2D9DA

Solution structure of the bag domain (275-350) of bag-family molecular chaperone regulator-5
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
89
structure length
89
Chain Sequence
b'GSSGSSGSILKIEKVLKRMREIKNELLQAQNPSELYLSSKTELQGLIGQLDEVSLEKNPCIREARRRAVIEVQTLITYIDLKESGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BAG family molecular chaperone regulator 5
publication title The C-terminal BAG domain of BAG5 induces conformational changes of the Hsp70 nucleotide-binding domain for ADP-ATP exchange
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chaperone
total genus 23
structure length 89
sequence length 89
ec nomenclature
pdb deposition date 2005-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02179 BAG BAG domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.120 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 BAG domain 2d9dA00
3FZMB 3A8YC 4HWFA 5AQRB 1I6ZA 5AQSB 3M3ZB 2D9DA 3FZHB 1M7KA 4HWIB 5AQTB 5AQUB 5AQIB 5AQVB 1UK5A 5AQKB 5AQJB 5AQFB 4HWHA 3LDQB 1T7SA 5AQHB 4HWDA 5AQLB 5AQPB 3FZKB 5AQOB 3FZFB 1M62A 5AQGB 5AQQB 1UGOA 1HX1B 5AQMB 5AQNB 4HWCA 3FZLB
chains in the Genus database with same CATH superfamily
1IJ6A 3R84B 4H9RC 1WFDA 3VR8A 2D9DA 2PG8A 2NTXA 2QVAA 2WY2A 3KV9A 4V1Av 4BJMA 3OBVE 4AISA 5L3GB 4U2ZA 3RIFA 2DLRA 3QC9A 3NZQA 2YOEA 5L3EB 5JDGA 3HKBE 2V5CA 1BR2A 5CGMA 2XAJB 5FVKA 4X1IE 5IYZE 2D2SA 1HX8A 4M1PA 3ONXA 2BVLA 2A72A 4NUUA 3PUZF 1N36T 2XY8B 5BR8T 2UU9T 2W62A 3LDQB 4YY3T 3NKZA 1MIVA 5LG4A 2I6HA 4XBFB 3Q5WA 2W67A 5F3JA 2P9BA 4JI3T 3AEGA 4WBNE 2CLYC 2ODVA 4OYJA 1KEYA 1MMDA 4GK5E 4DR4T 1ZEEA 2X0HA 3IA3A 2V6XA 3IEEA 2XQ7A 2D0UA 2UXNB 1XDPA 2YDSA 3QNUA 3AEDA 4ZZCA 3RKGA 3AA6B 2FJAA 5FY1A 4TV8E 4CXWA 4KI0F 3FXEB 5FP3A 1J1JA 2LRLA 4ZHQE 2E2AA 4AIUA 2VVSA 3F57A 1V9DA 4YSYA 2XQYA 4ZOLE 3KBUA 1YKHB 2K5BB 4ZI3D 4HWFA 4HKAA 3PV0F 4HFDA 4DR1T 4U74A 3CQXC 5EK2A 4PW8A 4I55E 3HKCE 4I4TE 3OTOT 4KX6A 2M67A 3PUVF 5C2TA 3C4XA 3FZLB 2X0YA 5DABA 2XAGB 2L8KA 4DR2T 1VOMA 2HPJA 2A3DA 3SFEA 4LF8T 4LFAT 2LLYA 3PTRB 4IT4A 5LHHB 1HFAA 2CXDA 4NPPA 2YN6A 3RH3A 3UUNA 4PJJA 2BS4A 4EOZB 3ZMTB 2WZHA 3S4UA 2WM9A 2WDRA 2XQ5A 1Z8UA 3N9OA 5ADXL 2J62A 2WBLA 4JV5T 2M6IA 2WS3A 5AQRB 4KBMB 2ZMAA 4HEAA 2L9QA 1N32T 5LP6E 1J5WA 3JADA 4AQFA 1HF8A 4WNKA 3VKHA 4JI8T 4Z90A 1QUUA 2K24A 3AXJA 4LFCT 3ZJ2A 3FZHB 2WZIA 2CWOA 2RA1A 2XSAA 3PUWF 1CHUA 3RHWA 2LM9A 3A7MA 3C64A 5HWYA 3ANWB 3ZC1A 3AE7A 3EDVA 4IDOA 5LYJE 3T1YT 1BR4A 2BS3A 2DHRA 2LKHA 1MMAA 3A8YC 2WB5A 3VRAA 4ZI2D 1M7KA 3C50A 4O4HE 4X1KE 2X67A 2AXDS 4H9QC 1KK7A 2RP4A 5L3BB 5HXHA 2I59A 3PUSA 4BA9A 4A98A 4ANJA 1Y01A 3IBPA 4O4JE 4H9OC 4CN4A 3N5LA 4JI5T 2V7MA 3UU5A 2V6YB 3N9MA 4OK0A 3AE8A 4HWHA 1XZYA 3V5SA 4MALA 2JQHA 4WYVA 3SOLA 5HXEA 3KV5A 5HEGA 3PU8A 2CA5A 5LMNT 1NENA 3FBLA 4DBRA 1E7PA 2ZLYA 1MNDA 2W0GA 2M6BA 5CA0E 3JC6C 5A1LA 1W9RA 3RC8A 1N33T 2NOXA 3ZCJA 3NBXX 1OEDC 4QWNB 3KFWX 4YSXA 5JREA 1FMWA 1H7CA 2BG9C 4YTNA 3LG7A 3PUXF 1D0ZA 2LT3A 2W4XA 3CKDA 2KNDA 3E0ZA 2F4VT 4CZZB 4LMKA 2GK9A 3GA8A 1YXRA 3NZPA 4CN6A 3ZT7A 3UQ4A 4UELA 4QXBB 1LVKA 4HFHA 4LF7T 2H7OA 4FJOA 5EZYE 3UUMA 1WYBA 4U72A 3DP7A 2UXCT 3HL6A 3R6NA 4L0RA 4UV8B 4MLKA 3P4SA 1R8IA 1U4QA 2WDVA 5FXZA 3TLVA 2D5UA 3O1IA 3FHNA 2A2FX 2Q9QC 2KWHA 3ZN0B 5C3JA 2QRXA 3CX8B 1FMVA 4NXMT 3HR0A 1N34T 2XAFB 4QHOA 5AQKB 4ZS3A 3JAEA 2VURA 2VKOA 5L4EA 5HCJA 1HNXT 4LF6T 4JI6T 3L09A 4MBQA 2E9XA 3KVAA 4PK4A 4O2BE 4HWIB 5F5WA 4H63H 5LMUT 2XQAA 3ZEFB 3FZKB 3UU8A 2AE9A 2XM2A 3RRWA 2LOPA 3ONLC 2XTLA 3RPUA 5ABEA 3RLFF 3VHLA 3RX6A 3MZKB 2MTQA 5L4HA 2EHOA 4O8SA 4HFBA 2LKGA 2NWBA 5AFUL 2BKOA 2LE8A 4X65T 2DWGA 3QB5K 3ZYKA 3Q2MA 2XASB 3TKLB 2C5IT 3AAIA 3N9PA 4IDZA 4DUYT 5DQVA 4YXDA 2V7IA 3CX7B 2JQQA 2X51A 4UV9B 4UEMA 3MA9A 2VKDA 2N1GA 3OJAA 1ZOYA 3KV4A 5EK4A 3ZKRA 1YQ3A 3PDYA 1IZNB 4JI7T 2QGSA 1SE7A 2LRKA 3EDUA 5AQUB 2WAUA 4AI6A 2IHR1 4JI4T 4DR5T 2LSIA 3U78A 4ILBA 2ES0A 5HAXA 2LSKA 1US7B 4BAYB 3LK2B 2DL1A 4PK6A 1WRDA 3JCFA 3FB2A 2H89A 3ONJA 4HN9A 3K3NA 1WR0A 5HYAA 2DNXA 4IDQA 4CI1B 3N9LA 4PK5A 3GWHA 2J1DG 3G06A 3HKDE 3UFEA 4WW0A 4EYYR 5DJQC 2MAWA 3AE1A 4GIWA 4C91A 4AKRB 3SS1A 4HGAA 5J0ZA 2VL0A 5AQGB 5LXTE 4LMLA 3DTOA 4X64T 2XQ4A 3RYHE 3F31A 2H7VC 5FKYA 4ZI7E 4JEUB 5LNKA 2JJ9A 2DCFA 4JYAT 2FJBA 3JAFA 3P4WA 1IBKT 3P50A 2CXFA 3AE6A 2X68A 3HI2A 4H63V 2N9DA 5HXCA 4Z91A 4LF4T 3M3ZB 1DU2A 4CI2B 4MHCA 3AA0B 4IDNA 1HS7A 2Y6XA 2D0TA 3O1HA 5JDLA 4JEHB 2LOSA 1L0VA 2XQ6A 3MKDA 3UULA 4X66T 5JDHA 4IE0A 1D0XA 3E08A 4QXCB 2MOZA 4X20E 1HTJF 4TX5A 4CN1A 5AQJB 3L39A 1OEDE 4UVBB 4P0AA 1X9BA 2N2NA 3MJXA 4I43B 3ZPOA 4PFPA 2BG9E 4F8HA 1B7TA 4AKGA 3ETUA 3ZN1B 2WQYA 4B3ST 2CPTA 2IDOB 5FNVE 3ZYLA 4DIDB 4H9NC 4ZZBA 5KMGP 4UF0A 2FUPA 2X9HA 2BZBA 5JDMA 3FZMB 2K9AA 2IAKA 4ZS2A 3TLWA 2IC9A 4E7SA 4YTMA 4KUMB 3MK7C 3ZCIA 3N2KE 5ABFA 4TZ4C 3I9WA 3TLSA 3RIAA 2ZM2A 3P7IA 4DUZT 4K0UA 2NTYA 3EHZA 4HE8A 4TNWA 1MIYA 5HEOA 1U5PA 2JMKA 5AQPB 1G73A 2CWYA 4YLHA 5AQQB 4UVCB 3P4QA 4QH5A 5LGUB 3RYFE 2E5VA 3ZMSB 3I0OA 3N2OA 3VR9A 3UU3A 4O4IE 3OVUA 4ILUA 3FBZA 4YTPA 3H3MA 1FIOA 3AE2A 3P4RA 1FJGT 5LJMA 3EAMA 3N9NA 2IUBA 3CK6A 4MFRA 1MMGA 5FL0A 2IMLA 3T1HT 4CXXA 2XHEB 4OYKA 5LG3A 2UXBT 3PE0A 4CI3B 5IUXA 2KT9A 3RIUA 4UF0B 3NRYA 4GK0E 4U2YA 2VL8A 2UXXB 4IDPA 2V7LA 1XDOA 4C90A 3CIRA 3MXZA 2K3WA 4LFBT 5JRCA 2YEVC 2FJDA 3IF8B 2XJ7A 3OPCA 2JRKA 4UR9A 5C8YE 4DV7T 2FJEA 2YU2A 1ZP0A 3K1SA 2W63A 4Q25A 1XNRT 2E9XD 2OLTA 4TV9E 3NRXA 4KHPT 4DR6T 3N2GE 4H9PC 1E2AA 3VRBA 4IE6A 3BK9A 4P1NA 3HKEE 1SA0E 3E22E 5IWAT 2BBJA 3KV6A 4GKKT 1OEDA 3KDSE 4IIJE 3RQUA 1HG2A 4O4LE 4ZI3C 2SPCA 4TWFA 1KFYA 5GONE 1MIWA 4U3CA 3PJAA 2YDQA 2EHOD 2ZM6T 4DMWA 4JI0T 2MYSA 3MACA 3VU7H 2WCAA 3H37A 4TNVA 5CFBA 2WSSV 3AXJB 3ZSSA 3PUYF 4IREA 2J47A 3EUHA 1T98A 1UURA 5AQNB 4QH4A 2V7JA 4B3RT 4IL9A 2WP9A 2MBGA 4EEBA 1KNPA 5AQFB 5JR9A 4IGUA 2V7KA 4A5XA 2JIWA 1IAPA 5JRCB 1JNRA 3UUBA 4YJ2E 2PJQA 3SWHA 3K3QC 5HCMA 5KX5E 2ODUA 2BKPA 4XAXB 3AE9A 2IC6A 3C98B 2UUBT 3GMIA 5FY7A 3LBXA 3U3IA 3ZT5A 5FL1A 3FZFB 2BKNA 3F2EA 1Z0PA 2Z6EA 4Z8XA 1QLBA 2CXLA 2NR4A 4BJNA 1LKXA 1S35A 4DV0T 4LF5T 5FY0A 3PUQA 2WWVA 2VKJA 4TUYE 3LK42 5H6RB 4DV5T 2IIUA 2ZM0A 1D1AA 1OXZA 3L8RA 4G63A 4B3TT 4A97A 2YINA 2XQ8A 2XZEA 3AECA 4X62T 2LHNA 3J9X1 3HA4A 2DI4A 1SUMB 2LJLA 4ZI2C 4EYUA 3AA7B 3A5XA 5FXWA 1ZKEA 2KMFA 1HNWT 3D0TA 3EI0A 2QYWA 3O4XE 2CCQA 1FEWA 4CXYA 2V5DA 3PUAA 5AQVB 2XM1A 1UK5A 5LBMA 3RKOA 2B1EA 4ASKA 5HXSA 2LSJA 2UUAT 1VRBA 5JR9B 4YFSA 1WR6A 4J2CA 1VCTA 4GYSA 2LEHA 4WBOA 3VKGA 4FI5A 4UIGA 3B57A 2KWIB 1WYCA 3B5MA 2BDEA 5LB7B 1Y64B 2WU5A 1AJ3A 3PJAJ 4PNIA 1KNRA 3LK3B 4IE7A 5ABHA 1M62A 2V1DB 4COFA 2KLQA 3I1AA 4IE5A 3LBXB 4ADZA 2HHHT 5ETWA 3Q5EA 2X0LB 4DV2T 3ZMVB 2CE7A 3FXDB 4I50E 5JQGE 5JTGA 3QB5A 4KP3C 2JQ9A 2CBIA 5HEJA 1UX5A 5AQMB 4EXTA 5FMNA 5CJ5A 5ABGA 1WCRA 5DQWA 1I6ZA 4HFVA 5LOVE 2W66A 3AB3B 1MNEA 2E9XB 1OWAA 1BR0A 3RC3A 1E1HB 3RI5A 2A9UA 3Q5DA 2XSBA 4EIWA 4UVAB 2VWAA 2CMRA 5EK3A 2MPKA 2UXDT 4YSZA 4ILAA 2R6GF 5H6QB 1D0YA 4EAHA 2BVMA 3X1DA 2L3LA 4F6RC 3UT5E 2EHOB 3I0QA 1UX4A 2C5KT 4U7IA 2WWUA 2IW5B 4JI1T 2WMOA 5LHIB 2JMHA 1CUNA 5HEHA 4OHFA 4I0UA 1KF6A 3PU3A 3OYXA 1W0BA 2LHRA 3UTKA 2YU1A 3I9YA 2NP9A 4E7ZA 3AAAB 2PTFA 4HFIA 3ZLIA 3DJBA 1YQ4A 4IL4A 3EABA 1XMOT 5AQIB 5LBQB 1ZV4X 4A56A 4PAGA 2WMNA 2PFVA 2XPKA 2RPAA 1HR0T 5JDNA 1UCUA 4UXNB 2WU2A 5J1GA 3CWZB 4ZXLA 4JI2T 5L47A 4AQGA 3OYZA 2CM0A 2VVNA 5AQHB 4HWDA 1YW0A 2LM2A 3NVOA 4U33A 3K8PC 4P0BA 2VQFT 2H3RA 2BBHA 4YHHT 2XAQB 5CA1E 1UUSA 1T8BA 2UUCT 4YJ3E 3RYIE 3W15B 2W61A 5HWXA 2W2UA 1UGOA 2X9YA 2X9WA 1O3XA 2E5LT 4QXHB 5KDMC 3JC6D 1X79A 3ANWA 3KVBA 4U7YA 4AKHA 3ZSTA 3C51A 4HFEA 1T72A 4JLEA 5HEUA 3LSVA 2CLYB 3ZYMA 1YKEB 4DV1T 2ZM8A 4DO0A 1W0AA 2VKHA 3AEFA 4EEDA 4DR7T 2H88A 1D1BA 5AQTB 4N78D 3UU4A 4B3MT 5F8PA 2KSRA 3CQGB 4XZCA 2B76A 3KBTA 1KNZA 2V6YA 4P09A 3QOFA 4AQYT 2C0SA 1HCIA 3H3AA 3AVSA 1W09A 2JPFA 5M4YA 5J2UE 2CRBA 2XQ9A 3CVRA 4TN7B 4AKLA 4DR3T 2DWKA 3RRCA 4LF9T 3BQLA 4TWHA 2FBWA 3N9QA 2HN2A 4TWDA 3RF1A 3O9XA 4ISSA 4IE4A 3GN5A 4QKNA 2Q9QD 3ABVA 1SHZC 3ZMUB 2PBIA 3NWIA 2BS2A 4QX8B 4LMJA 2HH7A 3CX6B 4HFCA 3Q5XA 1GQEA 4DV3T 3SRZA 2CHNA 3RGLA 2QA7A 3O1JA 1HNZT 5J2TE 4AQFC 4H9SE 3QK6A 5LGTB 3AA1B 1HX1B 2Y48B 2X9XA 2VK9A 2V26A 4HWCA 3UQ7A 1D1CA 5ABFB 3ESLA 3LJCA 1YD8G 4DVDA 1HG5A 3V5UA 5CB4E 3AEBA 4K0KT 4NIQA 1EZ3A 2XAHB 3RIUC 3K3OA 4OFZA 4HTEA 4EB6E 1ZHCA 4PJLA 1MMNA 4ILCA 2V8SV 5JDQA 5KXJA 1T7SA 4OX9T 5L2LA 2BG9A 2YDRA 1IJ5A 2VASA 4IHJE 5FVLA 4U31A 3BQIA 4X1YE 4NXNT 4AKIA 1LRZA 4ZEYA 4YT0A 3UU6A 3AEAA 2YK0A 3BQKA 2CEAA 3GN5B 4GYRA 2LSYA 3ETVA 4X5TA 3J7Yq 3T8OA 4PJMA 1VCSA 3AE3A 2XQ3A 3UFGA 2KZ7B 1XNQT 2E8IA 3UUXB 4G2AA 1NAFA 3AE4A 2WDQA 4JUYA 3Q9DA 2NW7A 3WI3A 2Q9QA 3EVYA 3IHRA 5LA6E 5JH7E 5LJNA 2OV9A 4QX7B 3B13A 3SFDA 3AE5A 2CBJA 4DV4T 3P8CD 3C4ZA 2W00A 5FXXA 3M65A 2ACXA 1I94T 4DNDA 4GKJT 5JR9C 2G0UA 2X66A 5L3FB 4PJNA 2HPLA 5TAOA 5AQLB 3ZJ1A 4DMVA 1OEDB 3KINB 5E0OA 4ERRA 4KMCA 3RYCE 1NWMX 2BG9B 4YHJA 5HXRA 2I0MA 3WAKA 2KINB 5JDFA 3TLTA 2JQKA 2KXPB 1IBLT 2ACZA 3TLUA 2VB6A 4L5GA 3C4WA 5AQOB 1IBMT 4B6XA 4WZXA 2Y8DA 3L3PA 5LHGB 3ZMZB 4EZ4A 2XUEA 4GOUA 5IHYA 1J5ET 3CMLA 5JVDE 2K48A 2NW8A 4NUVA 2OA5A 1LVFA 4L9IA 4EGWA 2LSGA 5L3DB 2E9XC 2HN1A 5L3CB 1BR1A 2CHOA 4CQIA 4QH1A 5AQSB 3QUJA 3CPZA 1NEKA 3AEEA 2Q9QB 5FXVA 1G8XA 4DV6T 3WAJA 2C5JA 1XMQT 2NW9A 3AAEB 2EHOC 4JBWF 1JNZA 3OKQA 3PURA 1S94A 4ISTA 3RQWA 1QSDA 4PFOA 3PUGA 4EV6A 3AVRA 4EZHA 2YKSA 3ZT6A 5LGNB 3LFMA 4DBQA 4O2AE 5LCYA 5BMVE 2J4GA 2VQET 3CQCB 1WLXA 3ZC0A 1XWMA 5FYMA 3P4PA 4KHZF 4AXPA
chains in the Genus database with same CATH topology
3FZMB 3A8YC 4HWFA 5AQRB 1I6ZA 5AQSB 3M3ZB 2D9DA 3FZHB 1M7KA 4HWIB 5AQTB 5AQUB 5AQIB 5AQVB 1UK5A 5AQKB 5AQJB 5AQFB 4HWHA 3LDQB 1T7SA 5AQHB 4HWDA 5AQLB 5AQPB 3FZKB 5AQOB 3FZFB 1M62A 5AQGB 5AQQB 1UGOA 1HX1B 5AQMB 5AQNB 4HWCA 3FZLB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FZM B;  3A8Y C;  4HWF A;  5AQR B;  1I6Z A;  5AQS B;  3M3Z B;  2D9D A;  3FZH B;  1M7K A;  4HWI B;  5AQT B;  5AQU B;  5AQI B;  5AQV B;  1UK5 A;  5AQK B;  5AQJ B;  5AQF B;  4HWH A;  3LDQ B;  1T7S A;  5AQH B;  4HWD A;  5AQL B;  5AQP B;  3FZK B;  5AQO B;  3FZF B;  1M62 A;  5AQG B;  5AQQ B;  1UGO A;  1HX1 B;  5AQM B;  5AQN B;  4HWC A;  3FZL B; 
#chains in the Genus database with same CATH topology
 1IJ6 A;  3R84 B;  4H9R C;  1WFD A;  3VR8 A;  2D9D A;  2PG8 A;  2NTX A;  2QVA A;  2WY2 A;  3KV9 A;  4V1A v;  4BJM A;  3OBV E;  4AIS A;  5L3G B;  4U2Z A;  3RIF A;  2DLR A;  3QC9 A;  3NZQ A;  2YOE A;  5L3E B;  5JDG A;  3HKB E;  2V5C A;  1BR2 A;  5CGM A;  2XAJ B;  5FVK A;  4X1I E;  5IYZ E;  2D2S A;  1HX8 A;  4M1P A;  3ONX A;  2BVL A;  2A72 A;  4NUU A;  3PUZ F;  1N36 T;  2XY8 B;  5BR8 T;  2UU9 T;  2W62 A;  3LDQ B;  4YY3 T;  3NKZ A;  1MIV A;  5LG4 A;  2I6H A;  4XBF B;  3Q5W A;  2W67 A;  5F3J A;  2P9B A;  4JI3 T;  3AEG A;  4WBN E;  2CLY C;  2ODV A;  4OYJ A;  1KEY A;  1MMD A;  4GK5 E;  4DR4 T;  1ZEE A;  2X0H A;  3IA3 A;  2V6X A;  3IEE A;  2XQ7 A;  2D0U A;  2UXN B;  1XDP A;  2YDS A;  3QNU A;  3AED A;  4ZZC A;  3RKG A;  3AA6 B;  2FJA A;  5FY1 A;  4TV8 E;  4CXW A;  4KI0 F;  3FXE B;  5FP3 A;  1J1J A;  2LRL A;  4ZHQ E;  2E2A A;  4AIU A;  2VVS A;  3F57 A;  1V9D A;  4YSY A;  2XQY A;  4ZOL E;  3KBU A;  1YKH B;  2K5B B;  4ZI3 D;  4HWF A;  4HKA A;  3PV0 F;  4HFD A;  4DR1 T;  4U74 A;  3CQX C;  5EK2 A;  4PW8 A;  4I55 E;  3HKC E;  4I4T E;  3OTO T;  4KX6 A;  2M67 A;  3PUV F;  5C2T A;  3C4X A;  3FZL B;  2X0Y A;  5DAB A;  2XAG B;  2L8K A;  4DR2 T;  1VOM A;  2HPJ A;  2A3D A;  3SFE A;  4LF8 T;  4LFA T;  2LLY A;  3PTR B;  4IT4 A;  5LHH B;  1HFA A;  2CXD A;  4NPP A;  2YN6 A;  3RH3 A;  3UUN A;  4PJJ A;  2BS4 A;  4EOZ B;  3ZMT B;  2WZH A;  3S4U A;  2WM9 A;  2WDR A;  2XQ5 A;  1Z8U A;  3N9O A;  5ADX L;  2J62 A;  2WBL A;  4JV5 T;  2M6I A;  2WS3 A;  5AQR B;  4KBM B;  2ZMA A;  4HEA A;  2L9Q A;  1N32 T;  5LP6 E;  1J5W A;  3JAD A;  4AQF A;  1HF8 A;  4WNK A;  3VKH A;  4JI8 T;  4Z90 A;  1QUU A;  2K24 A;  3AXJ A;  4LFC T;  3ZJ2 A;  3FZH B;  2WZI A;  2CWO A;  2RA1 A;  2XSA A;  3PUW F;  1CHU A;  3RHW A;  2LM9 A;  3A7M A;  3C64 A;  5HWY A;  3ANW B;  3ZC1 A;  3AE7 A;  3EDV A;  4IDO A;  5LYJ E;  3T1Y T;  1BR4 A;  2BS3 A;  2DHR A;  2LKH A;  1MMA A;  3A8Y C;  2WB5 A;  3VRA A;  4ZI2 D;  1M7K A;  3C50 A;  4O4H E;  4X1K E;  2X67 A;  2AXD S;  4H9Q C;  1KK7 A;  2RP4 A;  5L3B B;  5HXH A;  2I59 A;  3PUS A;  4BA9 A;  4A98 A;  4ANJ A;  1Y01 A;  3IBP A;  4O4J E;  4H9O C;  4CN4 A;  3N5L A;  4JI5 T;  2V7M A;  3UU5 A;  2V6Y B;  3N9M A;  4OK0 A;  3AE8 A;  4HWH A;  1XZY A;  3V5S A;  4MAL A;  2JQH A;  4WYV A;  3SOL A;  5HXE A;  3KV5 A;  5HEG A;  3PU8 A;  2CA5 A;  5LMN T;  1NEN A;  3FBL A;  4DBR A;  1E7P A;  2ZLY A;  1MND A;  2W0G A;  2M6B A;  5CA0 E;  3JC6 C;  5A1L A;  1W9R A;  3RC8 A;  1N33 T;  2NOX A;  3ZCJ A;  3NBX X;  1OED C;  4QWN B;  3KFW X;  4YSX A;  5JRE A;  1FMW A;  1H7C A;  2BG9 C;  4YTN A;  3LG7 A;  3PUX F;  1D0Z A;  2LT3 A;  2W4X A;  3CKD A;  2KND A;  3E0Z A;  2F4V T;  4CZZ B;  4LMK A;  2GK9 A;  3GA8 A;  1YXR A;  3NZP A;  4CN6 A;  3ZT7 A;  3UQ4 A;  4UEL A;  4QXB B;  1LVK A;  4HFH A;  4LF7 T;  2H7O A;  4FJO A;  5EZY E;  3UUM A;  1WYB A;  4U72 A;  3DP7 A;  2UXC T;  3HL6 A;  3R6N A;  4L0R A;  4UV8 B;  4MLK A;  3P4S A;  1R8I A;  1U4Q A;  2WDV A;  5FXZ A;  3TLV A;  2D5U A;  3O1I A;  3FHN A;  2A2F X;  2Q9Q C;  2KWH A;  3ZN0 B;  5C3J A;  2QRX A;  3CX8 B;  1FMV A;  4NXM T;  3HR0 A;  1N34 T;  2XAF B;  4QHO A;  5AQK B;  4ZS3 A;  3JAE A;  2VUR A;  2VKO A;  5L4E A;  5HCJ A;  1HNX T;  4LF6 T;  4JI6 T;  3L09 A;  4MBQ A;  2E9X A;  3KVA A;  4PK4 A;  4O2B E;  4HWI B;  5F5W A;  4H63 H;  5LMU T;  2XQA A;  3ZEF B;  3FZK B;  3UU8 A;  2AE9 A;  2XM2 A;  3RRW A;  2LOP A;  3ONL C;  2XTL A;  3RPU A;  5ABE A;  3RLF F;  3VHL A;  3RX6 A;  3MZK B;  2MTQ A;  5L4H A;  2EHO A;  4O8S A;  4HFB A;  2LKG A;  2NWB A;  5AFU L;  2BKO A;  2LE8 A;  4X65 T;  2DWG A;  3QB5 K;  3ZYK A;  3Q2M A;  2XAS B;  3TKL B;  2C5I T;  3AAI A;  3N9P A;  4IDZ A;  4DUY T;  5DQV A;  4YXD A;  2V7I A;  3CX7 B;  2JQQ A;  2X51 A;  4UV9 B;  4UEM A;  3MA9 A;  2VKD A;  2N1G A;  3OJA A;  1ZOY A;  3KV4 A;  5EK4 A;  3ZKR A;  1YQ3 A;  3PDY A;  1IZN B;  4JI7 T;  2QGS A;  1SE7 A;  2LRK A;  3EDU A;  5AQU B;  2WAU A;  4AI6 A;  2IHR 1;  4JI4 T;  4DR5 T;  2LSI A;  3U78 A;  4ILB A;  2ES0 A;  5HAX A;  2LSK A;  1US7 B;  4BAY B;  3LK2 B;  2DL1 A;  4PK6 A;  1WRD A;  3JCF A;  3FB2 A;  2H89 A;  3ONJ A;  4HN9 A;  3K3N A;  1WR0 A;  5HYA A;  2DNX A;  4IDQ A;  4CI1 B;  3N9L A;  4PK5 A;  3GWH A;  2J1D G;  3G06 A;  3HKD E;  3UFE A;  4WW0 A;  4EYY R;  5DJQ C;  2MAW A;  3AE1 A;  4GIW A;  4C91 A;  4AKR B;  3SS1 A;  4HGA A;  5J0Z A;  2VL0 A;  5AQG B;  5LXT E;  4LML A;  3DTO A;  4X64 T;  2XQ4 A;  3RYH E;  3F31 A;  2H7V C;  5FKY A;  4ZI7 E;  4JEU B;  5LNK A;  2JJ9 A;  2DCF A;  4JYA T;  2FJB A;  3JAF A;  3P4W A;  1IBK T;  3P50 A;  2CXF A;  3AE6 A;  2X68 A;  3HI2 A;  4H63 V;  2N9D A;  5HXC A;  4Z91 A;  4LF4 T;  3M3Z B;  1DU2 A;  4CI2 B;  4MHC A;  3AA0 B;  4IDN A;  1HS7 A;  2Y6X A;  2D0T A;  3O1H A;  5JDL A;  4JEH B;  2LOS A;  1L0V A;  2XQ6 A;  3MKD A;  3UUL A;  4X66 T;  5JDH A;  4IE0 A;  1D0X A;  3E08 A;  4QXC B;  2MOZ A;  4X20 E;  1HTJ F;  4TX5 A;  4CN1 A;  5AQJ B;  3L39 A;  1OED E;  4UVB B;  4P0A A;  1X9B A;  2N2N A;  3MJX A;  4I43 B;  3ZPO A;  4PFP A;  2BG9 E;  4F8H A;  1B7T A;  4AKG A;  3ETU A;  3ZN1 B;  2WQY A;  4B3S T;  2CPT A;  2IDO B;  5FNV E;  3ZYL A;  4DID B;  4H9N C;  4ZZB A;  5KMG P;  4UF0 A;  2FUP A;  2X9H A;  2BZB A;  5JDM A;  3FZM B;  2K9A A;  2IAK A;  4ZS2 A;  3TLW A;  2IC9 A;  4E7S A;  4YTM A;  4KUM B;  3MK7 C;  3ZCI A;  3N2K E;  5ABF A;  4TZ4 C;  3I9W A;  3TLS A;  3RIA A;  2ZM2 A;  3P7I A;  4DUZ T;  4K0U A;  2NTY A;  3EHZ A;  4HE8 A;  4TNW A;  1MIY A;  5HEO A;  1U5P A;  2JMK A;  5AQP B;  1G73 A;  2CWY A;  4YLH A;  5AQQ B;  4UVC B;  3P4Q A;  4QH5 A;  5LGU B;  3RYF E;  2E5V A;  3ZMS B;  3I0O A;  3N2O A;  3VR9 A;  3UU3 A;  4O4I E;  3OVU A;  4ILU A;  3FBZ A;  4YTP A;  3H3M A;  1FIO A;  3AE2 A;  3P4R A;  1FJG T;  5LJM A;  3EAM A;  3N9N A;  2IUB A;  3CK6 A;  4MFR A;  1MMG A;  5FL0 A;  2IML A;  3T1H T;  4CXX A;  2XHE B;  4OYK A;  5LG3 A;  2UXB T;  3PE0 A;  4CI3 B;  5IUX A;  2KT9 A;  3RIU A;  4UF0 B;  3NRY A;  4GK0 E;  4U2Y A;  2VL8 A;  2UXX B;  4IDP A;  2V7L A;  1XDO A;  4C90 A;  3CIR A;  3MXZ A;  2K3W A;  4LFB T;  5JRC A;  2YEV C;  2FJD A;  3IF8 B;  2XJ7 A;  3OPC A;  2JRK A;  4UR9 A;  5C8Y E;  4DV7 T;  2FJE A;  2YU2 A;  1ZP0 A;  3K1S A;  2W63 A;  4Q25 A;  1XNR T;  2E9X D;  2OLT A;  4TV9 E;  3NRX A;  4KHP T;  4DR6 T;  3N2G E;  4H9P C;  1E2A A;  3VRB A;  4IE6 A;  3BK9 A;  4P1N A;  3HKE E;  1SA0 E;  3E22 E;  5IWA T;  2BBJ A;  3KV6 A;  4GKK T;  1OED A;  3KDS E;  4IIJ E;  3RQU A;  1HG2 A;  4O4L E;  4ZI3 C;  2SPC A;  4TWF A;  1KFY A;  5GON E;  1MIW A;  4U3C A;  3PJA A;  2YDQ A;  2EHO D;  2ZM6 T;  4DMW A;  4JI0 T;  2MYS A;  3MAC A;  3VU7 H;  2WCA A;  3H37 A;  4TNV A;  5CFB A;  2WSS V;  3AXJ B;  3ZSS A;  3PUY F;  4IRE A;  2J47 A;  3EUH A;  1T98 A;  1UUR A;  5AQN B;  4QH4 A;  2V7J A;  4B3R T;  4IL9 A;  2WP9 A;  2MBG A;  4EEB A;  1KNP A;  5AQF B;  5JR9 A;  4IGU A;  2V7K A;  4A5X A;  2JIW A;  1IAP A;  5JRC B;  1JNR A;  3UUB A;  4YJ2 E;  2PJQ A;  3SWH A;  3K3Q C;  5HCM A;  5KX5 E;  2ODU A;  2BKP A;  4XAX B;  3AE9 A;  2IC6 A;  3C98 B;  2UUB T;  3GMI A;  5FY7 A;  3LBX A;  3U3I A;  3ZT5 A;  5FL1 A;  3FZF B;  2BKN A;  3F2E A;  1Z0P A;  2Z6E A;  4Z8X A;  1QLB A;  2CXL A;  2NR4 A;  4BJN A;  1LKX A;  1S35 A;  4DV0 T;  4LF5 T;  5FY0 A;  3PUQ A;  2WWV A;  2VKJ A;  4TUY E;  3LK4 2;  5H6R B;  4DV5 T;  2IIU A;  2ZM0 A;  1D1A A;  1OXZ A;  3L8R A;  4G63 A;  4B3T T;  4A97 A;  2YIN A;  2XQ8 A;  2XZE A;  3AEC A;  4X62 T;  2LHN A;  3J9X 1;  3HA4 A;  2DI4 A;  1SUM B;  2LJL A;  4ZI2 C;  4EYU A;  3AA7 B;  3A5X A;  5FXW A;  1ZKE A;  2KMF A;  1HNW T;  3D0T A;  3EI0 A;  2QYW A;  3O4X E;  2CCQ A;  1FEW A;  4CXY A;  2V5D A;  3PUA A;  5AQV B;  2XM1 A;  1UK5 A;  5LBM A;  3RKO A;  2B1E A;  4ASK A;  5HXS A;  2LSJ A;  2UUA T;  1VRB A;  5JR9 B;  4YFS A;  1WR6 A;  4J2C A;  1VCT A;  4GYS A;  2LEH A;  4WBO A;  3VKG A;  4FI5 A;  4UIG A;  3B57 A;  2KWI B;  1WYC A;  3B5M A;  2BDE A;  5LB7 B;  1Y64 B;  2WU5 A;  1AJ3 A;  3PJA J;  4PNI A;  1KNR A;  3LK3 B;  4IE7 A;  5ABH A;  1M62 A;  2V1D B;  4COF A;  2KLQ A;  3I1A A;  4IE5 A;  3LBX B;  4ADZ A;  2HHH T;  5ETW A;  3Q5E A;  2X0L B;  4DV2 T;  3ZMV B;  2CE7 A;  3FXD B;  4I50 E;  5JQG E;  5JTG A;  3QB5 A;  4KP3 C;  2JQ9 A;  2CBI A;  5HEJ A;  1UX5 A;  5AQM B;  4EXT A;  5FMN A;  5CJ5 A;  5ABG A;  1WCR A;  5DQW A;  1I6Z A;  4HFV A;  5LOV E;  2W66 A;  3AB3 B;  1MNE A;  2E9X B;  1OWA A;  1BR0 A;  3RC3 A;  1E1H B;  3RI5 A;  2A9U A;  3Q5D A;  2XSB A;  4EIW A;  4UVA B;  2VWA A;  2CMR A;  5EK3 A;  2MPK A;  2UXD T;  4YSZ A;  4ILA A;  2R6G F;  5H6Q B;  1D0Y A;  4EAH A;  2BVM A;  3X1D A;  2L3L A;  4F6R C;  3UT5 E;  2EHO B;  3I0Q A;  1UX4 A;  2C5K T;  4U7I A;  2WWU A;  2IW5 B;  4JI1 T;  2WMO A;  5LHI B;  2JMH A;  1CUN A;  5HEH A;  4OHF A;  4I0U A;  1KF6 A;  3PU3 A;  3OYX A;  1W0B A;  2LHR A;  3UTK A;  2YU1 A;  3I9Y A;  2NP9 A;  4E7Z A;  3AAA B;  2PTF A;  4HFI A;  3ZLI A;  3DJB A;  1YQ4 A;  4IL4 A;  3EAB A;  1XMO T;  5AQI B;  5LBQ B;  1ZV4 X;  4A56 A;  4PAG A;  2WMN A;  2PFV A;  2XPK A;  2RPA A;  1HR0 T;  5JDN A;  1UCU A;  4UXN B;  2WU2 A;  5J1G A;  3CWZ B;  4ZXL A;  4JI2 T;  5L47 A;  4AQG A;  3OYZ A;  2CM0 A;  2VVN A;  5AQH B;  4HWD A;  1YW0 A;  2LM2 A;  3NVO A;  4U33 A;  3K8P C;  4P0B A;  2VQF T;  2H3R A;  2BBH A;  4YHH T;  2XAQ B;  5CA1 E;  1UUS A;  1T8B A;  2UUC T;  4YJ3 E;  3RYI E;  3W15 B;  2W61 A;  5HWX A;  2W2U A;  1UGO A;  2X9Y A;  2X9W A;  1O3X A;  2E5L T;  4QXH B;  5KDM C;  3JC6 D;  1X79 A;  3ANW A;  3KVB A;  4U7Y A;  4AKH A;  3ZST A;  3C51 A;  4HFE A;  1T72 A;  4JLE A;  5HEU A;  3LSV A;  2CLY B;  3ZYM A;  1YKE B;  4DV1 T;  2ZM8 A;  4DO0 A;  1W0A A;  2VKH A;  3AEF A;  4EED A;  4DR7 T;  2H88 A;  1D1B A;  5AQT B;  4N78 D;  3UU4 A;  4B3M T;  5F8P A;  2KSR A;  3CQG B;  4XZC A;  2B76 A;  3KBT A;  1KNZ A;  2V6Y A;  4P09 A;  3QOF A;  4AQY T;  2C0S A;  1HCI A;  3H3A A;  3AVS A;  1W09 A;  2JPF A;  5M4Y A;  5J2U E;  2CRB A;  2XQ9 A;  3CVR A;  4TN7 B;  4AKL A;  4DR3 T;  2DWK A;  3RRC A;  4LF9 T;  3BQL A;  4TWH A;  2FBW A;  3N9Q A;  2HN2 A;  4TWD A;  3RF1 A;  3O9X A;  4ISS A;  4IE4 A;  3GN5 A;  4QKN A;  2Q9Q D;  3ABV A;  1SHZ C;  3ZMU B;  2PBI A;  3NWI A;  2BS2 A;  4QX8 B;  4LMJ A;  2HH7 A;  3CX6 B;  4HFC A;  3Q5X A;  1GQE A;  4DV3 T;  3SRZ A;  2CHN A;  3RGL A;  2QA7 A;  3O1J A;  1HNZ T;  5J2T E;  4AQF C;  4H9S E;  3QK6 A;  5LGT B;  3AA1 B;  1HX1 B;  2Y48 B;  2X9X A;  2VK9 A;  2V26 A;  4HWC A;  3UQ7 A;  1D1C A;  5ABF B;  3ESL A;  3LJC A;  1YD8 G;  4DVD A;  1HG5 A;  3V5U A;  5CB4 E;  3AEB A;  4K0K T;  4NIQ A;  1EZ3 A;  2XAH B;  3RIU C;  3K3O A;  4OFZ A;  4HTE A;  4EB6 E;  1ZHC A;  4PJL A;  1MMN A;  4ILC A;  2V8S V;  5JDQ A;  5KXJ A;  1T7S A;  4OX9 T;  5L2L A;  2BG9 A;  2YDR A;  1IJ5 A;  2VAS A;  4IHJ E;  5FVL A;  4U31 A;  3BQI A;  4X1Y E;  4NXN T;  4AKI A;  1LRZ A;  4ZEY A;  4YT0 A;  3UU6 A;  3AEA A;  2YK0 A;  3BQK A;  2CEA A;  3GN5 B;  4GYR A;  2LSY A;  3ETV A;  4X5T A;  3J7Y q;  3T8O A;  4PJM A;  1VCS A;  3AE3 A;  2XQ3 A;  3UFG A;  2KZ7 B;  1XNQ T;  2E8I A;  3UUX B;  4G2A A;  1NAF A;  3AE4 A;  2WDQ A;  4JUY A;  3Q9D A;  2NW7 A;  3WI3 A;  2Q9Q A;  3EVY A;  3IHR A;  5LA6 E;  5JH7 E;  5LJN A;  2OV9 A;  4QX7 B;  3B13 A;  3SFD A;  3AE5 A;  2CBJ A;  4DV4 T;  3P8C D;  3C4Z A;  2W00 A;  5FXX A;  3M65 A;  2ACX A;  1I94 T;  4DND A;  4GKJ T;  5JR9 C;  2G0U A;  2X66 A;  5L3F B;  4PJN A;  2HPL A;  5TAO A;  5AQL B;  3ZJ1 A;  4DMV A;  1OED B;  3KIN B;  5E0O A;  4ERR A;  4KMC A;  3RYC E;  1NWM X;  2BG9 B;  4YHJ A;  5HXR A;  2I0M A;  3WAK A;  2KIN B;  5JDF A;  3TLT A;  2JQK A;  2KXP B;  1IBL T;  2ACZ A;  3TLU A;  2VB6 A;  4L5G A;  3C4W A;  5AQO B;  1IBM T;  4B6X A;  4WZX A;  2Y8D A;  3L3P A;  5LHG B;  3ZMZ B;  4EZ4 A;  2XUE A;  4GOU A;  5IHY A;  1J5E T;  3CML A;  5JVD E;  2K48 A;  2NW8 A;  4NUV A;  2OA5 A;  1LVF A;  4L9I A;  4EGW A;  2LSG A;  5L3D B;  2E9X C;  2HN1 A;  5L3C B;  1BR1 A;  2CHO A;  4CQI A;  4QH1 A;  5AQS B;  3QUJ A;  3CPZ A;  1NEK A;  3AEE A;  2Q9Q B;  5FXV A;  1G8X A;  4DV6 T;  3WAJ A;  2C5J A;  1XMQ T;  2NW9 A;  3AAE B;  2EHO C;  4JBW F;  1JNZ A;  3OKQ A;  3PUR A;  1S94 A;  4IST A;  3RQW A;  1QSD A;  4PFO A;  3PUG A;  4EV6 A;  3AVR A;  4EZH A;  2YKS A;  3ZT6 A;  5LGN B;  3LFM A;  4DBQ A;  4O2A E;  5LCY A;  5BMV E;  2J4G A;  2VQE T;  3CQC B;  1WLX A;  3ZC0 A;  1XWM A;  5FYM A;  3P4P A;  4KHZ F;  4AXP A; 
#chains in the Genus database with same CATH homology
 3FZM B;  3A8Y C;  4HWF A;  5AQR B;  1I6Z A;  5AQS B;  3M3Z B;  2D9D A;  3FZH B;  1M7K A;  4HWI B;  5AQT B;  5AQU B;  5AQI B;  5AQV B;  1UK5 A;  5AQK B;  5AQJ B;  5AQF B;  4HWH A;  3LDQ B;  1T7S A;  5AQH B;  4HWD A;  5AQL B;  5AQP B;  3FZK B;  5AQO B;  3FZF B;  1M62 A;  5AQG B;  5AQQ B;  1UGO A;  1HX1 B;  5AQM B;  5AQN B;  4HWC A;  3FZL B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...