  2YU2 A;  3O1H A;  3KFW X;  1N34 T;  2BKO A;  5HEJ A;  2KWH A;  4JI8 T;  2VAS A;  2UUB T;  2LSI A;  3LK3 B;  3PUW F;  1EZ3 A;  3WI3 A;  5IWA T;  1KK7 A;  1M62 A;  2BS4 A;  3QB5 K;  4MBQ A;  4HTE A;  4MAL A;  1KFY A;  5LJN A;  3ZN1 B;  2A72 A;  3L39 A;  2YDS A;  4N78 D;  4UV9 B;  2WU2 A;  2UUC T;  3DTO A;  2EHO D;  3LBX B;  3E22 E;  3JAF A;  5JDQ A;  4QXB B;  2CLY B;  4NPP A;  4JI0 T;  2XAG B;  3U78 A;  2CHN A;  2LEH A;  1HNZ T;  4JI5 T;  2LOP A;  3R84 B;  2XQ8 A;  3AE4 A;  3LSV A;  2BG9 B;  4YLH A;  1LKX A;  5L3F B;  3SS1 A;  3HKC E;  4TWD A;  3PUX F;  3IEE A;  2NR4 A;  4TZ4 C;  3CX7 B;  3K3O A;  2JQK A;  2NWB A;  4ILC A;  5IYZ E;  2WS3 A;  2BBH A;  3ZC1 A;  1MMA A;  4PJN A;  3VRB A;  1NEK A;  5AQT B;  5JTG A;  2ACZ A;  1D0Z A;  3UU4 A;  3NZQ A;  3RRW A;  5ABH A;  4YHJ A;  4A97 A;  2WZI A;  3NZP A;  3C64 A;  4PW8 A;  3QOF A;  2KT9 A;  3AEE A;  2LRK A;  3BQK A;  3ZEF B;  1DU2 A;  2B1E A;  2PFV A;  2ACX A;  5JDM A;  5A1L A;  2BS2 A;  1MMG A;  2XPK A;  5C3J A;  4LF5 T;  3ZC0 A;  4CN6 A;  3UUM A;  2WY2 A;  3MK7 C;  3ZMZ B;  2CE7 A;  2G0U A;  2IHR 1;  2Q9Q C;  2BS3 A;  3AED A;  4JYA T;  4G2A A;  3OYX A;  3AAA B;  2XHE B;  2JPF A;  3ZT6 A;  3PUG A;  4JV5 T;  1BR0 A;  1S35 A;  3RYF E;  1WRD A;  4KBM B;  3R6N A;  5HCM A;  2E9X C;  1N32 T;  2WQY A;  2JMH A;  4H63 H;  4MHC A;  4DID B;  1IBK T;  1OWA A;  3VKG A;  3CVR A;  4PJL A;  3ZYL A;  4YJ3 E;  4TNW A;  5M4Y A;  5AQL B;  5L3G B;  1H7C A;  1WFD A;  2UU9 T;  3ZMS B;  3AA7 B;  1U5P A;  3WAJ A;  4B3T T;  4YXD A;  3V5S A;  3JC6 D;  4DR3 T;  4DR5 T;  4CN4 A;  3ZST A;  3Q5D A;  3KV6 A;  4PJJ A;  4IL4 A;  5HAX A;  4JLE A;  3TLU A;  3B5M A;  4CN1 A;  3TLV A;  3NKZ A;  4GOU A;  4CI2 B;  3N2G E;  4EED A;  2CWO A;  3UU8 A;  5FNV E;  4EB6 E;  2VB6 A;  2PG8 A;  1QUU A;  3IHR A;  4JI7 T;  2Y48 B;  4KMC A;  5DQW A;  3SFD A;  1D1B A;  5FXX A;  3RLF F;  5LYJ E;  3MJX A;  5HEG A;  3EDU A;  2KMF A;  3AE2 A;  3OBV E;  1Z8U A;  3A5X A;  4U74 A;  3IF8 B;  5AQJ B;  5KMG P;  3B57 A;  3H3A A;  4DVD A;  4UV8 B;  2WDR A;  1UUS A;  4J2C A;  4LFC T;  4IDQ A;  2XAQ B;  2H3R A;  3AA6 B;  2UXD T;  1YKE B;  5FY1 A;  2C5J A;  5FXZ A;  2J4G A;  4HFD A;  4YSY A;  4YJ2 E;  1OED A;  4ILU A;  2ODV A;  5L4E A;  4UR9 A;  4DV2 T;  3P50 A;  5H6Q B;  3KVB A;  3ABV A;  4DV6 T;  3RHW A;  3DJB A;  3LK4 2;  3N9O A;  5FXW A;  1MIV A;  5CGM A;  2W0G A;  1MIW A;  4MLK A;  2HHH T;  3UU3 A;  3RYI E;  2FBW A;  5JR9 C;  3UT5 E;  3TLT A;  2HPJ A;  4WNK A;  3ZMV B;  1O3X A;  2C0S A;  5HEO A;  3LJC A;  2P9B A;  2LSY A;  1T72 A;  5J2U E;  5AQM B;  3LFM A;  3C98 B;  2BG9 C;  4EYU A;  2NW9 A;  2K3W A;  2V7L A;  4WZX A;  2IIU A;  4YFS A;  3C4W A;  4OHF A;  3GWH A;  4DV0 T;  3PUY F;  2CMR A;  4IE0 A;  3ANW A;  5L3D B;  4AQY T;  3PU8 A;  4TUY E;  2N2N A;  2WP9 A;  1XMO T;  2VVS A;  3UFG A;  1XWM A;  2D5U A;  3FZK B;  4LMJ A;  3H3M A;  3QNU A;  3ZYK A;  2YU1 A;  2HN1 A;  1YXR A;  1XNR T;  4F8H A;  4ANJ A;  5AQU B;  3K3Q C;  4PK6 A;  3ETV A;  2WZH A;  5HXS A;  4GKK T;  4O4I E;  2W66 A;  3P4S A;  4DR1 T;  3RH3 A;  2JQQ A;  4DO0 A;  5LBM A;  4IHJ E;  2C5I T;  2LKG A;  5H6R B;  4GK0 E;  4HWF A;  2CHO A;  2LHN A;  2M6B A;  5JRC B;  4K0U A;  4HE8 A;  4EXT A;  2UUA T;  5AQH B;  5C2T A;  5CFB A;  2YEV C;  4IIJ E;  2IW5 B;  3KVA A;  2JIW A;  2UXC T;  3LDQ B;  5HEU A;  2BG9 E;  4DBR A;  2WCA A;  4U7I A;  4DMW A;  1D0Y A;  4OYK A;  2H7V C;  1CUN A;  2YDR A;  4KHP T;  5FVK A;  1NAF A;  2WB5 A;  3PJA A;  3KIN B;  5LP6 E;  2KWI B;  4JEH B;  2VKJ A;  2KXP B;  4BJM A;  4H9Q C;  4I55 E;  5LG3 A;  4F6R C;  5LJM A;  1IJ6 A;  4IE5 A;  3VHL A;  5AFU L;  4KX6 A;  4E7S A;  2N9D A;  3CK6 A;  4PK4 A;  4IE4 A;  1YD8 G;  3HR0 A;  5L47 A;  4GIW A;  2NP9 A;  2HH7 A;  3JCF A;  3BQL A;  2VWA A;  2K24 A;  1HCI A;  2XM2 A;  3UUL A;  2I0M A;  4LFA T;  1J5E T;  3VR9 A;  2XZE A;  3EI0 A;  3X1D A;  2CA5 A;  2XSA A;  2WU5 A;  3K1S A;  3UUB A;  4ZEY A;  1FJG T;  5E0O A;  3OKQ A;  3M65 A;  2EHO A;  2JQH A;  3F31 A;  1T7S A;  2NW8 A;  4HFE A;  4CZZ B;  5ABE A;  1D1C A;  2VKH A;  5TAO A;  3V5U A;  1CHU A;  3B13 A;  2XQ3 A;  3QK6 A;  3PTR B;  2LM2 A;  1X9B A;  2ZM6 T;  1FIO A;  4ZS3 A;  2C5K T;  4HWH A;  3VR8 A;  3HA4 A;  2IML A;  5JDN A;  4A5X A;  2XM1 A;  5EK4 A;  4QX7 B;  4X20 E;  4BA9 A;  1ZOY A;  4ZXL A;  2K9A A;  2JJ9 A;  2X51 A;  5BMV E;  2X0H A;  2XQA A;  1E1H B;  4BJN A;  4JI4 T;  1WYC A;  2RA1 A;  3AEA A;  5JRE A;  4AQF C;  3FZF B;  4NXM T;  1GQE A;  1XDO A;  3P4W A;  2H89 A;  3RIU A;  2QRX A;  3FXD B;  5JR9 B;  1ZV4 X;  3RQW A;  4U33 A;  3P7I A;  3LK2 B;  4X1I E;  3KDS E;  5AQR B;  4QKN A;  2Q9Q D;  2WDQ A;  2AE9 A;  3UU6 A;  3N9Q A;  4WBN E;  2Y6X A;  3HL6 A;  4NUV A;  5FY0 A;  4PFP A;  1I94 T;  1QLB A;  2ES0 A;  2ZM2 A;  2XQ7 A;  4UF0 A;  4BAY B;  2WWU A; 
#chains in the Genus database with same CATH homology
 1U4Q A;  4JLE A;  3FBZ A;  5LCY A;  1X79 A;  2V7M A;  5EK3 A;  2E9X D;  4EZH A;  3MXZ A;  4GOU A;  4X1K E;  5JRC A;  3KV5 A;  4XAX B;  4CI2 B;  4CXW A;  3N2G E;  4PAG A;  3E08 A;  2CWO A;  1YKH B;  3I9Y A;  4WW0 A;  5FNV E;  1HG5 A;  2Y8D A;  1BR2 A;  4EB6 E;  2VB6 A;  3CQX C;  4TN7 B;  2L8K A;  2PG8 A;  5JDF A;  4H63 V;  4UEM A;  1QUU A;  3IHR A;  4DBQ A;  4HGA A;  2XUE A;  3N5L A;  2Y48 B;  3J7Y q;  2HPL A;  3CQC B;  3PU3 A;  4KMC A;  3O4X E;  2KLQ A;  3Q5X A;  2IC9 A;  4UXN B;  5DQW A;  3SWH A;  5CA0 E;  3CX8 B;  1D1B A;  5FXX A;  5LYJ E;  2ODU A;  3RRC A;  1MIY A;  2IAK A;  3MJX A;  2DWK A;  1LVF A;  2J1D G;  2X68 A;  3ZYM A;  3O9X A;  3EDU A;  2KMF A;  3FB2 A;  3OBV E;  4U74 A;  3A5X A;  4IST A;  3IF8 B;  3MA9 A;  2QGS A;  5KMG P;  3KBT A;  3QUJ A;  1NWM X;  3B57 A;  3H3A A;  5IHY A;  4DVD A;  5HWY A;  4UV8 B;  2XAH B;  4B6X A;  2K48 A;  3F2E A;  2Q9Q A;  5F8P A;  1ZKE A;  4J2C A;  2XAQ B;  2H3R A;  4HN9 A;  3AA6 B;  4UVB B;  5LA6 E;  3AA0 B;  3D0T A;  4FI5 A;  1YKE B;  2OA5 A;  3RC8 A;  5FY1 A;  2C5J A;  5FXZ A;  1D0X A;  3CWZ B;  1B7T A;  3OYZ A;  3LBX A;  3F57 A;  5KDM C;  2V26 A;  2LHR A;  3HKE E;  4ILU A;  4YJ2 E;  2BVM A;  5HXC A;  1SHZ C;  4AQF A;  4EZ4 A;  5EK2 A;  5LGN B;  3RYC E;  2ODV A;  2LSK A;  1FMW A;  2E9X A;  2V7K A;  5F3J A;  3RX6 A;  2WAU A;  2EHO B;  3MKD A;  5JDL A;  5H6Q B;  3KVB A;  3ZMT B;  3AA1 B;  5LHH B;  5JDH A;  3DJB A;  3UUX B;  4M1P A;  3LK4 2;  3I1A A;  3N9O A;  2NTY A;  2A3D A;  4WBO A;  3N2K E;  1Z0P A;  5FXW A;  3S4U A;  4L0R A;  1MIV A;  2W0G A;  1MIW A;  3AAI A;  3L3P A;  5CB4 E;  4MLK A;  3NBX X;  5DQV A;  4QWN B;  3RYI E;  4JUY A;  5ETW A;  1YW0 A;  4H9N C;  1D1A A;  1UCU A;  2DNX A;  4UIG A;  5FYM A;  3ZMU B;  5JR9 C;  1FEW A;  3I0Q A;  3UT5 E;  2Z6E A;  4C91 A;  3I9W A;  2HPJ A;  4WNK A;  3ZMV B;  4QXC B;  1O3X A;  2C0S A;  3LJC A;  2P9B A;  2Q9Q B;  1MNE A;  2LSY A;  2V7I A;  3HI2 A;  5JH7 E;  4UEL A;  3ZCI A;  4ERR A;  2BDE A;  3GMI A;  4L9I A;  2PJQ A;  4P0B A;  3UTK A;  5J2U E;  4AKI A;  3LFM A;  3C98 B;  5JVD E;  4EYU A;  4P09 A;  1BR1 A;  2NW9 A;  2NOX A;  3T8O A;  5JQG E;  4IDZ A;  5JDG A;  2V7L A;  4ZI3 C;  1UX5 A;  4YFS A;  2ZLY A;  5KX5 E;  3C4W A;  3AVS A;  1VOM A;  2X9H A;  3GWH A;  4OHF A;  4X1Y E;  5LHG B;  3N9L A;  2E9X B;  3KV4 A;  2N1G A;  4JEU B;  2CMR A;  2VL8 A;  3CKD A;  4IE0 A;  4O4J E;  4CQI A;  3N9N A;  2K5B B;  3ANW A;  5HXE A;  5L3D B;  2LJL A;  1IZN B;  2XQY A;  3PU8 A;  4TUY E;  4HFV A;  2N2N A;  4GK5 E;  2UXX B;  4ZHQ E;  4GYS A;  3UFE A;  4DMV A;  4ZOL E;  3EVY A;  4QX8 B;  1LVK A;  5LGT B;  3ZN0 B;  2D5U A;  3ZYK A;  2YU1 A;  4OFZ A;  4QXH B;  5LOV E;  4QHO A;  2LOS A;  5HYA A;  2CEA A;  2X9Y A;  4ANJ A;  3PUS A;  4KUM B;  2NTX A;  3ZJ2 A;  5DAB A;  4KP3 C;  4AKH A;  2UXN B;  2WSS V;  3K3Q C;  3VU7 H;  1HTJ F;  2X9X A;  2LE8 A;  4PK6 A;  2W00 A;  3ETV A;  4OK0 A;  5DJQ C;  5L3E B;  1QSD A;  5HXS A;  4O4I E;  2ZMA A;  4UVC B;  3CX6 B;  4ZI3 D;  2L3L A;  2NW7 A;  2XAS B;  4H9S E;  4I4T E;  3ONX A;  3RH3 A;  3H37 A;  2JQQ A;  2M67 A;  1V9D A;  3ZLI A;  5L3C B;  2JMK A;  3RKO A;  4AQG A;  5HWX A;  3NRX A;  5LGU B;  2X67 A;  4DO0 A;  5LBM A;  4XBF B;  2IC6 A;  3C51 A;  5ADX L;  4IHJ E;  2W63 A;  4V1A v;  2C5I T;  5H6R B;  5C8Y E;  1MMN A;  2L9Q A;  4AKG A;  1AJ3 A;  4GK0 E;  4UF0 B;  1WLX A;  2V7J A;  2CM0 A;  3HKD E;  2LHN A;  3EUH A;  3PUQ A;  5JRC B;  1Y64 B;  4K0U A;  5LNK A;  4HE8 A;  3N9P A;  2EHO C;  4EXT A;  2LM9 A;  2X66 A;  3CPZ A;  2KZ7 B;  3LG7 A;  2YU2 A;  3AAE B;  3O1H A;  3KFW X;  4TX5 A;  3U3I A;  2YEV C;  4IIJ E;  4PK5 A;  2IW5 B;  1ZEE A;  2KWH A;  2VAS A;  3KVA A;  5JR9 A;  2LSI A;  3LK3 B;  4O2A E;  4DND A;  1EZ3 A;  3WI3 A;  3VKH A;  4PFO A;  4UVA B;  4DBR A;  2MTQ A;  3I0O A;  3Q9D A;  4EAH A;  4DMW A;  1D0Y A;  2A2F X;  2H7V C;  4OYK A;  1CUN A;  1KK7 A;  1IJ5 A;  3DP7 A;  1ZHC A;  4G63 A;  1KNZ A;  4MBQ A;  4HTE A;  2CXF A;  4O4L E;  1NAF A;  3N9M A;  4MAL A;  3KIN B;  5LJN A;  2KWI B;  2MOZ A;  5LP6 E;  1UX4 A;  4JEH B;  3ZN1 B;  2QA7 A;  1HF8 A;  2KXP B;  2VKJ A;  3UUN A;  3HKB E;  4BJM A;  2A72 A;  1S94 A;  3ETU A;  4I50 E;  3PE0 A;  4N78 D;  4UV9 B;  4ADZ A;  4H9Q C;  4I55 E;  4F6R C;  3DTO A;  5LJM A;  4CXX A;  1IJ6 A;  4AKL A;  4IE5 A;  3GN5 A;  3K3N A;  2DLR A;  4OYJ A;  2EHO D;  3LBX B;  2DHR A;  3Q2M A;  2BVL A;  4I43 B;  5HXR A;  3VHL A;  3E22 E;  1MND A;  5AFU L;  4E7S A;  2N9D A;  3J9X 1;  4QXB B;  5JDQ A;  2CLY B;  3CML A;  2LT3 A;  4PK4 A;  4IE4 A;  1YD8 G;  2I59 A;  3HR0 A;  3P8C D;  3ZCJ A;  5FP3 A;  2XAJ B;  2XAG B;  3U78 A;  3SRZ A;  4TV8 E;  2X0L B;  4GIW A;  1VRB A;  2LEH A;  2NP9 A;  2LOP A;  2MYS A;  2HH7 A;  2D2S A;  3PUR A;  2VK9 A;  3R84 B;  3BQL A;  2VWA A;  2K24 A;  1FMV A;  2V1D B;  3IBP A;  3ZPO A;  3ESL A;  2DCF A;  3ZJ1 A;  1HCI A;  2WBL A;  4PNI A;  4YLH A;  1MMD A;  1LKX A;  2XTL A;  5L3F B;  2YIN A;  3UUL A;  4EOZ B;  3O1I A;  3SS1 A;  4FJO A;  3HKC E;  4CXY A;  3MZK B;  4IGU A;  4E7Z A;  2ZM8 A;  5FXV A;  4XZC A;  4NUU A;  4ISS A;  3IEE A;  5L3B B;  4CI1 B;  2CA5 A;  4TZ4 C;  3GN5 B;  3L09 A;  3PUA A;  2JRK A;  3N2O A;  5HXH A;  3CX7 B;  3K3O A;  2NWB A;  4HEA A;  1WR6 A;  2VKO A;  3NRY A;  2YK0 A;  2WMN A;  1T98 A;  1OXZ A;  5IYZ E;  3SOL A;  3FHN A;  2H7O A;  1MMA A;  4IE7 A;  5EZY E;  3ZC1 A;  2VKD A;  4GYR A;  3O1J A;  4PJN A;  5E0O A;  3OKQ A;  3M65 A;  4ZS2 A;  2EHO A;  1G8X A;  3ANW B;  4H9P C;  2WMO A;  2W62 A;  3F31 A;  4HKA A;  1HX8 A;  1D0Z A;  3QC9 A;  5J1G A;  4ZI7 E;  2NW8 A;  3RC3 A;  3Q5W A;  3NZQ A;  3RRW A;  4CZZ B;  3RYH E;  4AI6 A;  4YHJ A;  2CXL A;  1D1C A;  2VKH A;  5TAO A;  3NZP A;  3V5U A;  3B13 A;  3W15 B;  3C64 A;  2KIN B;  4PW8 A;  2KT9 A;  1WYB A;  1LRZ A;  3BQK A;  3QK6 A;  4IE6 A;  3PTR B;  3ZEF B;  1FIO A;  3AB3 B;  2B1E A;  4CI3 B;  2PFV A;  4ZS3 A;  1G73 A;  2C5K T;  2ACX A;  3BK9 A;  5JDM A;  5A1L A;  4Z8X A;  1MMG A;  5J2T E;  1IAP A;  3TKL B;  3ZC0 A;  4TV9 E;  3HA4 A;  3PDY A;  3UUM A;  5JDN A;  2CCQ A;  3RPU A;  5L2L A;  5EK4 A;  3OJA A;  4A56 A;  4QX7 B;  3MK7 C;  3ZMZ B;  5LBQ B;  2CE7 A;  4X20 E;  4BA9 A;  3C4Z A;  2G0U A;  4PJM A;  5GON E;  4ZI2 C;  2K9A A;  2JJ9 A;  2X51 A;  3BQI A;  5FY7 A;  2Q9Q C;  2LSJ A;  5BMV E;  2D0T A;  3JC6 C;  2LSG A;  4G2A A;  2MBG A;  3GA8 A;  2RP4 A;  4ASK A;  1E1H B;  4BJN A;  3OYX A;  1WYC A;  3E0Z A;  3AAA B;  2RA1 A;  2ZM0 A;  2XHE B;  3C50 A;  2JPF A;  5CA1 E;  2BZB A;  3PUG A;  4AXP A;  3CQG B;  3FXE B;  1BR0 A;  1S35 A;  5JRE A;  4H9O C;  3RYF E;  1WRD A;  2CLY C;  4AKR B;  4AQF C;  4KBM B;  3R6N A;  2E9X C;  3EDV A;  3FBL A;  3WAK A;  2GK9 A;  2D0U A;  4C90 A;  1BR4 A;  2JMH A;  2CWY A;  1US7 B;  4H63 H;  4MHC A;  4U72 A;  3K8P C;  4P0A A;  1OWA A;  3KV9 A;  3VKG A;  3MAC A;  3CVR A;  4PJL A;  1HG2 A;  3ZYL A;  4YJ3 E;  2CXD A;  3FXD B;  4MFR A;  5JR9 B;  2PBI A;  1ZV4 X;  2E8I A;  2WM9 A;  4H9R C;  2XAF B;  5M4Y A;  5L3G B;  5LG4 A;  1H7C A;  3P7I A;  3LK2 B;  4X1I E;  3KBU A;  3ZMS B;  4O4H E;  2W61 A;  3KDS E;  1HFA A;  4ZI2 D;  2X9W A;  3AA7 B;  1U5P A;  2KND A;  4QKN A;  2Q9Q D;  3WAJ A;  3V5S A;  3JC6 D;  4L5G A;  4O8S A;  3N9Q A;  1SA0 E;  3AVR A;  4O2B E;  1HS7 A;  4WBN E;  4EYY R;  2Y6X A;  3HL6 A;  2DWG A;  4NUV A;  2DI4 A;  5FMN A;  5FY0 A;  4EIW A;  2SPC A;  4PFP A;  3KV6 A;  5LXT E;  5LHI B;  2ES0 A;  2ZM2 A;  3C4X A;  4PJJ A;  4UF0 A;  4BAY B;  5HAX A;  2WWU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...