2D9DA

Solution structure of the bag domain (275-350) of bag-family molecular chaperone regulator-5
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
89
structure length
89
Chain Sequence
GSSGSSGSILKIEKVLKRMREIKNELLQAQNPSELYLSSKTELQGLIGQLDEVSLEKNPCIREARRRAVIEVQTLITYIDLKESGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BAG family molecular chaperone regulator 5
publication title The C-terminal BAG domain of BAG5 induces conformational changes of the Hsp70 nucleotide-binding domain for ADP-ATP exchange
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chaperone
total genus 23
structure length 89
sequence length 89
ec nomenclature
pdb deposition date 2005-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02179 BAG BAG domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.120 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 BAG domain 2d9dA00
1HX1B 3M3ZB 5AQKB 5AQFB 5AQPB 3A8YC 5AQLB 1UK5A 2D9DA 5AQVB 5AQUB 4HWDA 5AQQB 3FZKB 5AQHB 4HWFA 3FZMB 1I6ZA 5AQGB 5AQNB 3LDQB 4HWHA 5AQTB 5AQIB 3FZHB 1UGOA 5AQJB 5AQOB 1M62A 1T7SA 5AQMB 3FZFB 4HWCA 1M7KA 5AQRB 5AQSB 3FZLB 4HWIB
chains in the Genus database with same CATH superfamily
5EK3A 4DIDB 3H37A 1WR0A 4YTMA 4BJMA 4HFIA 2I6HA 2ODVA 1YW0A 3N9OA 3PUYF 2CHNA 5F8PA 1YKEB 4HFCA 2LKHA 3MACA 2X51A 1VCSA 2XSBA 2A9UA 5LMNT 3V5UA 4L9IA 5J1GA 3OJAA 3TLSA 2YINA 2JPFA 4IDQA 3ZKRA 3EVYA 3LK42 4JI2T 5EK2A 3QUJA 4ANJA 3J7Yq 3N9PA 5LCYA 3UFEA 4DV5T 2V26A 3PUSA 2BG9C 2XQ4A 5H6RB 3CQCB 1XZYA 3QOFA 4UV8B 3PUZF 3VKGA 1MMGA 2VKOA 3VKHA 5L47A 2BVMA 2L8KA 2VB6A 5AQMB 4QXBB 2DWKA 1HG2A 3GWHA 3CWZB 5HXRA 3P4SA 3A7MA 4K0UA 3CK6A 3FZKB 4JYAT 1FMVA 1QUUA 2V7JA 2WMNA 4M1PA 2GK9A 4YXDA 4I50E 2BG9A 1ZHCA 4UR9A 3K8PC 3ZSTA 2BVLA 3A8YC 5L3DB 3OYXA 4AIUA 2FJDA 3C98B 2WZIA 4AI6A 3K3QC 4JI1T 1E1HB 4U3CA 4IT4A 3CX8B 3RC8A 3KV9A 4GK0E 2JQHA 1MMAA 3LBXB 3ZYKA 3NVOA 1IBMT 3AA1B 4QX7B 2RP4A 3RYFE 3ZYLA 1FIOA 2EHOB 4EYUA 1XDOA 5JVDE 1E2AA 4Z91A 2W00A 5ABFB 3GMIA 1BR4A 2H7OA 4LF7T 3O1HA 4C90A 4LF6T 4COFA 3LK3B 2KNDA 2WBLA 5HCMA 5EZYE 2L9QA 3ONJA 4PK6A 5CFBA 1KFYA 3HI2A 4NIQA 1HX1B 3P4RA 2JMKA 3EDVA 2XUEA 5CA0E 5LOVE 5JDLA 1W0AA 4TV8E 1LVFA 2HHHT 5LBMA 4IREA 1UCUA 2ZM2A 4CXXA 4DNDA 2KWHA 2XASB 2D0TA 2WDRA 5HXEA 2HPJA 4ZI3C 2NW7A 5LXTE 4PK4A 5JR9B 5FXZA 3JAFA 4AQFA 1T98A 4TWFA 2CXFA 4V1Av 2NW9A 1HNXT 2X9YA 4EAHA 3K3OA 2XHEB 2LKGA 4ZI2D 3K3NA 1L0VA 2D9DA 1XNRT 4OX9T 2IUBA 4U72A 4X20E 3P50A 5AQNB 3QNUA 2KINB 5JQGE 4IE0A 2PFVA 2OV9A 2XJ7A 4YY3T 2FBWA 4B3TT 4ADZA 2DCFA 2HPLA 3BQKA 1NENA 4KMCA 5FVLA 3FZHB 1T7SA 1I94T 5JDNA 3MA9A 2C5JA 3LJCA 3X1DA 2CBIA 3F2EA 4YSZA 4X1KE 2B76A 3F57A 4TV9E 5DQVA 2KZ7B 4ILAA 1OXZA 1M7KA 3A5XA 3IBPA 3EDUA 4U2YA 3L39A 3NZPA 2J4GA 4OYKA 4B6XA 3AEAA 2Y6XA 4MFRA 2WZHA 4NUUA 3OPCA 2WQYA 2XM2A 3H3MA 4O4HE 4ILCA 2WDVA 4I4TE 3DP7A 4DO0A 4EIWA 1N34T 5L3FB 2ZM6T 3MK7C 3PUVF 2ZM0A 1KNRA 5CGMA 2WCAA 2N2NA 3ONLC 5JRCA 2W67A 3V5SA 4A56A 1YXRA 2XM1A 2CXLA 3RX6A 5L3BB 4JI5T 5FY1A 5FY0A 3PUGA 2EHOA 1SA0E 3L09A 4TZ4C 3AE2A 5DABA 5LA6E 4KUMB 4DV2T 3WAKA 4KHZF 4I43B 3BQLA 3TLUA 4EEBA 1HNZT 1X9BA 5ABHA 1V9DA 2BS2A 4TUYE 3AAIA 3AE5A 4H9RC 1HTJF 2LJLA 1T72A 2CPTA 3O1IA 5JH7E 2YDRA 2BZBA 2LSKA 3ZN0B 1IZNB 3LDQB 4GIWA 4I0UA 3EAMA 1UURA 4PJLA 5AQRB 3ZT5A 4NXMT 5BMVE 4HFBA 4DV4T 2BG9B 3RPUA 2DI4A 2E9XC 4MLKA 4X64T 2D0UA 2XPKA 3AE4A 3NRXA 3FXEB 3KBTA 2QGSA 4AXPA 4HFDA 3KV6A 3RYHE 4X65T 2BKOA 3ZC1A 1CUNA 3Q5EA 4ZOLE 1VRBA 4DUZT 2YKSA 4UV9B 1T8BA 3AECA 2WY2A 4FJOA 4IDPA 1KK7A 2NTYA 2ES0A 1UGOA 4EV6A 1FMWA 3R84B 2XQ5A 3I1AA 4U7YA 4PK5A 3NWIA 2BBJA 3PU3A 1G73A 4JBWF 2BS4A 2WS3A 2CBJA 2E9XA 2PTFA 2J47A 2K24A 4KBMB 2IC6A 4IIJE 2L3LA 5AQOB 4AKRB 1WFDA 4CI3B 3CX7B 3E0ZA 4QKNA 2UUCT 4JI3T 2NWBA 4GYSA 1Y01A 2Q9QC 4CXWA 2FJAA 2ODUA 1NEKA 2DNXA 1WLXA 5GONE 4WNKA 3N9QA 4TN7B 2IC9A 5TAOA 2HH7A 1Y64B 3QC9A 4QWNB 4O4IE 2V5CA 2K3WA 3FBLA 4ZS3A 5FVKA 1UX5A 3HKCE 2OLTA 2KLQA 3VR9A 4QXCB 4C91A 5HXHA 5CB4E 2YDSA 2WU2A 3B13A 2Q9QA 3OYZA 2FJBA 2JQKA 2E2AA 4ERRA 1XMQT 4L5GA 4UVCB 1I6ZA 3HKBE 4OFZA 3OBVE 5CJ5A 3ZC0A 2PG8A 2W2UA 3RRWA 1HR0T 5LB7B 2CRBA 5L4EA 5J2TE 5BR8T 3RIAA 3CMLA 4E7ZA 4YHHT 4DMVA 1MMDA 3HA4A 1Z8UA 5HAXA 2CHOA 4WZXA 4DR5T 3ZMSB 4LF8T 2X0LB 4O8SA 2LSJA 4NPPA 3ZYMA 1OEDC 3C4ZA 4H9NC 3RI5A 4GK5E 1U4QA 4H63H 4AQYT 2J62A 4EYYR 5LJMA 5JREA 2XAHB 4EEDA 3VRAA 1WYBA 5FP3A 3UTKA 1MIVA 5ABEA 5J2UE 2WWUA 3P4WA 4UVAB 4WW0A 1QLBA 3HKDE 5AQTB 4MBQA 3QK6A 4WBOA 1M62A 3FZFB 2IAKA 2EHOD 3HL6A 4PFOA 4ZXLA 2LOSA 5AFUL 4U7IA 1ZV4X 4DVDA 1OEDA 2I59A 5KX5E 2YU1A 2VWAA 1HG5A 4N78D 3RYIE 2V7IA 3NRYA 2UUBT 3UT5E 2N1GA 3OKQA 3ZT6A 4JI7T 3F31A 3C4WA 4KI0F 3UUXB 5HEHA 2LHNA 3B5MA 3OTOT 4CN6A 5JRCB 2YEVC 5C3JA 5HWYA 3DTOA 4F8HA 2XQ8A 4X66T 2YDQA 4FI5A 2M6BA 3LK2B 2CLYC 3AE9A 3QB5K 3ANWA 3MKDA 4UIGA 4Z8XA 2JRKA 4EB6E 4IL4A 4BJNA 1MIYA 2AXDS 1KNPA 4HGAA 1JNRA 3JC6D 2UU9T 4JEUB 3SFEA 3UU3A 4LFAT 4PJMA 3N2OA 4O4JE 3Q5WA 4B3RT 2C5KT 3PDYA 1W9RA 3ZSSA 3ZMVB 2QA7A 2W61A 1SUMB 2ZLYA 3VRBA 2X66A 2BKNA 2JIWA 2A2FX 4IE5A 4CI2B 2N9DA 3EUHA 4CI1B 5LBQB 2E9XD 2JMHA 2W62A 4H9PC 4ZS2A 2MAWA 2MBGA 3LG7A 2BBHA 2MYSA 3J9X1 2LEHA 2ZMAA 4YSYA 3RKOA 1VOMA 3O4XE 1ZOYA 3GN5A 5FL1A 5KMGP 2XAJB 5HXCA 3FHNA 2XAQB 2WWVA 5J0ZA 4IDZA 3UUMA 3M65A 5M4YA 4DR1T 2VL8A 3KFWX 5L3CB 4DMWA 4JI0T 5LHIB 2WAUA 1FJGT 4IHJE 1IBLT 2BDEA 3C50A 2E9XB 1S94A 3KV5A 2K48A 2LHRA 3ZMTB 2B1EA 1BR2A 3L3PA 1WCRA 3WI3A 3B57A 4H9OC 2V6YA 2YN6A 3L8RA 3GA8A 4O2AE 2K9AA 2D5UA 5ADXL 4CQIA 2UXBT 3RIUC 3T1HT 2DHRA 3Q2MA 2LRLA 1KF6A 2LT3A 2HN1A 4TX5A 5JDGA 2LM9A 1N32T 4DV0T 5LYJE 2JQQA 4DV1T 4PAGA 1ZEEA 2Q9QB 5AQIB 4IE7A 3RYCE 3MJXA 1MMNA 4ISTA 3HKEE 1KEYA 5FY7A 5FKYA 1YKHB 2WDQA 4WBNE 5AQGB 3CQXC 2XQ9A 3S4UA 3PTRB 2MOZA 5LHGB 3O1JA 2IIUA 4PFPA 2IDOB 5FYMA 2VKJA 1HS7A 1NAFA 2X9HA 5LMUT 2VK9A 3JAEA 4WYVA 2VKHA 3NZQA 3CIRA 1LVKA 1YQ3A 5L2LA 3W15B 4IDOA 1SHZC 3FXDB 1B7TA 2C0SA 2XAGB 4KP3C 5EK4A 5A1LA 4DR3T 5C2TA 1XNQT 2WP9A 3ETVA 2NOXA 2CA5A 2CEAA 4X1IE 1US7B 1LRZA 4ILUA 5FXXA 5LHHB 2IMLA 3ZJ1A 5HXSA 4Q25A 2JJ9A 1ZKEA 2V8SV 1OEDB 4CXYA 2W0GA 1MNDA 3PJAJ 4ZEYA 4J2CA 2Y8DA 2KMFA 5JDFA 1VCTA 4YSXA 4GOUA 3CKDA 5AQKB 2H89A 2FUPA 3AEFA 2FJEA 2OA5A 2LE8A 1YQ4A 3ONXA 2G0UA 3K1SA 3I9YA 3KINB 3Q9DA 2V5DA 5JDMA 5L3EB 4LMJA 3AEEA 3AVSA 4HWIB 4NUVA 4U2ZA 3ANWB 4CN4A 2KSRA 4DR2T 4HFVA 4ZI2C 2VL0A 1J5ET 4QHOA 4LMLA 3UUBA 4UF0A 5HEGA 4XBFB 3I0QA 2NR4A 2UXNB 1ZP0A 5JTGA 4AQGA 5LGTB 3LSVA 3E22E 5AQUB 1FEWA 5HYAA 3IEEA 1WRDA 2Z6EA 3AE3A 4UEMA 3AEBA 1H7CA 4YHJA 1UX4A 5JDQA 4BA9A 4HWHA 2RPAA 3FB2A 5IYZE 5KXJA 3WAJA 2CLYB 2I0MA 2M67A 2V7LA 4TNVA 1UK5A 3ABVA 2Y48B 2MPKA 2XSAA 3PV0F 5FNVE 4ZI3D 2E8IA 4GKKT 4U74A 2ACZA 2HN2A 2PBIA 1MIWA 4BAYB 5F3JA 3PUXF 4LF4T 4YJ2E 5AQLB 3GN5B 2V7KA 3N5LA 2UXXB 1GQEA 1WR6A 2WM9A 4L0RA 3O9XA 2BG9E 3MXZA 3Q5XA 3OVUA 3AAAB 2IW5B 1IJ5A 3ZMZB 4AKIA 3PURA 5ETWA 2C5IT 4P1NA 5AQPB 4ZZBA 1LKXA 4OHFA 4LF9T 4IL9A 4HWFA 3MZKB 3I0OA 4IE4A 3QB5A 4LMKA 5AQSB 4MHCA 2NP9A 4IE6A 4B3MT 3JADA 2V6YB 2R6GF 1DU2A 1EZ3A 3AXJA 5CA1E 3UQ4A 4JV5T 3UU8A 3KBUA 4P0AA 5FXWA 4EXTA 2H88A 1XMOT 3AA6B 3VU7H 2LSGA 3FBZA 3P4QA 3RHWA 5AQQB 2VQET 1IBKT 2E5VA 3TLTA 1E7PA 2WMOA 5LGUB 4EZ4A 2XQ7A 2YU2A 3R6NA 5DJQC 4E7SA 4JI6T 4A98A 4TWDA 5IWAT 4JI4T 3ETUA 4DV6T 1WYCA 3RKGA 2E5LT 2LLYA 1D0ZA 3G06A 5E0OA 4AKHA 3ZJ2A 3KVBA 2V1DB 4OK0A 5AQFB 1QSDA 4KX6A 4JEHB 5AQHB 3UU5A 3PU8A 2XQAA 4F6RC 1BR0A 3E08A 2YOEA 5LGNB 4DUYT 4DV7T 3RRCA 3UULA 4TNWA 1NWMX 1W0BA 3EHZA 5HEOA 4AKLA 5LG4A 4G2AA 2J1DG 4JI8T 2KWIB 3SOLA 2XQYA 4X1YE 3TLVA 3PUWF 4H9SE 4KHPT 4YLHA 2KT9A 2PJQA 2XAFB 1N33T 2W63A 2X67A 3SWHA 4AQFC 5AQVB 2W66A 3ZCIA 4AKGA 3ESLA 2XY8B 3C4XA 4PJNA 4DR7T 5HEUA 3AE8A 2VKDA 1HNWT 4LF5T 2V6XA 3RH3A 1HF8A 2DWGA 3RGLA 2XQ6A 1HFAA 3RF1A 4DV3T 2ACXA 2QRXA 3CVRA 4Z90A 2RA1A 4UXNB 4I55E 4OYJA 3RIFA 2X9WA 4EOZB 2CE7A 1W09A 2BKPA 2CMRA 2H3RA 3U3IA 3ZPOA 2WU5A 3PE0A 2UUAT 2X0HA 5LP6E 2X9XA 4O4LE 3NBXX 3AB3B 1IJ6A 1JNZA 4EZHA 2X0YA 4P0BA 4HTEA 2QYWA 4UF0B 2WB5A 1KNZA 2VVNA 5C8YE 4ILBA 2F4VT 3UUNA 3TKLB 3FZMB 3IHRA 4CN1A 5ABGA 2VASA 2Q9QD 2CWYA 3N9LA 2CWOA 3M3ZB 1G8XA 3AE7A 4XZCA 4QX8B 2DLRA 4NXNT 2CM0A 2LSYA 4YT0A 3ZEFB 1J1JA 4X5TA 3AEGA 1AJ3A 3CPZA 4GKJT 4JUYA 3N2GE 2K5BB 4H63V 1X79A 2LRKA 4GYRA 4HE8A 3N2KE 1O3XA 5LG3A 2WSSV 5DQWA 3PUAA 2VQFT 2KXPB 4X62T 4ZI7E 3N9NA 4JLEA 2AE9A 1D1AA 1J5WA 3P7IA 2EHOC 3RIUA 4IGUA 4O2BE 3P8CD 2DL1A 3BK9A 4DBQA 3IF8B 2XTLA 4HFEA 1MNEA 5H6QB 4U31A 3DJBA 2VURA 4HWDA 2V7MA 1D1BA 1N36T 3UU6A 4H9QC 3SRZA 4IDNA 3SFDA 3LBXA 2H7VC 5JDHA 3AXJB 5HCJA 2JQ9A 1Z0PA 2NW8A 4HFHA 3I9WA 4QH1A 3T8OA 1UUSA 2UXDT 4EGWA 2QVAA 2XQ3A 4DR6T 3U78A 4TWHA 3AAEB 3BQIA 3AE1A 3ZLIA 3T1YT 5FL0A 5JR9C 5ABFA 3JC6C 2UXCT 2X68A 3KV4A 4XAXB 4A5XA 2CXDA 3SS1A 4PNIA 4A97A 4UVBB 5F5WA 3CQGB 3ZMUB 3EABA 5FXVA 3ZCJA 3RQUA 4B3ST 3AEDA 4UELA 4QH4A 2YK0A 3AVRA 4HN9A 3UQ7A 2CCQA 1HCIA 4P09A 3KVAA 3ZT7A 3AA7B 4G63A 5LJNA 5JR9A 3VHLA 1IAPA 2BS3A 3H3AA 3UU4A 3FZLB 1SE7A 4U33A 1XDPA 2A72A 2ZM8A 2VVSA 2W4XA 3UFGA 4LFBT 5AQJB 4MALA 4HWCA 5HWXA 4K0KT 2SPCA 3LFMA 3RC3A 3C64A 1CHUA 4DR4T 2A3DA 2M6IA 4YJ3E 3D0TA 2LSIA 5FMNA 4PW8A 4YTNA 4PJJA 4ISSA 4AISA 4HEAA 4QH5A 3C51A 4DBRA 3IA3A 2LM2A 4ASKA 3RQWA 2NTXA 3PJAA 5L3GB 1XWMA 5L4HA 1D0XA 4CZZB 3TLWA 3KDSE 1YD8G 1S35A 1R8IA 4HKAA 5KDMC 3EI0A 3JCFA 4YFSA 1OWAA 3RLFF 1U5PA 1D0YA 3PUQA 3CX6B 4ZHQE 5LNKA 4QXHB 4LFCT 3AE6A 3VR8A 2D2SA 2LOPA 3NKZA 4ZZCA 2P9BA 3ZN1B 3Q5DA 2XZEA 5HEJA 4YTPA 3P4PA 2IHR1 3HR0A 1D1CA 3N9MA 5IHYA 5IUXA 1HX8A 1BR1A 2MTQA 1OEDE 3AA0B
chains in the Genus database with same CATH topology
1HX1B 3M3ZB 5AQKB 5AQFB 5AQPB 3A8YC 5AQLB 1UK5A 2D9DA 5AQVB 5AQUB 4HWDA 5AQQB 3FZKB 5AQHB 4HWFA 3FZMB 1I6ZA 5AQGB 5AQNB 3LDQB 4HWHA 5AQTB 5AQIB 3FZHB 1UGOA 5AQJB 5AQOB 1M62A 1T7SA 5AQMB 3FZFB 4HWCA 1M7KA 5AQRB 5AQSB 3FZLB 4HWIB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HX1 B;  3M3Z B;  5AQK B;  5AQF B;  5AQP B;  3A8Y C;  5AQL B;  1UK5 A;  2D9D A;  5AQV B;  5AQU B;  4HWD A;  5AQQ B;  3FZK B;  5AQH B;  4HWF A;  3FZM B;  1I6Z A;  5AQG B;  5AQN B;  3LDQ B;  4HWH A;  5AQT B;  5AQI B;  3FZH B;  1UGO A;  5AQJ B;  5AQO B;  1M62 A;  1T7S A;  5AQM B;  3FZF B;  4HWC A;  1M7K A;  5AQR B;  5AQS B;  3FZL B;  4HWI B; 
#chains in the Genus database with same CATH topology
 5EK3 A;  4DID B;  3H37 A;  1WR0 A;  4YTM A;  4BJM A;  4HFI A;  2I6H A;  2ODV A;  1YW0 A;  3N9O A;  3PUY F;  2CHN A;  5F8P A;  1YKE B;  4HFC A;  2LKH A;  3MAC A;  2X51 A;  1VCS A;  2XSB A;  2A9U A;  5LMN T;  3V5U A;  4L9I A;  5J1G A;  3OJA A;  3TLS A;  2YIN A;  2JPF A;  4IDQ A;  3ZKR A;  3EVY A;  3LK4 2;  4JI2 T;  5EK2 A;  3QUJ A;  4ANJ A;  3J7Y q;  3N9P A;  5LCY A;  3UFE A;  4DV5 T;  2V26 A;  3PUS A;  2BG9 C;  2XQ4 A;  5H6R B;  3CQC B;  1XZY A;  3QOF A;  4UV8 B;  3PUZ F;  3VKG A;  1MMG A;  2VKO A;  3VKH A;  5L47 A;  2BVM A;  2L8K A;  2VB6 A;  5AQM B;  4QXB B;  2DWK A;  1HG2 A;  3GWH A;  3CWZ B;  5HXR A;  3P4S A;  3A7M A;  4K0U A;  3CK6 A;  3FZK B;  4JYA T;  1FMV A;  1QUU A;  2V7J A;  2WMN A;  4M1P A;  2GK9 A;  4YXD A;  4I50 E;  2BG9 A;  1ZHC A;  4UR9 A;  3K8P C;  3ZST A;  2BVL A;  3A8Y C;  5L3D B;  3OYX A;  4AIU A;  2FJD A;  3C98 B;  2WZI A;  4AI6 A;  3K3Q C;  4JI1 T;  1E1H B;  4U3C A;  4IT4 A;  3CX8 B;  3RC8 A;  3KV9 A;  4GK0 E;  2JQH A;  1MMA A;  3LBX B;  3ZYK A;  3NVO A;  1IBM T;  3AA1 B;  4QX7 B;  2RP4 A;  3RYF E;  3ZYL A;  1FIO A;  2EHO B;  4EYU A;  1XDO A;  5JVD E;  1E2A A;  4Z91 A;  2W00 A;  5ABF B;  3GMI A;  1BR4 A;  2H7O A;  4LF7 T;  3O1H A;  4C90 A;  4LF6 T;  4COF A;  3LK3 B;  2KND A;  2WBL A;  5HCM A;  5EZY E;  2L9Q A;  3ONJ A;  4PK6 A;  5CFB A;  1KFY A;  3HI2 A;  4NIQ A;  1HX1 B;  3P4R A;  2JMK A;  3EDV A;  2XUE A;  5CA0 E;  5LOV E;  5JDL A;  1W0A A;  4TV8 E;  1LVF A;  2HHH T;  5LBM A;  4IRE A;  1UCU A;  2ZM2 A;  4CXX A;  4DND A;  2KWH A;  2XAS B;  2D0T A;  2WDR A;  5HXE A;  2HPJ A;  4ZI3 C;  2NW7 A;  5LXT E;  4PK4 A;  5JR9 B;  5FXZ A;  3JAF A;  4AQF A;  1T98 A;  4TWF A;  2CXF A;  4V1A v;  2NW9 A;  1HNX T;  2X9Y A;  4EAH A;  3K3O A;  2XHE B;  2LKG A;  4ZI2 D;  3K3N A;  1L0V A;  2D9D A;  1XNR T;  4OX9 T;  2IUB A;  4U72 A;  4X20 E;  3P50 A;  5AQN B;  3QNU A;  2KIN B;  5JQG E;  4IE0 A;  2PFV A;  2OV9 A;  2XJ7 A;  4YY3 T;  2FBW A;  4B3T T;  4ADZ A;  2DCF A;  2HPL A;  3BQK A;  1NEN A;  4KMC A;  5FVL A;  3FZH B;  1T7S A;  1I94 T;  5JDN A;  3MA9 A;  2C5J A;  3LJC A;  3X1D A;  2CBI A;  3F2E A;  4YSZ A;  4X1K E;  2B76 A;  3F57 A;  4TV9 E;  5DQV A;  2KZ7 B;  4ILA A;  1OXZ A;  1M7K A;  3A5X A;  3IBP A;  3EDU A;  4U2Y A;  3L39 A;  3NZP A;  2J4G A;  4OYK A;  4B6X A;  3AEA A;  2Y6X A;  4MFR A;  2WZH A;  4NUU A;  3OPC A;  2WQY A;  2XM2 A;  3H3M A;  4O4H E;  4ILC A;  2WDV A;  4I4T E;  3DP7 A;  4DO0 A;  4EIW A;  1N34 T;  5L3F B;  2ZM6 T;  3MK7 C;  3PUV F;  2ZM0 A;  1KNR A;  5CGM A;  2WCA A;  2N2N A;  3ONL C;  5JRC A;  2W67 A;  3V5S A;  4A56 A;  1YXR A;  2XM1 A;  2CXL A;  3RX6 A;  5L3B B;  4JI5 T;  5FY1 A;  5FY0 A;  3PUG A;  2EHO A;  1SA0 E;  3L09 A;  4TZ4 C;  3AE2 A;  5DAB A;  5LA6 E;  4KUM B;  4DV2 T;  3WAK A;  4KHZ F;  4I43 B;  3BQL A;  3TLU A;  4EEB A;  1HNZ T;  1X9B A;  5ABH A;  1V9D A;  2BS2 A;  4TUY E;  3AAI A;  3AE5 A;  4H9R C;  1HTJ F;  2LJL A;  1T72 A;  2CPT A;  3O1I A;  5JH7 E;  2YDR A;  2BZB A;  2LSK A;  3ZN0 B;  1IZN B;  3LDQ B;  4GIW A;  4I0U A;  3EAM A;  1UUR A;  4PJL A;  5AQR B;  3ZT5 A;  4NXM T;  5BMV E;  4HFB A;  4DV4 T;  2BG9 B;  3RPU A;  2DI4 A;  2E9X C;  4MLK A;  4X64 T;  2D0U A;  2XPK A;  3AE4 A;  3NRX A;  3FXE B;  3KBT A;  2QGS A;  4AXP A;  4HFD A;  3KV6 A;  3RYH E;  4X65 T;  2BKO A;  3ZC1 A;  1CUN A;  3Q5E A;  4ZOL E;  1VRB A;  4DUZ T;  2YKS A;  4UV9 B;  1T8B A;  3AEC A;  2WY2 A;  4FJO A;  4IDP A;  1KK7 A;  2NTY A;  2ES0 A;  1UGO A;  4EV6 A;  1FMW A;  3R84 B;  2XQ5 A;  3I1A A;  4U7Y A;  4PK5 A;  3NWI A;  2BBJ A;  3PU3 A;  1G73 A;  4JBW F;  2BS4 A;  2WS3 A;  2CBJ A;  2E9X A;  2PTF A;  2J47 A;  2K24 A;  4KBM B;  2IC6 A;  4IIJ E;  2L3L A;  5AQO B;  4AKR B;  1WFD A;  4CI3 B;  3CX7 B;  3E0Z A;  4QKN A;  2UUC T;  4JI3 T;  2NWB A;  4GYS A;  1Y01 A;  2Q9Q C;  4CXW A;  2FJA A;  2ODU A;  1NEK A;  2DNX A;  1WLX A;  5GON E;  4WNK A;  3N9Q A;  4TN7 B;  2IC9 A;  5TAO A;  2HH7 A;  1Y64 B;  3QC9 A;  4QWN B;  4O4I E;  2V5C A;  2K3W A;  3FBL A;  4ZS3 A;  5FVK A;  1UX5 A;  3HKC E;  2OLT A;  2KLQ A;  3VR9 A;  4QXC B;  4C91 A;  5HXH A;  5CB4 E;  2YDS A;  2WU2 A;  3B13 A;  2Q9Q A;  3OYZ A;  2FJB A;  2JQK A;  2E2A A;  4ERR A;  1XMQ T;  4L5G A;  4UVC B;  1I6Z A;  3HKB E;  4OFZ A;  3OBV E;  5CJ5 A;  3ZC0 A;  2PG8 A;  2W2U A;  3RRW A;  1HR0 T;  5LB7 B;  2CRB A;  5L4E A;  5J2T E;  5BR8 T;  3RIA A;  3CML A;  4E7Z A;  4YHH T;  4DMV A;  1MMD A;  3HA4 A;  1Z8U A;  5HAX A;  2CHO A;  4WZX A;  4DR5 T;  3ZMS B;  4LF8 T;  2X0L B;  4O8S A;  2LSJ A;  4NPP A;  3ZYM A;  1OED C;  3C4Z A;  4H9N C;  3RI5 A;  4GK5 E;  1U4Q A;  4H63 H;  4AQY T;  2J62 A;  4EYY R;  5LJM A;  5JRE A;  2XAH B;  4EED A;  3VRA A;  1WYB A;  5FP3 A;  3UTK A;  1MIV A;  5ABE A;  5J2U E;  2WWU A;  3P4W A;  4UVA B;  4WW0 A;  1QLB A;  3HKD E;  5AQT B;  4MBQ A;  3QK6 A;  4WBO A;  1M62 A;  3FZF B;  2IAK A;  2EHO D;  3HL6 A;  4PFO A;  4ZXL A;  2LOS A;  5AFU L;  4U7I A;  1ZV4 X;  4DVD A;  1OED A;  2I59 A;  5KX5 E;  2YU1 A;  2VWA A;  1HG5 A;  4N78 D;  3RYI E;  2V7I A;  3NRY A;  2UUB T;  3UT5 E;  2N1G A;  3OKQ A;  3ZT6 A;  4JI7 T;  3F31 A;  3C4W A;  4KI0 F;  3UUX B;  5HEH A;  2LHN A;  3B5M A;  3OTO T;  4CN6 A;  5JRC B;  2YEV C;  5C3J A;  5HWY A;  3DTO A;  4F8H A;  2XQ8 A;  4X66 T;  2YDQ A;  4FI5 A;  2M6B A;  3LK2 B;  2CLY C;  3AE9 A;  3QB5 K;  3ANW A;  3MKD A;  4UIG A;  4Z8X A;  2JRK A;  4EB6 E;  4IL4 A;  4BJN A;  1MIY A;  2AXD S;  1KNP A;  4HGA A;  1JNR A;  3JC6 D;  2UU9 T;  4JEU B;  3SFE A;  3UU3 A;  4LFA T;  4PJM A;  3N2O A;  4O4J E;  3Q5W A;  4B3R T;  2C5K T;  3PDY A;  1W9R A;  3ZSS A;  3ZMV B;  2QA7 A;  2W61 A;  1SUM B;  2ZLY A;  3VRB A;  2X66 A;  2BKN A;  2JIW A;  2A2F X;  4IE5 A;  4CI2 B;  2N9D A;  3EUH A;  4CI1 B;  5LBQ B;  2E9X D;  2JMH A;  2W62 A;  4H9P C;  4ZS2 A;  2MAW A;  2MBG A;  3LG7 A;  2BBH A;  2MYS A;  3J9X 1;  2LEH A;  2ZMA A;  4YSY A;  3RKO A;  1VOM A;  3O4X E;  1ZOY A;  3GN5 A;  5FL1 A;  5KMG P;  2XAJ B;  5HXC A;  3FHN A;  2XAQ B;  2WWV A;  5J0Z A;  4IDZ A;  3UUM A;  3M65 A;  5M4Y A;  4DR1 T;  2VL8 A;  3KFW X;  5L3C B;  4DMW A;  4JI0 T;  5LHI B;  2WAU A;  1FJG T;  4IHJ E;  1IBL T;  2BDE A;  3C50 A;  2E9X B;  1S94 A;  3KV5 A;  2K48 A;  2LHR A;  3ZMT B;  2B1E A;  1BR2 A;  3L3P A;  1WCR A;  3WI3 A;  3B57 A;  4H9O C;  2V6Y A;  2YN6 A;  3L8R A;  3GA8 A;  4O2A E;  2K9A A;  2D5U A;  5ADX L;  4CQI A;  2UXB T;  3RIU C;  3T1H T;  2DHR A;  3Q2M A;  2LRL A;  1KF6 A;  2LT3 A;  2HN1 A;  4TX5 A;  5JDG A;  2LM9 A;  1N32 T;  4DV0 T;  5LYJ E;  2JQQ A;  4DV1 T;  4PAG A;  1ZEE A;  2Q9Q B;  5AQI B;  4IE7 A;  3RYC E;  3MJX A;  1MMN A;  4IST A;  3HKE E;  1KEY A;  5FY7 A;  5FKY A;  1YKH B;  2WDQ A;  4WBN E;  5AQG B;  3CQX C;  2XQ9 A;  3S4U A;  3PTR B;  2MOZ A;  5LHG B;  3O1J A;  2IIU A;  4PFP A;  2IDO B;  5FYM A;  2VKJ A;  1HS7 A;  1NAF A;  2X9H A;  5LMU T;  2VK9 A;  3JAE A;  4WYV A;  2VKH A;  3NZQ A;  3CIR A;  1LVK A;  1YQ3 A;  5L2L A;  3W15 B;  4IDO A;  1SHZ C;  3FXD B;  1B7T A;  2C0S A;  2XAG B;  4KP3 C;  5EK4 A;  5A1L A;  4DR3 T;  5C2T A;  1XNQ T;  2WP9 A;  3ETV A;  2NOX A;  2CA5 A;  2CEA A;  4X1I E;  1US7 B;  1LRZ A;  4ILU A;  5FXX A;  5LHH B;  2IML A;  3ZJ1 A;  5HXS A;  4Q25 A;  2JJ9 A;  1ZKE A;  2V8S V;  1OED B;  4CXY A;  2W0G A;  1MND A;  3PJA J;  4ZEY A;  4J2C A;  2Y8D A;  2KMF A;  5JDF A;  1VCT A;  4YSX A;  4GOU A;  3CKD A;  5AQK B;  2H89 A;  2FUP A;  3AEF A;  2FJE A;  2OA5 A;  2LE8 A;  1YQ4 A;  3ONX A;  2G0U A;  3K1S A;  3I9Y A;  3KIN B;  3Q9D A;  2V5D A;  5JDM A;  5L3E B;  4LMJ A;  3AEE A;  3AVS A;  4HWI B;  4NUV A;  4U2Z A;  3ANW B;  4CN4 A;  2KSR A;  4DR2 T;  4HFV A;  4ZI2 C;  2VL0 A;  1J5E T;  4QHO A;  4LML A;  3UUB A;  4UF0 A;  5HEG A;  4XBF B;  3I0Q A;  2NR4 A;  2UXN B;  1ZP0 A;  5JTG A;  4AQG A;  5LGT B;  3LSV A;  3E22 E;  5AQU B;  1FEW A;  5HYA A;  3IEE A;  1WRD A;  2Z6E A;  3AE3 A;  4UEM A;  3AEB A;  1H7C A;  4YHJ A;  1UX4 A;  5JDQ A;  4BA9 A;  4HWH A;  2RPA A;  3FB2 A;  5IYZ E;  5KXJ A;  3WAJ A;  2CLY B;  2I0M A;  2M67 A;  2V7L A;  4TNV A;  1UK5 A;  3ABV A;  2Y48 B;  2MPK A;  2XSA A;  3PV0 F;  5FNV E;  4ZI3 D;  2E8I A;  4GKK T;  4U74 A;  2ACZ A;  2HN2 A;  2PBI A;  1MIW A;  4BAY B;  5F3J A;  3PUX F;  4LF4 T;  4YJ2 E;  5AQL B;  3GN5 B;  2V7K A;  3N5L A;  2UXX B;  1GQE A;  1WR6 A;  2WM9 A;  4L0R A;  3O9X A;  2BG9 E;  3MXZ A;  3Q5X A;  3OVU A;  3AAA B;  2IW5 B;  1IJ5 A;  3ZMZ B;  4AKI A;  3PUR A;  5ETW A;  2C5I T;  4P1N A;  5AQP B;  4ZZB A;  1LKX A;  4OHF A;  4LF9 T;  4IL9 A;  4HWF A;  3MZK B;  3I0O A;  4IE4 A;  3QB5 A;  4LMK A;  5AQS B;  4MHC A;  2NP9 A;  4IE6 A;  4B3M T;  3JAD A;  2V6Y B;  2R6G F;  1DU2 A;  1EZ3 A;  3AXJ A;  5CA1 E;  3UQ4 A;  4JV5 T;  3UU8 A;  3KBU A;  4P0A A;  5FXW A;  4EXT A;  2H88 A;  1XMO T;  3AA6 B;  3VU7 H;  2LSG A;  3FBZ A;  3P4Q A;  3RHW A;  5AQQ B;  2VQE T;  1IBK T;  2E5V A;  3TLT A;  1E7P A;  2WMO A;  5LGU B;  4EZ4 A;  2XQ7 A;  2YU2 A;  3R6N A;  5DJQ C;  4E7S A;  4JI6 T;  4A98 A;  4TWD A;  5IWA T;  4JI4 T;  3ETU A;  4DV6 T;  1WYC A;  3RKG A;  2E5L T;  2LLY A;  1D0Z A;  3G06 A;  5E0O A;  4AKH A;  3ZJ2 A;  3KVB A;  2V1D B;  4OK0 A;  5AQF B;  1QSD A;  4KX6 A;  4JEH B;  5AQH B;  3UU5 A;  3PU8 A;  2XQA A;  4F6R C;  1BR0 A;  3E08 A;  2YOE A;  5LGN B;  4DUY T;  4DV7 T;  3RRC A;  3UUL A;  4TNW A;  1NWM X;  1W0B A;  3EHZ A;  5HEO A;  4AKL A;  5LG4 A;  4G2A A;  2J1D G;  4JI8 T;  2KWI B;  3SOL A;  2XQY A;  4X1Y E;  3TLV A;  3PUW F;  4H9S E;  4KHP T;  4YLH A;  2KT9 A;  2PJQ A;  2XAF B;  1N33 T;  2W63 A;  2X67 A;  3SWH A;  4AQF C;  5AQV B;  2W66 A;  3ZCI A;  4AKG A;  3ESL A;  2XY8 B;  3C4X A;  4PJN A;  4DR7 T;  5HEU A;  3AE8 A;  2VKD A;  1HNW T;  4LF5 T;  2V6X A;  3RH3 A;  1HF8 A;  2DWG A;  3RGL A;  2XQ6 A;  1HFA A;  3RF1 A;  4DV3 T;  2ACX A;  2QRX A;  3CVR A;  4Z90 A;  2RA1 A;  4UXN B;  4I55 E;  4OYJ A;  3RIF A;  2X9W A;  4EOZ B;  2CE7 A;  1W09 A;  2BKP A;  2CMR A;  2H3R A;  3U3I A;  3ZPO A;  2WU5 A;  3PE0 A;  2UUA T;  2X0H A;  5LP6 E;  2X9X A;  4O4L E;  3NBX X;  3AB3 B;  1IJ6 A;  1JNZ A;  4EZH A;  2X0Y A;  4P0B A;  4HTE A;  2QYW A;  4UF0 B;  2WB5 A;  1KNZ A;  2VVN A;  5C8Y E;  4ILB A;  2F4V T;  3UUN A;  3TKL B;  3FZM B;  3IHR A;  4CN1 A;  5ABG A;  2VAS A;  2Q9Q D;  2CWY A;  3N9L A;  2CWO A;  3M3Z B;  1G8X A;  3AE7 A;  4XZC A;  4QX8 B;  2DLR A;  4NXN T;  2CM0 A;  2LSY A;  4YT0 A;  3ZEF B;  1J1J A;  4X5T A;  3AEG A;  1AJ3 A;  3CPZ A;  4GKJ T;  4JUY A;  3N2G E;  2K5B B;  4H63 V;  1X79 A;  2LRK A;  4GYR A;  4HE8 A;  3N2K E;  1O3X A;  5LG3 A;  2WSS V;  5DQW A;  3PUA A;  2VQF T;  2KXP B;  4X62 T;  4ZI7 E;  3N9N A;  4JLE A;  2AE9 A;  1D1A A;  1J5W A;  3P7I A;  2EHO C;  3RIU A;  4IGU A;  4O2B E;  3P8C D;  2DL1 A;  3BK9 A;  4DBQ A;  3IF8 B;  2XTL A;  4HFE A;  1MNE A;  5H6Q B;  4U31 A;  3DJB A;  2VUR A;  4HWD A;  2V7M A;  1D1B A;  1N36 T;  3UU6 A;  4H9Q C;  3SRZ A;  4IDN A;  3SFD A;  3LBX A;  2H7V C;  5JDH A;  3AXJ B;  5HCJ A;  2JQ9 A;  1Z0P A;  2NW8 A;  4HFH A;  3I9W A;  4QH1 A;  3T8O A;  1UUS A;  2UXD T;  4EGW A;  2QVA A;  2XQ3 A;  4DR6 T;  3U78 A;  4TWH A;  3AAE B;  3BQI A;  3AE1 A;  3ZLI A;  3T1Y T;  5FL0 A;  5JR9 C;  5ABF A;  3JC6 C;  2UXC T;  2X68 A;  3KV4 A;  4XAX B;  4A5X A;  2CXD A;  3SS1 A;  4PNI A;  4A97 A;  4UVB B;  5F5W A;  3CQG B;  3ZMU B;  3EAB A;  5FXV A;  3ZCJ A;  3RQU A;  4B3S T;  3AED A;  4UEL A;  4QH4 A;  2YK0 A;  3AVR A;  4HN9 A;  3UQ7 A;  2CCQ A;  1HCI A;  4P09 A;  3KVA A;  3ZT7 A;  3AA7 B;  4G63 A;  5LJN A;  5JR9 A;  3VHL A;  1IAP A;  2BS3 A;  3H3A A;  3UU4 A;  3FZL B;  1SE7 A;  4U33 A;  1XDP A;  2A72 A;  2ZM8 A;  2VVS A;  2W4X A;  3UFG A;  4LFB T;  5AQJ B;  4MAL A;  4HWC A;  5HWX A;  4K0K T;  2SPC A;  3LFM A;  3RC3 A;  3C64 A;  1CHU A;  4DR4 T;  2A3D A;  2M6I A;  4YJ3 E;  3D0T A;  2LSI A;  5FMN A;  4PW8 A;  4YTN A;  4PJJ A;  4ISS A;  4AIS A;  4HEA A;  4QH5 A;  3C51 A;  4DBR A;  3IA3 A;  2LM2 A;  4ASK A;  3RQW A;  2NTX A;  3PJA A;  5L3G B;  1XWM A;  5L4H A;  1D0X A;  4CZZ B;  3TLW A;  3KDS E;  1YD8 G;  1S35 A;  1R8I A;  4HKA A;  5KDM C;  3EI0 A;  3JCF A;  4YFS A;  1OWA A;  3RLF F;  1U5P A;  1D0Y A;  3PUQ A;  3CX6 B;  4ZHQ E;  5LNK A;  4QXH B;  4LFC T;  3AE6 A;  3VR8 A;  2D2S A;  2LOP A;  3NKZ A;  4ZZC A;  2P9B A;  3ZN1 B;  3Q5D A;  2XZE A;  5HEJ A;  4YTP A;  3P4P A;  2IHR 1;  3HR0 A;  1D1C A;  3N9M A;  5IHY A;  5IUX A;  1HX8 A;  1BR1 A;  2MTQ A;  1OED E;  3AA0 B; 
#chains in the Genus database with same CATH homology
 1HX1 B;  3M3Z B;  5AQK B;  5AQF B;  5AQP B;  3A8Y C;  5AQL B;  1UK5 A;  2D9D A;  5AQV B;  5AQU B;  4HWD A;  5AQQ B;  3FZK B;  5AQH B;  4HWF A;  3FZM B;  1I6Z A;  5AQG B;  5AQN B;  3LDQ B;  4HWH A;  5AQT B;  5AQI B;  3FZH B;  1UGO A;  5AQJ B;  5AQO B;  1M62 A;  1T7S A;  5AQM B;  3FZF B;  4HWC A;  1M7K A;  5AQR B;  5AQS B;  3FZL B;  4HWI B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...