2D9DA

Solution structure of the bag domain (275-350) of bag-family molecular chaperone regulator-5
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
89
structure length
89
Chain Sequence
GSSGSSGSILKIEKVLKRMREIKNELLQAQNPSELYLSSKTELQGLIGQLDEVSLEKNPCIREARRRAVIEVQTLITYIDLKESGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chaperone
molecule keywords BAG family molecular chaperone regulator 5
publication title The C-terminal BAG domain of BAG5 induces conformational changes of the Hsp70 nucleotide-binding domain for ADP-ATP exchange
pubmed doi rcsb
source organism Homo sapiens
total genus 23
structure length 89
sequence length 89
ec nomenclature
pdb deposition date 2005-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02179 BAG BAG domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.120 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 BAG domain 2d9dA00
5AQSB 5AQMB 5AQVB 4HWFA 5AQRB 5AQUB 4HWDA 4HWHA 1HX1B 3FZMB 1UK5A 5AQHB 3FZKB 5AQTB 3FZLB 3LDQB 5AQLB 3FZFB 5AQIB 5AQKB 1T7SA 4HWIB 5AQPB 4HWCA 3M3ZB 1M7KA 5AQFB 3FZHB 5AQQB 1I6ZA 1UGOA 5AQOB 5AQGB 1M62A 5AQJB 2D9DA 3A8YC 5AQNB
chains in the Genus database with same CATH superfamily
3UUBA 3KBTA 2WDVA 2K9AA 4ZI2C 1WR6A 2A9UA 2B76A 2D0TA 3JC6D 4OK0A 1FMWA 4AIUA 3HKEE 3RHWA 1D1AA 1HTJF 2LJLA 3U3IA 4O8SA 4QH4A 3QK6A 3ZMUB 4Z8XA 3UUXB 2NW9A 2X68A 5HEJA 4U72A 3ONJA 3Q5EA 3PUYF 3RQUA 3C51A 4TWHA 4X1YE 2CLYC 1US7B 3AE8A 2CHOA 3KVBA 3LK42 5JVDE 2IIUA 1YD8G 2UUBT 3SRZA 4JLEA 2WY2A 2UU9T 5AQOB 5E0OA 2JQKA 3ZPOA 1NENA 4X64T 3J7Yq 3UU5A 3PURA 2X51A 3RRCA 3PU3A 5LMNT 1LVFA 4XAXB 3RGLA 3RF1A 5F5WA 5HYAA 3I9YA 2MOZA 3N9MA 4KBMB 1MMDA 4MHCA 2Y6XA 2OV9A 5LG4A 2Y8DA 1M7KA 2J4GA 4DMVA 3NVOA 4QH5A 4H9OC 3R84B 2H88A 5EZYE 2XHEB 1KF6A 3KFWX 2CXLA 2XSAA 4BJNA 5L3DB 1FMVA 4HFIA 5LA6E 1YKHB 1HFAA 4EZHA 3FXEB 5DQWA 5FY0A 4WBOA 1FIOA 4NUVA 4J2CA 4CI3B 3OKQA 1D1CA 2KXPB 3LJCA 2C5KT 3PTRB 2UUAT 3JC6C 4LMJA 2K3WA 4ZXLA 1LVKA 1YQ3A 4YT0A 4DR5T 3SFEA 3L09A 2V8SV 3NRXA 4CN4A 2HHHT 1D0ZA 5JQGE 4QKNA 4LF9T 4P0BA 3AA0B 5CGMA 1IBLT 5HCJA 2C0SA 4HFCA 2CA5A 2VKDA 5M4YA 2JRKA 2NWBA 3N9OA 3MK7C 3RYCE 3N2GE 5JDNA 2LLYA 4GOUA 1WYCA 4PK6A 1SE7A 5LYJE 5FY1A 3F2EA 4CZZB 1UX5A 2WCAA 2CLYB 4EEBA 4ANJA 3LBXA 2PFVA 2XTLA 3HKCE 4BA9A 3ZC0A 2BS3A 1OEDC 4U74A 5AQHB 4EOZB 4UF0B 2X0HA 2V7IA 2EHOD 5FXZA 2LSJA 4B3RT 2FUPA 4UEMA 2XASB 3AEDA 5IUXA 4UELA 4P09A 3J9X1 5L47A 4ILCA 4Q25A 1UURA 3UUNA 3S4UA 4F6RC 4LF6T 4QX8B 3LBXB 1XDOA 3RRWA 4JV5T 2CXFA 4IDZA 4O2AE 4QHOA 3FZHB 4DR6T 4DV0T 2V7LA 5JREA 1BR4A 3DTOA 5J2UE 5JDLA 3VRAA 2LRLA 5JTGA 2ZM0A 3VU7H 1CUNA 3HKBE 4QXHB 2A2FX 3FZLB 4UIGA 3EI0A 4AKHA 3P8CD 5F3JA 4UV8B 2VKHA 4JI3T 4DIDB 4AISA 2V1DB 3M65A 4AKRB 3E0ZA 3HL6A 3JAFA 3JAEA 2N1GA 3UFGA 2KSRA 4KP3C 3CPZA 2XZEA 3UQ7A 1BR0A 4I0UA 2P9BA 5FXXA 2WZIA 3CQXC 4TWFA 5HEHA 2HPLA 3P4RA 3HI2A 4WZXA 4AQYT 4HFEA 3IBPA 4B6XA 2I6HA 2BG9C 5HXSA 2CWYA 3Q9DA 3F31A 3AEBA 3CMLA 5LHGB 2JQHA 2XQ5A 3MZKB 3IHRA 4HWFA 4LF8T 4UVBB 5LOVE 1MIVA 2KWIB 2LKHA 2YDSA 3PDYA 4XBFB 2W2UA 3PUQA 3RX6A 4CN1A 2X67A 3P4PA 1KFYA 3N9QA 1JNZA 4ZI3D 3IEEA 3RYHE 4EB6E 4QX7B 4ZI2D 2H7OA 3N5LA 4CXWA 1SHZC 4V1Av 2XPKA 4X66T 1N36T 4WNKA 2JMKA 1N34T 3L39A 2E9XD 1IJ5A 2W00A 3CX8B 4I55E 2BBJA 4X1KE 2EHOC 3OJAA 3AAIA 3O1HA 4YY3T 3P4SA 3AEFA 3ZYLA 5AQMB 1BR2A 4MALA 4TV8E 1O3XA 2NW7A 4EYYR 4DV3T 2V6YA 3HA4A 3ZCJA 2XQ3A 2YDRA 3ESLA 5HXRA 3RIUC 3ZMVB 4EGWA 2IUBA 2Q9QC 2DI4A 3AE7A 3SWHA 4IDPA 3JCFA 3K3OA 1KNPA 4U3CA 2LM9A 1HNWT 5ABEA 1XMQT 2BDEA 4IDQA 2LSKA 5LP6E 1HF8A 3K8PC 4F8HA 3BK9A 3TLSA 2VK9A 4PFPA 2VKJA 1M62A 4TNVA 2VQET 1HCIA 5IYZE 2WDRA 3HR0A 4Z90A 2V6YB 2LRKA 4DO0A 1XZYA 5ABHA 4YSZA 3EDUA 2DCFA 3TLUA 1J5ET 2E5VA 3I9WA 5LHIB 5C8YE 2JMHA 5JR9C 2WM9A 3C4ZA 1Y01A 2FJEA 4U31A 5ABFA 5IHYA 4DV7T 3AVSA 3RLFF 5AFUL 3QNUA 2J1DG 5HXCA 3VHLA 1I6ZA 3AECA 3UQ4A 4PFOA 1MNDA 3EABA 2BBHA 2IAKA 3OYXA 2BG9B 3NBXX 4X1IE 4PJMA 4EXTA 1VOMA 4COFA 4HFBA 4AKIA 2XAFB 4JBWF 5HEUA 2GK9A 3DP7A 4DBQA 4YSYA 3V5UA 4ZI3C 4ZZCA 5ABFB 4PJLA 2D0UA 5JDGA 4IDNA 2JPFA 1S94A 1MMGA 4ASKA 4HE8A 3NZQA 5AQFB 2AXDS 2E9XC 1GQEA 3LFMA 2LSYA 4JEUB 3RIUA 4WBNE 3KVAA 2H3RA 2CWOA 1YKEB 3C98B 4ZZBA 4JUYA 5CB4E 3N9PA 5FVLA 5H6RB 2K24A 3AEAA 3GWHA 2X66A 4JI0T 3MJXA 4H9PC 4HWCA 2EHOB 4GK5E 2ZM6T 5L3FB 5L2LA 3UTKA 4Z91A 5AQVB 3ZSSA 2XJ7A 3PUWF 2W4XA 4IE5A 5KX5E 3L3PA 1ZEEA 2YU1A 4E7SA 3P4WA 5AQLB 5FYMA 2Q9QB 4MFRA 2CE7A 4LF5T 3PV0F 1W0BA 2WU5A 2VB6A 1HNXT 2VKOA 5LGUB 5J1GA 1G8XA 4ZS2A 2BZBA 1SUMB 3I0OA 3UU8A 3NRYA 1ZP0A 3EVYA 1UX4A 2UXCT 2KNDA 5FKYA 3PUZF 3B5MA 4P1NA 3K3QC 1J5WA 4A98A 2X9XA 2CBJA 2IHR1 3AE3A 3C4WA 4YHJA 2FJAA 5DQVA 1YW0A 4ILBA 3ZJ2A 3RI5A 5AQJB 4O4JE 4FJOA 2CMRA 5DJQC 5LBMA 2IW5B 3ZCIA 1L0VA 4CI2B 5L3BB 2BS2A 2V5CA 2WQYA 2VL0A 2BVLA 1W09A 3CKDA 1J1JA 3OBVE 4KX6A 4IE7A 2DHRA 4IREA 5ADXL 3NZPA 4U33A 1LRZA 5CFBA 4WW0A 1HG2A 2XUEA 4KI0F 3B13A 4DR3T 2LHNA 3X1DA 3ONLC 2LM2A 3EHZA 1EZ3A 3RPUA 1VCTA 2F4VT 4ZHQE 5L4HA 3QC9A 2E9XB 4B3ST 2MYSA 2HN1A 3ZMSB 5FP3A 4UF0A 5CA1E 5GONE 5FXWA 1MIWA 3NWIA 1KK7A 4G2AA 2V7MA 2BKPA 4X20E 1G73A 5EK4A 2E8IA 4C90A 2ZM2A 4AI6A 5AQGB 2M67A 4IE6A 4HEAA 2E5LT 4LMKA 2M6BA 2XM2A 4H9NC 3Q5WA 2W66A 4LFAT 3RKGA 3PUGA 3BQLA 4HWIB 3AE9A 2VQFT 4GIWA 3TLWA 2X9HA 2KINB 2OA5A 5CJ5A 2ACZA 1WR0A 3JADA 4H9RC 4YSXA 3AE6A 4DV1T 2KLQA 4KUMB 3ETUA 4PW8A 2Q9QD 5TAOA 3KBUA 2W67A 2PBIA 4DNDA 2ZMAA 4EIWA 4AQFC 1IBMT 4DV5T 5H6QB 2E2AA 4YFSA 4DBRA 3QB5A 1HX8A 2X0YA 3UFEA 3RC8A 2QRXA 2X9WA 4AKGA 3KDSE 4AKLA 2WWUA 2PG8A 2YKSA 2MPKA 2C5IT 4LMLA 2L3LA 2KZ7B 3GN5B 5HCMA 1KEYA 4OHFA 5LBQB 3NKZA 2XQYA 3CWZB 5FVKA 3ZC1A 2KMFA 4HTEA 4DV6T 1XWMA 2YINA 1E7PA 1YXRA 4ADZA 2JQQA 1FEWA 5FMNA 2VASA 3B57A 3AE4A 5HXHA 4EAHA 5JDFA 2DWGA 2W0GA 4WYVA 1WCRA 1UGOA 1ZOYA 1HR0T 3UU4A 4I50E 3U78A 1D0YA 4PJNA 5FNVE 3SS1A 3SFDA 2PJQA 4U7IA 4GKJT 1OEDA 1Z0PA 3AE5A 1T7SA 2CHNA 3PUAA 4JI4T 4JI6T 1N33T 3KV5A 3CIRA 3OVUA 2VURA 2ODUA 3RQWA 2CBIA 5LMUT 4CI1B 2BS4A 3QUJA 3FXDB 3PUXF 2RP4A 3O4XE 5CA0E 4TV9E 3ONXA 2LE8A 2CRBA 4OYKA 1N32T 1OEDB 2NTXA 5BMVE 2V7JA 2CCQA 4TZ4C 3RIAA 3ANWA 3VR8A 3GA8A 3P50A 4IE4A 2LT3A 2XAGB 5F8PA 1OWAA 4EV6A 3CX6B 2HH7A 2H89A 5JRCB 3CX7B 3SOLA 3ZT5A 2V6XA 2YN6A 4HN9A 4LF7T 4IT4A 5FY7A 3TLTA 4DR7T 2WP9A 3KV9A 3MA9A 4TWDA 5J0ZA 4H9QC 1WLXA 3MACA 3W15B 4H9SE 3WI3A 4XZCA 4HWDA 4U2ZA 4HGAA 3ANWB 4U7YA 5HXEA 2BG9A 4YTMA 3CQCB 1VCSA 5AQTB 4PK5A 4O4LE 2CEAA 2UXDT 2IC6A 2LSGA 5ETWA 2YEVC 2K48A 1Y64B 1DU2A 4QWNB 3KINB 4EEDA 1I94T 4O4HE 3P7IA 4L9IA 4JI1T 1MMNA 2Y48B 5HEOA 4I43B 2WDQA 2PTFA 1T8BA 1E2AA 3L8RA 3H37A 3AEGA 3UU6A 4N78D 3A7MA 3IA3A 2JIWA 2YK0A 3OTOT 2WB5A 1CHUA 2IC9A 2A3DA 2LOPA 4HFHA 1OEDE 4GYSA 4IIJE 1NWMX 2R6GF 3AAAB 4LFCT 4DVDA 2EHOA 3N9NA 2XQAA 2NOXA 1AJ3A 2XAJB 2AE9A 1D0XA 2W61A 4K0KT 3FBLA 1NAFA 3MXZA 3HKDE 5AQIB 3RC3A 2WU2A 4UVAB 3PUVF 2X9YA 4C91A 3AA6B 2RPAA 2Q9QA 2D2SA 2LEHA 4DV4T 2XQ8A 4TUYE 4UR9A 1WRDA 3FHNA 4HFDA 4GKKT 1R8IA 4EZ4A 4IHJE 2UXXB 4YHHT 4IL9A 2NR4A 3RIFA 3E08A 3PU8A 1IJ6A 4CQIA 4TNWA 5AQUB 1NEKA 1X79A 5LNKA 5L4EA 4ZI7E 2BKNA 3BQKA 2CXDA 2X0LB 4KHPT 2JJ9A 4ILUA 5JR9A 1B7TA 4DR4T 2KT9A 2BG9E 4ILAA 3VR9A 2WS3A 1IAPA 2XM1A 5C3JA 2DWKA 4KHZF 2XAHB 2ZM8A 5FL1A 2Z6EA 4O2BE 5AQNB 4JYAT 3F57A 1SA0E 1KNRA 3ZT6A 2YU2A 4LF4T 3ZKRA 4OX9T 5L3CB 3LK2B 3UT5E 4B3TT 3AAEB 5JDHA 2FJDA 3H3MA 5JR9B 3O1IA 1VRBA 1WYBA 2LSIA 2MBGA 5LXTE 3T1YT 4MBQA 1Z8UA 3VKGA 4AXPA 5KDMC 5LHHB 3RH3A 5HAXA 2E9XA 4PK4A 4UXNB 3AE2A 1QSDA 2XAQB 4DMWA 3ZN0B 4L5GA 2BVMA 4H63V 1LKXA 3AE1A 2VVSA 1W9RA 2FJBA 3ZMZB 2N2NA 3O9XA 2QVAA 5KXJA 4E7ZA 1MIYA 2KWHA 1XMOT 2J47A 4G63A 5BR8T 3PJAJ 1ZHCA 2ACXA 4IGUA 3I0QA 2XQ6A 2NP9A 2LOSA 4CXXA 2ZLYA 5EK3A 1XDPA 2K5BB 5JDQA 4A97A 2CPTA 2IMLA 3FB2A 4BAYB 3C50A 2DLRA 2SPCA 3EUHA 3KV4A 1HG5A 2WSSV 4NPPA 2CM0A 2VL8A 5LGNB 2ES0A 3ZN1B 3RYIE 2W62A 3O1JA 2V5DA 5L3GB 3TKLB 4DV2T 4YTPA 3WAKA 3A8YC 4ZEYA 4MLKA 4PNIA 3LSVA 3K1SA 3K3NA 5HWYA 3N2OA 1ZKEA 4M1PA 3ZMTB 2MAWA 3QB5K 5FL0A 2WBLA 3C4XA 4YJ2E 4TX5A 1UCUA 1U5PA 2LHRA 4HWHA 1T98A 3P4QA 1UK5A 2DNXA 2JQ9A 1ZV4X 3GN5A 3PE0A 4CN6A 2I0MA 4QH1A 2MTQA 2B1EA 1BR1A 3ZJ1A 3T1HT 3WAJA 1HX1B 5JDMA 4GYRA 3LK3B 5JH7E 4NXNT 4X62T 3CK6A 2NW8A 4DUZT 2OLTA 5FXVA 2HN2A 2XQ9A 3A5XA 4L0RA 3E22E 3Q5XA 1JNRA 3LDQB 4OFZA 3AA7B 4O4IE 1H7CA 4JEHB 2G0UA 2XQ4A 4I4TE 1UUSA 4DUYT 1IBKT 2M6IA 3I1AA 3AB3B 3VKHA 4UV9B 2WWVA 4QXCB 2V7KA 3DJBA 5HEGA 4DR1T 2L9QA 5A1LA 1IZNB 4CXYA 1QUUA 5LCYA 3ZLIA 2L8KA 4NUUA 2LKGA 4ZOLE 3UULA 4JI7T 4PAGA 3ZT7A 4AQGA 1QLBA 4EYUA 2DL1A 3AVRA 4H63H 3EDVA 3OPCA 2VWAA 5AQKB 3M3ZB 1FJGT 3AXJA 5KMGP 3ZSTA 2QYWA 5HWXA 4ISTA 2YOEA 4KMCA 3FBZA 4GK0E 3Q2MA 4ZS3A 4YTNA 3H3AA 5JRCA 1U4QA 1KNZA 4HKAA 4IE0A 5LG3A 2ODVA 4IDOA 5AQPB 4ISSA 2FBWA 2RA1A 5AQQB 5LB7B 2VVNA 2C5JA 1D1BA 3RKOA 1E1HB 3RYFE 2BKOA 4AQFA 2WMOA 3PJAA 1YQ4A 1X9BA 5LJMA 4JI8T 3AXJB 5J2TE 5ABGA 1S35A 1W0AA 3FZFB 2QGSA 4YXDA 2WZHA 4YJ3E 4NXMT 2WMNA 2UXBT 5L3EB 1V9DA 5AQRB 2J62A 2QA7A 4K0UA 2W63A 3OYZA 3T8OA 2I59A 3PUSA 4IL4A 3N2KE 3KV6A 3V5SA 3D0TA 3ZYKA 1MMAA 4X5TA 3AEEA 3QOFA 4HFVA 3BQIA 4YLHA 4PJJA 3CQGB 3FZKB 4TN7B 3Q5DA 4LFBT 4OYJA 1MNEA 4X65T 1T72A 2D9DA 4ERRA 3GMIA 5C2TA 5IWAT 1XNRT 5LJNA 3FZMB 3VRBA 4DR2T 3ZYMA 2IDOB 3ZEFB 3MKDA 1HNZT 2H7VC 4B3MT 2N9DA 2XY8B 4A5XA 3UU3A 3C64A 3TLVA 3ETVA 5AQSB 4A56A 2XSBA 4NIQA 4FI5A 4P0AA 3CVRA 3R6NA 3G06A 4QXBB 4UVCB 3IF8B 4U2YA 4JI5T 3N9LA 1WFDA 2V26A 4JI2T 1XNQT 2HPJA 3EAMA 3LG7A 4BJMA 5DABA 2WAUA 2A72A 2UXNB 5LGTB 2UUCT 2NTYA 5EK2A 1OXZA 3AA1B 2XQ7A 3ABVA 1HS7A 2YDQA 3UUMA 2D5UA
chains in the Genus database with same CATH topology
5AQSB 5AQMB 5AQVB 4HWFA 5AQRB 5AQUB 4HWDA 4HWHA 1HX1B 3FZMB 1UK5A 5AQHB 3FZKB 5AQTB 3FZLB 3LDQB 5AQLB 3FZFB 5AQIB 5AQKB 1T7SA 4HWIB 5AQPB 4HWCA 3M3ZB 1M7KA 5AQFB 3FZHB 5AQQB 1I6ZA 1UGOA 5AQOB 5AQGB 1M62A 5AQJB 2D9DA 3A8YC 5AQNB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AQS B;  5AQM B;  5AQV B;  4HWF A;  5AQR B;  5AQU B;  4HWD A;  4HWH A;  1HX1 B;  3FZM B;  1UK5 A;  5AQH B;  3FZK B;  5AQT B;  3FZL B;  3LDQ B;  5AQL B;  3FZF B;  5AQI B;  5AQK B;  1T7S A;  4HWI B;  5AQP B;  4HWC A;  3M3Z B;  1M7K A;  5AQF B;  3FZH B;  5AQQ B;  1I6Z A;  1UGO A;  5AQO B;  5AQG B;  1M62 A;  5AQJ B;  2D9D A;  3A8Y C;  5AQN B; 
#chains in the Genus database with same CATH topology
 3UUB A;  3KBT A;  2WDV A;  2K9A A;  4ZI2 C;  1WR6 A;  2A9U A;  2B76 A;  2D0T A;  3JC6 D;  4OK0 A;  1FMW A;  4AIU A;  3HKE E;  3RHW A;  1D1A A;  1HTJ F;  2LJL A;  3U3I A;  4O8S A;  4QH4 A;  3QK6 A;  3ZMU B;  4Z8X A;  3UUX B;  2NW9 A;  2X68 A;  5HEJ A;  4U72 A;  3ONJ A;  3Q5E A;  3PUY F;  3RQU A;  3C51 A;  4TWH A;  4X1Y E;  2CLY C;  1US7 B;  3AE8 A;  2CHO A;  3KVB A;  3LK4 2;  5JVD E;  2IIU A;  1YD8 G;  2UUB T;  3SRZ A;  4JLE A;  2WY2 A;  2UU9 T;  5AQO B;  5E0O A;  2JQK A;  3ZPO A;  1NEN A;  4X64 T;  3J7Y q;  3UU5 A;  3PUR A;  2X51 A;  3RRC A;  3PU3 A;  5LMN T;  1LVF A;  4XAX B;  3RGL A;  3RF1 A;  5F5W A;  5HYA A;  3I9Y A;  2MOZ A;  3N9M A;  4KBM B;  1MMD A;  4MHC A;  2Y6X A;  2OV9 A;  5LG4 A;  2Y8D A;  1M7K A;  2J4G A;  4DMV A;  3NVO A;  4QH5 A;  4H9O C;  3R84 B;  2H88 A;  5EZY E;  2XHE B;  1KF6 A;  3KFW X;  2CXL A;  2XSA A;  4BJN A;  5L3D B;  1FMV A;  4HFI A;  5LA6 E;  1YKH B;  1HFA A;  4EZH A;  3FXE B;  5DQW A;  5FY0 A;  4WBO A;  1FIO A;  4NUV A;  4J2C A;  4CI3 B;  3OKQ A;  1D1C A;  2KXP B;  3LJC A;  2C5K T;  3PTR B;  2UUA T;  3JC6 C;  4LMJ A;  2K3W A;  4ZXL A;  1LVK A;  1YQ3 A;  4YT0 A;  4DR5 T;  3SFE A;  3L09 A;  2V8S V;  3NRX A;  4CN4 A;  2HHH T;  1D0Z A;  5JQG E;  4QKN A;  4LF9 T;  4P0B A;  3AA0 B;  5CGM A;  1IBL T;  5HCJ A;  2C0S A;  4HFC A;  2CA5 A;  2VKD A;  5M4Y A;  2JRK A;  2NWB A;  3N9O A;  3MK7 C;  3RYC E;  3N2G E;  5JDN A;  2LLY A;  4GOU A;  1WYC A;  4PK6 A;  1SE7 A;  5LYJ E;  5FY1 A;  3F2E A;  4CZZ B;  1UX5 A;  2WCA A;  2CLY B;  4EEB A;  4ANJ A;  3LBX A;  2PFV A;  2XTL A;  3HKC E;  4BA9 A;  3ZC0 A;  2BS3 A;  1OED C;  4U74 A;  5AQH B;  4EOZ B;  4UF0 B;  2X0H A;  2V7I A;  2EHO D;  5FXZ A;  2LSJ A;  4B3R T;  2FUP A;  4UEM A;  2XAS B;  3AED A;  5IUX A;  4UEL A;  4P09 A;  3J9X 1;  5L47 A;  4ILC A;  4Q25 A;  1UUR A;  3UUN A;  3S4U A;  4F6R C;  4LF6 T;  4QX8 B;  3LBX B;  1XDO A;  3RRW A;  4JV5 T;  2CXF A;  4IDZ A;  4O2A E;  4QHO A;  3FZH B;  4DR6 T;  4DV0 T;  2V7L A;  5JRE A;  1BR4 A;  3DTO A;  5J2U E;  5JDL A;  3VRA A;  2LRL A;  5JTG A;  2ZM0 A;  3VU7 H;  1CUN A;  3HKB E;  4QXH B;  2A2F X;  3FZL B;  4UIG A;  3EI0 A;  4AKH A;  3P8C D;  5F3J A;  4UV8 B;  2VKH A;  4JI3 T;  4DID B;  4AIS A;  2V1D B;  3M65 A;  4AKR B;  3E0Z A;  3HL6 A;  3JAF A;  3JAE A;  2N1G A;  3UFG A;  2KSR A;  4KP3 C;  3CPZ A;  2XZE A;  3UQ7 A;  1BR0 A;  4I0U A;  2P9B A;  5FXX A;  2WZI A;  3CQX C;  4TWF A;  5HEH A;  2HPL A;  3P4R A;  3HI2 A;  4WZX A;  4AQY T;  4HFE A;  3IBP A;  4B6X A;  2I6H A;  2BG9 C;  5HXS A;  2CWY A;  3Q9D A;  3F31 A;  3AEB A;  3CML A;  5LHG B;  2JQH A;  2XQ5 A;  3MZK B;  3IHR A;  4HWF A;  4LF8 T;  4UVB B;  5LOV E;  1MIV A;  2KWI B;  2LKH A;  2YDS A;  3PDY A;  4XBF B;  2W2U A;  3PUQ A;  3RX6 A;  4CN1 A;  2X67 A;  3P4P A;  1KFY A;  3N9Q A;  1JNZ A;  4ZI3 D;  3IEE A;  3RYH E;  4EB6 E;  4QX7 B;  4ZI2 D;  2H7O A;  3N5L A;  4CXW A;  1SHZ C;  4V1A v;  2XPK A;  4X66 T;  1N36 T;  4WNK A;  2JMK A;  1N34 T;  3L39 A;  2E9X D;  1IJ5 A;  2W00 A;  3CX8 B;  4I55 E;  2BBJ A;  4X1K E;  2EHO C;  3OJA A;  3AAI A;  3O1H A;  4YY3 T;  3P4S A;  3AEF A;  3ZYL A;  5AQM B;  1BR2 A;  4MAL A;  4TV8 E;  1O3X A;  2NW7 A;  4EYY R;  4DV3 T;  2V6Y A;  3HA4 A;  3ZCJ A;  2XQ3 A;  2YDR A;  3ESL A;  5HXR A;  3RIU C;  3ZMV B;  4EGW A;  2IUB A;  2Q9Q C;  2DI4 A;  3AE7 A;  3SWH A;  4IDP A;  3JCF A;  3K3O A;  1KNP A;  4U3C A;  2LM9 A;  1HNW T;  5ABE A;  1XMQ T;  2BDE A;  4IDQ A;  2LSK A;  5LP6 E;  1HF8 A;  3K8P C;  4F8H A;  3BK9 A;  3TLS A;  2VK9 A;  4PFP A;  2VKJ A;  1M62 A;  4TNV A;  2VQE T;  1HCI A;  5IYZ E;  2WDR A;  3HR0 A;  4Z90 A;  2V6Y B;  2LRK A;  4DO0 A;  1XZY A;  5ABH A;  4YSZ A;  3EDU A;  2DCF A;  3TLU A;  1J5E T;  2E5V A;  3I9W A;  5LHI B;  5C8Y E;  2JMH A;  5JR9 C;  2WM9 A;  3C4Z A;  1Y01 A;  2FJE A;  4U31 A;  5ABF A;  5IHY A;  4DV7 T;  3AVS A;  3RLF F;  5AFU L;  3QNU A;  2J1D G;  5HXC A;  3VHL A;  1I6Z A;  3AEC A;  3UQ4 A;  4PFO A;  1MND A;  3EAB A;  2BBH A;  2IAK A;  3OYX A;  2BG9 B;  3NBX X;  4X1I E;  4PJM A;  4EXT A;  1VOM A;  4COF A;  4HFB A;  4AKI A;  2XAF B;  4JBW F;  5HEU A;  2GK9 A;  3DP7 A;  4DBQ A;  4YSY A;  3V5U A;  4ZI3 C;  4ZZC A;  5ABF B;  4PJL A;  2D0U A;  5JDG A;  4IDN A;  2JPF A;  1S94 A;  1MMG A;  4ASK A;  4HE8 A;  3NZQ A;  5AQF B;  2AXD S;  2E9X C;  1GQE A;  3LFM A;  2LSY A;  4JEU B;  3RIU A;  4WBN E;  3KVA A;  2H3R A;  2CWO A;  1YKE B;  3C98 B;  4ZZB A;  4JUY A;  5CB4 E;  3N9P A;  5FVL A;  5H6R B;  2K24 A;  3AEA A;  3GWH A;  2X66 A;  4JI0 T;  3MJX A;  4H9P C;  4HWC A;  2EHO B;  4GK5 E;  2ZM6 T;  5L3F B;  5L2L A;  3UTK A;  4Z91 A;  5AQV B;  3ZSS A;  2XJ7 A;  3PUW F;  2W4X A;  4IE5 A;  5KX5 E;  3L3P A;  1ZEE A;  2YU1 A;  4E7S A;  3P4W A;  5AQL B;  5FYM A;  2Q9Q B;  4MFR A;  2CE7 A;  4LF5 T;  3PV0 F;  1W0B A;  2WU5 A;  2VB6 A;  1HNX T;  2VKO A;  5LGU B;  5J1G A;  1G8X A;  4ZS2 A;  2BZB A;  1SUM B;  3I0O A;  3UU8 A;  3NRY A;  1ZP0 A;  3EVY A;  1UX4 A;  2UXC T;  2KND A;  5FKY A;  3PUZ F;  3B5M A;  4P1N A;  3K3Q C;  1J5W A;  4A98 A;  2X9X A;  2CBJ A;  2IHR 1;  3AE3 A;  3C4W A;  4YHJ A;  2FJA A;  5DQV A;  1YW0 A;  4ILB A;  3ZJ2 A;  3RI5 A;  5AQJ B;  4O4J E;  4FJO A;  2CMR A;  5DJQ C;  5LBM A;  2IW5 B;  3ZCI A;  1L0V A;  4CI2 B;  5L3B B;  2BS2 A;  2V5C A;  2WQY A;  2VL0 A;  2BVL A;  1W09 A;  3CKD A;  1J1J A;  3OBV E;  4KX6 A;  4IE7 A;  2DHR A;  4IRE A;  5ADX L;  3NZP A;  4U33 A;  1LRZ A;  5CFB A;  4WW0 A;  1HG2 A;  2XUE A;  4KI0 F;  3B13 A;  4DR3 T;  2LHN A;  3X1D A;  3ONL C;  2LM2 A;  3EHZ A;  1EZ3 A;  3RPU A;  1VCT A;  2F4V T;  4ZHQ E;  5L4H A;  3QC9 A;  2E9X B;  4B3S T;  2MYS A;  2HN1 A;  3ZMS B;  5FP3 A;  4UF0 A;  5CA1 E;  5GON E;  5FXW A;  1MIW A;  3NWI A;  1KK7 A;  4G2A A;  2V7M A;  2BKP A;  4X20 E;  1G73 A;  5EK4 A;  2E8I A;  4C90 A;  2ZM2 A;  4AI6 A;  5AQG B;  2M67 A;  4IE6 A;  4HEA A;  2E5L T;  4LMK A;  2M6B A;  2XM2 A;  4H9N C;  3Q5W A;  2W66 A;  4LFA T;  3RKG A;  3PUG A;  3BQL A;  4HWI B;  3AE9 A;  2VQF T;  4GIW A;  3TLW A;  2X9H A;  2KIN B;  2OA5 A;  5CJ5 A;  2ACZ A;  1WR0 A;  3JAD A;  4H9R C;  4YSX A;  3AE6 A;  4DV1 T;  2KLQ A;  4KUM B;  3ETU A;  4PW8 A;  2Q9Q D;  5TAO A;  3KBU A;  2W67 A;  2PBI A;  4DND A;  2ZMA A;  4EIW A;  4AQF C;  1IBM T;  4DV5 T;  5H6Q B;  2E2A A;  4YFS A;  4DBR A;  3QB5 A;  1HX8 A;  2X0Y A;  3UFE A;  3RC8 A;  2QRX A;  2X9W A;  4AKG A;  3KDS E;  4AKL A;  2WWU A;  2PG8 A;  2YKS A;  2MPK A;  2C5I T;  4LML A;  2L3L A;  2KZ7 B;  3GN5 B;  5HCM A;  1KEY A;  4OHF A;  5LBQ B;  3NKZ A;  2XQY A;  3CWZ B;  5FVK A;  3ZC1 A;  2KMF A;  4HTE A;  4DV6 T;  1XWM A;  2YIN A;  1E7P A;  1YXR A;  4ADZ A;  2JQQ A;  1FEW A;  5FMN A;  2VAS A;  3B57 A;  3AE4 A;  5HXH A;  4EAH A;  5JDF A;  2DWG A;  2W0G A;  4WYV A;  1WCR A;  1UGO A;  1ZOY A;  1HR0 T;  3UU4 A;  4I50 E;  3U78 A;  1D0Y A;  4PJN A;  5FNV E;  3SS1 A;  3SFD A;  2PJQ A;  4U7I A;  4GKJ T;  1OED A;  1Z0P A;  3AE5 A;  1T7S A;  2CHN A;  3PUA A;  4JI4 T;  4JI6 T;  1N33 T;  3KV5 A;  3CIR A;  3OVU A;  2VUR A;  2ODU A;  3RQW A;  2CBI A;  5LMU T;  4CI1 B;  2BS4 A;  3QUJ A;  3FXD B;  3PUX F;  2RP4 A;  3O4X E;  5CA0 E;  4TV9 E;  3ONX A;  2LE8 A;  2CRB A;  4OYK A;  1N32 T;  1OED B;  2NTX A;  5BMV E;  2V7J A;  2CCQ A;  4TZ4 C;  3RIA A;  3ANW A;  3VR8 A;  3GA8 A;  3P50 A;  4IE4 A;  2LT3 A;  2XAG B;  5F8P A;  1OWA A;  4EV6 A;  3CX6 B;  2HH7 A;  2H89 A;  5JRC B;  3CX7 B;  3SOL A;  3ZT5 A;  2V6X A;  2YN6 A;  4HN9 A;  4LF7 T;  4IT4 A;  5FY7 A;  3TLT A;  4DR7 T;  2WP9 A;  3KV9 A;  3MA9 A;  4TWD A;  5J0Z A;  4H9Q C;  1WLX A;  3MAC A;  3W15 B;  4H9S E;  3WI3 A;  4XZC A;  4HWD A;  4U2Z A;  4HGA A;  3ANW B;  4U7Y A;  5HXE A;  2BG9 A;  4YTM A;  3CQC B;  1VCS A;  5AQT B;  4PK5 A;  4O4L E;  2CEA A;  2UXD T;  2IC6 A;  2LSG A;  5ETW A;  2YEV C;  2K48 A;  1Y64 B;  1DU2 A;  4QWN B;  3KIN B;  4EED A;  1I94 T;  4O4H E;  3P7I A;  4L9I A;  4JI1 T;  1MMN A;  2Y48 B;  5HEO A;  4I43 B;  2WDQ A;  2PTF A;  1T8B A;  1E2A A;  3L8R A;  3H37 A;  3AEG A;  3UU6 A;  4N78 D;  3A7M A;  3IA3 A;  2JIW A;  2YK0 A;  3OTO T;  2WB5 A;  1CHU A;  2IC9 A;  2A3D A;  2LOP A;  4HFH A;  1OED E;  4GYS A;  4IIJ E;  1NWM X;  2R6G F;  3AAA B;  4LFC T;  4DVD A;  2EHO A;  3N9N A;  2XQA A;  2NOX A;  1AJ3 A;  2XAJ B;  2AE9 A;  1D0X A;  2W61 A;  4K0K T;  3FBL A;  1NAF A;  3MXZ A;  3HKD E;  5AQI B;  3RC3 A;  2WU2 A;  4UVA B;  3PUV F;  2X9Y A;  4C91 A;  3AA6 B;  2RPA A;  2Q9Q A;  2D2S A;  2LEH A;  4DV4 T;  2XQ8 A;  4TUY E;  4UR9 A;  1WRD A;  3FHN A;  4HFD A;  4GKK T;  1R8I A;  4EZ4 A;  4IHJ E;  2UXX B;  4YHH T;  4IL9 A;  2NR4 A;  3RIF A;  3E08 A;  3PU8 A;  1IJ6 A;  4CQI A;  4TNW A;  5AQU B;  1NEK A;  1X79 A;  5LNK A;  5L4E A;  4ZI7 E;  2BKN A;  3BQK A;  2CXD A;  2X0L B;  4KHP T;  2JJ9 A;  4ILU A;  5JR9 A;  1B7T A;  4DR4 T;  2KT9 A;  2BG9 E;  4ILA A;  3VR9 A;  2WS3 A;  1IAP A;  2XM1 A;  5C3J A;  2DWK A;  4KHZ F;  2XAH B;  2ZM8 A;  5FL1 A;  2Z6E A;  4O2B E;  5AQN B;  4JYA T;  3F57 A;  1SA0 E;  1KNR A;  3ZT6 A;  2YU2 A;  4LF4 T;  3ZKR A;  4OX9 T;  5L3C B;  3LK2 B;  3UT5 E;  4B3T T;  3AAE B;  5JDH A;  2FJD A;  3H3M A;  5JR9 B;  3O1I A;  1VRB A;  1WYB A;  2LSI A;  2MBG A;  5LXT E;  3T1Y T;  4MBQ A;  1Z8U A;  3VKG A;  4AXP A;  5KDM C;  5LHH B;  3RH3 A;  5HAX A;  2E9X A;  4PK4 A;  4UXN B;  3AE2 A;  1QSD A;  2XAQ B;  4DMW A;  3ZN0 B;  4L5G A;  2BVM A;  4H63 V;  1LKX A;  3AE1 A;  2VVS A;  1W9R A;  2FJB A;  3ZMZ B;  2N2N A;  3O9X A;  2QVA A;  5KXJ A;  4E7Z A;  1MIY A;  2KWH A;  1XMO T;  2J47 A;  4G63 A;  5BR8 T;  3PJA J;  1ZHC A;  2ACX A;  4IGU A;  3I0Q A;  2XQ6 A;  2NP9 A;  2LOS A;  4CXX A;  2ZLY A;  5EK3 A;  1XDP A;  2K5B B;  5JDQ A;  4A97 A;  2CPT A;  2IML A;  3FB2 A;  4BAY B;  3C50 A;  2DLR A;  2SPC A;  3EUH A;  3KV4 A;  1HG5 A;  2WSS V;  4NPP A;  2CM0 A;  2VL8 A;  5LGN B;  2ES0 A;  3ZN1 B;  3RYI E;  2W62 A;  3O1J A;  2V5D A;  5L3G B;  3TKL B;  4DV2 T;  4YTP A;  3WAK A;  3A8Y C;  4ZEY A;  4MLK A;  4PNI A;  3LSV A;  3K1S A;  3K3N A;  5HWY A;  3N2O A;  1ZKE A;  4M1P A;  3ZMT B;  2MAW A;  3QB5 K;  5FL0 A;  2WBL A;  3C4X A;  4YJ2 E;  4TX5 A;  1UCU A;  1U5P A;  2LHR A;  4HWH A;  1T98 A;  3P4Q A;  1UK5 A;  2DNX A;  2JQ9 A;  1ZV4 X;  3GN5 A;  3PE0 A;  4CN6 A;  2I0M A;  4QH1 A;  2MTQ A;  2B1E A;  1BR1 A;  3ZJ1 A;  3T1H T;  3WAJ A;  1HX1 B;  5JDM A;  4GYR A;  3LK3 B;  5JH7 E;  4NXN T;  4X62 T;  3CK6 A;  2NW8 A;  4DUZ T;  2OLT A;  5FXV A;  2HN2 A;  2XQ9 A;  3A5X A;  4L0R A;  3E22 E;  3Q5X A;  1JNR A;  3LDQ B;  4OFZ A;  3AA7 B;  4O4I E;  1H7C A;  4JEH B;  2G0U A;  2XQ4 A;  4I4T E;  1UUS A;  4DUY T;  1IBK T;  2M6I A;  3I1A A;  3AB3 B;  3VKH A;  4UV9 B;  2WWV A;  4QXC B;  2V7K A;  3DJB A;  5HEG A;  4DR1 T;  2L9Q A;  5A1L A;  1IZN B;  4CXY A;  1QUU A;  5LCY A;  3ZLI A;  2L8K A;  4NUU A;  2LKG A;  4ZOL E;  3UUL A;  4JI7 T;  4PAG A;  3ZT7 A;  4AQG A;  1QLB A;  4EYU A;  2DL1 A;  3AVR A;  4H63 H;  3EDV A;  3OPC A;  2VWA A;  5AQK B;  3M3Z B;  1FJG T;  3AXJ A;  5KMG P;  3ZST A;  2QYW A;  5HWX A;  4IST A;  2YOE A;  4KMC A;  3FBZ A;  4GK0 E;  3Q2M A;  4ZS3 A;  4YTN A;  3H3A A;  5JRC A;  1U4Q A;  1KNZ A;  4HKA A;  4IE0 A;  5LG3 A;  2ODV A;  4IDO A;  5AQP B;  4ISS A;  2FBW A;  2RA1 A;  5AQQ B;  5LB7 B;  2VVN A;  2C5J A;  1D1B A;  3RKO A;  1E1H B;  3RYF E;  2BKO A;  4AQF A;  2WMO A;  3PJA A;  1YQ4 A;  1X9B A;  5LJM A;  4JI8 T;  3AXJ B;  5J2T E;  5ABG A;  1S35 A;  1W0A A;  3FZF B;  2QGS A;  4YXD A;  2WZH A;  4YJ3 E;  4NXM T;  2WMN A;  2UXB T;  5L3E B;  1V9D A;  5AQR B;  2J62 A;  2QA7 A;  4K0U A;  2W63 A;  3OYZ A;  3T8O A;  2I59 A;  3PUS A;  4IL4 A;  3N2K E;  3KV6 A;  3V5S A;  3D0T A;  3ZYK A;  1MMA A;  4X5T A;  3AEE A;  3QOF A;  4HFV A;  3BQI A;  4YLH A;  4PJJ A;  3CQG B;  3FZK B;  4TN7 B;  3Q5D A;  4LFB T;  4OYJ A;  1MNE A;  4X65 T;  1T72 A;  2D9D A;  4ERR A;  3GMI A;  5C2T A;  5IWA T;  1XNR T;  5LJN A;  3FZM B;  3VRB A;  4DR2 T;  3ZYM A;  2IDO B;  3ZEF B;  3MKD A;  1HNZ T;  2H7V C;  4B3M T;  2N9D A;  2XY8 B;  4A5X A;  3UU3 A;  3C64 A;  3TLV A;  3ETV A;  5AQS B;  4A56 A;  2XSB A;  4NIQ A;  4FI5 A;  4P0A A;  3CVR A;  3R6N A;  3G06 A;  4QXB B;  4UVC B;  3IF8 B;  4U2Y A;  4JI5 T;  3N9L A;  1WFD A;  2V26 A;  4JI2 T;  1XNQ T;  2HPJ A;  3EAM A;  3LG7 A;  4BJM A;  5DAB A;  2WAU A;  2A72 A;  2UXN B;  5LGT B;  2UUC T;  2NTY A;  5EK2 A;  1OXZ A;  3AA1 B;  2XQ7 A;  3ABV A;  1HS7 A;  2YDQ A;  3UUM A;  2D5U A; 
#chains in the Genus database with same CATH homology
 5AQS B;  5AQM B;  5AQV B;  4HWF A;  5AQR B;  5AQU B;  4HWD A;  4HWH A;  1HX1 B;  3FZM B;  1UK5 A;  5AQH B;  3FZK B;  5AQT B;  3FZL B;  3LDQ B;  5AQL B;  3FZF B;  5AQI B;  5AQK B;  1T7S A;  4HWI B;  5AQP B;  4HWC A;  3M3Z B;  1M7K A;  5AQF B;  3FZH B;  5AQQ B;  1I6Z A;  1UGO A;  5AQO B;  5AQG B;  1M62 A;  5AQJ B;  2D9D A;  3A8Y C;  5AQN B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...