2D9DA

Solution structure of the bag domain (275-350) of bag-family molecular chaperone regulator-5
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
89
structure length
89
Chain Sequence
b'GSSGSSGSILKIEKVLKRMREIKNELLQAQNPSELYLSSKTELQGLIGQLDEVSLEKNPCIREARRRAVIEVQTLITYIDLKESGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BAG family molecular chaperone regulator 5
molecule tags Chaperone
source organism Homo sapiens
publication title The C-terminal BAG domain of BAG5 induces conformational changes of the Hsp70 nucleotide-binding domain for ADP-ATP exchange
pubmed doi rcsb
total genus 23
structure length 89
sequence length 89
ec nomenclature
pdb deposition date 2005-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02179 BAG BAG domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.120 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 BAG domain 2d9dA00
4HWHA 2D9DA 1M7KA 3FZFB 5AQRB 1M62A 3A8YC 5AQMB 5AQHB 3FZMB 3FZKB 3LDQB 4HWDA 5AQPB 5AQIB 5AQFB 5AQSB 3FZHB 5AQTB 4HWFA 1I6ZA 5AQNB 3FZLB 5AQVB 5AQQB 5AQGB 1T7SA 5AQUB 5AQLB 4HWCA 1UK5A 5AQKB 1HX1B 1UGOA 5AQJB 5AQOB 4HWIB 3M3ZB
chains in the Genus database with same CATH superfamily
4HWHA 4MFRA 4JYAT 1WFDA 2W00A 2E9XD 4TWDA 2FJEA 1BR2A 3HKCE 3BK9A 3TLTA 4IDNA 3UFEA 1MMNA 2W0GA 1HCIA 3AEGA 3RYFE 2AXDS 3EABA 4B3RT 2VL8A 1G8XA 1H7CA 2WDQA 1YKHB 2C5JA 3AXJB 1VCTA 2Y8DA 4O8SA 5C8YE 2UXCT 2DWGA 1US7B 2H7OA 1KNRA 1VOMA 2LM2A 1J5WA 2OLTA 2XAQB 4JUYA 3OTOT 2D0TA 5LB7B 3UT5E 5J2TE 4LF6T 4ZI7E 4DR1T 3FHNA 4ILBA 5CA1E 3RQUA 2L9QA 2XAFB 5E0OA 2XHEB 3CX7B 2XASB 5LMUT 4O4HE 2W67A 3N9QA 5FY0A 1XNRT 4DR4T 5CB4E 2N9DA 2IHR1 5JREA 2ZM8A 3MK7C 3AVRA 3AE4A 1MNEA 3O1IA 4DIDB 2PJQA 3PV0F 3AB3B 3CIRA 3HKEE 4QX7B 4TNWA 4AIUA 4EEDA 1J5ET 3F31A 3Q9DA 5L3EB 4OHFA 2PTFA 3H37A 4QXHB 2CHOA 2ZLYA 1XDOA 4AXPA 2PFVA 2Y6XA 3AE8A 2FJDA 5FXVA 4DV4T 4JI0T 5L3DB 3KVAA 4I0UA 1MIWA 2FBWA 2VL0A 3LK42 4IHJE 3PUWF 2DL1A 2XAJB 5L3FB 2ODUA 3RIAA 2G0UA 3IBPA 4JBWF 4ZI2D 2C5KT 3AEFA 4LMJA 4PAGA 5JQGE 4WZXA 2KNDA 2LJLA 4I4TE 4UR9A 4B6XA 2DCFA 4H63V 4OYJA 2BG9C 3ZT6A 2BKPA 2W2UA 2A3DA 2WQYA 5LBQB 3RC3A 4CI2B 1BR0A 4YFSA 3RKGA 3T1HT 4CI1B 2VQET 1Z0PA 3CVRA 2CXLA 4YTMA 2XSBA 3ZLIA 2DI4A 2MPKA 4IE7A 5AQMB 5HCJA 3ZYLA 3AE1A 3N2KE 5F3JA 4QH4A 4IDZA 3ZN0B 3RLFF 4X64T 3JAEA 3UU6A 1QLBA 2QA7A 2X51A 2CLYB 1V9DA 2K24A 3FZHB 3B13A 3A7MA 5JR9B 3AE9A 3ABVA 1MIVA 4YHJA 4BAYB 4LFBT 4O4IE 4IIJE 2XQ9A 4KHZF 5AQVB 3RKOA 2KMFA 3ONLC 1U5PA 4U74A 3C64A 3PUXF 1WYCA 3UU4A 1JNRA 3IA3A 2WBLA 2BG9E 3C4XA 3P4RA 4U7IA 3RRCA 1SHZC 4PJJA 2J1DG 4MALA 3UUMA 2VVSA 3LG7A 5LYJE 1W0BA 1IJ6A 1XZYA 2QYWA 2FJAA 4UV8B 4EXTA 4UVCB 5A1LA 4DR7T 4O4JE 2Q9QD 2YEVC 4L9IA 5DJQC 5DQVA 4ZS3A 5AQRB 1FMVA 1M62A 3DP7A 3I0OA 2X9HA 3QB5K 4YLHA 4BA9A 5HWXA 5JRCA 1S94A 5HXRA 5LG3A 5LNKA 5KXJA 1IAPA 2NOXA 3FXEB 2NTXA 2XM2A 3AE5A 3K8PC 2IMLA 2LSGA 3KINB 3H3MA 3T8OA 4I50E 3AAEB 2BS3A 2WCAA 3E08A 3UTKA 5LG4A 3RGLA 1VCSA 4AKLA 3L3PA 2BBJA 5L4HA 4AKRB 2JMHA 2NTYA 1D1AA 1U4QA 3LBXA 4PJLA 1FEWA 4OFZA 4WBNE 1HS7A 2EHOC 4GYRA 2JPFA 4LF7T 3M65A 3OYZA 2E9XC 2KLQA 3Q5EA 3HKDE 4H9RC 3ETVA 4A98A 1G73A 2DLRA 4DR6T 2CBJA 2X0HA 2DHRA 2JQKA 3PUAA 3PURA 4IDPA 1OEDE 4U31A 1ZEEA 3VR8A 2LKHA 2LSJA 3FBZA 4U2YA 3VKGA 1N34T 4JI3T 5JDHA 1ZV4X 3A8YC 2HN1A 3RPUA 3ZSTA 2JQQA 2J4GA 2YOEA 2R6GF 3CWZB 3K1SA 3RX6A 2PBIA 2WM9A 4K0UA 2V6YB 4YJ2E 2W61A 1OEDC 4JI8T 4X66T 1HR0T 4GK5E 3PU3A 2Q9QC 3Q5WA 2JJ9A 4HFBA 5AQIB 3SFDA 2UUBT 2BG9B 4JI6T 4QKNA 3UFGA 4AISA 3SWHA 3CQGB 4DR2T 4Z8XA 2BKOA 2WZIA 4AI6A 4EAHA 2K9AA 3FZLB 2WP9A 5C2TA 5J0ZA 2HHHT 3ZJ2A 4NPPA 4H63H 2J62A 2V26A 3GWHA 4AKIA 2D5UA 4LMLA 2KZ7B 1CHUA 3K3QC 3U78A 4B3ST 4U33A 4O4LE 3SRZA 2KWHA 2LHRA 2V7LA 4HWIB 2W66A 5HXSA 2JQ9A 3AE6A 3G06A 3KV6A 2MOZA 3X1DA 1N33T 4AKHA 4ANJA 1MMAA 5JTGA 3AE7A 3CK6A 1GQEA 4Q25A 4G63A 4UEMA 3AEEA 5CJ5A 1N32T 3C4ZA 4HTEA 5AFUL 4TV8E 4HFEA 2K5BB 2XQ6A 1IBKT 4YJ3E 5HCMA 1LKXA 5LJNA 2I6HA 2LKGA 2BVMA 2NW8A 4IL4A 1B7TA 5FXXA 2I59A 4Z90A 4JI5T 3N2OA 1Z8UA 3V5SA 2C5IT 2IC9A 4HGAA 2X0LB 4JEUB 1XMOT 2XQ7A 3K3NA 3RIUA 2JIWA 5AQUB 4YSZA 5AQLB 1SA0E 2XY8B 3SS1A 3ZYKA 4DBRA 3LJCA 1Y64B 4DV5T 4ILUA 1WLXA 5JDQA 3PJAJ 3N9NA 3M3ZB 2NW7A 3RYIE 4A56A 5IUXA 4HE8A 2GK9A 1IZNB 2Q9QB 5LP6E 3HKBE 5LGTB 1OEDB 2AE9A 4X1IE 2XQ5A 5FMNA 1HNWT 5L47A 2NWBA 3MACA 2YU2A 2W63A 4UF0A 1HNXT 1QSDA 5KDMC 3ZC0A 2H7VC 2UXNB 3AA0B 3FZKB 4HWDA 5FXWA 4P0AA 1MMGA 4TX5A 2ES0A 4C90A 1D1BA 3O9XA 1D0ZA 3RC8A 2YKSA 5C3JA 1UURA 4COFA 3HA4A 4FI5A 2A2FX 2E9XB 2WDRA 2XQAA 5EK2A 3AECA 3V5UA 3PUGA 2LE8A 3MXZA 5AQQB 3B57A 3UUXB 4P1NA 2UU9T 4KBMB 5IWAT 1WCRA 2LRLA 4EV6A 3ZPOA 1KEYA 2IDOB 1OXZA 4UXNB 1T8BA 5AQOB 4EB6E 1NWMX 3AXJA 3OKQA 2ZM2A 4IE4A 4IE0A 2X0YA 5FVLA 4IE5A 4AQFA 2W62A 2XUEA 1BR4A 1XNQT 1MMDA 2VKDA 2EHOB 3E22E 3U3IA 2WU5A 4DR3T 3UU3A 5AQHB 1R8IA 4NUUA 2YK0A 2MTQA 3CPZA 4PFOA 5L3BB 3KV5A 3D0TA 1EZ3A 5JR9A 2JRKA 3UULA 5AQFB 1S35A 2X9XA 5LXTE 3BQIA 1J1JA 3PUZF 4HFIA 3K3OA 4AQYT 3A5XA 1YKEB 3NWIA 1WYBA 5TAOA 2KSRA 5LCYA 2BZBA 1W09A 2V6YA 4AKGA 3N9OA 4H9OC 4HWFA 4YY3T 3MZKB 2L8KA 4KHPT 3NKZA 4PJMA 2B1EA 2HH7A 2BS4A 4ILAA 2XJ7A 4L5GA 4UV9B 2MYSA 3GN5B 5FY7A 4K0KT 4DV1T 5JR9C 3L09A 3N5LA 3ONJA 4DUYT 3VHLA 2WU2A 3OBVE 2VWAA 2LSIA 1YQ3A 4QXCB 5DABA 1KFYA 2XQ3A 2LSYA 3HI2A 3P8CD 3AA6B 3IEEA 4HFCA 4KUMB 4U72A 5H6QB 4AQFC 1HG2A 4DVDA 4TUYE 4YTPA 5EK3A 1IJ5A 4H9SE 1IBMT 1OEDA 3LSVA 3CX8B 1JNZA 3UUBA 2J47A 2CHNA 2Q9QA 3LK2B 3F2EA 5LBMA 3P4QA 4WNKA 2ACXA 3NZPA 1IBLT 3TLSA 4IDOA 5JDGA 2CLYC 3FXDB 5HWYA 2V1DB 3TLUA 4CQIA 3RHWA 3MA9A 4O2BE 1QUUA 3VR9A 2QGSA 3W15B 1W0AA 4E7SA 1HG5A 3AEDA 3QNUA 2WWUA 1E1HB 2RP4A 1BR1A 2WS3A 4PFPA 3J9X1 2YINA 1HX8A 2C0SA 1UUSA 3MKDA 3ZMTB 2ZM6T 5JRCB 3WAKA 1SE7A 2W4XA 3GMIA 3ESLA 2WMNA 3L39A 4P09A 3QK6A 4QHOA 5FL0A 5IHYA 2CPTA 1HX1B 3PTRB 4LFCT 5ABEA 2HPLA 3ZMVB 3I9WA 5ABFB 5HXCA 3ZC1A 2CMRA 2D9DA 3KBTA 3EDVA 3VRAA 4EYYR 3T1YT 2M6IA 4EIWA 4KP3C 4WYVA 3RYCE 5EZYE 5JDLA 2H89A 1Y01A 3UU8A 3KV9A 3N9LA 1YW0A 2WMOA 2VASA 4J2CA 4PW8A 4ZZCA 4QWNB 4DV6T 4IE6A 3CMLA 3JAFA 1WRDA 1ZP0A 2X68A 4ZXLA 1XWMA 5HEHA 4DV0T 4ISSA 4MLKA 2YU1A 4IDQA 5AQTB 5LGNB 1YQ4A 1SUMB 5CGMA 4H9PC 5FNVE 2IW5B 4N78D 3P4PA 2UXXB 3P50A 3DTOA 3NVOA 4O2AE 4UIGA 1D0YA 5JDNA 1XMQT 4TV9E 5AQKB 4YHHT 3L8RA 4YSXA 5ABHA 5HEGA 2ODVA 4GKKT 4B3TT 3ZCIA 4I55E 2LHNA 3F57A 3PUQA 4V1Av 5ABGA 2MAWA 2YDRA 3O4XE 3QC9A 4UVAB 3VRBA 2V8SV 4A97A 3KBUA 3RIFA 3I9YA 1HFAA 2JQHA 5GONE 2VB6A 5JH7E 3FZMB 2BVLA 3LBXB 1HTJF 4G2AA 3UUNA 1FJGT 1KNZA 2Z6EA 3OJAA 2X9YA 4GIWA 3TLVA 2V6XA 4H9NC 2CWOA 2CXFA 3O1HA 2OV9A 2XM1A 4EYUA 4UVBB 4B3MT 2VKOA 3AAIA 3EDUA 3NRXA 2CCQA 4GK0E 4IT4A 1I6ZA 2QVAA 3OPCA 3ZJ1A 2YDQA 4ZI2C 3EHZA 5JVDE 5LGUB 4PK4A 4CXXA 1WR0A 2M67A 2XAGB 1W9RA 2UUAT 4LF4T 4UF0B 4E7ZA 2D2SA 4JV5T 2LRKA 3R6NA 3LK3B 3GA8A 4ERRA 3EI0A 5ETWA 1M7KA 3FB2A 4FJOA 5FXZA 1MNDA 5KX5E 1YD8G 2KWIB 1O3XA 3ANWB 2EHOA 2XQYA 3KFWX 2BDEA 2PG8A 4YTNA 5L2LA 4DV2T 2I0MA 4P0BA 1HNZT 3PUYF 1FIOA 2RA1A 2X66A 3OYXA 2E9XA 4JLEA 4DUZT 5LHHB 2UXDT 3EUHA 3Q2MA 5AQSB 2LOSA 2V5CA 2YDSA 3RYHE 3ZKRA 2JMKA 3I1AA 3N2GE 3P7IA 4KX6A 4YT0A 4X65T 4JI7T 1KNPA 3RQWA 3LFMA 4JI1T 2LSKA 3PUSA 4DBQA 1XDPA 3MJXA 3ETUA 4UELA 1T7SA 2CA5A 2D0UA 2X9WA 2QRXA 3TKLB 3QOFA 3ZEFB 4AQGA 3WAJA 4OK0A 3Q5XA 2N2NA 4ZI3C 4YSYA 2VQFT 5LOVE 2F4VT 2CXDA 4H9QC 3J7Yq 3N9MA 4HFDA 4WW0A 5FY1A 1NENA 2V5DA 5HAXA 2ZM0A 4DV3T 3ZT7A 2VVNA 3E0ZA 4EZHA 4X1KE 3SFEA 4Z91A 1X9BA 5J2UE 3AE2A 2XQ8A 4GOUA 3LDQB 3DJBA 4PJNA 4DV7T 3S4UA 2KT9A 4EOZB 1L0VA 4TN7B 5L3CB 3AVSA 3ZMZB 1LVKA 4QXBB 2LLYA 1LRZA 3NZQA 4NUVA 4C91A 1UX5A 5HXHA 4I43B 3ZCJA 4GKJT 2HN2A 3PDYA 4QX8B 4MHCA 4X62T 1UCUA 2K3WA 2OA5A 2XAHB 2XPKA 2CWYA 4TZ4C 3P4WA 4PK6A 1OWAA 4XAXB 5L4EA 2CRBA 3N9PA 5DQWA 3OVUA 3SOLA 5BMVE 1D1CA 4BJMA 4WBOA 4ILCA 4HWCA 4ZOLE 3AEAA 2LT3A 1D0XA 2NW9A 1UK5A 2CE7A 3RH3A 4PNIA 4CN6A 1UGOA 2KXPB 2VK9A 5AQJB 2UXBT 3CX6B 4JI2T 2E5VA 3CQXC 1N36T 4ZZBA 4XBFB 3CQCB 2NR4A 3ZSSA 2A9UA 2HPJA 2WB5A 3QUJA 2CM0A 2E2AA 3FZFB 4U2ZA 4LF8T 5FL1A 5L3GB 3ONXA 2VKHA 3AA7B 3R84B 4XZCA 2XZEA 2M6BA 3GN5A 5KMGP 2CBIA 4F6RC 5LMNT 2L3LA 1WR6A 3P4SA 4OYKA 4DMVA 2LOPA 2E5LT 3O1JA 1AJ3A 4JI4T 2MBGA 3ZMUB 1KF6A 3ZMSB 3ZT5A 1NAFA 2ACZA 2IIUA 2P9BA 2V7JA 4HEAA 2BS2A 1ZHCA 3QB5A 2H88A 2BKNA 2V7KA 2ZMAA 3JC6D 4EEBA 3UQ7A 3UU5A 2WSSV 1T98A 4TNVA 1E2AA 4PK5A 3PE0A 5F5WA 4X5TA 5FP3A 4ADZA 5CFBA 4CZZB 2A72A 2X67A 4HFHA 3C51A 4HKAA 5HXEA 2WAUA 3BQLA 4DNDA 4MBQA 2XSAA 2XTLA 1FMWA 2FJBA 2VURA 2VKJA 4IREA 4QH5A 4U7YA 4X1YE 4CN1A 5CA0E 5ABFA 3HL6A 3AE3A 2CEAA 4ZHQE 4NXMT 1NEKA 4CI3B 3IHRA 3VKHA 1CUNA 2DNXA 3RIUC 4CN4A 3I0QA 5LHIB 2K48A 2B76A 2RPAA 5HEUA 1DU2A 2LM9A 3TLWA 5HYAA 4KMCA 2BBHA 3PU8A 5FYMA 3FBLA 3NRYA 1MIYA 5LA6E 3AA1B 5JDFA 2WWVA 3JCFA 4DR5T 5HEOA 2UUCT 5IYZE 1HF8A 4LFAT 1VRBA 4ZS2A 4ZI3D 4ZEYA 2Y48B 4TWFA 2N1GA 2WY2A 5AQNB 3Q5DA 5FKYA 4DMWA 4EGWA 4IGUA 4TWHA 2EHOD 4EZ4A 4LF5T 2NP9A 3JC6C 2IAKA 4M1PA 5FVKA 3JADA 5F8PA 3HR0A 3RI5A 4NIQA 2IUBA 3AAAB 2FUPA 3IF8B 1KK7A 3NBXX 4JEHB 5ADXL 5JDMA 3KVBA 4CXYA 1UX4A 3H3AA 3RF1A 4DO0A 5HEJA 5BR8T 4OX9T 1ZOYA 2LEHA 3C4WA 3KV4A 4QH1A 1X79A 4CXWA 2WZHA 1ZKEA 3KDSE 2XQ4A 5EK4A 3RRWA 3VU7H 4NXNT 3C98B 3PJAA 5J1GA 4YXDA 4GYSA 2H3RA 2KINB 3EVYA 3UQ4A 5AQPB 4F8HA 2IC6A 2V7IA 2BG9A 2V7MA 4HN9A 2SPCA 4ASKA 1LVFA 3PUVF 4L0RA 1I94T 4LF9T 3ZN1B 3BQKA 3C50A 1E7PA 1YXRA 3EAMA 4BJNA 5LJMA 1T72A 3AEBA 5AQGB 4ISTA 2E8IA 3CKDA 4IL9A 5LHGB 5M4YA 2DWKA 2WDVA 4HFVA 4A5XA 5H6RB 4KI0F 3ZYMA 3ANWA 4X20E 2YN6A 4U3CA 3B5MA 3WI3A 4LMKA
chains in the Genus database with same CATH topology
4HWHA 2D9DA 1M7KA 3FZFB 5AQRB 1M62A 3A8YC 5AQMB 5AQHB 3FZMB 3FZKB 3LDQB 4HWDA 5AQPB 5AQIB 5AQFB 5AQSB 3FZHB 5AQTB 4HWFA 1I6ZA 5AQNB 3FZLB 5AQVB 5AQQB 5AQGB 1T7SA 5AQUB 5AQLB 4HWCA 1UK5A 5AQKB 1HX1B 1UGOA 5AQJB 5AQOB 4HWIB 3M3ZB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HWH A;  2D9D A;  1M7K A;  3FZF B;  5AQR B;  1M62 A;  3A8Y C;  5AQM B;  5AQH B;  3FZM B;  3FZK B;  3LDQ B;  4HWD A;  5AQP B;  5AQI B;  5AQF B;  5AQS B;  3FZH B;  5AQT B;  4HWF A;  1I6Z A;  5AQN B;  3FZL B;  5AQV B;  5AQQ B;  5AQG B;  1T7S A;  5AQU B;  5AQL B;  4HWC A;  1UK5 A;  5AQK B;  1HX1 B;  1UGO A;  5AQJ B;  5AQO B;  4HWI B;  3M3Z B; 
#chains in the Genus database with same CATH topology
 4HWH A;  4MFR A;  4JYA T;  1WFD A;  2W00 A;  2E9X D;  4TWD A;  2FJE A;  1BR2 A;  3HKC E;  3BK9 A;  3TLT A;  4IDN A;  3UFE A;  1MMN A;  2W0G A;  1HCI A;  3AEG A;  3RYF E;  2AXD S;  3EAB A;  4B3R T;  2VL8 A;  1G8X A;  1H7C A;  2WDQ A;  1YKH B;  2C5J A;  3AXJ B;  1VCT A;  2Y8D A;  4O8S A;  5C8Y E;  2UXC T;  2DWG A;  1US7 B;  2H7O A;  1KNR A;  1VOM A;  2LM2 A;  1J5W A;  2OLT A;  2XAQ B;  4JUY A;  3OTO T;  2D0T A;  5LB7 B;  3UT5 E;  5J2T E;  4LF6 T;  4ZI7 E;  4DR1 T;  3FHN A;  4ILB A;  5CA1 E;  3RQU A;  2L9Q A;  2XAF B;  5E0O A;  2XHE B;  3CX7 B;  2XAS B;  5LMU T;  4O4H E;  2W67 A;  3N9Q A;  5FY0 A;  1XNR T;  4DR4 T;  5CB4 E;  2N9D A;  2IHR 1;  5JRE A;  2ZM8 A;  3MK7 C;  3AVR A;  3AE4 A;  1MNE A;  3O1I A;  4DID B;  2PJQ A;  3PV0 F;  3AB3 B;  3CIR A;  3HKE E;  4QX7 B;  4TNW A;  4AIU A;  4EED A;  1J5E T;  3F31 A;  3Q9D A;  5L3E B;  4OHF A;  2PTF A;  3H37 A;  4QXH B;  2CHO A;  2ZLY A;  1XDO A;  4AXP A;  2PFV A;  2Y6X A;  3AE8 A;  2FJD A;  5FXV A;  4DV4 T;  4JI0 T;  5L3D B;  3KVA A;  4I0U A;  1MIW A;  2FBW A;  2VL0 A;  3LK4 2;  4IHJ E;  3PUW F;  2DL1 A;  2XAJ B;  5L3F B;  2ODU A;  3RIA A;  2G0U A;  3IBP A;  4JBW F;  4ZI2 D;  2C5K T;  3AEF A;  4LMJ A;  4PAG A;  5JQG E;  4WZX A;  2KND A;  2LJL A;  4I4T E;  4UR9 A;  4B6X A;  2DCF A;  4H63 V;  4OYJ A;  2BG9 C;  3ZT6 A;  2BKP A;  2W2U A;  2A3D A;  2WQY A;  5LBQ B;  3RC3 A;  4CI2 B;  1BR0 A;  4YFS A;  3RKG A;  3T1H T;  4CI1 B;  2VQE T;  1Z0P A;  3CVR A;  2CXL A;  4YTM A;  2XSB A;  3ZLI A;  2DI4 A;  2MPK A;  4IE7 A;  5AQM B;  5HCJ A;  3ZYL A;  3AE1 A;  3N2K E;  5F3J A;  4QH4 A;  4IDZ A;  3ZN0 B;  3RLF F;  4X64 T;  3JAE A;  3UU6 A;  1QLB A;  2QA7 A;  2X51 A;  2CLY B;  1V9D A;  2K24 A;  3FZH B;  3B13 A;  3A7M A;  5JR9 B;  3AE9 A;  3ABV A;  1MIV A;  4YHJ A;  4BAY B;  4LFB T;  4O4I E;  4IIJ E;  2XQ9 A;  4KHZ F;  5AQV B;  3RKO A;  2KMF A;  3ONL C;  1U5P A;  4U74 A;  3C64 A;  3PUX F;  1WYC A;  3UU4 A;  1JNR A;  3IA3 A;  2WBL A;  2BG9 E;  3C4X A;  3P4R A;  4U7I A;  3RRC A;  1SHZ C;  4PJJ A;  2J1D G;  4MAL A;  3UUM A;  2VVS A;  3LG7 A;  5LYJ E;  1W0B A;  1IJ6 A;  1XZY A;  2QYW A;  2FJA A;  4UV8 B;  4EXT A;  4UVC B;  5A1L A;  4DR7 T;  4O4J E;  2Q9Q D;  2YEV C;  4L9I A;  5DJQ C;  5DQV A;  4ZS3 A;  5AQR B;  1FMV A;  1M62 A;  3DP7 A;  3I0O A;  2X9H A;  3QB5 K;  4YLH A;  4BA9 A;  5HWX A;  5JRC A;  1S94 A;  5HXR A;  5LG3 A;  5LNK A;  5KXJ A;  1IAP A;  2NOX A;  3FXE B;  2NTX A;  2XM2 A;  3AE5 A;  3K8P C;  2IML A;  2LSG A;  3KIN B;  3H3M A;  3T8O A;  4I50 E;  3AAE B;  2BS3 A;  2WCA A;  3E08 A;  3UTK A;  5LG4 A;  3RGL A;  1VCS A;  4AKL A;  3L3P A;  2BBJ A;  5L4H A;  4AKR B;  2JMH A;  2NTY A;  1D1A A;  1U4Q A;  3LBX A;  4PJL A;  1FEW A;  4OFZ A;  4WBN E;  1HS7 A;  2EHO C;  4GYR A;  2JPF A;  4LF7 T;  3M65 A;  3OYZ A;  2E9X C;  2KLQ A;  3Q5E A;  3HKD E;  4H9R C;  3ETV A;  4A98 A;  1G73 A;  2DLR A;  4DR6 T;  2CBJ A;  2X0H A;  2DHR A;  2JQK A;  3PUA A;  3PUR A;  4IDP A;  1OED E;  4U31 A;  1ZEE A;  3VR8 A;  2LKH A;  2LSJ A;  3FBZ A;  4U2Y A;  3VKG A;  1N34 T;  4JI3 T;  5JDH A;  1ZV4 X;  3A8Y C;  2HN1 A;  3RPU A;  3ZST A;  2JQQ A;  2J4G A;  2YOE A;  2R6G F;  3CWZ B;  3K1S A;  3RX6 A;  2PBI A;  2WM9 A;  4K0U A;  2V6Y B;  4YJ2 E;  2W61 A;  1OED C;  4JI8 T;  4X66 T;  1HR0 T;  4GK5 E;  3PU3 A;  2Q9Q C;  3Q5W A;  2JJ9 A;  4HFB A;  5AQI B;  3SFD A;  2UUB T;  2BG9 B;  4JI6 T;  4QKN A;  3UFG A;  4AIS A;  3SWH A;  3CQG B;  4DR2 T;  4Z8X A;  2BKO A;  2WZI A;  4AI6 A;  4EAH A;  2K9A A;  3FZL B;  2WP9 A;  5C2T A;  5J0Z A;  2HHH T;  3ZJ2 A;  4NPP A;  4H63 H;  2J62 A;  2V26 A;  3GWH A;  4AKI A;  2D5U A;  4LML A;  2KZ7 B;  1CHU A;  3K3Q C;  3U78 A;  4B3S T;  4U33 A;  4O4L E;  3SRZ A;  2KWH A;  2LHR A;  2V7L A;  4HWI B;  2W66 A;  5HXS A;  2JQ9 A;  3AE6 A;  3G06 A;  3KV6 A;  2MOZ A;  3X1D A;  1N33 T;  4AKH A;  4ANJ A;  1MMA A;  5JTG A;  3AE7 A;  3CK6 A;  1GQE A;  4Q25 A;  4G63 A;  4UEM A;  3AEE A;  5CJ5 A;  1N32 T;  3C4Z A;  4HTE A;  5AFU L;  4TV8 E;  4HFE A;  2K5B B;  2XQ6 A;  1IBK T;  4YJ3 E;  5HCM A;  1LKX A;  5LJN A;  2I6H A;  2LKG A;  2BVM A;  2NW8 A;  4IL4 A;  1B7T A;  5FXX A;  2I59 A;  4Z90 A;  4JI5 T;  3N2O A;  1Z8U A;  3V5S A;  2C5I T;  2IC9 A;  4HGA A;  2X0L B;  4JEU B;  1XMO T;  2XQ7 A;  3K3N A;  3RIU A;  2JIW A;  5AQU B;  4YSZ A;  5AQL B;  1SA0 E;  2XY8 B;  3SS1 A;  3ZYK A;  4DBR A;  3LJC A;  1Y64 B;  4DV5 T;  4ILU A;  1WLX A;  5JDQ A;  3PJA J;  3N9N A;  3M3Z B;  2NW7 A;  3RYI E;  4A56 A;  5IUX A;  4HE8 A;  2GK9 A;  1IZN B;  2Q9Q B;  5LP6 E;  3HKB E;  5LGT B;  1OED B;  2AE9 A;  4X1I E;  2XQ5 A;  5FMN A;  1HNW T;  5L47 A;  2NWB A;  3MAC A;  2YU2 A;  2W63 A;  4UF0 A;  1HNX T;  1QSD A;  5KDM C;  3ZC0 A;  2H7V C;  2UXN B;  3AA0 B;  3FZK B;  4HWD A;  5FXW A;  4P0A A;  1MMG A;  4TX5 A;  2ES0 A;  4C90 A;  1D1B A;  3O9X A;  1D0Z A;  3RC8 A;  2YKS A;  5C3J A;  1UUR A;  4COF A;  3HA4 A;  4FI5 A;  2A2F X;  2E9X B;  2WDR A;  2XQA A;  5EK2 A;  3AEC A;  3V5U A;  3PUG A;  2LE8 A;  3MXZ A;  5AQQ B;  3B57 A;  3UUX B;  4P1N A;  2UU9 T;  4KBM B;  5IWA T;  1WCR A;  2LRL A;  4EV6 A;  3ZPO A;  1KEY A;  2IDO B;  1OXZ A;  4UXN B;  1T8B A;  5AQO B;  4EB6 E;  1NWM X;  3AXJ A;  3OKQ A;  2ZM2 A;  4IE4 A;  4IE0 A;  2X0Y A;  5FVL A;  4IE5 A;  4AQF A;  2W62 A;  2XUE A;  1BR4 A;  1XNQ T;  1MMD A;  2VKD A;  2EHO B;  3E22 E;  3U3I A;  2WU5 A;  4DR3 T;  3UU3 A;  5AQH B;  1R8I A;  4NUU A;  2YK0 A;  2MTQ A;  3CPZ A;  4PFO A;  5L3B B;  3KV5 A;  3D0T A;  1EZ3 A;  5JR9 A;  2JRK A;  3UUL A;  5AQF B;  1S35 A;  2X9X A;  5LXT E;  3BQI A;  1J1J A;  3PUZ F;  4HFI A;  3K3O A;  4AQY T;  3A5X A;  1YKE B;  3NWI A;  1WYB A;  5TAO A;  2KSR A;  5LCY A;  2BZB A;  1W09 A;  2V6Y A;  4AKG A;  3N9O A;  4H9O C;  4HWF A;  4YY3 T;  3MZK B;  2L8K A;  4KHP T;  3NKZ A;  4PJM A;  2B1E A;  2HH7 A;  2BS4 A;  4ILA A;  2XJ7 A;  4L5G A;  4UV9 B;  2MYS A;  3GN5 B;  5FY7 A;  4K0K T;  4DV1 T;  5JR9 C;  3L09 A;  3N5L A;  3ONJ A;  4DUY T;  3VHL A;  2WU2 A;  3OBV E;  2VWA A;  2LSI A;  1YQ3 A;  4QXC B;  5DAB A;  1KFY A;  2XQ3 A;  2LSY A;  3HI2 A;  3P8C D;  3AA6 B;  3IEE A;  4HFC A;  4KUM B;  4U72 A;  5H6Q B;  4AQF C;  1HG2 A;  4DVD A;  4TUY E;  4YTP A;  5EK3 A;  1IJ5 A;  4H9S E;  1IBM T;  1OED A;  3LSV A;  3CX8 B;  1JNZ A;  3UUB A;  2J47 A;  2CHN A;  2Q9Q A;  3LK2 B;  3F2E A;  5LBM A;  3P4Q A;  4WNK A;  2ACX A;  3NZP A;  1IBL T;  3TLS A;  4IDO A;  5JDG A;  2CLY C;  3FXD B;  5HWY A;  2V1D B;  3TLU A;  4CQI A;  3RHW A;  3MA9 A;  4O2B E;  1QUU A;  3VR9 A;  2QGS A;  3W15 B;  1W0A A;  4E7S A;  1HG5 A;  3AED A;  3QNU A;  2WWU A;  1E1H B;  2RP4 A;  1BR1 A;  2WS3 A;  4PFP A;  3J9X 1;  2YIN A;  1HX8 A;  2C0S A;  1UUS A;  3MKD A;  3ZMT B;  2ZM6 T;  5JRC B;  3WAK A;  1SE7 A;  2W4X A;  3GMI A;  3ESL A;  2WMN A;  3L39 A;  4P09 A;  3QK6 A;  4QHO A;  5FL0 A;  5IHY A;  2CPT A;  1HX1 B;  3PTR B;  4LFC T;  5ABE A;  2HPL A;  3ZMV B;  3I9W A;  5ABF B;  5HXC A;  3ZC1 A;  2CMR A;  2D9D A;  3KBT A;  3EDV A;  3VRA A;  4EYY R;  3T1Y T;  2M6I A;  4EIW A;  4KP3 C;  4WYV A;  3RYC E;  5EZY E;  5JDL A;  2H89 A;  1Y01 A;  3UU8 A;  3KV9 A;  3N9L A;  1YW0 A;  2WMO A;  2VAS A;  4J2C A;  4PW8 A;  4ZZC A;  4QWN B;  4DV6 T;  4IE6 A;  3CML A;  3JAF A;  1WRD A;  1ZP0 A;  2X68 A;  4ZXL A;  1XWM A;  5HEH A;  4DV0 T;  4ISS A;  4MLK A;  2YU1 A;  4IDQ A;  5AQT B;  5LGN B;  1YQ4 A;  1SUM B;  5CGM A;  4H9P C;  5FNV E;  2IW5 B;  4N78 D;  3P4P A;  2UXX B;  3P50 A;  3DTO A;  3NVO A;  4O2A E;  4UIG A;  1D0Y A;  5JDN A;  1XMQ T;  4TV9 E;  5AQK B;  4YHH T;  3L8R A;  4YSX A;  5ABH A;  5HEG A;  2ODV A;  4GKK T;  4B3T T;  3ZCI A;  4I55 E;  2LHN A;  3F57 A;  3PUQ A;  4V1A v;  5ABG A;  2MAW A;  2YDR A;  3O4X E;  3QC9 A;  4UVA B;  3VRB A;  2V8S V;  4A97 A;  3KBU A;  3RIF A;  3I9Y A;  1HFA A;  2JQH A;  5GON E;  2VB6 A;  5JH7 E;  3FZM B;  2BVL A;  3LBX B;  1HTJ F;  4G2A A;  3UUN A;  1FJG T;  1KNZ A;  2Z6E A;  3OJA A;  2X9Y A;  4GIW A;  3TLV A;  2V6X A;  4H9N C;  2CWO A;  2CXF A;  3O1H A;  2OV9 A;  2XM1 A;  4EYU A;  4UVB B;  4B3M T;  2VKO A;  3AAI A;  3EDU A;  3NRX A;  2CCQ A;  4GK0 E;  4IT4 A;  1I6Z A;  2QVA A;  3OPC A;  3ZJ1 A;  2YDQ A;  4ZI2 C;  3EHZ A;  5JVD E;  5LGU B;  4PK4 A;  4CXX A;  1WR0 A;  2M67 A;  2XAG B;  1W9R A;  2UUA T;  4LF4 T;  4UF0 B;  4E7Z A;  2D2S A;  4JV5 T;  2LRK A;  3R6N A;  3LK3 B;  3GA8 A;  4ERR A;  3EI0 A;  5ETW A;  1M7K A;  3FB2 A;  4FJO A;  5FXZ A;  1MND A;  5KX5 E;  1YD8 G;  2KWI B;  1O3X A;  3ANW B;  2EHO A;  2XQY A;  3KFW X;  2BDE A;  2PG8 A;  4YTN A;  5L2L A;  4DV2 T;  2I0M A;  4P0B A;  1HNZ T;  3PUY F;  1FIO A;  2RA1 A;  2X66 A;  3OYX A;  2E9X A;  4JLE A;  4DUZ T;  5LHH B;  2UXD T;  3EUH A;  3Q2M A;  5AQS B;  2LOS A;  2V5C A;  2YDS A;  3RYH E;  3ZKR A;  2JMK A;  3I1A A;  3N2G E;  3P7I A;  4KX6 A;  4YT0 A;  4X65 T;  4JI7 T;  1KNP A;  3RQW A;  3LFM A;  4JI1 T;  2LSK A;  3PUS A;  4DBQ A;  1XDP A;  3MJX A;  3ETU A;  4UEL A;  1T7S A;  2CA5 A;  2D0U A;  2X9W A;  2QRX A;  3TKL B;  3QOF A;  3ZEF B;  4AQG A;  3WAJ A;  4OK0 A;  3Q5X A;  2N2N A;  4ZI3 C;  4YSY A;  2VQF T;  5LOV E;  2F4V T;  2CXD A;  4H9Q C;  3J7Y q;  3N9M A;  4HFD A;  4WW0 A;  5FY1 A;  1NEN A;  2V5D A;  5HAX A;  2ZM0 A;  4DV3 T;  3ZT7 A;  2VVN A;  3E0Z A;  4EZH A;  4X1K E;  3SFE A;  4Z91 A;  1X9B A;  5J2U E;  3AE2 A;  2XQ8 A;  4GOU A;  3LDQ B;  3DJB A;  4PJN A;  4DV7 T;  3S4U A;  2KT9 A;  4EOZ B;  1L0V A;  4TN7 B;  5L3C B;  3AVS A;  3ZMZ B;  1LVK A;  4QXB B;  2LLY A;  1LRZ A;  3NZQ A;  4NUV A;  4C91 A;  1UX5 A;  5HXH A;  4I43 B;  3ZCJ A;  4GKJ T;  2HN2 A;  3PDY A;  4QX8 B;  4MHC A;  4X62 T;  1UCU A;  2K3W A;  2OA5 A;  2XAH B;  2XPK A;  2CWY A;  4TZ4 C;  3P4W A;  4PK6 A;  1OWA A;  4XAX B;  5L4E A;  2CRB A;  3N9P A;  5DQW A;  3OVU A;  3SOL A;  5BMV E;  1D1C A;  4BJM A;  4WBO A;  4ILC A;  4HWC A;  4ZOL E;  3AEA A;  2LT3 A;  1D0X A;  2NW9 A;  1UK5 A;  2CE7 A;  3RH3 A;  4PNI A;  4CN6 A;  1UGO A;  2KXP B;  2VK9 A;  5AQJ B;  2UXB T;  3CX6 B;  4JI2 T;  2E5V A;  3CQX C;  1N36 T;  4ZZB A;  4XBF B;  3CQC B;  2NR4 A;  3ZSS A;  2A9U A;  2HPJ A;  2WB5 A;  3QUJ A;  2CM0 A;  2E2A A;  3FZF B;  4U2Z A;  4LF8 T;  5FL1 A;  5L3G B;  3ONX A;  2VKH A;  3AA7 B;  3R84 B;  4XZC A;  2XZE A;  2M6B A;  3GN5 A;  5KMG P;  2CBI A;  4F6R C;  5LMN T;  2L3L A;  1WR6 A;  3P4S A;  4OYK A;  4DMV A;  2LOP A;  2E5L T;  3O1J A;  1AJ3 A;  4JI4 T;  2MBG A;  3ZMU B;  1KF6 A;  3ZMS B;  3ZT5 A;  1NAF A;  2ACZ A;  2IIU A;  2P9B A;  2V7J A;  4HEA A;  2BS2 A;  1ZHC A;  3QB5 A;  2H88 A;  2BKN A;  2V7K A;  2ZMA A;  3JC6 D;  4EEB A;  3UQ7 A;  3UU5 A;  2WSS V;  1T98 A;  4TNV A;  1E2A A;  4PK5 A;  3PE0 A;  5F5W A;  4X5T A;  5FP3 A;  4ADZ A;  5CFB A;  4CZZ B;  2A72 A;  2X67 A;  4HFH A;  3C51 A;  4HKA A;  5HXE A;  2WAU A;  3BQL A;  4DND A;  4MBQ A;  2XSA A;  2XTL A;  1FMW A;  2FJB A;  2VUR A;  2VKJ A;  4IRE A;  4QH5 A;  4U7Y A;  4X1Y E;  4CN1 A;  5CA0 E;  5ABF A;  3HL6 A;  3AE3 A;  2CEA A;  4ZHQ E;  4NXM T;  1NEK A;  4CI3 B;  3IHR A;  3VKH A;  1CUN A;  2DNX A;  3RIU C;  4CN4 A;  3I0Q A;  5LHI B;  2K48 A;  2B76 A;  2RPA A;  5HEU A;  1DU2 A;  2LM9 A;  3TLW A;  5HYA A;  4KMC A;  2BBH A;  3PU8 A;  5FYM A;  3FBL A;  3NRY A;  1MIY A;  5LA6 E;  3AA1 B;  5JDF A;  2WWV A;  3JCF A;  4DR5 T;  5HEO A;  2UUC T;  5IYZ E;  1HF8 A;  4LFA T;  1VRB A;  4ZS2 A;  4ZI3 D;  4ZEY A;  2Y48 B;  4TWF A;  2N1G A;  2WY2 A;  5AQN B;  3Q5D A;  5FKY A;  4DMW A;  4EGW A;  4IGU A;  4TWH A;  2EHO D;  4EZ4 A;  4LF5 T;  2NP9 A;  3JC6 C;  2IAK A;  4M1P A;  5FVK A;  3JAD A;  5F8P A;  3HR0 A;  3RI5 A;  4NIQ A;  2IUB A;  3AAA B;  2FUP A;  3IF8 B;  1KK7 A;  3NBX X;  4JEH B;  5ADX L;  5JDM A;  3KVB A;  4CXY A;  1UX4 A;  3H3A A;  3RF1 A;  4DO0 A;  5HEJ A;  5BR8 T;  4OX9 T;  1ZOY A;  2LEH A;  3C4W A;  3KV4 A;  4QH1 A;  1X79 A;  4CXW A;  2WZH A;  1ZKE A;  3KDS E;  2XQ4 A;  5EK4 A;  3RRW A;  3VU7 H;  4NXN T;  3C98 B;  3PJA A;  5J1G A;  4YXD A;  4GYS A;  2H3R A;  2KIN B;  3EVY A;  3UQ4 A;  5AQP B;  4F8H A;  2IC6 A;  2V7I A;  2BG9 A;  2V7M A;  4HN9 A;  2SPC A;  4ASK A;  1LVF A;  3PUV F;  4L0R A;  1I94 T;  4LF9 T;  3ZN1 B;  3BQK A;  3C50 A;  1E7P A;  1YXR A;  3EAM A;  4BJN A;  5LJM A;  1T72 A;  3AEB A;  5AQG B;  4IST A;  2E8I A;  3CKD A;  4IL9 A;  5LHG B;  5M4Y A;  2DWK A;  2WDV A;  4HFV A;  4A5X A;  5H6R B;  4KI0 F;  3ZYM A;  3ANW A;  4X20 E;  2YN6 A;  4U3C A;  3B5M A;  3WI3 A;  4LMK A; 
#chains in the Genus database with same CATH homology
 4HWH A;  2D9D A;  1M7K A;  3FZF B;  5AQR B;  1M62 A;  3A8Y C;  5AQM B;  5AQH B;  3FZM B;  3FZK B;  3LDQ B;  4HWD A;  5AQP B;  5AQI B;  5AQF B;  5AQS B;  3FZH B;  5AQT B;  4HWF A;  1I6Z A;  5AQN B;  3FZL B;  5AQV B;  5AQQ B;  5AQG B;  1T7S A;  5AQU B;  5AQL B;  4HWC A;  1UK5 A;  5AQK B;  1HX1 B;  1UGO A;  5AQJ B;  5AQO B;  4HWI B;  3M3Z B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...