2NW9A

Crystal structure of tryptophan 2,3-dioxygenase (tdo) from xanthomonas campestris in complex with ferrous heme and 6-fluoro-tryptophan. northeast structural genomics target xcr13
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
265
structure length
265
Chain Sequence
GRLTYGGYLRLDQLLSAQQPLSEPAHHDEMLFIIQHQTSELWLKLLAHELRAAIVHLQRDEVWQCRKVLARSKQVLRQLTEQWSVLETLTPSEYMGFRDVLGPSSGFQSLQYRYIEFLLGNKNPQMLQVFAYDPAGQARLREVLEAPSLYEEFLRYLARFGHAIPQQYQARDWTAAHVADDTLRPVFERIYENTDRYWREYSLCEDLVDVETQFQLWRFRHMRTVMRVIGFKRGTGGSSGVGFLQQALALTFFPELFDVRTSVGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tryptophan 2,3-dioxygenase
publication title Molecular insights into substrate recognition and catalysis by tryptophan 2,3-dioxygenase.
pubmed doi rcsb
source organism Xanthomonas campestris pv. campestris
molecule tags Oxidoreductase
total genus 110
structure length 265
sequence length 265
chains with identical sequence B
ec nomenclature ec 1.13.11.11: Tryptophan 2,3-dioxygenase.
pdb deposition date 2006-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03301 Trp_dioxygenase Tryptophan 2,3-dioxygenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.480 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2nw9A00
5EK3A 2V7LA 4PK5A 2V7MA 3E08A 2NWBA 2D0TA 2NW7A 1ZEEA 4U72A 2NW9A 2V7KA 5EK2A 2X68A 2NOXA 2X66A 2NW8A 5EK4A 4U74A 4PK6A 5ETWA 4HKAA 1YW0A 4PW8A 2D0UA 2V7IA 2X67A 2V7JA 3BK9A
chains in the Genus database with same CATH superfamily
4ADZA 2XM1A 2CLYC 2YEVC 3CPZA 1M62A 3P7IA 3I0OA 3P4PA 5IWAT 5HCJA 1LRZA 3HKDE 3ZYMA 3KINB 3S4UA 4IT4A 5L3EB 4ISSA 2CLYB 2WCAA 4HTEA 1BR0A 4IE7A 4DR3T 3SOLA 3O9XA 2D9DA 3ZCJA 5EK2A 4ZI3D 4JI2T 1N33T 3PUGA 5LA6E 5ABEA 2FUPA 1HG2A 3CQCB 5FY7A 5C2TA 2WMOA 5F5WA 2L8KA 3SWHA 2XTLA 4MHCA 2JMKA 3R84B 4KX6A 2IMLA 4A98A 2F4VT 1IAPA 2PG8A 3PUVF 3VR9A 1OEDE 2LSKA 2H88A 1ZEEA 4JBWF 5IUXA 2JPFA 2MYSA 5CA1E 4GKKT 2C5JA 2LKHA 3BQLA 3HKEE 1QUUA 3KBUA 3PU3A 2WQYA 5FY1A 2ZM2A 3AEAA 3KVBA 4DV5T 3N2KE 1T8BA 4HWCA 4QKNA 3ZSTA 4AQFA 3DP7A 2BKNA 1XDPA 2WZIA 4I4TE 4EOZB 1OXZA 4YSYA 3AAAB 3RF1A 3LSVA 4E7SA 1R8IA 4EIWA 2YKSA 4UVBB 2LRKA 2XQ7A 2MTQA 4EXTA 2A2FX 4QWNB 5AQTB 5E0OA 2PBIA 3ESLA 1D0YA 3LK3B 2CHOA 3J7Yq 3PUXF 4ZOLE 3RYIE 4DV2T 2MPKA 3ZYKA 3ZSSA 2W4XA 4LFAT 4UXNB 2HHHT 4BJNA 3SS1A 3AEDA 5L4HA 3ZEFB 4DMVA 2J1DG 1W0AA 2W0GA 4PNIA 2V26A 2V6YB 4IDQA 4CN1A 2LM2A 2YDRA 3ZN0B 4ZS2A 2SPCA 2CA5A 4M1PA 4A5XA 2VB6A 3Q5WA 4CI1B 3PDYA 4LMLA 3C64A 3CX7B 4DR5T 2IDOB 2DLRA 4PJNA 4K0UA 3CK6A 4BA9A 2E9XC 2ODVA 2QVAA 2DWKA 3L09A 4JEUB 2LLYA 3C50A 1FMVA 3ANWB 3DTOA 4GK5E 1U4QA 3OBVE 3Q5XA 2E9XB 4CZZB 4DV7T 4AKHA 5JDMA 4DR2T 2VURA 1IJ6A 2FJBA 1NEKA 4HFBA 3UUMA 4YJ3E 1WR0A 2D0UA 1WYBA 3FZHB 4ZZCA 3AE7A 2V7LA 3RKOA 3AEGA 5AQNB 4X64T 2X66A 1UX5A 1VRBA 2DCFA 1EZ3A 3HKCE 5DQVA 2E5LT 4UF0B 3UULA 4HFEA 1J5ET 2UUBT 4I55E 4ILBA 5KXJA 4C91A 4A97A 3EAMA 2JJ9A 5AQJB 5IYZE 1WFDA 3M3ZB 1CHUA 4LFCT 2UUAT 4DIDB 4UELA 1KK7A 3AVRA 4IHJE 1US7B 1UX4A 4N78D 3RIUA 2OA5A 4HGAA 4CI3B 3IHRA 3Q5EA 5CB4E 3RC3A 4LFBT 3JCFA 3E22E 4GK0E 5HXCA 5HWYA 3A7MA 1LKXA 5AQUB 2LHRA 5HXRA 2LSIA 1S94A 4KHPT 2DHRA 3UU3A 3FB2A 3AECA 2X51A 5CGMA 3PV0F 1FIOA 4UR9A 3AXJB 1YW0A 4AKIA 5GONE 3WI3A 4CQIA 2CEAA 2I0MA 4B3TT 5FL0A 1HNZT 5HAXA 4E7ZA 3RX6A 1WRDA 2VVSA 3GWHA 2K24A 4UV9B 4U3CA 1T98A 1U5PA 4F8HA 4JEHB 2VKDA 1MIVA 2YU2A 2JRKA 2XSAA 4TUYE 5LXTE 3K1SA 3AE9A 3U78A 2C0SA 2AXDS 3SFDA 3KV6A 5AQLB 1Y64B 3AE3A 4JI5T 4WW0A 3UU6A 1I94T 2DWGA 4I50E 4P09A 5JQGE 5FVKA 4PAGA 3P4QA 2V1DB 4H9SE 2YOEA 1LVFA 4AKLA 5EZYE 3O1HA 4WNKA 5KMGP 5AQQB 2XY8B 5HCMA 2QA7A 3MK7C 3QNUA 4MFRA 2L9QA 3A8YC 4TWDA 1UCUA 1ZP0A 4EYYR 2WMNA 2WDVA 2HN1A 3N9QA 2NR4A 3C98B 1H7CA 3AA1B 1XDOA 5F3JA 4GKJT 5LP6E 3Q2MA 4YT0A 2LOSA 4DV6T 5LG3A 4IREA 3J9X1 3ANWA 4I0UA 4DR1T 3X1DA 3SFEA 4OX9T 3AA7B 5AQMB 2V7MA 3E08A 5LHIB 5LGTB 4X1YE 2KLQA 2JQQA 4PJLA 4ZI7E 2NW9A 1W9RA 4EAHA 3QC9A 5LBQB 2J62A 2K9AA 4K0KT 2WY2A 2IHR1 2KWHA 2JIWA 3QOFA 2IW5B 2WWUA 4GYRA 3SRZA 2ACZA 4JI0T 3MACA 3KV4A 4AXPA 4WBNE 2A72A 3ABVA 3MA9A 4EZHA 2DNXA 3PJAA 1HX1B 4H9OC 2E2AA 4NIQA 1W0BA 4O4JE 2XM2A 3EVYA 4HFVA 4UF0A 2B1EA 1XNQT 5KX5E 1O3XA 2N2NA 4HWIB 5FXVA 2BG9A 2XASB 2XQ3A 4PFOA 4TN7B 4EEBA 5ABFB 4KBMB 2HH7A 3RLFF 2NTYA 4WYVA 3RIFA 4FJOA 2CHNA 3ZMUB 3PUQA 2M6IA 3UFGA 1L0VA 2LSJA 3FXEB 1IBKT 4PFPA 3PE0A 3CIRA 3RIUC 4DUZT 4DV4T 4QH4A 1V9DA 2BDEA 1WR6A 1HTJF 1IBMT 4IDNA 4H9QC 4FI5A 2CXFA 3TLTA 4AKGA 3NZQA 5J0ZA 4NUUA 2XAHB 4AQGA 5LNKA 3IBPA 3AXJA 4CN6A 2YDSA 1OWAA 2WZHA 4IL4A 4UV8B 5JDFA 4IE5A 3F31A 3NWIA 1WYCA 3O1JA 3RIAA 5DQWA 5FXZA 4DV0T 4KHZF 3LBXA 2HN2A 3PJAJ 3IEEA 4QX8B 3PURA 4OYJA 2J47A 4Q25A 3P50A 3VRAA 5J2TE 3FHNA 2FJDA 1N32T 3AE5A 3TLUA 3B57A 5AQKB 5LGNB 1QLBA 3N2GE 3JC6C 3JAFA 3AE1A 5AFUL 4NUVA 5LCYA 4Z90A 4G2AA 4H9NC 4AI6A 5F8PA 2WB5A 3UUNA 3RH3A 3I9YA 3EHZA 4WZXA 2PTFA 3AAIA 2H7OA 4DV3T 3N9LA 5H6RB 3L39A 5JH7E 3AE6A 2KINB 2GK9A 3KV9A 5HEUA 2N1GA 3TLVA 5JDGA 1WLXA 3CX6B 4OYKA 4HFHA 4ZEYA 4B3MT 2CBJA 4O4IE 4NXMT 4CN4A 4PJMA 2N9DA 1HG5A 3UT5E 1ZKEA 5JTGA 4F6RC 1YXRA 3IA3A 2K5BB 4ZS3A 3ZKRA 1MMAA 2VKOA 1YKEB 1M7KA 4TZ4C 4DNDA 4ZHQE 1XMQT 3CKDA 1E7PA 2V6XA 4XAXB 4HWHA 3RQUA 4ASKA 3KBTA 3KV5A 4EEDA 1XWMA 1LVKA 4UIGA 3FXDB 5AQFB 1VCSA 4LF7T 4O2BE 3ZMVB 3RYHE 1X9BA 2NW7A 1JNZA 3FBZA 3NRXA 3FZLB 4PK4A 3Q5DA 1JNRA 2IUBA 1D1AA 4O2AE 3N9PA 5JREA 2Q9QD 3RYCE 2Z6EA 4QXCB 4Z8XA 3BK9A 2V5CA 3ZC1A 3RI5A 2UXCT 1SE7A 3TLSA 4AISA 5ABFA 2BG9C 1BR1A 3O1IA 3N9MA 3HR0A 2VKJA 3NKZA 2QRXA 4P0AA 4JI4T 1N36T 4BJMA 3UU8A 3G06A 2ES0A 3FZFB 2IIUA 3AVSA 4G63A 1YD8G 5HEOA 2XQAA 4YLHA 4UVCB 3EI0A 2B76A 2BG9B 3PU8A 2L3LA 3V5SA 4HE8A 2XQ4A 3P4RA 3U3IA 5JDQA 2NP9A 3ZMZB 4ZI3C 5L3CB 4DO0A 3T1HT 3QB5K 1XZYA 3PUZF 1W09A 5JRCB 4YJ2E 5BMVE 4O4HE 1HR0T 2KT9A 5HYAA 1Z8UA 3Q9DA 4X66T 2VQFT 3IF8B 2X0YA 1IZNB 3CVRA 5HEHA 5L3FB 4JYAT 1FEWA 4IE0A 4J2CA 3I0QA 3UU4A 3FBLA 3HL6A 2XUEA 2YU1A 3LJCA 2YN6A 5FL1A 2XJ7A 2R6GF 2NW8A 2BKPA 3EABA 1MNDA 1MNEA 3KDSE 3LG7A 3VHLA 3ZMTB 2BKOA 2MAWA 2XQ8A 2E5VA 3EDUA 2LE8A 3RKGA 5JVDE 4TNWA 3L3PA 1FMWA 4AIUA 3K3QC 2PJQA 5FXXA 3OVUA 2ODUA 2CXLA 3VKHA 5L47A 3LBXB 5DJQC 3OPCA 2A9UA 2A3DA 3K3OA 3RQWA 1KEYA 5J2UE 5JR9A 4A56A 5FKYA 1YKHB 5L2LA 2LM9A 3F2EA 3NVOA 5H6QB 1HCIA 4QH1A 3RRCA 5TAOA 1GQEA 2UUCT 3QUJA 4BAYB 2RPAA 4KI0F 3ZPOA 4HN9A 5DABA 2X0HA 4JUYA 5BR8T 3H3MA 1MIWA 3MKDA 4WBOA 2CXDA 4O4LE 4O8SA 4CI2B 4B3ST 4X20E 1KNPA 3UU5A 1KFYA 4COFA 5M4YA 2W00A 4DV1T 2XAJB 2XQ9A 3HI2A 2JQHA 3GA8A 2XAFB 3DJBA 3QK6A 4HWDA 2X9YA 2WDQA 2BBHA 4X65T 1T7SA 2XQ6A 3ZJ2A 1UUSA 1D1CA 3C4WA 2WDRA 5HXSA 5A1LA 5AQIB 2ZMAA 2BVLA 3CWZB 3GN5B 4TWFA 1D0XA 2BG9E 2OV9A 3RRWA 4OHFA 2E9XD 2OLTA 2LT3A 3GMIA 4B6XA 2KMFA 3UFEA 2LKGA 3AB3B 3N2OA 2BBJA 4X1IE 4AQYT 4X1KE 3FZMB 2YK0A 4P0BA 2VL0A 5CA0E 2V8SV 4U2ZA 4AKRB 3F57A 4HFCA 3ZT7A 1SA0E 4U72A 2V7KA 4NPPA 2MBGA 2J4GA 3FZKB 2W63A 3OTOT 3P4SA 5JRCA 1MIYA 2X9HA 3OJAA 3UQ4A 4IDOA 2H89A 2Y8DA 3RHWA 4L0RA 2I59A 4H9RC 4GYSA 4YY3T 2WS3A 3ZT5A 2ZM0A 4Z91A 1B7TA 2IC9A 5KDMC 2D2SA 3AE4A 4ZI2D 2G0UA 2CPTA 2UXXB 5ADXL 2XAGB 4JI6T 2DL1A 2VK9A 2FJAA 4H63V 5LYJE 1X79A 4DR7T 4PW8A 3MZKB 2CCQA 4I43B 2EHOA 4IIJE 4XBFB 2EHOD 4LF8T 3ZLIA 1J1JA 1G73A 4ANJA 4L5GA 4KP3C 5AQVB 2DI4A 3C4XA 2W2UA 2WBLA 3RC8A 2WU5A 3MXZA 5AQGB 2VWAA 3ZC0A 5IHYA 5FMNA 2QGSA 3N9OA 4B3RT 4DBRA 2LHNA 2KSRA 5JR9C 5FXWA 3K8PC 3VRBA 4YTNA 3EDVA 3V5UA 4JI7T 3M65A 3AA0B 2BS2A 3UUXB 3P8CD 5L3DB 3LK42 5LOVE 3AE8A 4QHOA 5JR9B 2M67A 1BR2A 1OEDA 4PJJA 3ONXA 2FJEA 2KXPB 3T8OA 4OFZA 3LK2B 5ETWA 2YINA 2JMHA 3D0TA 5AQOB 3H37A 5EK3A 1IJ5A 3ZCIA 1QSDA 4U31A 3ETVA 2M6BA 2BZBA 2LSYA 2MOZA 1I6ZA 1YQ3A 2Y6XA 3C51A 4YSZA 3JAEA 1ZV4X 5JDNA 4YFSA 1XNRT 4YHHT 2LJLA 3AEFA 4ISTA 2BS4A 2AE9A 2ACXA 5FP3A 2RA1A 2VQET 5CFBA 4C90A 3UUBA 4IDPA 3WAKA 1ZOYA 2BVMA 5LHHB 3TKLB 4JI1T 2ZM6T 5LMUT 5LGUB 3B13A 2XPKA 4KUMB 3CQGB 2WWVA 3UTKA 3GN5A 1N34T 3ZT6A 1ZHCA 3ZYLA 2CMRA 4GIWA 4YTMA 3BQIA 4JI8T 4LF9T 2WP9A 3EUHA 5LJNA 5LBMA 4TX5A 4PK5A 5HWXA 3N5LA 2NTXA 2UXDT 3ZN1B 4YXDA 4X5TA 3HKBE 4QXBB 2Q9QA 4X62T 5LMNT 5ABHA 3RGLA 4EB6E 2IAKA 5AQPB 3H3AA 4EV6A 4DVDA 4H9PC 3N9NA 2ZLYA 4EYUA 2ZM8A 1VCTA 5L3GB 4HFIA 3KVAA 1G8XA 3VR8A 4HKAA 5JDHA 3AEEA 1T72A 1CUNA 1HF8A 2UXBT 4U7YA 2P9BA 4MLKA 5J1GA 5AQSB 1HNXT 4CXYA 3ONLC 4KMCA 2K48A 1KNRA 3JADA 1NWMX 4DMWA 2VVNA 2X67A 2RP4A 3MJXA 3PTRB 3OYXA 4HEAA 4ILAA 4YTPA 2CBIA 2CWYA 5LB7B 4ZI2C 4L9IA 5LJMA 2I6HA 4ZXLA 2WM9A 2K3WA 5AQRB 4TWHA 2W61A 3LDQB 1HFAA 4IE4A 4H63H 4YHJA 3W15B 2X9XA 4NXNT 1AJ3A 2EHOC 1HX8A 2CE7A 3K3NA 4YSXA 4UVAB 4CXWA 2E8IA 1E1HB 1SHZC 4LMKA 3OYZA 4JLEA 2EHOB 4IE6A 4IDZA 3KFWX 1FJGT 1D1BA 5AQHB 5L3BB 4V1Av 2X68A 2NOXA 4MBQA 4ILCA 3LFMA 3ZJ1A 3CMLA 3PUSA 2FBWA 2X0LB 1UGOA 4QX7B 4DBQA 2KZ7B 3NBXX 5HXHA 4IGUA 1Y01A 1WCRA 4DUYT 3CX8B 2Y48B 1S35A 2CWOA 3CQXC 4AQFC 1BR4A 3A5XA 3I9WA 4U33A 5FVLA 4OK0A 4QH5A 4LF4T 2PFVA 1NENA 2XQ5A 4CXXA 3NZPA 1OEDC 3T1YT 3RPUA 2C5IT 4TV8E 2YDQA 4EGWA 2V7JA 1NAFA 2C5KT 3BQKA 4HWFA 4LMJA 4LF6T 4MALA 4JI3T 1MMDA 3QB5A 2XHEB 2W62A 3PUWF 2W66A 3WAJA 3TLWA 1OEDB 5LG4A 3JC6D 2UXNB 2D5UA 2VASA 4ILUA 4XZCA 1MMNA 4ZZBA 2KWIB 2VKHA 5C8YE 1IBLT 5FNVE 1HNWT 3RYFE 2D0TA 2H3RA 2XAQB 3UQ7A 3B5MA 4DR6T 2H7VC 3ZMSB 4EZ4A 3VKGA 3AEBA 1UK5A 3ONJA 2BS3A 2WAUA 5HEJA 2WSSV 3PUAA 5CJ5A 1E2AA 2V6YA 2LEHA 3VU7H 2HPLA 3PUYF 2NWBA 2KNDA 4P1NA 2XQYA 1KNZA 4U7IA 4U74A 1VOMA 4GOUA 4TNVA 5EK4A 3C4ZA 1XMOT 2X9WA 5L4EA 2UU9T 4ERRA 2V5DA 4TV9E 2JQ9A 3E0ZA 4LF5T 3AA6B 5LHGB 3AAEB 4JV5T 4UEMA 4IL9A 2CRBA 3O4XE 1DU2A 5ABGA 2Q9QC 2E9XA 2WU2A 3R6NA 2CM0A 2HPJA 5HEGA 4QXHB 3I1AA 2XSBA 1KF6A 2XZEA 5JDLA 4U2YA 2QYWA 3L8RA 4DR4T 3NRYA 3HA4A 1MMGA 2Q9QB 2IC6A 5C3JA 2V7IA 3OKQA 1UURA 2LRLA 2VL8A 2LSGA 2JQKA 1YQ4A 5FY0A 1Z0PA 3AE2A 2W67A 5FYMA 3ETUA 1HS7A 1J5WA 1SUMB 4PK6A 2LOPA 3P4WA 4HFDA 1D0ZA 5HXEA
chains in the Genus database with same CATH topology
5EK3A 1IJ5A 3ZCIA 2DWGA 4I50E 1QSDA 3PU8A 4P09A 4ADZA 5JQGE 3ETVA 4PAGA 2L3LA 2V1DB 3V5SA 4HE8A 4H9SE 2BZBA 2CLYC 3U3IA 2YEVC 5JDQA 2LSYA 2MOZA 1LVFA 3CPZA 4AKLA 3P7IA 5EZYE 2Y6XA 3C51A 2NP9A 3ZMZB 3I0OA 3O1HA 4ZI3C 5L3CB 1LRZA 1ZV4X 5JDNA 4WNKA 4YFSA 3HKDE 5KMGP 4DO0A 3ZYMA 3KINB 2LJLA 4ISTA 2QA7A 5JRCB 3MK7C 3S4UA 5L3EB 4MFRA 2L9QA 4YJ2E 4ISSA 5BMVE 2CLYB 4O4HE 1UCUA 2ACXA 2KT9A 4HTEA 4EYYR 5HYAA 1BR0A 4IE7A 3Q9DA 3IF8B 2WMNA 3SOLA 3O9XA 3ZCJA 1IZNB 3CVRA 4ZI3D 5FP3A 5EK2A 2RA1A 5L3FB 4C90A 3N9QA 3C98B 1H7CA 3AA1B 1FEWA 3WAKA 4IE0A 2BVMA 4J2CA 3I0QA 5LHHB 5F3JA 3PUGA 3FBLA 5LA6E 3TKLB 5LP6E 5LGUB 3B13A 3HL6A 4KUMB 2XUEA 3CQGB 3Q2MA 1HG2A 3CQCB 3UTKA 2YU1A 5FY7A 3GN5A 2WMOA 3LJCA 2L8KA 3SWHA 1ZHCA 2XTLA 4MHCA 2LOSA 3ZYLA 2JMKA 2NW8A 2CMRA 4GIWA 3R84B 1MNDA 1MNEA 3KDSE 3BQIA 3LG7A 3J9X1 3VHLA 3ZMTB 1IAPA 3ANWA 2PG8A 3EUHA 5LJNA 5LBMA 4TX5A 3EDUA 2LE8A 4PK5A 3AA7B 2V7MA 3E08A 2LSKA 5LHIB 5LGTB 4X1YE 2KLQA 5JVDE 2JQQA 4PJLA 5HWXA 1ZEEA 3L3PA 4ZI7E 2NW9A 3N5LA 4EAHA 2JPFA 2NTXA 2MYSA 3ZN1B 1FMWA 5CA1E 2C5JA 3K3QC 3QC9A 5LBQB 2PJQA 2K9AA 3HKBE 5FXXA 2ODUA 4QXBB 2CXLA 3BQLA 3HKEE 3VKHA 2Q9QA 1QUUA 3KBUA 3PU3A 5FY1A 2ZM2A 3KVBA 3LBXB 2KWHA 3N2KE 5DJQC 4EB6E 2IAKA 2IW5B 2WWUA 3H3AA 4GYRA 4QKNA 3SRZA 2A3DA 3K3OA 3MACA 4AQFA 3KV4A 3DP7A 4AXPA 4DVDA 4WBNE 2A72A 3MA9A 4H9PC 4I4TE 4EZHA 2DNXA 2ZLYA 3N9NA 4EOZB 4EYUA 5J2UE 2ZM8A 5JR9A 1OXZA 3AAAB 4A56A 5L3GB 4E7SA 1YKHB 5L2LA 4H9OC 2LM9A 3F2EA 4O4JE 3KVAA 4EIWA 1G8XA 3EVYA 4HFVA 4UF0A 1HCIA 5H6QB 2B1EA 4HKAA 3RRCA 5KX5E 1O3XA 5TAOA 2N2NA 4UVBB 2MTQA 5FXVA 4EXTA 5JDHA 2XASB 3QUJA 2A2FX 4BAYB 1CUNA 1HF8A 4PFOA 4TN7B 4QWNB 3ZPOA 2P9BA 4MLKA 5J1GA 4CXYA 4KBMB 2HH7A 5E0OA 2PBIA 3ESLA 2NTYA 4FJOA 4HN9A 4KMCA 5DABA 2K48A 4JUYA 1D0YA 3LK3B 1NWMX 4DMWA 1MIWA 3ZMUB 2X67A 2RP4A 3PUQA 3MJXA 3PTRB 3J7Yq 4ZOLE 3RYIE 3OYXA 3MKDA 2LSJA 3FXEB 4WBOA 3ZYKA 4PFPA 2CXDA 3PE0A 4HEAA 4UXNB 2CWYA 4O4LE 4ZI2C 4L9IA 4BJNA 3SS1A 4O8SA 4CI2B 5LJMA 4X20E 3ZEFB 1V9DA 2WM9A 2BDEA 1WR6A 1HTJF 4DMVA 5M4YA 2W61A 2W00A 2XAJB 2J1DG 4H9QC 1HFAA 4IE4A 3HI2A 4H63H 4YHJA 3GA8A 2XAFB 3W15B 2W0GA 4PNIA 2V26A 4FI5A 2CXFA 3DJBA 2X9XA 1AJ3A 2EHOC 1HX8A 3QK6A 2CE7A 4AKGA 3ZN0B 3NZQA 4ZS2A 2SPCA 2CA5A 2X9YA 4NUUA 2XAHB 4M1PA 4AQGA 5LNKA 3IBPA 3ZJ2A 2VB6A 3Q5WA 3K3NA 4CI1B 3PDYA 4UVAB 1D1CA 1OWAA 3C64A 3C4WA 3CX7B 4CXWA 5HXSA 5A1LA 2E8IA 1E1HB 4UV8B 1SHZC 2DLRA 3OYZA 4PJNA 2ZMAA 4K0UA 4JLEA 5JDFA 4IE5A 3F31A 2EHOB 4IE6A 4IDZA 4BA9A 2E9XC 3KFWX 1WYCA 3O1JA 2BVLA 2ODVA 3CWZB 3GN5B 1D1BA 2DWKA 1D0XA 5L3BB 5DQWA 3L09A 4V1Av 2X68A 2NOXA 5FXZA 4JEUB 4MBQA 3LFMA 3ZJ1A 3CMLA 3PUSA 3RRWA 3LBXA 2X0LB 3C50A 1FMVA 4QX7B 4OHFA 3ANWB 3IEEA 4DBQA 3DTOA 4QX8B 2KZ7B 1U4QA 2E9XD 4GK5E 3PURA 2LT3A 3NBXX 3OBVE 3Q5XA 3GMIA 4B6XA 5HXHA 2E9XB 4OYJA 4IGUA 4CZZB 2KMFA 4AKHA 5JDMA 3CX8B 2Y48B 5J2TE 3UFEA 1S35A 2CWOA 3CQXC 3FHNA 4AQFC 1BR4A 3A5XA 3I9WA 1IJ6A 4OK0A 3AB3B 3B57A 3N2OA 4X1IE 2PFVA 4X1KE 4CXXA 3UUMA 2YK0A 3NZPA 4P0BA 4YJ3E 5LGNB 5CA0E 2D0UA 3N2GE 1WYBA 2C5IT 3JC6C 4TV8E 3RPUA 5AFUL 4NUVA 2V7JA 5LCYA 1NAFA 2C5KT 3BQKA 4G2AA 4H9NC 4AI6A 5F8PA 2V7LA 4AKRB 3F57A 4MALA 3RKOA 1MMDA 3UUNA 1SA0E 4U72A 3I9YA 3RH3A 2V7KA 2MBGA 2XHEB 2W62A 2X66A 1UX5A 3WAJA 1VRBA 2DCFA 3JC6D 1EZ3A 3AAIA 2UXNB 2W63A 3HKCE 2H7OA 5DQVA 5LG4A 2D5UA 4UF0B 2VASA 4ILUA 4XZCA 3UULA 1MMNA 3N9LA 5H6RB 5JRCA 5JH7E 2KWIB 2VKHA 5C8YE 2KINB 2GK9A 3KV9A 1MIYA 5FNVE 2N1GA 4I55E 2X9HA 3RYFE 2D0TA 3OJAA 4C91A 2H3RA 2XAQB 5JDGA 2Y8DA 2H7VC 1WLXA 2JJ9A 3ZMSB 4EZ4A 5IYZE 4L0RA 3CX6B 2I59A 4H9RC 3VKGA 4GYSA 4OYKA 2ZM0A 2WAUA 4UELA 1KK7A 1B7TA 2WSSV 3PUAA 2IC9A 3AVRA 5KDMC 4O4IE 2D2SA 2LEHA 3VU7H 4ZI2D 2HPLA 4IHJE 1US7B 2NWBA 1UX4A 2KNDA 4N78D 2G0UA 2UXXB 4PJMA 2OA5A 4HGAA 2N9DA 3IHRA 1HG5A 3UT5E 1ZKEA 4CI3B 5CB4E 3RC3A 5ADXL 2XQYA 2XAGB 4F6RC 3E22E 2VK9A 4GK0E 4H63V 1KNZA 2K5BB 5HXCA 5LYJE 1X79A 5HWYA 4ZS3A 4U74A 1VOMA 1LKXA 4GOUA 1MMAA 2VKOA 1YKEB 4PW8A 3MZKB 2LHRA 5HXRA 2LSIA 2CCQA 1S94A 4TZ4C 4DNDA 4I43B 5EK4A 4ZHQE 3CKDA 2EHOA 4IIJE 4XBFB 2EHOD 3C4ZA 3ZLIA 2X9WA 2DHRA 4ERRA 3FB2A 4TV9E 4XAXB 1G73A 3E0ZA 4ASKA 3KBTA 3KV5A 4ANJA 4L5GA 3AA6B 2X51A 4KP3C 1LVKA 4UIGA 2DI4A 3C4XA 3FXDB 5LHGB 1FIOA 3AAEB 1YW0A 4AKIA 4UEMA 2WBLA 3O4XE 3RC8A 2Q9QC 2E9XA 5GONE 3MXZA 4O2BE 2VWAA 3WI3A 3R6NA 4CQIA 3ZC0A 2CM0A 2HPJA 5FMNA 5IHYA 3ZMVB 3RYHE 2CEAA 2QGSA 4QXHB 3N9OA 2NW7A 4DBRA 2LHNA 3I1AA 5JDLA 5HAXA 4E7ZA 3FBZA 3NRXA 4PK4A 5JR9C 5FXWA 3RX6A 3NRYA 1WRDA 3HA4A 3K8PC 4O2AE 1D1AA 1MMGA 3N9PA 3GWHA 2Q9QD 5JREA 3RYCE 2K24A 2Z6EA 4UV9B 1T98A 1U5PA 2Q9QB 2IC6A 4QXCB 4JEHB 2VKDA 2V7IA 3EDVA 3OKQA 1MIVA 4Z8XA 2YU2A 3V5UA 2JRKA 2VL8A 3BK9A 3ZC1A 3M65A 2LSGA 4TUYE 3AA0B 5LXTE 3UUXB 3P8CD 5L3DB 1BR1A 3LK42 5FY0A 3O1IA 1Z0PA 5LOVE 3U78A 3N9MA 3HR0A 2C0SA 2VKJA 4QHOA 5JR9B 2M67A 5FYMA 4P0AA 3ETUA 1BR2A 1HS7A 4PJJA 3ONXA 4BJMA 3KV6A 2KXPB 3T8OA 4OFZA 2ES0A 3LK2B 4PK6A 5ETWA 1Y64B 2LOPA 3AVSA 4G63A 1YD8G 2YINA 2JMHA 3D0TA 4YLHA 3H37A 4UVCB 1D0ZA 4WW0A 5HXEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EK3 A;  2V7L A;  4PK5 A;  2V7M A;  3E08 A;  2NWB A;  2D0T A;  2NW7 A;  1ZEE A;  4U72 A;  2NW9 A;  2V7K A;  5EK2 A;  2X68 A;  2NOX A;  2X66 A;  2NW8 A;  5EK4 A;  4U74 A;  4PK6 A;  5ETW A;  4HKA A;  1YW0 A;  4PW8 A;  2D0U A;  2V7I A;  2X67 A;  2V7J A;  3BK9 A; 
#chains in the Genus database with same CATH topology
 4ADZ A;  2XM1 A;  2CLY C;  2YEV C;  3CPZ A;  1M62 A;  3P7I A;  3I0O A;  3P4P A;  5IWA T;  5HCJ A;  1LRZ A;  3HKD E;  3ZYM A;  3KIN B;  3S4U A;  4IT4 A;  5L3E B;  4ISS A;  2CLY B;  2WCA A;  4HTE A;  1BR0 A;  4IE7 A;  4DR3 T;  3SOL A;  3O9X A;  2D9D A;  3ZCJ A;  5EK2 A;  4ZI3 D;  4JI2 T;  1N33 T;  3PUG A;  5LA6 E;  5ABE A;  2FUP A;  1HG2 A;  3CQC B;  5FY7 A;  5C2T A;  2WMO A;  5F5W A;  2L8K A;  3SWH A;  2XTL A;  4MHC A;  2JMK A;  3R84 B;  4KX6 A;  2IML A;  4A98 A;  2F4V T;  1IAP A;  2PG8 A;  3PUV F;  3VR9 A;  1OED E;  2LSK A;  2H88 A;  1ZEE A;  4JBW F;  5IUX A;  2JPF A;  2MYS A;  5CA1 E;  4GKK T;  2C5J A;  2LKH A;  3BQL A;  3HKE E;  1QUU A;  3KBU A;  3PU3 A;  2WQY A;  5FY1 A;  2ZM2 A;  3AEA A;  3KVB A;  4DV5 T;  3N2K E;  1T8B A;  4HWC A;  4QKN A;  3ZST A;  4AQF A;  3DP7 A;  2BKN A;  1XDP A;  2WZI A;  4I4T E;  4EOZ B;  1OXZ A;  4YSY A;  3AAA B;  3RF1 A;  3LSV A;  4E7S A;  1R8I A;  4EIW A;  2YKS A;  4UVB B;  2LRK A;  2XQ7 A;  2MTQ A;  4EXT A;  2A2F X;  4QWN B;  5AQT B;  5E0O A;  2PBI A;  3ESL A;  1D0Y A;  3LK3 B;  2CHO A;  3J7Y q;  3PUX F;  4ZOL E;  3RYI E;  4DV2 T;  2MPK A;  3ZYK A;  3ZSS A;  2W4X A;  4LFA T;  4UXN B;  2HHH T;  4BJN A;  3SS1 A;  3AED A;  5L4H A;  3ZEF B;  4DMV A;  2J1D G;  1W0A A;  2W0G A;  4PNI A;  2V26 A;  2V6Y B;  4IDQ A;  4CN1 A;  2LM2 A;  2YDR A;  3ZN0 B;  4ZS2 A;  2SPC A;  2CA5 A;  4M1P A;  4A5X A;  2VB6 A;  3Q5W A;  4CI1 B;  3PDY A;  4LML A;  3C64 A;  3CX7 B;  4DR5 T;  2IDO B;  2DLR A;  4PJN A;  4K0U A;  3CK6 A;  4BA9 A;  2E9X C;  2ODV A;  2QVA A;  2DWK A;  3L09 A;  4JEU B;  2LLY A;  3C50 A;  1FMV A;  3ANW B;  3DTO A;  4GK5 E;  1U4Q A;  3OBV E;  3Q5X A;  2E9X B;  4CZZ B;  4DV7 T;  4AKH A;  5JDM A;  4DR2 T;  2VUR A;  1IJ6 A;  2FJB A;  1NEK A;  4HFB A;  3UUM A;  4YJ3 E;  1WR0 A;  2D0U A;  1WYB A;  3FZH B;  4ZZC A;  3AE7 A;  2V7L A;  3RKO A;  3AEG A;  5AQN B;  4X64 T;  2X66 A;  1UX5 A;  1VRB A;  2DCF A;  1EZ3 A;  3HKC E;  5DQV A;  2E5L T;  4UF0 B;  3UUL A;  4HFE A;  1J5E T;  2UUB T;  4I55 E;  4ILB A;  5KXJ A;  4C91 A;  4A97 A;  3EAM A;  2JJ9 A;  5AQJ B;  5IYZ E;  1WFD A;  3M3Z B;  1CHU A;  4LFC T;  2UUA T;  4DID B;  4UEL A;  1KK7 A;  3AVR A;  4IHJ E;  1US7 B;  1UX4 A;  4N78 D;  3RIU A;  2OA5 A;  4HGA A;  4CI3 B;  3IHR A;  3Q5E A;  5CB4 E;  3RC3 A;  4LFB T;  3JCF A;  3E22 E;  4GK0 E;  5HXC A;  5HWY A;  3A7M A;  1LKX A;  5AQU B;  2LHR A;  5HXR A;  2LSI A;  1S94 A;  4KHP T;  2DHR A;  3UU3 A;  3FB2 A;  3AEC A;  2X51 A;  5CGM A;  3PV0 F;  1FIO A;  4UR9 A;  3AXJ B;  1YW0 A;  4AKI A;  5GON E;  3WI3 A;  4CQI A;  2CEA A;  2I0M A;  4B3T T;  5FL0 A;  1HNZ T;  5HAX A;  4E7Z A;  3RX6 A;  1WRD A;  2VVS A;  3GWH A;  2K24 A;  4UV9 B;  4U3C A;  1T98 A;  1U5P A;  4F8H A;  4JEH B;  2VKD A;  1MIV A;  2YU2 A;  2JRK A;  2XSA A;  4TUY E;  5LXT E;  3K1S A;  3AE9 A;  3U78 A;  2C0S A;  2AXD S;  3SFD A;  3KV6 A;  5AQL B;  1Y64 B;  3AE3 A;  4JI5 T;  4WW0 A;  3UU6 A;  1I94 T;  2DWG A;  4I50 E;  4P09 A;  5JQG E;  5FVK A;  4PAG A;  3P4Q A;  2V1D B;  4H9S E;  2YOE A;  1LVF A;  4AKL A;  5EZY E;  3O1H A;  4WNK A;  5KMG P;  5AQQ B;  2XY8 B;  5HCM A;  2QA7 A;  3MK7 C;  3QNU A;  4MFR A;  2L9Q A;  3A8Y C;  4TWD A;  1UCU A;  1ZP0 A;  4EYY R;  2WMN A;  2WDV A;  2HN1 A;  3N9Q A;  2NR4 A;  3C98 B;  1H7C A;  3AA1 B;  1XDO A;  5F3J A;  4GKJ T;  5LP6 E;  3Q2M A;  4YT0 A;  2LOS A;  4DV6 T;  5LG3 A;  4IRE A;  3J9X 1;  3ANW A;  4I0U A;  4DR1 T;  3X1D A;  3SFE A;  4OX9 T;  3AA7 B;  5AQM B;  2V7M A;  3E08 A;  5LHI B;  5LGT B;  4X1Y E;  2KLQ A;  2JQQ A;  4PJL A;  4ZI7 E;  2NW9 A;  1W9R A;  4EAH A;  3QC9 A;  5LBQ B;  2J62 A;  2K9A A;  4K0K T;  2WY2 A;  2IHR 1;  2KWH A;  2JIW A;  3QOF A;  2IW5 B;  2WWU A;  4GYR A;  3SRZ A;  2ACZ A;  4JI0 T;  3MAC A;  3KV4 A;  4AXP A;  4WBN E;  2A72 A;  3ABV A;  3MA9 A;  4EZH A;  2DNX A;  3PJA A;  1HX1 B;  4H9O C;  2E2A A;  4NIQ A;  1W0B A;  4O4J E;  2XM2 A;  3EVY A;  4HFV A;  4UF0 A;  2B1E A;  1XNQ T;  5KX5 E;  1O3X A;  2N2N A;  4HWI B;  5FXV A;  2BG9 A;  2XAS B;  2XQ3 A;  4PFO A;  4TN7 B;  4EEB A;  5ABF B;  4KBM B;  2HH7 A;  3RLF F;  2NTY A;  4WYV A;  3RIF A;  4FJO A;  2CHN A;  3ZMU B;  3PUQ A;  2M6I A;  3UFG A;  1L0V A;  2LSJ A;  3FXE B;  1IBK T;  4PFP A;  3PE0 A;  3CIR A;  3RIU C;  4DUZ T;  4DV4 T;  4QH4 A;  1V9D A;  2BDE A;  1WR6 A;  1HTJ F;  1IBM T;  4IDN A;  4H9Q C;  4FI5 A;  2CXF A;  3TLT A;  4AKG A;  3NZQ A;  5J0Z A;  4NUU A;  2XAH B;  4AQG A;  5LNK A;  3IBP A;  3AXJ A;  4CN6 A;  2YDS A;  1OWA A;  2WZH A;  4IL4 A;  4UV8 B;  5JDF A;  4IE5 A;  3F31 A;  3NWI A;  1WYC A;  3O1J A;  3RIA A;  5DQW A;  5FXZ A;  4DV0 T;  4KHZ F;  3LBX A;  2HN2 A;  3PJA J;  3IEE A;  4QX8 B;  3PUR A;  4OYJ A;  2J47 A;  4Q25 A;  3P50 A;  3VRA A;  5J2T E;  3FHN A;  2FJD A;  1N32 T;  3AE5 A;  3TLU A;  3B57 A;  5AQK B;  5LGN B;  1QLB A;  3N2G E;  3JC6 C;  3JAF A;  3AE1 A;  5AFU L;  4NUV A;  5LCY A;  4Z90 A;  4G2A A;  4H9N C;  4AI6 A;  5F8P A;  2WB5 A;  3UUN A;  3RH3 A;  3I9Y A;  3EHZ A;  4WZX A;  2PTF A;  3AAI A;  2H7O A;  4DV3 T;  3N9L A;  5H6R B;  3L39 A;  5JH7 E;  3AE6 A;  2KIN B;  2GK9 A;  3KV9 A;  5HEU A;  2N1G A;  3TLV A;  5JDG A;  1WLX A;  3CX6 B;  4OYK A;  4HFH A;  4ZEY A;  4B3M T;  2CBJ A;  4O4I E;  4NXM T;  4CN4 A;  4PJM A;  2N9D A;  1HG5 A;  3UT5 E;  1ZKE A;  5JTG A;  4F6R C;  1YXR A;  3IA3 A;  2K5B B;  4ZS3 A;  3ZKR A;  1MMA A;  2VKO A;  1YKE B;  1M7K A;  4TZ4 C;  4DND A;  4ZHQ E;  1XMQ T;  3CKD A;  1E7P A;  2V6X A;  4XAX B;  4HWH A;  3RQU A;  4ASK A;  3KBT A;  3KV5 A;  4EED A;  1XWM A;  1LVK A;  4UIG A;  3FXD B;  5AQF B;  1VCS A;  4LF7 T;  4O2B E;  3ZMV B;  3RYH E;  1X9B A;  2NW7 A;  1JNZ A;  3FBZ A;  3NRX A;  3FZL B;  4PK4 A;  3Q5D A;  1JNR A;  2IUB A;  1D1A A;  4O2A E;  3N9P A;  5JRE A;  2Q9Q D;  3RYC E;  2Z6E A;  4QXC B;  4Z8X A;  3BK9 A;  2V5C A;  3ZC1 A;  3RI5 A;  2UXC T;  1SE7 A;  3TLS A;  4AIS A;  5ABF A;  2BG9 C;  1BR1 A;  3O1I A;  3N9M A;  3HR0 A;  2VKJ A;  3NKZ A;  2QRX A;  4P0A A;  4JI4 T;  1N36 T;  4BJM A;  3UU8 A;  3G06 A;  2ES0 A;  3FZF B;  2IIU A;  3AVS A;  4G63 A;  1YD8 G;  5HEO A;  2XQA A;  4YLH A;  4UVC B;  3EI0 A;  2B76 A;  2BG9 B;  3PU8 A;  2L3L A;  3V5S A;  4HE8 A;  2XQ4 A;  3P4R A;  3U3I A;  5JDQ A;  2NP9 A;  3ZMZ B;  4ZI3 C;  5L3C B;  4DO0 A;  3T1H T;  3QB5 K;  1XZY A;  3PUZ F;  1W09 A;  5JRC B;  4YJ2 E;  5BMV E;  4O4H E;  1HR0 T;  2KT9 A;  5HYA A;  1Z8U A;  3Q9D A;  4X66 T;  2VQF T;  3IF8 B;  2X0Y A;  1IZN B;  3CVR A;  5HEH A;  5L3F B;  4JYA T;  1FEW A;  4IE0 A;  4J2C A;  3I0Q A;  3UU4 A;  3FBL A;  3HL6 A;  2XUE A;  2YU1 A;  3LJC A;  2YN6 A;  5FL1 A;  2XJ7 A;  2R6G F;  2NW8 A;  2BKP A;  3EAB A;  1MND A;  1MNE A;  3KDS E;  3LG7 A;  3VHL A;  3ZMT B;  2BKO A;  2MAW A;  2XQ8 A;  2E5V A;  3EDU A;  2LE8 A;  3RKG A;  5JVD E;  4TNW A;  3L3P A;  1FMW A;  4AIU A;  3K3Q C;  2PJQ A;  5FXX A;  3OVU A;  2ODU A;  2CXL A;  3VKH A;  5L47 A;  3LBX B;  5DJQ C;  3OPC A;  2A9U A;  2A3D A;  3K3O A;  3RQW A;  1KEY A;  5J2U E;  5JR9 A;  4A56 A;  5FKY A;  1YKH B;  5L2L A;  2LM9 A;  3F2E A;  3NVO A;  5H6Q B;  1HCI A;  4QH1 A;  3RRC A;  5TAO A;  1GQE A;  2UUC T;  3QUJ A;  4BAY B;  2RPA A;  4KI0 F;  3ZPO A;  4HN9 A;  5DAB A;  2X0H A;  4JUY A;  5BR8 T;  3H3M A;  1MIW A;  3MKD A;  4WBO A;  2CXD A;  4O4L E;  4O8S A;  4CI2 B;  4B3S T;  4X20 E;  1KNP A;  3UU5 A;  1KFY A;  4COF A;  5M4Y A;  2W00 A;  4DV1 T;  2XAJ B;  2XQ9 A;  3HI2 A;  2JQH A;  3GA8 A;  2XAF B;  3DJB A;  3QK6 A;  4HWD A;  2X9Y A;  2WDQ A;  2BBH A;  4X65 T;  1T7S A;  2XQ6 A;  3ZJ2 A;  1UUS A;  1D1C A;  3C4W A;  2WDR A;  5HXS A;  5A1L A;  5AQI B;  2ZMA A;  2BVL A;  3CWZ B;  3GN5 B;  4TWF A;  1D0X A;  2BG9 E;  2OV9 A;  3RRW A;  4OHF A;  2E9X D;  2OLT A;  2LT3 A;  3GMI A;  4B6X A;  2KMF A;  3UFE A;  2LKG A;  3AB3 B;  3N2O A;  2BBJ A;  4X1I E;  4AQY T;  4X1K E;  3FZM B;  2YK0 A;  4P0B A;  2VL0 A;  5CA0 E;  2V8S V;  4U2Z A;  4AKR B;  3F57 A;  4HFC A;  3ZT7 A;  1SA0 E;  4U72 A;  2V7K A;  4NPP A;  2MBG A;  2J4G A;  3FZK B;  2W63 A;  3OTO T;  3P4S A;  5JRC A;  1MIY A;  2X9H A;  3OJA A;  3UQ4 A;  4IDO A;  2H89 A;  2Y8D A;  3RHW A;  4L0R A;  2I59 A;  4H9R C;  4GYS A;  4YY3 T;  2WS3 A;  3ZT5 A;  2ZM0 A;  4Z91 A;  1B7T A;  2IC9 A;  5KDM C;  2D2S A;  3AE4 A;  4ZI2 D;  2G0U A;  2CPT A;  2UXX B;  5ADX L;  2XAG B;  4JI6 T;  2DL1 A;  2VK9 A;  2FJA A;  4H63 V;  5LYJ E;  1X79 A;  4DR7 T;  4PW8 A;  3MZK B;  2CCQ A;  4I43 B;  2EHO A;  4IIJ E;  4XBF B;  2EHO D;  4LF8 T;  3ZLI A;  1J1J A;  1G73 A;  4ANJ A;  4L5G A;  4KP3 C;  5AQV B;  2DI4 A;  3C4X A;  2W2U A;  2WBL A;  3RC8 A;  2WU5 A;  3MXZ A;  5AQG B;  2VWA A;  3ZC0 A;  5IHY A;  5FMN A;  2QGS A;  3N9O A;  4B3R T;  4DBR A;  2LHN A;  2KSR A;  5JR9 C;  5FXW A;  3K8P C;  3VRB A;  4YTN A;  3EDV A;  3V5U A;  4JI7 T;  3M65 A;  3AA0 B;  2BS2 A;  3UUX B;  3P8C D;  5L3D B;  3LK4 2;  5LOV E;  3AE8 A;  4QHO A;  5JR9 B;  2M67 A;  1BR2 A;  1OED A;  4PJJ A;  3ONX A;  2FJE A;  2KXP B;  3T8O A;  4OFZ A;  3LK2 B;  5ETW A;  2YIN A;  2JMH A;  3D0T A;  5AQO B;  3H37 A;  5EK3 A;  1IJ5 A;  3ZCI A;  1QSD A;  4U31 A;  3ETV A;  2M6B A;  2BZB A;  2LSY A;  2MOZ A;  1I6Z A;  1YQ3 A;  2Y6X A;  3C51 A;  4YSZ A;  3JAE A;  1ZV4 X;  5JDN A;  4YFS A;  1XNR T;  4YHH T;  2LJL A;  3AEF A;  4IST A;  2BS4 A;  2AE9 A;  2ACX A;  5FP3 A;  2RA1 A;  2VQE T;  5CFB A;  4C90 A;  3UUB A;  4IDP A;  3WAK A;  1ZOY A;  2BVM A;  5LHH B;  3TKL B;  4JI1 T;  2ZM6 T;  5LMU T;  5LGU B;  3B13 A;  2XPK A;  4KUM B;  3CQG B;  2WWV A;  3UTK A;  3GN5 A;  1N34 T;  3ZT6 A;  1ZHC A;  3ZYL A;  2CMR A;  4GIW A;  4YTM A;  3BQI A;  4JI8 T;  4LF9 T;  2WP9 A;  3EUH A;  5LJN A;  5LBM A;  4TX5 A;  4PK5 A;  5HWX A;  3N5L A;  2NTX A;  2UXD T;  3ZN1 B;  4YXD A;  4X5T A;  3HKB E;  4QXB B;  2Q9Q A;  4X62 T;  5LMN T;  5ABH A;  3RGL A;  4EB6 E;  2IAK A;  5AQP B;  3H3A A;  4EV6 A;  4DVD A;  4H9P C;  3N9N A;  2ZLY A;  4EYU A;  2ZM8 A;  1VCT A;  5L3G B;  4HFI A;  3KVA A;  1G8X A;  3VR8 A;  4HKA A;  5JDH A;  3AEE A;  1T72 A;  1CUN A;  1HF8 A;  2UXB T;  4U7Y A;  2P9B A;  4MLK A;  5J1G A;  5AQS B;  1HNX T;  4CXY A;  3ONL C;  4KMC A;  2K48 A;  1KNR A;  3JAD A;  1NWM X;  4DMW A;  2VVN A;  2X67 A;  2RP4 A;  3MJX A;  3PTR B;  3OYX A;  4HEA A;  4ILA A;  4YTP A;  2CBI A;  2CWY A;  5LB7 B;  4ZI2 C;  4L9I A;  5LJM A;  2I6H A;  4ZXL A;  2WM9 A;  2K3W A;  5AQR B;  4TWH A;  2W61 A;  3LDQ B;  1HFA A;  4IE4 A;  4H63 H;  4YHJ A;  3W15 B;  2X9X A;  4NXN T;  1AJ3 A;  2EHO C;  1HX8 A;  2CE7 A;  3K3N A;  4YSX A;  4UVA B;  4CXW A;  2E8I A;  1E1H B;  1SHZ C;  4LMK A;  3OYZ A;  4JLE A;  2EHO B;  4IE6 A;  4IDZ A;  3KFW X;  1FJG T;  1D1B A;  5AQH B;  5L3B B;  4V1A v;  2X68 A;  2NOX A;  4MBQ A;  4ILC A;  3LFM A;  3ZJ1 A;  3CML A;  3PUS A;  2FBW A;  2X0L B;  1UGO A;  4QX7 B;  4DBQ A;  2KZ7 B;  3NBX X;  5HXH A;  4IGU A;  1Y01 A;  1WCR A;  4DUY T;  3CX8 B;  2Y48 B;  1S35 A;  2CWO A;  3CQX C;  4AQF C;  1BR4 A;  3A5X A;  3I9W A;  4U33 A;  5FVL A;  4OK0 A;  4QH5 A;  4LF4 T;  2PFV A;  1NEN A;  2XQ5 A;  4CXX A;  3NZP A;  1OED C;  3T1Y T;  3RPU A;  2C5I T;  4TV8 E;  2YDQ A;  4EGW A;  2V7J A;  1NAF A;  2C5K T;  3BQK A;  4HWF A;  4LMJ A;  4LF6 T;  4MAL A;  4JI3 T;  1MMD A;  3QB5 A;  2XHE B;  2W62 A;  3PUW F;  2W66 A;  3WAJ A;  3TLW A;  1OED B;  5LG4 A;  3JC6 D;  2UXN B;  2D5U A;  2VAS A;  4ILU A;  4XZC A;  1MMN A;  4ZZB A;  2KWI B;  2VKH A;  5C8Y E;  1IBL T;  5FNV E;  1HNW T;  3RYF E;  2D0T A;  2H3R A;  2XAQ B;  3UQ7 A;  3B5M A;  4DR6 T;  2H7V C;  3ZMS B;  4EZ4 A;  3VKG A;  3AEB A;  1UK5 A;  3ONJ A;  2BS3 A;  2WAU A;  5HEJ A;  2WSS V;  3PUA A;  5CJ5 A;  1E2A A;  2V6Y A;  2LEH A;  3VU7 H;  2HPL A;  3PUY F;  2NWB A;  2KND A;  4P1N A;  2XQY A;  1KNZ A;  4U7I A;  4U74 A;  1VOM A;  4GOU A;  4TNV A;  5EK4 A;  3C4Z A;  1XMO T;  2X9W A;  5L4E A;  2UU9 T;  4ERR A;  2V5D A;  4TV9 E;  2JQ9 A;  3E0Z A;  4LF5 T;  3AA6 B;  5LHG B;  3AAE B;  4JV5 T;  4UEM A;  4IL9 A;  2CRB A;  3O4X E;  1DU2 A;  5ABG A;  2Q9Q C;  2E9X A;  2WU2 A;  3R6N A;  2CM0 A;  2HPJ A;  5HEG A;  4QXH B;  3I1A A;  2XSB A;  1KF6 A;  2XZE A;  5JDL A;  4U2Y A;  2QYW A;  3L8R A;  4DR4 T;  3NRY A;  3HA4 A;  1MMG A;  2Q9Q B;  2IC6 A;  5C3J A;  2V7I A;  3OKQ A;  1UUR A;  2LRL A;  2VL8 A;  2LSG A;  2JQK A;  1YQ4 A;  5FY0 A;  1Z0P A;  3AE2 A;  2W67 A;  5FYM A;  3ETU A;  1HS7 A;  1J5W A;  1SUM B;  4PK6 A;  2LOP A;  3P4W A;  4HFD A;  1D0Z A;  5HXE A; 
#chains in the Genus database with same CATH homology
 5EK3 A;  1IJ5 A;  3ZCI A;  2DWG A;  4I50 E;  1QSD A;  3PU8 A;  4P09 A;  4ADZ A;  5JQG E;  3ETV A;  4PAG A;  2L3L A;  2V1D B;  3V5S A;  4HE8 A;  4H9S E;  2BZB A;  2CLY C;  3U3I A;  2YEV C;  5JDQ A;  2LSY A;  2MOZ A;  1LVF A;  3CPZ A;  4AKL A;  3P7I A;  5EZY E;  2Y6X A;  3C51 A;  2NP9 A;  3ZMZ B;  3I0O A;  3O1H A;  4ZI3 C;  5L3C B;  1LRZ A;  1ZV4 X;  5JDN A;  4WNK A;  4YFS A;  3HKD E;  5KMG P;  4DO0 A;  3ZYM A;  3KIN B;  2LJL A;  4IST A;  2QA7 A;  5JRC B;  3MK7 C;  3S4U A;  5L3E B;  4MFR A;  2L9Q A;  4YJ2 E;  4ISS A;  5BMV E;  2CLY B;  4O4H E;  1UCU A;  2ACX A;  2KT9 A;  4HTE A;  4EYY R;  5HYA A;  1BR0 A;  4IE7 A;  3Q9D A;  3IF8 B;  2WMN A;  3SOL A;  3O9X A;  3ZCJ A;  1IZN B;  3CVR A;  4ZI3 D;  5FP3 A;  5EK2 A;  2RA1 A;  5L3F B;  4C90 A;  3N9Q A;  3C98 B;  1H7C A;  3AA1 B;  1FEW A;  3WAK A;  4IE0 A;  2BVM A;  4J2C A;  3I0Q A;  5LHH B;  5F3J A;  3PUG A;  3FBL A;  5LA6 E;  3TKL B;  5LP6 E;  5LGU B;  3B13 A;  3HL6 A;  4KUM B;  2XUE A;  3CQG B;  3Q2M A;  1HG2 A;  3CQC B;  3UTK A;  2YU1 A;  5FY7 A;  3GN5 A;  2WMO A;  3LJC A;  2L8K A;  3SWH A;  1ZHC A;  2XTL A;  4MHC A;  2LOS A;  3ZYL A;  2JMK A;  2NW8 A;  2CMR A;  4GIW A;  3R84 B;  1MND A;  1MNE A;  3KDS E;  3BQI A;  3LG7 A;  3J9X 1;  3VHL A;  3ZMT B;  1IAP A;  3ANW A;  2PG8 A;  3EUH A;  5LJN A;  5LBM A;  4TX5 A;  3EDU A;  2LE8 A;  4PK5 A;  3AA7 B;  2V7M A;  3E08 A;  2LSK A;  5LHI B;  5LGT B;  4X1Y E;  2KLQ A;  5JVD E;  2JQQ A;  4PJL A;  5HWX A;  1ZEE A;  3L3P A;  4ZI7 E;  2NW9 A;  3N5L A;  4EAH A;  2JPF A;  2NTX A;  2MYS A;  3ZN1 B;  1FMW A;  5CA1 E;  2C5J A;  3K3Q C;  3QC9 A;  5LBQ B;  2PJQ A;  2K9A A;  3HKB E;  5FXX A;  2ODU A;  4QXB B;  2CXL A;  3BQL A;  3HKE E;  3VKH A;  2Q9Q A;  1QUU A;  3KBU A;  3PU3 A;  5FY1 A;  2ZM2 A;  3KVB A;  3LBX B;  2KWH A;  3N2K E;  5DJQ C;  4EB6 E;  2IAK A;  2IW5 B;  2WWU A;  3H3A A;  4GYR A;  4QKN A;  3SRZ A;  2A3D A;  3K3O A;  3MAC A;  4AQF A;  3KV4 A;  3DP7 A;  4AXP A;  4DVD A;  4WBN E;  2A72 A;  3MA9 A;  4H9P C;  4I4T E;  4EZH A;  2DNX A;  2ZLY A;  3N9N A;  4EOZ B;  4EYU A;  5J2U E;  2ZM8 A;  5JR9 A;  1OXZ A;  3AAA B;  4A56 A;  5L3G B;  4E7S A;  1YKH B;  5L2L A;  4H9O C;  2LM9 A;  3F2E A;  4O4J E;  3KVA A;  4EIW A;  1G8X A;  3EVY A;  4HFV A;  4UF0 A;  1HCI A;  5H6Q B;  2B1E A;  4HKA A;  3RRC A;  5KX5 E;  1O3X A;  5TAO A;  2N2N A;  4UVB B;  2MTQ A;  5FXV A;  4EXT A;  5JDH A;  2XAS B;  3QUJ A;  2A2F X;  4BAY B;  1CUN A;  1HF8 A;  4PFO A;  4TN7 B;  4QWN B;  3ZPO A;  2P9B A;  4MLK A;  5J1G A;  4CXY A;  4KBM B;  2HH7 A;  5E0O A;  2PBI A;  3ESL A;  2NTY A;  4FJO A;  4HN9 A;  4KMC A;  5DAB A;  2K48 A;  4JUY A;  1D0Y A;  3LK3 B;  1NWM X;  4DMW A;  1MIW A;  3ZMU B;  2X67 A;  2RP4 A;  3PUQ A;  3MJX A;  3PTR B;  3J7Y q;  4ZOL E;  3RYI E;  3OYX A;  3MKD A;  2LSJ A;  3FXE B;  4WBO A;  3ZYK A;  4PFP A;  2CXD A;  3PE0 A;  4HEA A;  4UXN B;  2CWY A;  4O4L E;  4ZI2 C;  4L9I A;  4BJN A;  3SS1 A;  4O8S A;  4CI2 B;  5LJM A;  4X20 E;  3ZEF B;  1V9D A;  2WM9 A;  2BDE A;  1WR6 A;  1HTJ F;  4DMV A;  5M4Y A;  2W61 A;  2W00 A;  2XAJ B;  2J1D G;  4H9Q C;  1HFA A;  4IE4 A;  3HI2 A;  4H63 H;  4YHJ A;  3GA8 A;  2XAF B;  3W15 B;  2W0G A;  4PNI A;  2V26 A;  4FI5 A;  2CXF A;  3DJB A;  2X9X A;  1AJ3 A;  2EHO C;  1HX8 A;  3QK6 A;  2CE7 A;  4AKG A;  3ZN0 B;  3NZQ A;  4ZS2 A;  2SPC A;  2CA5 A;  2X9Y A;  4NUU A;  2XAH B;  4M1P A;  4AQG A;  5LNK A;  3IBP A;  3ZJ2 A;  2VB6 A;  3Q5W A;  3K3N A;  4CI1 B;  3PDY A;  4UVA B;  1D1C A;  1OWA A;  3C64 A;  3C4W A;  3CX7 B;  4CXW A;  5HXS A;  5A1L A;  2E8I A;  1E1H B;  4UV8 B;  1SHZ C;  2DLR A;  3OYZ A;  4PJN A;  2ZMA A;  4K0U A;  4JLE A;  5JDF A;  4IE5 A;  3F31 A;  2EHO B;  4IE6 A;  4IDZ A;  4BA9 A;  2E9X C;  3KFW X;  1WYC A;  3O1J A;  2BVL A;  2ODV A;  3CWZ B;  3GN5 B;  1D1B A;  2DWK A;  1D0X A;  5L3B B;  5DQW A;  3L09 A;  4V1A v;  2X68 A;  2NOX A;  5FXZ A;  4JEU B;  4MBQ A;  3LFM A;  3ZJ1 A;  3CML A;  3PUS A;  3RRW A;  3LBX A;  2X0L B;  3C50 A;  1FMV A;  4QX7 B;  4OHF A;  3ANW B;  3IEE A;  4DBQ A;  3DTO A;  4QX8 B;  2KZ7 B;  1U4Q A;  2E9X D;  4GK5 E;  3PUR A;  2LT3 A;  3NBX X;  3OBV E;  3Q5X A;  3GMI A;  4B6X A;  5HXH A;  2E9X B;  4OYJ A;  4IGU A;  4CZZ B;  2KMF A;  4AKH A;  5JDM A;  3CX8 B;  2Y48 B;  5J2T E;  3UFE A;  1S35 A;  2CWO A;  3CQX C;  3FHN A;  4AQF C;  1BR4 A;  3A5X A;  3I9W A;  1IJ6 A;  4OK0 A;  3AB3 B;  3B57 A;  3N2O A;  4X1I E;  2PFV A;  4X1K E;  4CXX A;  3UUM A;  2YK0 A;  3NZP A;  4P0B A;  4YJ3 E;  5LGN B;  5CA0 E;  2D0U A;  3N2G E;  1WYB A;  2C5I T;  3JC6 C;  4TV8 E;  3RPU A;  5AFU L;  4NUV A;  2V7J A;  5LCY A;  1NAF A;  2C5K T;  3BQK A;  4G2A A;  4H9N C;  4AI6 A;  5F8P A;  2V7L A;  4AKR B;  3F57 A;  4MAL A;  3RKO A;  1MMD A;  3UUN A;  1SA0 E;  4U72 A;  3I9Y A;  3RH3 A;  2V7K A;  2MBG A;  2XHE B;  2W62 A;  2X66 A;  1UX5 A;  3WAJ A;  1VRB A;  2DCF A;  3JC6 D;  1EZ3 A;  3AAI A;  2UXN B;  2W63 A;  3HKC E;  2H7O A;  5DQV A;  5LG4 A;  2D5U A;  4UF0 B;  2VAS A;  4ILU A;  4XZC A;  3UUL A;  1MMN A;  3N9L A;  5H6R B;  5JRC A;  5JH7 E;  2KWI B;  2VKH A;  5C8Y E;  2KIN B;  2GK9 A;  3KV9 A;  1MIY A;  5FNV E;  2N1G A;  4I55 E;  2X9H A;  3RYF E;  2D0T A;  3OJA A;  4C91 A;  2H3R A;  2XAQ B;  5JDG A;  2Y8D A;  2H7V C;  1WLX A;  2JJ9 A;  3ZMS B;  4EZ4 A;  5IYZ E;  4L0R A;  3CX6 B;  2I59 A;  4H9R C;  3VKG A;  4GYS A;  4OYK A;  2ZM0 A;  2WAU A;  4UEL A;  1KK7 A;  1B7T A;  2WSS V;  3PUA A;  2IC9 A;  3AVR A;  5KDM C;  4O4I E;  2D2S A;  2LEH A;  3VU7 H;  4ZI2 D;  2HPL A;  4IHJ E;  1US7 B;  2NWB A;  1UX4 A;  2KND A;  4N78 D;  2G0U A;  2UXX B;  4PJM A;  2OA5 A;  4HGA A;  2N9D A;  3IHR A;  1HG5 A;  3UT5 E;  1ZKE A;  4CI3 B;  5CB4 E;  3RC3 A;  5ADX L;  2XQY A;  2XAG B;  4F6R C;  3E22 E;  2VK9 A;  4GK0 E;  4H63 V;  1KNZ A;  2K5B B;  5HXC A;  5LYJ E;  1X79 A;  5HWY A;  4ZS3 A;  4U74 A;  1VOM A;  1LKX A;  4GOU A;  1MMA A;  2VKO A;  1YKE B;  4PW8 A;  3MZK B;  2LHR A;  5HXR A;  2LSI A;  2CCQ A;  1S94 A;  4TZ4 C;  4DND A;  4I43 B;  5EK4 A;  4ZHQ E;  3CKD A;  2EHO A;  4IIJ E;  4XBF B;  2EHO D;  3C4Z A;  3ZLI A;  2X9W A;  2DHR A;  4ERR A;  3FB2 A;  4TV9 E;  4XAX B;  1G73 A;  3E0Z A;  4ASK A;  3KBT A;  3KV5 A;  4ANJ A;  4L5G A;  3AA6 B;  2X51 A;  4KP3 C;  1LVK A;  4UIG A;  2DI4 A;  3C4X A;  3FXD B;  5LHG B;  1FIO A;  3AAE B;  1YW0 A;  4AKI A;  4UEM A;  2WBL A;  3O4X E;  3RC8 A;  2Q9Q C;  2E9X A;  5GON E;  3MXZ A;  4O2B E;  2VWA A;  3WI3 A;  3R6N A;  4CQI A;  3ZC0 A;  2CM0 A;  2HPJ A;  5FMN A;  5IHY A;  3ZMV B;  3RYH E;  2CEA A;  2QGS A;  4QXH B;  3N9O A;  2NW7 A;  4DBR A;  2LHN A;  3I1A A;  5JDL A;  5HAX A;  4E7Z A;  3FBZ A;  3NRX A;  4PK4 A;  5JR9 C;  5FXW A;  3RX6 A;  3NRY A;  1WRD A;  3HA4 A;  3K8P C;  4O2A E;  1D1A A;  1MMG A;  3N9P A;  3GWH A;  2Q9Q D;  5JRE A;  3RYC E;  2K24 A;  2Z6E A;  4UV9 B;  1T98 A;  1U5P A;  2Q9Q B;  2IC6 A;  4QXC B;  4JEH B;  2VKD A;  2V7I A;  3EDV A;  3OKQ A;  1MIV A;  4Z8X A;  2YU2 A;  3V5U A;  2JRK A;  2VL8 A;  3BK9 A;  3ZC1 A;  3M65 A;  2LSG A;  4TUY E;  3AA0 B;  5LXT E;  3UUX B;  3P8C D;  5L3D B;  1BR1 A;  3LK4 2;  5FY0 A;  3O1I A;  1Z0P A;  5LOV E;  3U78 A;  3N9M A;  3HR0 A;  2C0S A;  2VKJ A;  4QHO A;  5JR9 B;  2M67 A;  5FYM A;  4P0A A;  3ETU A;  1BR2 A;  1HS7 A;  4PJJ A;  3ONX A;  4BJM A;  3KV6 A;  2KXP B;  3T8O A;  4OFZ A;  2ES0 A;  3LK2 B;  4PK6 A;  5ETW A;  1Y64 B;  2LOP A;  3AVS A;  4G63 A;  1YD8 G;  2YIN A;  2JMH A;  3D0T A;  4YLH A;  3H37 A;  4UVC B;  1D0Z A;  4WW0 A;  5HXE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...