2NW9A

Crystal structure of tryptophan 2,3-dioxygenase (tdo) from xanthomonas campestris in complex with ferrous heme and 6-fluoro-tryptophan. northeast structural genomics target xcr13
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
265
structure length
265
Chain Sequence
GRLTYGGYLRLDQLLSAQQPLSEPAHHDEMLFIIQHQTSELWLKLLAHELRAAIVHLQRDEVWQCRKVLARSKQVLRQLTEQWSVLETLTPSEYMGFRDVLGPSSGFQSLQYRYIEFLLGNKNPQMLQVFAYDPAGQARLREVLEAPSLYEEFLRYLARFGHAIPQQYQARDWTAAHVADDTLRPVFERIYENTDRYWREYSLCEDLVDVETQFQLWRFRHMRTVMRVIGFKRGTGGSSGVGFLQQALALTFFPELFDVRTSVGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tryptophan 2,3-dioxygenase
publication title Molecular insights into substrate recognition and catalysis by tryptophan 2,3-dioxygenase.
pubmed doi rcsb
source organism Xanthomonas campestris pv. campestris
molecule tags Oxidoreductase
total genus 110
structure length 265
sequence length 265
chains with identical sequence B
ec nomenclature ec 1.13.11.11: Tryptophan 2,3-dioxygenase.
pdb deposition date 2006-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03301 Trp_dioxygenase Tryptophan 2,3-dioxygenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.480 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2nw9A00
2X66A 2D0TA 2NW9A 4U74A 2NWBA 4HKAA 4U72A 2D0UA 2X67A 2V7JA 2V7IA 5EK3A 4PK6A 2V7MA 1YW0A 2V7KA 5ETWA 5EK4A 5EK2A 2NW8A 3BK9A 2NW7A 1ZEEA 3E08A 2NOXA 4PK5A 4PW8A 2V7LA 2X68A
chains in the Genus database with same CATH superfamily
4TUYE 4O2BE 4U2YA 1V9DA 4X62T 4YJ3E 2BBJA 2KWHA 5H6RB 3ZN0B 2K3WA 2W61A 4YT0A 2ODVA 4HE8A 2R6GF 2BS3A 3AE6A 3I1AA 5JDLA 4HWIB 4OHFA 2C0SA 3Q5WA 3OYZA 2V7IA 2WP9A 3PJAA 4PJLA 1XMQT 5L47A 1Z0PA 2FJBA 4GKKT 1KEYA 1BR4A 3O1HA 4KHZF 3JCFA 2V26A 2BVMA 2CBJA 3KV5A 3KV6A 1OEDB 4X64T 3ZC0A 4H9SE 3E22E 4ILAA 3SS1A 5LB7B 4EEDA 1LKXA 3QOFA 4A97A 1T72A 1L0VA 2KNDA 5L3CB 2NOXA 4QX7B 2JRKA 1WYBA 3T8OA 5CJ5A 2ZM0A 2W4XA 3FZLB 5AQRB 4MALA 2XQ3A 3ZCIA 4HTEA 2V7JA 4KBMB 3TLUA 4YFSA 2D5UA 5JR9A 3UUNA 3LFMA 2YOEA 2H89A 4C90A 2AXDS 2CWOA 3D0TA 4BJMA 3RYIE 5EZYE 2DWKA 5A1LA 2LE8A 3QNUA 3AAEB 1QLBA 3B13A 1ZEEA 4ZEYA 2FUPA 2X51A 4HWCA 3LK3B 2FJAA 2LSIA 3VR8A 4U2ZA 2BKNA 3K3NA 2Q9QA 1GQEA 2RPAA 3MK7C 2CBIA 1OWAA 4JEHB 3LSVA 3AEGA 3DJBA 3KVAA 4O4IE 3K3QC 2UXDT 4UEMA 3HL6A 1BR1A 4BAYB 4U74A 3FXEB 5BMVE 1R8IA 4TNWA 2KSRA 4KP3C 2CLYB 3HI2A 2CMRA 2VQFT 2BS2A 2XHEB 3E0ZA 1DU2A 1S94A 2LLYA 1HR0T 3EABA 4ZOLE 3T1HT 2DLRA 3ZEFB 2BG9A 3VRBA 4AKGA 2LSKA 1FIOA 5KMGP 1J5WA 1WR0A 5EK4A 5AQNB 2UUCT 1WYCA 2LT3A 3CX8B 5CA1E 3AE3A 1XNRT 4DNDA 2YEVC 1KNRA 1UURA 3KFWX 2BKOA 1W9RA 4UF0B 4KMCA 3N2OA 5DQVA 4DR1T 4YHHT 1LVFA 4AISA 3UFGA 4ZZBA 2WU5A 1MMDA 2DHRA 4MBQA 3PUQA 4NXNT 3MKDA 4LF6T 2XQAA 5LXTE 4ZZCA 1EZ3A 4HFBA 4PK6A 1HG2A 3ZT7A 2Y8DA 5LYJE 3ZYMA 1XZYA 2BKPA 4QX8B 2CE7A 3W15B 2ZLYA 4DR2T 3A8YC 3OTOT 2C5JA 4UV9B 4MLKA 4JI8T 4KX6A 4DV0T 3QB5K 1LRZA 3EDUA 4PFPA 3UQ4A 3CIRA 2X0YA 1MNEA 4IREA 2WY2A 3GN5B 3OBVE 4C91A 1YKHB 4JI0T 2MTQA 3PUAA 3P4WA 4GK0E 3P4PA 2SPCA 3M65A 5JDQA 4EEBA 2K24A 5HXEA 2V7KA 2LSYA 2N2NA 4HFVA 4QWNB 2VKOA 4NIQA 3JC6D 3VHLA 3KINB 3AE2A 3F31A 3AE4A 2E8IA 3I9YA 4JI4T 5L4HA 5JDHA 1YQ3A 1B7TA 2C5IT 2XQ5A 3FZHB 5ADXL 3WI3A 3C51A 1YQ4A 4JI7T 4HEAA 2XM1A 2XASB 3C4ZA 1D1CA 4IDZA 4JBWF 3X1DA 5HEGA 3PURA 3P4RA 3V5SA 2GK9A 2VKHA 2CCQA 5CGMA 2K9AA 2K5BB 3ZKRA 4EGWA 2E9XB 2D0TA 3SFEA 5L3DB 2D2SA 1MIYA 1UCUA 1QUUA 5JH7E 2XQ4A 5JQGE 2CXFA 2N9DA 5LGTB 1UX4A 3Q9DA 5ABHA 3AVRA 2W67A 4TNVA 4AXPA 2D0UA 4DBQA 1WCRA 2UXXB 2VK9A 2QRXA 2MPKA 3ZSSA 2IUBA 4LMJA 4IL4A 3GA8A 2CHNA 4WZXA 2JQHA 2WWVA 2VASA 5FP3A 3PV0F 4OK0A 4P0AA 3OYXA 2V8SV 3LBXA 1WRDA 5LGNB 1US7B 2AE9A 2EHOA 3N5LA 4QXHB 1ZKEA 2JQ9A 3RIFA 1KNZA 1KFYA 4EYUA 2WAUA 2WZHA 1HS7A 4OFZA 3B57A 1YD8G 3L3PA 4OYKA 2L8KA 2BG9E 3Q5EA 4DR6T 4I4TE 1O3XA 2XUEA 4ASKA 4DMWA 1D1BA 1WFDA 3PUVF 2Q9QC 2Q9QD 1W09A 4IHJE 4NPPA 2E5VA 5LGUB 5JDGA 4ISSA 4JI6T 5JR9B 1N34T 1D0XA 3PTRB 4O4LE 1ZHCA 3B5MA 3FZMB 2L3LA 1SE7A 3UU5A 3N9QA 4DV7T 2X0HA 4EYYR 3PUGA 3K1SA 4ANJA 3LK42 2BG9C 5DQWA 4P0BA 5JDFA 3PUZF 1XDPA 3ZYKA 2W66A 4B3MT 2WDVA 3ZLIA 4HFCA 3I9WA 2X9HA 3JAFA 4JI5T 2CM0A 1HCIA 2XJ7A 4AQYT 3UTKA 3FBLA 1FMVA 5JDNA 3R84B 3H3MA 5JTGA 3ZT6A 4CXXA 4YTNA 4NXMT 2W62A 4PJMA 4PFOA 5ABFA 1XMOT 4WW0A 4IDPA 1OXZA 5LBMA 4UVCB 4H9NC 3N2GE 3AA0B 1XNQT 4JI2T 3RYHE 4LFCT 5F5WA 4B3RT 2LHRA 5AQQB 2JMKA 5LHHB 5TAOA 4CQIA 4AKHA 3RKOA 3NVOA 5FXZA 4HFDA 2YINA 5JREA 3S4UA 3KBUA 2XQ6A 5AQOB 4LFBT 3AEAA 1FJGT 2YU1A 2NW8A 2NP9A 2XSBA 2BS4A 3FXDB 1KNPA 3ONLC 4L5GA 3ZCJA 5HYAA 3VU7H 4O2AE 3ZN1B 5H6QB 2ACXA 1G8XA 4GIWA 1MIWA 3ZMTB 4LMLA 3PUWF 3CPZA 1T7SA 2W2UA 3FZFB 5ABEA 2LHNA 4I0UA 3N9OA 4U31A 3IEEA 2WZIA 5L3EB 3OKQA 4KI0F 3ONXA 4X1KE 2VVNA 3AAAB 2BVLA 3C64A 4ERRA 3F57A 5LG3A 1CUNA 4YSYA 2E5LT 4DV3T 4UXNB 4JI1T 5HEHA 2ODUA 4O4JE 4CN1A 5AQIB 4YHJA 3PJAJ 3N9LA 5AFUL 2NTXA 4IE5A 4LF4T 2KZ7B 4TV8E 1VOMA 4H9PC 4CI2B 3LG7A 2FJEA 3KV9A 3AE8A 2XSAA 2ZM8A 5LOVE 3UU3A 3MZKB 3OPCA 4DIDB 3ZMZB 4K0UA 1ZOYA 1U4QA 3TLVA 1HX1B 4ZI7E 3RC8A 3TLTA 1N32T 5F3JA 3ETVA 4UVAB 4DV1T 4U7IA 5JRCB 3K8PC 2B1EA 3ZJ1A 2LSJA 2QYWA 2XAQB 2LM2A 2CWYA 2WDRA 5AQTB 5AQKB 4ZHQE 3H3AA 2V6YA 4JEUB 4CI3B 2MAWA 5C2TA 2VL8A 4AQGA 2EHOC 2EHOD 2BZBA 1E1HB 1OEDA 3DTOA 3GMIA 4EXTA 2NTYA 2YDRA 3NRYA 2JMHA 2LEHA 3FHNA 3VRAA 3AA7B 4ILCA 4UV8B 1NEKA 3CQCB 4H9RC 4TV9E 4PW8A 5FMNA 3P50A 5L3FB 3TLSA 1IZNB 2CXLA 2MOZA 5FL0A 2NWBA 4IDNA 1MMNA 4LF8T 3N9PA 4DR7T 2A3DA 2OA5A 4LF7T 3ESLA 3P7IA 3BQLA 3BQIA 1Y64B 2JJ9A 4V1Av 2CEAA 4CI1B 2BBHA 5AQHB 2QA7A 2ACZA 3EVYA 1NENA 2WU2A 4HWFA 2ES0A 3UU8A 3TKLB 1IJ5A 2V5DA 5HXCA 2YDSA 4TX5A 2RP4A 3KV4A 2G0UA 2WM9A 3CX7B 2D9DA 3AVSA 3L8RA 4ILBA 1I6ZA 3N9NA 3JC6C 2J62A 4IIJE 2XAJB 4ISTA 1HG5A 4HWDA 4FJOA 4OYJA 4UR9A 3F2EA 3ZMSB 2I59A 3RC3A 2W63A 3AXJA 2MYSA 1HNZT 2NR4A 5HXSA 3RH3A 1D1AA 5IHYA 4ZI3C 4ZI3D 2VURA 2HN1A 1MMAA 3AE9A 4X65T 2WS3A 4AQFA 1W0BA 4DBRA 2X66A 4TWFA 4ZXLA 5LP6E 2PG8A 4I43B 4AKRB 3QC9A 4DVDA 2Z6EA 3UU4A 4A5XA 4NUUA 3RIUC 3QB5A 4U3CA 3G06A 3VR9A 2V5CA 3PUSA 4YTMA 1J5ET 3HR0A 4EZ4A 2WCAA 3CX6B 3P8CD 1ZP0A 4B3TT 5LG4A 5L3BB 3FB2A 2VB6A 3I0QA 2XQ9A 2M6BA 4B6XA 3NBXX 2YU2A 1YXRA 1CHUA 4A56A 5EK2A 3NRXA 2LOSA 3EI0A 5F8PA 2F4VT 2V7LA 5J2UE 2LOPA 3RKGA 1FEWA 5HEJA 3LJCA 3OJAA 5HCJA 4YSXA 3MXZA 3UUXB 3NZPA 3ZMVB 1NWMX 2XTLA 4DV6T 1M7KA 5C8YE 4M1PA 2A2FX 1UX5A 2J4GA 4DV5T 2WQYA 5CFBA 3GN5A 2B76A 4L9IA 3UUMA 4LF9T 4G2AA 5AQGB 4ADZA 5FY1A 5LHGB 4DV4T 2YK0A 3L09A 3BK9A 3CQGB 2IHR1 4P09A 3HKBE 5IYZE 4JYAT 4L0RA 2E2AA 3ZYLA 4KHPT 2LRLA 4IT4A 1YKEB 4AKIA 1Z8UA 4QH1A 4U72A 5FVLA 3FBZA 4AI6A 4UELA 5EK3A 1Y01A 1JNRA 2YDQA 3EDVA 1N33T 1HNXT 4AIUA 4A98A 2IC6A 3C4XA 1BR2A 4CN4A 5KXJA 2ZMAA 4UIGA 2CHOA 3SOLA 1IBLT 4QHOA 5LA6E 2V7MA 1AJ3A 3CMLA 1S35A 3AEBA 4IE7A 3EAMA 2H88A 4UVBB 1OEDE 3E08A 3QK6A 4TZ4C 3TLWA 2VWAA 4HWHA 1LVKA 5FYMA 2MBGA 4Z8XA 5HWYA 2LKHA 5FXWA 5AQLB 2KLQA 4U33A 4P1NA 4YLHA 2E9XA 5AQUB 3N2KE 3R6NA 3ANWA 5KX5E 5E0OA 3NKZA 3RI5A 4TN7B 1KF6A 5AQFB 3RRWA 2Q9QB 3PUYF 3HKEE 2VKDA 4H9OC 2JQKA 3C4WA 3O9XA 1UK5A 2A9UA 5J1GA 3RYFE 3MJXA 4N78D 1OEDC 5AQVB 2V1DB 4WBOA 2Y48B 3WAKA 3ZSTA 5HEUA 4JLEA 4CN6A 2XAFB 2QVAA 2KXPB 2H3RA 3RIUA 3IHRA 4WNKA 2BG9B 2BDEA 2DL1A 2KINB 3UQ7A 2VKJA 2XAHB 4O4HE 3RIAA 4DR3T 5DJQC 2OLTA 3AE5A 1I94T 3N9MA 1D0YA 1W0AA 3A5XA 2WMNA 3M3ZB 3L39A 3CQXC 4I55E 3RYCE 5L3GB 2M67A 4GYRA 3CKDA 4IE4A 2V6YB 4ILUA 5IUXA 5LJNA 3U78A 1D0ZA 2JPFA 5L2LA 2WWUA 2CXDA 2ZM2A 2KT9A 1JNZA 3RF1A 2LKGA 2A72A 3CK6A 4O8SA 4YY3T 4EB6E 3LK2B 5GONE 4IGUA 2M6IA 3RQWA 5DABA 4YSZA 4BA9A 3K3OA 4ZS2A 4IDQA 5JVDE 3O4XE 4F8HA 5LJMA 2CLYC 3MACA 2X68A 2UXNB 4QH4A 3VKHA 2JQQA 4OX9T 2XZEA 4B3ST 4HFEA 4H63H 4X1YE 1J1JA 2PTFA 4EZHA 3VKGA 4AQFC 5J2TE 4PAGA 1KK7A 4TWDA 2UU9T 3U3IA 2WSSV 2CPTA 4HKAA 2X67A 4JV5T 2Y6XA 2IIUA 2HHHT 3A7MA 2HPJA 4EAHA 4IE6A 4JI3T 2WMOA 3AA6B 4F6RC 3AE7A 3J9X1 3O1JA 1HTJF 5HAXA 4LMKA 3UUBA 2VVSA 3AE1A 3AEFA 1MIVA 3RGLA 3AXJB 4HN9A 1SUMB 3V5UA 4K0KT 3P4SA 1N36T 2K48A 3RRCA 3MA9A 3PU3A 3J7Yq 2UUAT 4X20E 3C98B 3KDSE 4ZS3A 5CB4E 3EHZA 2PBIA 4QH5A 5AQPB 1T8BA 4H63V 4NUVA 2C5KT 3ABVA 1G73A 2H7VC 2IMLA 2J47A 3AEEA 3SFDA 5FVKA 4CXYA 3H37A 2JIWA 2IW5B 3QUJA 1IBMT 2XQYA 5C3JA 1IAPA 4MFRA 4EIWA 4DV2T 2LM9A 4QXCB 3IF8B 5CA0E 3T1YT 2UUBT 3KVBA 5JDMA 3CVRA 1FMWA 4X1IE 4U7YA 5FXXA 3GWHA 2YKSA 5HWXA 2X9YA 5M4YA 4G63A 5AQSB 4YXDA 4KUMB 1XWMA 3LBXB 5L4EA 3C50A 2EHOB 4DMVA 3UULA 2H7OA 3CWZB 4IDOA 5HXRA 4XAXB 4PNIA 5FKYA 4XZCA 4QKNA 4PK5A 4JUYA 2UXBT 2XPKA 2N1GA 2PJQA 3FZKB 2I0MA 2IAKA 2CRBA 4HFIA 3ZT5A 5LBQB 4DUYT 3O1IA 3EUHA 2E9XC 2E9XD 5ETWA 5FY0A 2XM2A 2KMFA 3AA1B 3ZMUB 1MMGA 3KBTA 2XAGB 4PJJA 4E7ZA 2L9QA 4EOZB 4Q25A 2X9XA 2CA5A 1BR0A 3WAJA 4EV6A 1X79A 1XDOA 5LHIB 4DUZT 4DO0A 4ZI2C 4ZI2D 1IBKT 1HFAA 4QXBB 2V6XA 2KWIB 4COFA 2VL0A 2VQET 3JADA 5ABGA 2I6HA 5FY7A 5KDMC 5JRCA 1ZV4X 4CXWA 5LCYA 3UU6A 2LSGA 4DR5T 2HPLA 4YTPA 3ZJ2A 2YN6A 4E7SA 2DNXA 2QGSA 4UF0A 3ANWB 4BJNA 2WBLA 2LRKA 3IBPA 1YW0A 1QSDA 1WR6A 1MNDA 4YJ2E 3Q5DA 2W0GA 3HKDE 2FJDA 1UUSA 4H9QC 2XQ7A 3HA4A 2HN2A 4WYVA 3AB3B 5AQMB 3SWHA 5FL1A 4IL9A 5LMUT 4HFHA 4MHCA 4GKJT 3NZQA 4LF5T 5ABFB 5IWAT 5LNKA 4FI5A 5FXVA 3RQUA 3AAIA 1VCTA 3RPUA 4IE0A 4X5TA 2X0LB 1E7PA 1UGOA 2DWGA 3RHWA 2P9BA 3P4QA 4I50E 5JR9C 5J0ZA 2XQ8A 3Q2MA 3HKCE 1IJ6A 3RLFF 3ZPOA 2PFVA 3BQKA 2XY8B 3PE0A 1E2AA 4HGAA 1HNWT 3AEDA 1M62A 3AECA 5HCMA 4TWHA 4Z90A 1SHZC 5FNVE 3PU8A 4WBNE 2FBWA 1VRBA 2J1DG 1SA0E 3UFEA 3PUXF 1WLXA 2HH7A 1U5PA 4LFAT 1VCSA 2LJLA 2RA1A 4PJNA 4GK5E 3RX6A 2W00A 1H7CA 3ONJA 3SRZA 4XBFB 4AKLA 5HEOA 2NW7A 5LMNT 3DP7A 3ZC1A 3JAEA 2NW9A 3OVUA 5AQJB 2WB5A 4J2CA 3LDQB 3ETUA 5HXHA 4X66T 1X9BA 2X9WA 4DR4T 3Q5XA 4CZZB 2DI4A 4GYSA 3NWIA 3IA3A 4PK4A 3PDYA 3I0OA 5BR8T 2ZM6T 1HF8A 4GOUA 3UT5E 2IC9A 1T98A 2UXCT 2WDQA 2OV9A 1NAFA 2IDOB 4Z91A 1HX8A 2DCFA
chains in the Genus database with same CATH topology
3EVYA 4TUYE 4O2BE 3U3IA 2VASA 2WSSV 2ES0A 1V9DA 4HKAA 5FP3A 2X67A 4OK0A 4YJ3E 4P0AA 3TKLB 2Y6XA 1IJ5A 5HXCA 2KWHA 5H6RB 4TX5A 3OYXA 3LBXA 1WRDA 3ZN0B 5LGNB 1US7B 2HPJA 4EAHA 2EHOA 4IE6A 2W61A 2WMOA 3N5LA 2RP4A 1ZKEA 3AA6B 3KV4A 4QXHB 4F6RC 2G0UA 2ODVA 4HE8A 2WM9A 3CX7B 3J9X1 3O1JA 1KNZA 1HTJF 5HAXA 3AVSA 4EYUA 3N9NA 3JC6C 3I1AA 5JDLA 2WAUA 4IIJE 2XAJB 4OHFA 2C0SA 1HS7A 4ISTA 4OFZA 3B57A 3Q5WA 1HG5A 3OYZA 2V7IA 1YD8G 3L3PA 1MIVA 4PJLA 4FJOA 4HN9A 4OYJA 3V5UA 1Z0PA 4OYKA 2L8KA 3F2EA 3ZMSB 2I59A 3RC3A 2W63A 1BR4A 3O1HA 2K48A 2V26A 3RRCA 2BVMA 3MA9A 3PU3A 4I4TE 3J7Yq 1O3XA 2MYSA 2XUEA 4ASKA 4DMWA 4X20E 3C98B 3KDSE 5HXSA 1D1BA 4ZS3A 3RH3A 1D1AA 3KV5A 3KV6A 5CB4E 3ZC0A 5IHYA 4ZI3C 4ZI3D 4H9SE 2Q9QC 2PBIA 2Q9QD 3E22E 4NUVA 4H63V 4IHJE 1MMAA 3SS1A 2C5KT 1LKXA 2KNDA 5L3CB 2NOXA 1G73A 4QX7B 2JRKA 5LGUB 4AQFA 5JDGA 1WYBA 2H7VC 4ISSA 4DBRA 3T8OA 4CXYA 2X66A 5JR9B 2ZM0A 3H37A 4MALA 3ZCIA 2PG8A 4I43B 5LP6E 2IW5B 4HTEA 4AKRB 1D0XA 2V7JA 3QC9A 3QUJA 4DVDA 2XQYA 2Z6EA 3PTRB 4KBMB 4O4LE 4NUUA 4YFSA 1ZHCA 2D5UA 2L3LA 5JR9A 1IAPA 3N9QA 3UUNA 3LFMA 3PUSA 4MFRA 4EIWA 4C90A 4EYYR 3HR0A 3PUGA 4EZ4A 2LM9A 3CX6B 3P8CD 4QXCB 3IF8B 4ANJA 3LK42 5DQWA 5CA0E 2CWOA 3D0TA 4P0BA 5LG4A 5L3BB 3FB2A 4BJMA 2VB6A 3RYIE 3I0QA 5EZYE 5JDFA 4B6XA 2DWKA 3NBXX 3KVBA 2YU2A 5A1LA 5JDMA 3CVRA 1FMWA 2LE8A 4X1IE 5FXXA 4A56A 3AAEB 3GWHA 5HWXA 2X9YA 5EK2A 5M4YA 3NRXA 2LOSA 3B13A 1ZEEA 5F8PA 2V7LA 5J2UE 4G63A 2LOPA 3ZYKA 2X51A 4KUMB 3LK3B 3LBXB 3ZLIA 3I9WA 3C50A 2EHOB 4DMVA 2LSIA 2X9HA 1FEWA 3UULA 3LJCA 2H7OA 3OJAA 3CWZB 3MXZA 3K3NA 2Q9QA 3UUXB 3MK7C 3NZPA 3ZMVB 1NWMX 2XTLA 2CM0A 1HCIA 3UTKA 5HXRA 3FBLA 1FMVA 5JDNA 5C8YE 4XAXB 4PNIA 3R84B 4M1PA 1OWAA 4JEHB 4XZCA 2A2FX 4QKNA 4PK5A 3DJBA 1UX5A 3KVAA 4JUYA 4O4IE 3K3QC 2N1GA 2PJQA 4UEMA 3HL6A 4CXXA 1BR1A 2W62A 4BAYB 3GN5A 4U74A 3FXEB 2IAKA 4PJMA 4PFOA 5BMVE 4L9IA 4WW0A 1OXZA 4KP3C 5LBQB 3UUMA 2CLYB 5LBMA 4G2AA 4ADZA 3HI2A 2CMRA 3EUHA 3O1IA 2E9XC 2E9XD 5FY1A 5LHGB 2XHEB 3E0ZA 5ETWA 4UVCB 5FY0A 2YK0A 2KMFA 3AA1B 1S94A 3BK9A 3CQGB 3L09A 1MMGA 3KBTA 2XAGB 3N2GE 4H9NC 3AA0B 4P09A 5L2LA 3RYHE 3HKBE 5IYZE 4PJJA 4ZOLE 2DLRA 2LHRA 3ZEFB 2JMKA 4L0RA 4AKGA 3ZYLA 5LHHB 4E7ZA 5TAOA 2LSKA 4CQIA 3RKOA 4AKHA 1YKEB 2L9QA 4AKIA 1FIOA 4EOZB 5FXZA 2X9XA 2CA5A 4U72A 1BR0A 2YINA 3FBZA 3S4UA 5KMGP 3WAJA 5JREA 4UELA 5EK3A 4AI6A 1X79A 3KBUA 3EDVA 5LHIB 4DO0A 5EK4A 4ZI2C 4ZI2D 1WYCA 2YU1A 2NW8A 2LT3A 1HFAA 2IC6A 2NP9A 3CX8B 4QXBB 2KWIB 5CA1E 3C4XA 3FXDB 1BR2A 4DNDA 2ZMAA 4UIGA 2YEVC 3SOLA 4L5GA 3KFWX 3ZCJA 5HYAA 4QHOA 5LA6E 5FY7A 5KDMC 4UF0B 4KMCA 5JRCA 3VU7H 2V7MA 1ZV4X 3N2OA 1AJ3A 4CXWA 3CMLA 5LCYA 2LSGA 5DQVA 2HPLA 4O2AE 1LVFA 1S35A 4IE7A 3ZN1B 3ZJ2A 4E7SA 5H6QB 2ACXA 4UVBB 1G8XA 3E08A 3QK6A 4TZ4C 2DNXA 1MMDA 2QGSA 2DHRA 4UF0A 4GIWA 1MIWA 4MBQA 2VWAA 3PUQA 3ZMTB 3MKDA 1LVKA 5FYMA 3ANWB 2MBGA 4Z8XA 5HWYA 4BJNA 2WBLA 5LXTE 3CPZA 5FXWA 2KLQA 1EZ3A 4PK6A 1HG2A 4YLHA 2E9XA 3IBPA 3N2KE 3R6NA 1YW0A 3ANWA 1QSDA 1WR6A 2Y8DA 5KX5E 5LYJE 2LHNA 5E0OA 3ZYMA 1MNDA 4YJ2E 4QX8B 3N9OA 2CE7A 4TN7B 3IEEA 3RRWA 3W15B 2Q9QB 2ZLYA 5L3EB 3OKQA 2W0GA 3HKDE 2C5JA 3ONXA 4UV9B 4MLKA 3AAAB 4X1KE 3HKEE 4H9QC 2BVLA 3HA4A 2VKDA 3C64A 4H9OC 3AB3B 4ERRA 1LRZA 3F57A 3SWHA 3EDUA 4PFPA 3C4WA 1CUNA 3O9XA 5J1GA 1MNEA 3RYFE 3MJXA 4MHCA 3GN5B 3NZQA 4N78D 5LNKA 3OBVE 4FI5A 4UXNB 4C91A 2ODUA 5FXVA 1YKHB 2V1DB 4WBOA 4O4JE 3AAIA 2MTQA 3PUAA 2Y48B 4YHJA 3RPUA 3WAKA 4IE0A 2X0LB 4GK0E 2SPCA 4JLEA 3N9LA 3M65A 5AFUL 2XAFB 2KXPB 2NTXA 4IE5A 5JDQA 2K24A 2KZ7B 5HXEA 2H3RA 4TV8E 2DWGA 3IHRA 1VOMA 4WNKA 2BDEA 2P9BA 2KINB 2LSYA 2V7KA 4H9PC 4I50E 4CI2B 5JR9C 3Q2MA 3HKCE 3LG7A 2N2NA 2VKJA 3KV9A 2XAHB 4HFVA 4O4HE 4QWNB 2VKOA 2ZM8A 5LOVE 3JC6D 5DJQC 3VHLA 3KINB 1IJ6A 3MZKB 3ZPOA 3F31A 2PFVA 3ZMZB 3BQKA 3N9MA 2E8IA 4K0UA 3PE0A 4HGAA 3I9YA 1D0YA 1U4QA 5JDHA 3A5XA 4ZI7E 1SHZC 2WMNA 5FNVE 3PU8A 3RC8A 1B7TA 3CQXC 4WBNE 2C5IT 5F3JA 3ETVA 4UVAB 4I55E 1VRBA 3RYCE 5ADXL 5L3GB 5JRCB 2J1DG 2M67A 3K8PC 3CKDA 4GYRA 4IE4A 3WI3A 2B1EA 1SA0E 4ILUA 3C51A 3ZJ1A 3UFEA 5LJNA 1WLXA 2HH7A 2LSJA 2XAQB 1U5PA 4HEAA 3U78A 2XASB 3C4ZA 1D1CA 2CWYA 4IDZA 1D0ZA 2JPFA 2LJLA 2RA1A 4ZHQE 2WWUA 2CXDA 2ZM2A 2KT9A 3H3AA 4GK5E 4JEUB 2W00A 4PJNA 3RX6A 4CI3B 1H7CA 3PURA 3SRZA 4XBFB 4AKLA 2VL8A 4AQGA 2GK9A 2EHOC 3V5SA 2EHOD 2CCQA 2NW7A 2VKHA 3DP7A 2K9AA 2BZBA 1E1HB 2A72A 4O8SA 2K5BB 3ZC1A 3DTOA 2E9XB 3GMIA 4EB6E 3LK2B 2D0TA 4EXTA 2NW9A 2NTYA 5GONE 4IGUA 3NRYA 2JMHA 2LEHA 4J2CA 5L3DB 2D2SA 3FHNA 1MIYA 5DABA 3ETUA 5HXHA 4BA9A 1UCUA 1QUUA 3AA7B 3K3OA 2X9WA 5JH7E 4ZS2A 5JQGE 2CXFA 4UV8B 3CQCB 4H9RC 5JVDE 2N9DA 3O4XE 3Q5XA 4TV9E 5LGTB 4PW8A 4CZZB 2DI4A 5LJMA 4GYSA 5FMNA 2CLYC 3MACA 5L3FB 3ZMUB 2X68A 4PK4A 1IZNB 3PDYA 1UX4A 2CXLA 2UXNB 3Q9DA 3VKHA 2MOZA 3AVRA 2JQQA 3I0OA 2NWBA 4AXPA 1MMNA 2D0UA 3N9PA 2A3DA 2OA5A 4DBQA 2UXXB 4H63H 3ESLA 2VK9A 1HF8A 4GOUA 3P7IA 3UT5E 3BQLA 2IC9A 4X1YE 1T98A 3BQIA 1Y64B 2JJ9A 4V1Av 1NAFA 2CEAA 4EZHA 4CI1B 3VKGA 3GA8A 4AQFC 5J2TE 4PAGA 1HX8A 1KK7A 2DCFA 2QA7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2X66 A;  2D0T A;  2NW9 A;  4U74 A;  2NWB A;  4HKA A;  4U72 A;  2D0U A;  2X67 A;  2V7J A;  2V7I A;  5EK3 A;  4PK6 A;  2V7M A;  1YW0 A;  2V7K A;  5ETW A;  5EK4 A;  5EK2 A;  2NW8 A;  3BK9 A;  2NW7 A;  1ZEE A;  3E08 A;  2NOX A;  4PK5 A;  4PW8 A;  2V7L A;  2X68 A; 
#chains in the Genus database with same CATH topology
 4TUY E;  4O2B E;  4U2Y A;  1V9D A;  4X62 T;  4YJ3 E;  2BBJ A;  2KWH A;  5H6R B;  3ZN0 B;  2K3W A;  2W61 A;  4YT0 A;  2ODV A;  4HE8 A;  2R6G F;  2BS3 A;  3AE6 A;  3I1A A;  5JDL A;  4HWI B;  4OHF A;  2C0S A;  3Q5W A;  3OYZ A;  2V7I A;  2WP9 A;  3PJA A;  4PJL A;  1XMQ T;  5L47 A;  1Z0P A;  2FJB A;  4GKK T;  1KEY A;  1BR4 A;  3O1H A;  4KHZ F;  3JCF A;  2V26 A;  2BVM A;  2CBJ A;  3KV5 A;  3KV6 A;  1OED B;  4X64 T;  3ZC0 A;  4H9S E;  3E22 E;  4ILA A;  3SS1 A;  5LB7 B;  4EED A;  1LKX A;  3QOF A;  4A97 A;  1T72 A;  1L0V A;  2KND A;  5L3C B;  2NOX A;  4QX7 B;  2JRK A;  1WYB A;  3T8O A;  5CJ5 A;  2ZM0 A;  2W4X A;  3FZL B;  5AQR B;  4MAL A;  2XQ3 A;  3ZCI A;  4HTE A;  2V7J A;  4KBM B;  3TLU A;  4YFS A;  2D5U A;  5JR9 A;  3UUN A;  3LFM A;  2YOE A;  2H89 A;  4C90 A;  2AXD S;  2CWO A;  3D0T A;  4BJM A;  3RYI E;  5EZY E;  2DWK A;  5A1L A;  2LE8 A;  3QNU A;  3AAE B;  1QLB A;  3B13 A;  1ZEE A;  4ZEY A;  2FUP A;  2X51 A;  4HWC A;  3LK3 B;  2FJA A;  2LSI A;  3VR8 A;  4U2Z A;  2BKN A;  3K3N A;  2Q9Q A;  1GQE A;  2RPA A;  3MK7 C;  2CBI A;  1OWA A;  4JEH B;  3LSV A;  3AEG A;  3DJB A;  3KVA A;  4O4I E;  3K3Q C;  2UXD T;  4UEM A;  3HL6 A;  1BR1 A;  4BAY B;  4U74 A;  3FXE B;  5BMV E;  1R8I A;  4TNW A;  2KSR A;  4KP3 C;  2CLY B;  3HI2 A;  2CMR A;  2VQF T;  2BS2 A;  2XHE B;  3E0Z A;  1DU2 A;  1S94 A;  2LLY A;  1HR0 T;  3EAB A;  4ZOL E;  3T1H T;  2DLR A;  3ZEF B;  2BG9 A;  3VRB A;  4AKG A;  2LSK A;  1FIO A;  5KMG P;  1J5W A;  1WR0 A;  5EK4 A;  5AQN B;  2UUC T;  1WYC A;  2LT3 A;  3CX8 B;  5CA1 E;  3AE3 A;  1XNR T;  4DND A;  2YEV C;  1KNR A;  1UUR A;  3KFW X;  2BKO A;  1W9R A;  4UF0 B;  4KMC A;  3N2O A;  5DQV A;  4DR1 T;  4YHH T;  1LVF A;  4AIS A;  3UFG A;  4ZZB A;  2WU5 A;  1MMD A;  2DHR A;  4MBQ A;  3PUQ A;  4NXN T;  3MKD A;  4LF6 T;  2XQA A;  5LXT E;  4ZZC A;  1EZ3 A;  4HFB A;  4PK6 A;  1HG2 A;  3ZT7 A;  2Y8D A;  5LYJ E;  3ZYM A;  1XZY A;  2BKP A;  4QX8 B;  2CE7 A;  3W15 B;  2ZLY A;  4DR2 T;  3A8Y C;  3OTO T;  2C5J A;  4UV9 B;  4MLK A;  4JI8 T;  4KX6 A;  4DV0 T;  3QB5 K;  1LRZ A;  3EDU A;  4PFP A;  3UQ4 A;  3CIR A;  2X0Y A;  1MNE A;  4IRE A;  2WY2 A;  3GN5 B;  3OBV E;  4C91 A;  1YKH B;  4JI0 T;  2MTQ A;  3PUA A;  3P4W A;  4GK0 E;  3P4P A;  2SPC A;  3M65 A;  5JDQ A;  4EEB A;  2K24 A;  5HXE A;  2V7K A;  2LSY A;  2N2N A;  4HFV A;  4QWN B;  2VKO A;  4NIQ A;  3JC6 D;  3VHL A;  3KIN B;  3AE2 A;  3F31 A;  3AE4 A;  2E8I A;  3I9Y A;  4JI4 T;  5L4H A;  5JDH A;  1YQ3 A;  1B7T A;  2C5I T;  2XQ5 A;  3FZH B;  5ADX L;  3WI3 A;  3C51 A;  1YQ4 A;  4JI7 T;  4HEA A;  2XM1 A;  2XAS B;  3C4Z A;  1D1C A;  4IDZ A;  4JBW F;  3X1D A;  5HEG A;  3PUR A;  3P4R A;  3V5S A;  2GK9 A;  2VKH A;  2CCQ A;  5CGM A;  2K9A A;  2K5B B;  3ZKR A;  4EGW A;  2E9X B;  2D0T A;  3SFE A;  5L3D B;  2D2S A;  1MIY A;  1UCU A;  1QUU A;  5JH7 E;  2XQ4 A;  5JQG E;  2CXF A;  2N9D A;  5LGT B;  1UX4 A;  3Q9D A;  5ABH A;  3AVR A;  2W67 A;  4TNV A;  4AXP A;  2D0U A;  4DBQ A;  1WCR A;  2UXX B;  2VK9 A;  2QRX A;  2MPK A;  3ZSS A;  2IUB A;  4LMJ A;  4IL4 A;  3GA8 A;  2CHN A;  4WZX A;  2JQH A;  2WWV A;  2VAS A;  5FP3 A;  3PV0 F;  4OK0 A;  4P0A A;  3OYX A;  2V8S V;  3LBX A;  1WRD A;  5LGN B;  1US7 B;  2AE9 A;  2EHO A;  3N5L A;  4QXH B;  1ZKE A;  2JQ9 A;  3RIF A;  1KNZ A;  1KFY A;  4EYU A;  2WAU A;  2WZH A;  1HS7 A;  4OFZ A;  3B57 A;  1YD8 G;  3L3P A;  4OYK A;  2L8K A;  2BG9 E;  3Q5E A;  4DR6 T;  4I4T E;  1O3X A;  2XUE A;  4ASK A;  4DMW A;  1D1B A;  1WFD A;  3PUV F;  2Q9Q C;  2Q9Q D;  1W09 A;  4IHJ E;  4NPP A;  2E5V A;  5LGU B;  5JDG A;  4ISS A;  4JI6 T;  5JR9 B;  1N34 T;  1D0X A;  3PTR B;  4O4L E;  1ZHC A;  3B5M A;  3FZM B;  2L3L A;  1SE7 A;  3UU5 A;  3N9Q A;  4DV7 T;  2X0H A;  4EYY R;  3PUG A;  3K1S A;  4ANJ A;  3LK4 2;  2BG9 C;  5DQW A;  4P0B A;  5JDF A;  3PUZ F;  1XDP A;  3ZYK A;  2W66 A;  4B3M T;  2WDV A;  3ZLI A;  4HFC A;  3I9W A;  2X9H A;  3JAF A;  4JI5 T;  2CM0 A;  1HCI A;  2XJ7 A;  4AQY T;  3UTK A;  3FBL A;  1FMV A;  5JDN A;  3R84 B;  3H3M A;  5JTG A;  3ZT6 A;  4CXX A;  4YTN A;  4NXM T;  2W62 A;  4PJM A;  4PFO A;  5ABF A;  1XMO T;  4WW0 A;  4IDP A;  1OXZ A;  5LBM A;  4UVC B;  4H9N C;  3N2G E;  3AA0 B;  1XNQ T;  4JI2 T;  3RYH E;  4LFC T;  5F5W A;  4B3R T;  2LHR A;  5AQQ B;  2JMK A;  5LHH B;  5TAO A;  4CQI A;  4AKH A;  3RKO A;  3NVO A;  5FXZ A;  4HFD A;  2YIN A;  5JRE A;  3S4U A;  3KBU A;  2XQ6 A;  5AQO B;  4LFB T;  3AEA A;  1FJG T;  2YU1 A;  2NW8 A;  2NP9 A;  2XSB A;  2BS4 A;  3FXD B;  1KNP A;  3ONL C;  4L5G A;  3ZCJ A;  5HYA A;  3VU7 H;  4O2A E;  3ZN1 B;  5H6Q B;  2ACX A;  1G8X A;  4GIW A;  1MIW A;  3ZMT B;  4LML A;  3PUW F;  3CPZ A;  1T7S A;  2W2U A;  3FZF B;  5ABE A;  2LHN A;  4I0U A;  3N9O A;  4U31 A;  3IEE A;  2WZI A;  5L3E B;  3OKQ A;  4KI0 F;  3ONX A;  4X1K E;  2VVN A;  3AAA B;  2BVL A;  3C64 A;  4ERR A;  3F57 A;  5LG3 A;  1CUN A;  4YSY A;  2E5L T;  4DV3 T;  4UXN B;  4JI1 T;  5HEH A;  2ODU A;  4O4J E;  4CN1 A;  5AQI B;  4YHJ A;  3PJA J;  3N9L A;  5AFU L;  2NTX A;  4IE5 A;  4LF4 T;  2KZ7 B;  4TV8 E;  1VOM A;  4H9P C;  4CI2 B;  3LG7 A;  2FJE A;  3KV9 A;  3AE8 A;  2XSA A;  2ZM8 A;  5LOV E;  3UU3 A;  3MZK B;  3OPC A;  4DID B;  3ZMZ B;  4K0U A;  1ZOY A;  1U4Q A;  3TLV A;  1HX1 B;  4ZI7 E;  3RC8 A;  3TLT A;  1N32 T;  5F3J A;  3ETV A;  4UVA B;  4DV1 T;  4U7I A;  5JRC B;  3K8P C;  2B1E A;  3ZJ1 A;  2LSJ A;  2QYW A;  2XAQ B;  2LM2 A;  2CWY A;  2WDR A;  5AQT B;  5AQK B;  4ZHQ E;  3H3A A;  2V6Y A;  4JEU B;  4CI3 B;  2MAW A;  5C2T A;  2VL8 A;  4AQG A;  2EHO C;  2EHO D;  2BZB A;  1E1H B;  1OED A;  3DTO A;  3GMI A;  4EXT A;  2NTY A;  2YDR A;  3NRY A;  2JMH A;  2LEH A;  3FHN A;  3VRA A;  3AA7 B;  4ILC A;  4UV8 B;  1NEK A;  3CQC B;  4H9R C;  4TV9 E;  4PW8 A;  5FMN A;  3P50 A;  5L3F B;  3TLS A;  1IZN B;  2CXL A;  2MOZ A;  5FL0 A;  2NWB A;  4IDN A;  1MMN A;  4LF8 T;  3N9P A;  4DR7 T;  2A3D A;  2OA5 A;  4LF7 T;  3ESL A;  3P7I A;  3BQL A;  3BQI A;  1Y64 B;  2JJ9 A;  4V1A v;  2CEA A;  4CI1 B;  2BBH A;  5AQH B;  2QA7 A;  2ACZ A;  3EVY A;  1NEN A;  2WU2 A;  4HWF A;  2ES0 A;  3UU8 A;  3TKL B;  1IJ5 A;  2V5D A;  5HXC A;  2YDS A;  4TX5 A;  2RP4 A;  3KV4 A;  2G0U A;  2WM9 A;  3CX7 B;  2D9D A;  3AVS A;  3L8R A;  4ILB A;  1I6Z A;  3N9N A;  3JC6 C;  2J62 A;  4IIJ E;  2XAJ B;  4IST A;  1HG5 A;  4HWD A;  4FJO A;  4OYJ A;  4UR9 A;  3F2E A;  3ZMS B;  2I59 A;  3RC3 A;  2W63 A;  3AXJ A;  2MYS A;  1HNZ T;  2NR4 A;  5HXS A;  3RH3 A;  1D1A A;  5IHY A;  4ZI3 C;  4ZI3 D;  2VUR A;  2HN1 A;  1MMA A;  3AE9 A;  4X65 T;  2WS3 A;  4AQF A;  1W0B A;  4DBR A;  2X66 A;  4TWF A;  4ZXL A;  5LP6 E;  2PG8 A;  4I43 B;  4AKR B;  3QC9 A;  4DVD A;  2Z6E A;  3UU4 A;  4A5X A;  4NUU A;  3RIU C;  3QB5 A;  4U3C A;  3G06 A;  3VR9 A;  2V5C A;  3PUS A;  4YTM A;  1J5E T;  3HR0 A;  4EZ4 A;  2WCA A;  3CX6 B;  3P8C D;  1ZP0 A;  4B3T T;  5LG4 A;  5L3B B;  3FB2 A;  2VB6 A;  3I0Q A;  2XQ9 A;  2M6B A;  4B6X A;  3NBX X;  2YU2 A;  1YXR A;  1CHU A;  4A56 A;  5EK2 A;  3NRX A;  2LOS A;  3EI0 A;  5F8P A;  2F4V T;  2V7L A;  5J2U E;  2LOP A;  3RKG A;  1FEW A;  5HEJ A;  3LJC A;  3OJA A;  5HCJ A;  4YSX A;  3MXZ A;  3UUX B;  3NZP A;  3ZMV B;  1NWM X;  2XTL A;  4DV6 T;  1M7K A;  5C8Y E;  4M1P A;  2A2F X;  1UX5 A;  2J4G A;  4DV5 T;  2WQY A;  5CFB A;  3GN5 A;  2B76 A;  4L9I A;  3UUM A;  4LF9 T;  4G2A A;  5AQG B;  4ADZ A;  5FY1 A;  5LHG B;  4DV4 T;  2YK0 A;  3L09 A;  3BK9 A;  3CQG B;  2IHR 1;  4P09 A;  3HKB E;  5IYZ E;  4JYA T;  4L0R A;  2E2A A;  3ZYL A;  4KHP T;  2LRL A;  4IT4 A;  1YKE B;  4AKI A;  1Z8U A;  4QH1 A;  4U72 A;  5FVL A;  3FBZ A;  4AI6 A;  4UEL A;  5EK3 A;  1Y01 A;  1JNR A;  2YDQ A;  3EDV A;  1N33 T;  1HNX T;  4AIU A;  4A98 A;  2IC6 A;  3C4X A;  1BR2 A;  4CN4 A;  5KXJ A;  2ZMA A;  4UIG A;  2CHO A;  3SOL A;  1IBL T;  4QHO A;  5LA6 E;  2V7M A;  1AJ3 A;  3CML A;  1S35 A;  3AEB A;  4IE7 A;  3EAM A;  2H88 A;  4UVB B;  1OED E;  3E08 A;  3QK6 A;  4TZ4 C;  3TLW A;  2VWA A;  4HWH A;  1LVK A;  5FYM A;  2MBG A;  4Z8X A;  5HWY A;  2LKH A;  5FXW A;  5AQL B;  2KLQ A;  4U33 A;  4P1N A;  4YLH A;  2E9X A;  5AQU B;  3N2K E;  3R6N A;  3ANW A;  5KX5 E;  5E0O A;  3NKZ A;  3RI5 A;  4TN7 B;  1KF6 A;  5AQF B;  3RRW A;  2Q9Q B;  3PUY F;  3HKE E;  2VKD A;  4H9O C;  2JQK A;  3C4W A;  3O9X A;  1UK5 A;  2A9U A;  5J1G A;  3RYF E;  3MJX A;  4N78 D;  1OED C;  5AQV B;  2V1D B;  4WBO A;  2Y48 B;  3WAK A;  3ZST A;  5HEU A;  4JLE A;  4CN6 A;  2XAF B;  2QVA A;  2KXP B;  2H3R A;  3RIU A;  3IHR A;  4WNK A;  2BG9 B;  2BDE A;  2DL1 A;  2KIN B;  3UQ7 A;  2VKJ A;  2XAH B;  4O4H E;  3RIA A;  4DR3 T;  5DJQ C;  2OLT A;  3AE5 A;  1I94 T;  3N9M A;  1D0Y A;  1W0A A;  3A5X A;  2WMN A;  3M3Z B;  3L39 A;  3CQX C;  4I55 E;  3RYC E;  5L3G B;  2M67 A;  4GYR A;  3CKD A;  4IE4 A;  2V6Y B;  4ILU A;  5IUX A;  5LJN A;  3U78 A;  1D0Z A;  2JPF A;  5L2L A;  2WWU A;  2CXD A;  2ZM2 A;  2KT9 A;  1JNZ A;  3RF1 A;  2LKG A;  2A72 A;  3CK6 A;  4O8S A;  4YY3 T;  4EB6 E;  3LK2 B;  5GON E;  4IGU A;  2M6I A;  3RQW A;  5DAB A;  4YSZ A;  4BA9 A;  3K3O A;  4ZS2 A;  4IDQ A;  5JVD E;  3O4X E;  4F8H A;  5LJM A;  2CLY C;  3MAC A;  2X68 A;  2UXN B;  4QH4 A;  3VKH A;  2JQQ A;  4OX9 T;  2XZE A;  4B3S T;  4HFE A;  4H63 H;  4X1Y E;  1J1J A;  2PTF A;  4EZH A;  3VKG A;  4AQF C;  5J2T E;  4PAG A;  1KK7 A;  4TWD A;  2UU9 T;  3U3I A;  2WSS V;  2CPT A;  4HKA A;  2X67 A;  4JV5 T;  2Y6X A;  2IIU A;  2HHH T;  3A7M A;  2HPJ A;  4EAH A;  4IE6 A;  4JI3 T;  2WMO A;  3AA6 B;  4F6R C;  3AE7 A;  3J9X 1;  3O1J A;  1HTJ F;  5HAX A;  4LMK A;  3UUB A;  2VVS A;  3AE1 A;  3AEF A;  1MIV A;  3RGL A;  3AXJ B;  4HN9 A;  1SUM B;  3V5U A;  4K0K T;  3P4S A;  1N36 T;  2K48 A;  3RRC A;  3MA9 A;  3PU3 A;  3J7Y q;  2UUA T;  4X20 E;  3C98 B;  3KDS E;  4ZS3 A;  5CB4 E;  3EHZ A;  2PBI A;  4QH5 A;  5AQP B;  1T8B A;  4H63 V;  4NUV A;  2C5K T;  3ABV A;  1G73 A;  2H7V C;  2IML A;  2J47 A;  3AEE A;  3SFD A;  5FVK A;  4CXY A;  3H37 A;  2JIW A;  2IW5 B;  3QUJ A;  1IBM T;  2XQY A;  5C3J A;  1IAP A;  4MFR A;  4EIW A;  4DV2 T;  2LM9 A;  4QXC B;  3IF8 B;  5CA0 E;  3T1Y T;  2UUB T;  3KVB A;  5JDM A;  3CVR A;  1FMW A;  4X1I E;  4U7Y A;  5FXX A;  3GWH A;  2YKS A;  5HWX A;  2X9Y A;  5M4Y A;  4G63 A;  5AQS B;  4YXD A;  4KUM B;  1XWM A;  3LBX B;  5L4E A;  3C50 A;  2EHO B;  4DMV A;  3UUL A;  2H7O A;  3CWZ B;  4IDO A;  5HXR A;  4XAX B;  4PNI A;  5FKY A;  4XZC A;  4QKN A;  4PK5 A;  4JUY A;  2UXB T;  2XPK A;  2N1G A;  2PJQ A;  3FZK B;  2I0M A;  2IAK A;  2CRB A;  4HFI A;  3ZT5 A;  5LBQ B;  4DUY T;  3O1I A;  3EUH A;  2E9X C;  2E9X D;  5ETW A;  5FY0 A;  2XM2 A;  2KMF A;  3AA1 B;  3ZMU B;  1MMG A;  3KBT A;  2XAG B;  4PJJ A;  4E7Z A;  2L9Q A;  4EOZ B;  4Q25 A;  2X9X A;  2CA5 A;  1BR0 A;  3WAJ A;  4EV6 A;  1X79 A;  1XDO A;  5LHI B;  4DUZ T;  4DO0 A;  4ZI2 C;  4ZI2 D;  1IBK T;  1HFA A;  4QXB B;  2V6X A;  2KWI B;  4COF A;  2VL0 A;  2VQE T;  3JAD A;  5ABG A;  2I6H A;  5FY7 A;  5KDM C;  5JRC A;  1ZV4 X;  4CXW A;  5LCY A;  3UU6 A;  2LSG A;  4DR5 T;  2HPL A;  4YTP A;  3ZJ2 A;  2YN6 A;  4E7S A;  2DNX A;  2QGS A;  4UF0 A;  3ANW B;  4BJN A;  2WBL A;  2LRK A;  3IBP A;  1YW0 A;  1QSD A;  1WR6 A;  1MND A;  4YJ2 E;  3Q5D A;  2W0G A;  3HKD E;  2FJD A;  1UUS A;  4H9Q C;  2XQ7 A;  3HA4 A;  2HN2 A;  4WYV A;  3AB3 B;  5AQM B;  3SWH A;  5FL1 A;  4IL9 A;  5LMU T;  4HFH A;  4MHC A;  4GKJ T;  3NZQ A;  4LF5 T;  5ABF B;  5IWA T;  5LNK A;  4FI5 A;  5FXV A;  3RQU A;  3AAI A;  1VCT A;  3RPU A;  4IE0 A;  4X5T A;  2X0L B;  1E7P A;  1UGO A;  2DWG A;  3RHW A;  2P9B A;  3P4Q A;  4I50 E;  5JR9 C;  5J0Z A;  2XQ8 A;  3Q2M A;  3HKC E;  1IJ6 A;  3RLF F;  3ZPO A;  2PFV A;  3BQK A;  2XY8 B;  3PE0 A;  1E2A A;  4HGA A;  1HNW T;  3AED A;  1M62 A;  3AEC A;  5HCM A;  4TWH A;  4Z90 A;  1SHZ C;  5FNV E;  3PU8 A;  4WBN E;  2FBW A;  1VRB A;  2J1D G;  1SA0 E;  3UFE A;  3PUX F;  1WLX A;  2HH7 A;  1U5P A;  4LFA T;  1VCS A;  2LJL A;  2RA1 A;  4PJN A;  4GK5 E;  3RX6 A;  2W00 A;  1H7C A;  3ONJ A;  3SRZ A;  4XBF B;  4AKL A;  5HEO A;  2NW7 A;  5LMN T;  3DP7 A;  3ZC1 A;  3JAE A;  2NW9 A;  3OVU A;  5AQJ B;  2WB5 A;  4J2C A;  3LDQ B;  3ETU A;  5HXH A;  4X66 T;  1X9B A;  2X9W A;  4DR4 T;  3Q5X A;  4CZZ B;  2DI4 A;  4GYS A;  3NWI A;  3IA3 A;  4PK4 A;  3PDY A;  3I0O A;  5BR8 T;  2ZM6 T;  1HF8 A;  4GOU A;  3UT5 E;  2IC9 A;  1T98 A;  2UXC T;  2WDQ A;  2OV9 A;  1NAF A;  2IDO B;  4Z91 A;  1HX8 A;  2DCF A; 
#chains in the Genus database with same CATH homology
 3EVY A;  4TUY E;  4O2B E;  3U3I A;  2VAS A;  2WSS V;  2ES0 A;  1V9D A;  4HKA A;  5FP3 A;  2X67 A;  4OK0 A;  4YJ3 E;  4P0A A;  3TKL B;  2Y6X A;  1IJ5 A;  5HXC A;  2KWH A;  5H6R B;  4TX5 A;  3OYX A;  3LBX A;  1WRD A;  3ZN0 B;  5LGN B;  1US7 B;  2HPJ A;  4EAH A;  2EHO A;  4IE6 A;  2W61 A;  2WMO A;  3N5L A;  2RP4 A;  1ZKE A;  3AA6 B;  3KV4 A;  4QXH B;  4F6R C;  2G0U A;  2ODV A;  4HE8 A;  2WM9 A;  3CX7 B;  3J9X 1;  3O1J A;  1KNZ A;  1HTJ F;  5HAX A;  3AVS A;  4EYU A;  3N9N A;  3JC6 C;  3I1A A;  5JDL A;  2WAU A;  4IIJ E;  2XAJ B;  4OHF A;  2C0S A;  1HS7 A;  4IST A;  4OFZ A;  3B57 A;  3Q5W A;  1HG5 A;  3OYZ A;  2V7I A;  1YD8 G;  3L3P A;  1MIV A;  4PJL A;  4FJO A;  4HN9 A;  4OYJ A;  3V5U A;  1Z0P A;  4OYK A;  2L8K A;  3F2E A;  3ZMS B;  2I59 A;  3RC3 A;  2W63 A;  1BR4 A;  3O1H A;  2K48 A;  2V26 A;  3RRC A;  2BVM A;  3MA9 A;  3PU3 A;  4I4T E;  3J7Y q;  1O3X A;  2MYS A;  2XUE A;  4ASK A;  4DMW A;  4X20 E;  3C98 B;  3KDS E;  5HXS A;  1D1B A;  4ZS3 A;  3RH3 A;  1D1A A;  3KV5 A;  3KV6 A;  5CB4 E;  3ZC0 A;  5IHY A;  4ZI3 C;  4ZI3 D;  4H9S E;  2Q9Q C;  2PBI A;  2Q9Q D;  3E22 E;  4NUV A;  4H63 V;  4IHJ E;  1MMA A;  3SS1 A;  2C5K T;  1LKX A;  2KND A;  5L3C B;  2NOX A;  1G73 A;  4QX7 B;  2JRK A;  5LGU B;  4AQF A;  5JDG A;  1WYB A;  2H7V C;  4ISS A;  4DBR A;  3T8O A;  4CXY A;  2X66 A;  5JR9 B;  2ZM0 A;  3H37 A;  4MAL A;  3ZCI A;  2PG8 A;  4I43 B;  5LP6 E;  2IW5 B;  4HTE A;  4AKR B;  1D0X A;  2V7J A;  3QC9 A;  3QUJ A;  4DVD A;  2XQY A;  2Z6E A;  3PTR B;  4KBM B;  4O4L E;  4NUU A;  4YFS A;  1ZHC A;  2D5U A;  2L3L A;  5JR9 A;  1IAP A;  3N9Q A;  3UUN A;  3LFM A;  3PUS A;  4MFR A;  4EIW A;  4C90 A;  4EYY R;  3HR0 A;  3PUG A;  4EZ4 A;  2LM9 A;  3CX6 B;  3P8C D;  4QXC B;  3IF8 B;  4ANJ A;  3LK4 2;  5DQW A;  5CA0 E;  2CWO A;  3D0T A;  4P0B A;  5LG4 A;  5L3B B;  3FB2 A;  4BJM A;  2VB6 A;  3RYI E;  3I0Q A;  5EZY E;  5JDF A;  4B6X A;  2DWK A;  3NBX X;  3KVB A;  2YU2 A;  5A1L A;  5JDM A;  3CVR A;  1FMW A;  2LE8 A;  4X1I E;  5FXX A;  4A56 A;  3AAE B;  3GWH A;  5HWX A;  2X9Y A;  5EK2 A;  5M4Y A;  3NRX A;  2LOS A;  3B13 A;  1ZEE A;  5F8P A;  2V7L A;  5J2U E;  4G63 A;  2LOP A;  3ZYK A;  2X51 A;  4KUM B;  3LK3 B;  3LBX B;  3ZLI A;  3I9W A;  3C50 A;  2EHO B;  4DMV A;  2LSI A;  2X9H A;  1FEW A;  3UUL A;  3LJC A;  2H7O A;  3OJA A;  3CWZ B;  3MXZ A;  3K3N A;  2Q9Q A;  3UUX B;  3MK7 C;  3NZP A;  3ZMV B;  1NWM X;  2XTL A;  2CM0 A;  1HCI A;  3UTK A;  5HXR A;  3FBL A;  1FMV A;  5JDN A;  5C8Y E;  4XAX B;  4PNI A;  3R84 B;  4M1P A;  1OWA A;  4JEH B;  4XZC A;  2A2F X;  4QKN A;  4PK5 A;  3DJB A;  1UX5 A;  3KVA A;  4JUY A;  4O4I E;  3K3Q C;  2N1G A;  2PJQ A;  4UEM A;  3HL6 A;  4CXX A;  1BR1 A;  2W62 A;  4BAY B;  3GN5 A;  4U74 A;  3FXE B;  2IAK A;  4PJM A;  4PFO A;  5BMV E;  4L9I A;  4WW0 A;  1OXZ A;  4KP3 C;  5LBQ B;  3UUM A;  2CLY B;  5LBM A;  4G2A A;  4ADZ A;  3HI2 A;  2CMR A;  3EUH A;  3O1I A;  2E9X C;  2E9X D;  5FY1 A;  5LHG B;  2XHE B;  3E0Z A;  5ETW A;  4UVC B;  5FY0 A;  2YK0 A;  2KMF A;  3AA1 B;  1S94 A;  3BK9 A;  3CQG B;  3L09 A;  1MMG A;  3KBT A;  2XAG B;  3N2G E;  4H9N C;  3AA0 B;  4P09 A;  5L2L A;  3RYH E;  3HKB E;  5IYZ E;  4PJJ A;  4ZOL E;  2DLR A;  2LHR A;  3ZEF B;  2JMK A;  4L0R A;  4AKG A;  3ZYL A;  5LHH B;  4E7Z A;  5TAO A;  2LSK A;  4CQI A;  3RKO A;  4AKH A;  1YKE B;  2L9Q A;  4AKI A;  1FIO A;  4EOZ B;  5FXZ A;  2X9X A;  2CA5 A;  4U72 A;  1BR0 A;  2YIN A;  3FBZ A;  3S4U A;  5KMG P;  3WAJ A;  5JRE A;  4UEL A;  5EK3 A;  4AI6 A;  1X79 A;  3KBU A;  3EDV A;  5LHI B;  4DO0 A;  5EK4 A;  4ZI2 C;  4ZI2 D;  1WYC A;  2YU1 A;  2NW8 A;  2LT3 A;  1HFA A;  2IC6 A;  2NP9 A;  3CX8 B;  4QXB B;  2KWI B;  5CA1 E;  3C4X A;  3FXD B;  1BR2 A;  4DND A;  2ZMA A;  4UIG A;  2YEV C;  3SOL A;  4L5G A;  3KFW X;  3ZCJ A;  5HYA A;  4QHO A;  5LA6 E;  5FY7 A;  5KDM C;  4UF0 B;  4KMC A;  5JRC A;  3VU7 H;  2V7M A;  1ZV4 X;  3N2O A;  1AJ3 A;  4CXW A;  3CML A;  5LCY A;  2LSG A;  5DQV A;  2HPL A;  4O2A E;  1LVF A;  1S35 A;  4IE7 A;  3ZN1 B;  3ZJ2 A;  4E7S A;  5H6Q B;  2ACX A;  4UVB B;  1G8X A;  3E08 A;  3QK6 A;  4TZ4 C;  2DNX A;  1MMD A;  2QGS A;  2DHR A;  4UF0 A;  4GIW A;  1MIW A;  4MBQ A;  2VWA A;  3PUQ A;  3ZMT B;  3MKD A;  1LVK A;  5FYM A;  3ANW B;  2MBG A;  4Z8X A;  5HWY A;  4BJN A;  2WBL A;  5LXT E;  3CPZ A;  5FXW A;  2KLQ A;  1EZ3 A;  4PK6 A;  1HG2 A;  4YLH A;  2E9X A;  3IBP A;  3N2K E;  3R6N A;  1YW0 A;  3ANW A;  1QSD A;  1WR6 A;  2Y8D A;  5KX5 E;  5LYJ E;  2LHN A;  5E0O A;  3ZYM A;  1MND A;  4YJ2 E;  4QX8 B;  3N9O A;  2CE7 A;  4TN7 B;  3IEE A;  3RRW A;  3W15 B;  2Q9Q B;  2ZLY A;  5L3E B;  3OKQ A;  2W0G A;  3HKD E;  2C5J A;  3ONX A;  4UV9 B;  4MLK A;  3AAA B;  4X1K E;  3HKE E;  4H9Q C;  2BVL A;  3HA4 A;  2VKD A;  3C64 A;  4H9O C;  3AB3 B;  4ERR A;  1LRZ A;  3F57 A;  3SWH A;  3EDU A;  4PFP A;  3C4W A;  1CUN A;  3O9X A;  5J1G A;  1MNE A;  3RYF E;  3MJX A;  4MHC A;  3GN5 B;  3NZQ A;  4N78 D;  5LNK A;  3OBV E;  4FI5 A;  4UXN B;  4C91 A;  2ODU A;  5FXV A;  1YKH B;  2V1D B;  4WBO A;  4O4J E;  3AAI A;  2MTQ A;  3PUA A;  2Y48 B;  4YHJ A;  3RPU A;  3WAK A;  4IE0 A;  2X0L B;  4GK0 E;  2SPC A;  4JLE A;  3N9L A;  3M65 A;  5AFU L;  2XAF B;  2KXP B;  2NTX A;  4IE5 A;  5JDQ A;  2K24 A;  2KZ7 B;  5HXE A;  2H3R A;  4TV8 E;  2DWG A;  3IHR A;  1VOM A;  4WNK A;  2BDE A;  2P9B A;  2KIN B;  2LSY A;  2V7K A;  4H9P C;  4I50 E;  4CI2 B;  5JR9 C;  3Q2M A;  3HKC E;  3LG7 A;  2N2N A;  2VKJ A;  3KV9 A;  2XAH B;  4HFV A;  4O4H E;  4QWN B;  2VKO A;  2ZM8 A;  5LOV E;  3JC6 D;  5DJQ C;  3VHL A;  3KIN B;  1IJ6 A;  3MZK B;  3ZPO A;  3F31 A;  2PFV A;  3ZMZ B;  3BQK A;  3N9M A;  2E8I A;  4K0U A;  3PE0 A;  4HGA A;  3I9Y A;  1D0Y A;  1U4Q A;  5JDH A;  3A5X A;  4ZI7 E;  1SHZ C;  2WMN A;  5FNV E;  3PU8 A;  3RC8 A;  1B7T A;  3CQX C;  4WBN E;  2C5I T;  5F3J A;  3ETV A;  4UVA B;  4I55 E;  1VRB A;  3RYC E;  5ADX L;  5L3G B;  5JRC B;  2J1D G;  2M67 A;  3K8P C;  3CKD A;  4GYR A;  4IE4 A;  3WI3 A;  2B1E A;  1SA0 E;  4ILU A;  3C51 A;  3ZJ1 A;  3UFE A;  5LJN A;  1WLX A;  2HH7 A;  2LSJ A;  2XAQ B;  1U5P A;  4HEA A;  3U78 A;  2XAS B;  3C4Z A;  1D1C A;  2CWY A;  4IDZ A;  1D0Z A;  2JPF A;  2LJL A;  2RA1 A;  4ZHQ E;  2WWU A;  2CXD A;  2ZM2 A;  2KT9 A;  3H3A A;  4GK5 E;  4JEU B;  2W00 A;  4PJN A;  3RX6 A;  4CI3 B;  1H7C A;  3PUR A;  3SRZ A;  4XBF B;  4AKL A;  2VL8 A;  4AQG A;  2GK9 A;  2EHO C;  3V5S A;  2EHO D;  2CCQ A;  2NW7 A;  2VKH A;  3DP7 A;  2K9A A;  2BZB A;  1E1H B;  2A72 A;  4O8S A;  2K5B B;  3ZC1 A;  3DTO A;  2E9X B;  3GMI A;  4EB6 E;  3LK2 B;  2D0T A;  4EXT A;  2NW9 A;  2NTY A;  5GON E;  4IGU A;  3NRY A;  2JMH A;  2LEH A;  4J2C A;  5L3D B;  2D2S A;  3FHN A;  1MIY A;  5DAB A;  3ETU A;  5HXH A;  4BA9 A;  1UCU A;  1QUU A;  3AA7 B;  3K3O A;  2X9W A;  5JH7 E;  4ZS2 A;  5JQG E;  2CXF A;  4UV8 B;  3CQC B;  4H9R C;  5JVD E;  2N9D A;  3O4X E;  3Q5X A;  4TV9 E;  5LGT B;  4PW8 A;  4CZZ B;  2DI4 A;  5LJM A;  4GYS A;  5FMN A;  2CLY C;  3MAC A;  5L3F B;  3ZMU B;  2X68 A;  4PK4 A;  1IZN B;  3PDY A;  1UX4 A;  2CXL A;  2UXN B;  3Q9D A;  3VKH A;  2MOZ A;  3AVR A;  2JQQ A;  3I0O A;  2NWB A;  4AXP A;  1MMN A;  2D0U A;  3N9P A;  2A3D A;  2OA5 A;  4DBQ A;  2UXX B;  4H63 H;  3ESL A;  2VK9 A;  1HF8 A;  4GOU A;  3P7I A;  3UT5 E;  3BQL A;  2IC9 A;  4X1Y E;  1T98 A;  3BQI A;  1Y64 B;  2JJ9 A;  4V1A v;  1NAF A;  2CEA A;  4EZH A;  4CI1 B;  3VKG A;  3GA8 A;  4AQF C;  5J2T E;  4PAG A;  1HX8 A;  1KK7 A;  2DCF A;  2QA7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...