3C64A

The mc179 portion of the cysteine-rich interdomain region (cidr) of a plasmodium falciparum erythrocyte membrane protein-1 (pfemp1)
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
166
structure length
152
Chain Sequence
DKIMSYNAFFWMWVHDMLIDSIKWRDEHGCNKKCICFQKWVEQKKTEWGKIKDHFRKQKDIPKDWTHDDFLQTLLMKDLLLEIIQDTYGDANEIKRIEALLEQAGVGGIDFAALAGLYTKGFVAEKDTTIDKLLQHEQKEADKCLKTHTDDT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Cysteine-Rich Interdomain Region from the Highly Variable Plasmodium falciparum Erythrocyte Membrane Protein-1 Exhibits a Conserved Structure.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Cd36-binding protein,cell adhesion
molecule keywords PfEMP1 variant 2 of strain MC
total genus 58
structure length 152
sequence length 166
ec nomenclature
pdb deposition date 2008-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03011 PFEMP PFEMP DBL domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.830 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3c64A00
3BQLA 4NUUA 3BQIA 2YK0A 5F3JA 3C64A 4YFSA 3RRCA 3BQKA 2WAUA 4NUVA 3CMLA 3CPZA 2Y8DA
chains in the Genus database with same CATH superfamily
5HEOA 4DR1T 2H7VC 3GMIA 2CM0A 3J9X1 4JI7T 2ZM8A 3N9QA 4DNDA 4JI8T 2Q9QA 1WYBA 5ABGA 2BS3A 4HEAA 1VCSA 3SWHA 4DR2T 4ZI2C 4GOUA 4O2AE 3CPZA 3TKLB 2MPKA 5FL1A 5AQQB 3AEGA 4X66T 4AI6A 4Q25A 4AQGA 3LG7A 2MOZA 4DR6T 5F8PA 1J1JA 1HNXT 4JV5T 2XASB 5FMNA 2PG8A 5C2TA 5ADXL 3IF8B 5FXWA 4KX6A 5LGTB 2D9DA 3JAEA 4ISTA 3Q2MA 4I4TE 1UX5A 2BKPA 3K3OA 2V7KA 1G73A 1BR4A 4QXHB 3RRCA 4E7ZA 4TNWA 1J5ET 2FBWA 3CX8B 3E0ZA 4LFAT 1EZ3A 1FIOA 3MXZA 4H9SE 3RYCE 3P7IA 3EVYA 3AE4A 4IDPA 4JI1T 5L2LA 2WM9A 4ILUA 1WR6A 2J47A 4O4JE 2MAWA 5FKYA 3C51A 2MBGA 4X5TA 1IJ5A 4ASKA 1E1HB 5AQJB 4I43B 4QWNB 5AQMB 1HNWT 3ZMTB 4U7YA 5FXZA 3ZMVB 5LMNT 2V5CA 4TUYE 3AE7A 3RYFE 4MBQA 1M7KA 2EHOC 2LE8A 3EDVA 3PJAJ 4UV8B 4XAXB 1WFDA 3W15B 4IGUA 5E0OA 4ZS2A 2ZLYA 3ZN1B 1JNZA 1MMGA 1YW0A 3PUXF 1OXZA 5ETWA 3TLVA 1IBKT 1HFAA 3AE8A 2HPLA 3P4QA 3U78A 3MK7C 5KX5E 2DHRA 5L3CB 1IZNB 2ES0A 2XAHB 3UTKA 3VRBA 2CXFA 2P9BA 2WB5A 2LHRA 3ONJA 3RIAA 1CUNA 1N33T 2X0HA 4AIUA 1US7B 2VKDA 4JI2T 4DVDA 1UK5A 2VB6A 2CE7A 2CRBA 2QGSA 3ZJ2A 4EZHA 4YJ2E 4CXYA 1YXRA 3PUYF 4A98A 3C4ZA 4JYAT 4LFCT 2BBJA 2W67A 5JH7E 2D0UA 3AXJA 4YSXA 4IL4A 1D1CA 3ABVA 2KLQA 2KZ7B 2NW8A 1VOMA 4UV9B 5LMUT 1R8IA 3B57A 2WQYA 4CN1A 2J1DG 2JQQA 4COFA 3EABA 1AJ3A 4NIQA 4YLHA 3P4RA 2XM2A 3FBLA 3GN5A 4HWHA 2WCAA 4YXDA 3HKDE 3B13A 3FB2A 1UCUA 3I0QA 4DR7T 4KMCA 1OWAA 4HKAA 3AE3A 4OK0A 3EI0A 3RGLA 1SHZC 2R6GF 4H63H 4Z90A 3ZEFB 5JDFA 3ZYKA 2YU1A 4ZZCA 2X67A 5ABEA 4MLKA 2HN2A 1B7TA 1X79A 2ODUA 3QB5K 3A5XA 3UULA 5LHGB 4XBFB 2PJQA 3ZN0B 3E08A 1YQ3A 4PJMA 5JDLA 1XDOA 5AQIB 2DWGA 3HL6A 2CXDA 4CXWA 2DL1A 4U2YA 2VURA 2B76A 2YINA 3KVBA 3PU3A 4IE7A 2V6YB 3AVRA 4UVAB 4UF0B 5L4EA 4QH1A 4WBOA 5H6QB 3V5UA 2JQHA 3T1HT 4OHFA 5L3BB 1ZKEA 4TNVA 2LSIA 2XSAA 5FXXA 2FJEA 3FZFB 3IEEA 4IE6A 3N9NA 4L9IA 5IHYA 5IUXA 3H3MA 2C5KT 1ZV4X 3K8PC 3KV4A 4GK0E 4TV8E 3ZCJA 2X68A 4LF4T 2Z6EA 3C4XA 3OBVE 3AECA 2JJ9A 5JQGE 4E7SA 2XHEB 5FY7A 3E22E 2FJDA 4AQYT 1SE7A 2CMRA 3HKBE 2RA1A 4X1YE 3OVUA 2PFVA 2CCQA 2X9WA 3PV0F 4JBWF 5FVLA 1UGOA 2V1DB 1Y01A 5J2UE 2IIUA 3LBXB 5LCYA 2KINB 2KT9A 3O1HA 5HAXA 4X65T 3M3ZB 4HFEA 3CQCB 3RRWA 1GQEA 1V9DA 2LOPA 3N9PA 4CI3B 2LEHA 1XWMA 4JUYA 2NWBA 1YD8G 4G63A 4PJNA 4EYUA 2W4XA 5J2TE 3RC8A 2VKOA 2H7OA 2Q9QB 3AAIA 3P4SA 4U31A 5C3JA 1W9RA 3RF1A 2WZHA 2LM9A 3JC6C 2VL0A 1ZP0A 1QLBA 2GK9A 3IA3A 3UU3A 2ZMAA 2LKHA 2LRKA 1OEDC 1BR2A 3GN5B 4EXTA 2E9XB 3I0OA 3F57A 4QHOA 2LKGA 5AQSB 1S94A 1XDPA 3S4UA 3RIUA 4DMVA 5CA1E 4B3ST 3CX6B 2BBHA 3MZKB 4TWFA 3NVOA 3RYIE 2MTQA 1MMDA 2CBIA 2JQKA 4UF0A 2XQ4A 3KV6A 3ZJ1A 4HGAA 2W62A 5HXCA 2XJ7A 5CGMA 3PUGA 5LXTE 4GKKT 1IBLT 1HX8A 5FY1A 1I94T 2XQ7A 3Q9DA 1SUMB 5LNKA 2KWIB 1KFYA 4UVBB 2AE9A 5J0ZA 4YY3T 1T8BA 2D5UA 3A8YC 5FP3A 2VQET 3VKGA 1JNRA 4DV5T 4IIJE 4QX8B 2I59A 3LSVA 5HEGA 4HWDA 5AQLB 3CVRA 2XAFB 4B6XA 4DR4T 2KWHA 2LLYA 4Z8XA 1S35A 2I6HA 5AQFB 5LOVE 4DV2T 3F2EA 3HI2A 1CHUA 2EHOA 4OFZA 4KHPT 3UUMA 4X62T 3T1YT 2XTLA 2W0GA 4ILCA 5JTGA 1BR1A 3CK6A 1U4QA 2M67A 5FXVA 2YDQA 3O4XE 2ACZA 2N9DA 4FI5A 5AQOB 2HH7A 4GYRA 2QA7A 4DR5T 4NXMT 3BQKA 2WSSV 4ZXLA 1FJGT 4AKHA 4HWIB 5AQKB 2C0SA 3AA6B 2LT3A 3OTOT 3Q5EA 3UU5A 2WMNA 5DABA 5LGUB 4JI3T 3DTOA 1MNEA 5HEHA 2E9XC 3AA0B 3KV9A 2Q9QC 1OEDB 4HFVA 4LMJA 4EAHA 2BG9C 3RKGA 2X0LB 3VU7H 3SS1A 4LF6T 4P0AA 2UUBT 1NEKA 1ZEEA 3TLWA 4PFPA 2XQ8A 2UXNB 2XZEA 3BQIA 3MKDA 4NUUA 3RIFA 3AE9A 4ZI2D 2YEVC 2YOEA 4TWDA 2X9XA 5L3FB 3ZMUB 5L3GB 5JR9A 1HX1B 3RI5A 4ZI7E 3O9XA 3A7MA 2IDOB 1SA0E 2XQ3A 1D0XA 4WW0A 3MACA 4TWHA 2X66A 4DMWA 3TLSA 4O4IE 4P09A 2NTYA 3ZT7A 4IL9A 2WZIA 3SRZA 1NAFA 2ACXA 1MIVA 4EYYR 2UXDT 3AE2A 1IJ6A 2WU5A 4O2BE 2IAKA 2XM1A 2ODVA 5AQTB 4NPPA 2OV9A 4ZOLE 3AEEA 5EZYE 4YHJA 4HTEA 3UFGA 2YDRA 2BS2A 2CPTA 1MNDA 5F3JA 2W61A 1D1AA 2G0UA 2JPFA 1KF6A 4O4LE 4V1Av 4AKGA 4GKJT 5AQPB 1D0ZA 1HF8A 5AQRB 4BA9A 5IYZE 5JDHA 4DBQA 4XZCA 4DR3T 3PUAA 2SPCA 2VKHA 3SOLA 5A1LA 3ZCIA 5AQUB 2W00A 3RH3A 2D0TA 4UEMA 4ADZA 3FZMB 3KVAA 4IREA 3J7Yq 4DV4T 4IE0A 4ZEYA 4DBRA 2C5JA 2XSBA 3EDUA 3EHZA 5C8YE 5LHIB 4J2CA 4DUYT 2E5LT 2CWYA 1MIWA 4K0UA 2NW9A 4B3MT 2LSGA 3RPUA 2V7MA 3L39A 2KXPB 4HFBA 2HHHT 2JMHA 4YFSA 5L3DB 2JRKA 2L8KA 3AAEB 5HEUA 3RHWA 2Q9QD 2HN1A 3FXDB 4B3TT 3O1JA 2B1EA 1T98A 2WMOA 3G06A 3HA4A 3FXEB 4PK4A 1L0VA 4AQFC 2E9XD 3LFMA 3ZSSA 1NWMX 2FUPA 1HR0T 3NRYA 1VCTA 3AB3B 4GYSA 3UUBA 1HCIA 5JDMA 2E2AA 5J1GA 2WWVA 5LJMA 5ABFA 5AQVB 4DO0A 2WAUA 3M65A 3UU6A 1E2AA 2D2SA 3LK2B 2IUBA 2YU2A 3LK3B 3PUQA 4ANJA 2XAQB 4ILAA 4QXCB 5JDQA 1HG2A 1KNZA 2LSYA 5HXEA 1ZOYA 1E7PA 3AA1B 2IC6A 2XAJB 4H9QC 3K3QC 4HFIA 4WZXA 3UUXB 4ZZBA 2JMKA 2WWUA 4PK5A 4WNKA 5HCJA 2NR4A 1WR0A 2OA5A 3KBTA 3JC6D 3N9MA 4UELA 5JVDE 2V5DA 4IE5A 1IBMT 4OYKA 4PW8A 5JREA 2BS4A 4M1PA 2V6YA 3AE5A 4BJNA 4LF7T 3D0TA 3QK6A 5HYAA 3VKHA 3V5SA 3PUWF 3ETUA 2LOSA 4UVCB 3WI3A 2UUAT 1D1BA 5LJNA 3UQ7A 3K3NA 2LRLA 2ZM0A 3PTRB 4IE4A 4CN4A 4QKNA 1WCRA 2LSJA 4U7IA 4H63V 4AKLA 1HG5A 4H9OC 4HE8A 3NZPA 5TAOA 5CJ5A 4DV0T 4U2ZA 4TX5A 3N2OA 1H7CA 4KI0F 2FJBA 5DJQC 1G8XA 3OYZA 3UU4A 4CZZB 1Y64B 2C5IT 3RC3A 4QH4A 3AE1A 3ZT6A 2AXDS 4DV7T 1QSDA 5AQHB 2BKOA 4A97A 2Y6XA 4F6RC 4O4HE 3VRAA 4YSYA 2OLTA 5EK2A 3ZSTA 3AVSA 4HFDA 3CMLA 1T7SA 2WU2A 3AE6A 3CX7B 3GA8A 3MA9A 4OYJA 4QH5A 4TZ4C 4O8SA 2A72A 5ABHA 2CWOA 1IAPA 2QVAA 3GWHA 1OEDA 3PUSA 1I6ZA 1DU2A 3C50A 3QOFA 4NUVA 3OPCA 2FJAA 1WRDA 1FMWA 2L3LA 2YDSA 3P4WA 4HFHA 2V26A 3JADA 2BKNA 4ERRA 2UXCT 3B5MA 4KUMB 3RIUC 5LG4A 3QC9A 4H9NC 3FHNA 4LMKA 3BK9A 3TLTA 2QYWA 3L3PA 4I0UA 5FL0A 3UFEA 3PJAA 5JDGA 2JIWA 3JCFA 5FY0A 2X9YA 3ZC1A 2DI4A 5M4YA 4EOZB 2V7IA 5JRCB 3P4PA 4IDOA 3U3IA 3WAJA 1LVFA 1HS7A 1MMAA 4YTPA 1N36T 2NP9A 4EB6E 2BZBA 4ZI3C 3CQGB 2E8IA 4AKIA 4EZ4A 2XQ9A 4PK6A 2RP4A 3IBPA 2VK9A 4ZHQE 4YSZA 2EHOD 4LF5T 4IDNA 2DCFA 2W63A 3DP7A 2M6IA 1Z0PA 4IHJE 4KBMB 1BR0A 1Z8UA 2NTXA 1WLXA 3O1IA 3ZPOA 5L47A 3RKOA 2V6XA 3AA7B 4WBNE 3AEDA 4NXNT 1MIYA 5KXJA 3KV5A 4MALA 4OX9T 2LM2A 5AQGB 3RQUA 1T72A 4X1KE 3ZMZB 4AKRB 2CLYC 3QNUA 2J62A 1KNPA 2L9QA 4HN9A 3ZLIA 4JI0T 4I50E 2IW5B 3ETVA 1XMQT 2MYSA 1KNRA 1UUSA 4TN7B 3LBXA 5GONE 2BVLA 4AISA 2BDEA 2BG9E 5DQVA 3Q5XA 3ONXA 4CI1B 2K5BB 3N2GE 4JEHB 2WDQA 5HEJA 3NRXA 3FBZA 1OEDE 1W0BA 3NBXX 4WYVA 4IDQA 2N1GA 2CA5A 2LHNA 2A3DA 2VQFT 5FYMA 4U3CA 5LG3A 3CQXC 2CXLA 2WY2A 2X0YA 4DV6T 2K9AA 2XUEA 4MFRA 4HWFA 2DWKA 1WYCA 4UIGA 4C90A 3AEBA 5JR9C 5HWXA 2XQ5A 3KDSE 2XY8B 4H9RC 5FNVE 5HWYA 4CXXA 2XQ6A 1D0YA 2KSRA 3AEFA 2QRXA 3HKEE 4JI5T 3LK42 2VASA 3L8RA 3R84B 3SFDA 5ABFB 3H3AA 1LVKA 3N9LA 2BG9A 4K0KT 2J4GA 5L3EB 2KNDA 2E9XA 2V7LA 4EEBA 1UX4A 4H9PC 3EUHA 4A5XA 1KK7A 1MMNA 3ZKRA 3ZT5A 3UU8A 4KP3C 3KFWX 4PNIA 2N2NA 4U72A 2CEAA 4QXBB 4LF8T 3IHRA 3C64A 1UURA 5LGNB 2BVMA 2X51A 3MJXA 3NKZA 1QUUA 5HCMA 2ZM2A 3X1DA 4EEDA 2IMLA 3VR9A 4JI4T 2IHR1 3EAMA 3N5LA 5LB7B 2XQAA 4Z91A 3ONLC 4UXNB 4DIDB 1N32T 1LRZA 1VRBA 3L09A 3LJCA 4ZI3D 3CWZB 2M6BA 3F31A 3KBUA 2WP9A 3T8OA 1W09A 5HXHA 5IWAT 4YTNA 5LA6E 5F5WA 3RLFF 5FVKA 5BR8T 3PUZF 3VHLA 1HNZT 5KMGP 2WDVA 2VL8A 2KMFA 3JAFA 3KINB 4U74A 2VWAA 2A9UA 3I9WA 2UXBT 4CQIA 5JDNA 3Q5WA 3WAKA 3RQWA 3FZLB 1U5PA 3OKQA 4X64T 4U33A 2CBJA 3UT5E 3Q5DA 4LF9T 1FEWA 1J5WA 2K24A 4ILBA 5EK4A 5AFUL 5LBMA 3PURA 2Y8DA 3P50A 4I55E 3NZQA 4IDZA 4X1IE 3UUNA 5EK3A 2VVSA 3RX6A 2PBIA 4JI6T 1XNRT 4QX7B 3P8CD 4X20E 4YJ3E 3K1SA 4EV6A 1M62A 1NENA 3AXJB 3I1AA 4KHZF 3SFEA 2HPJA 3PE0A 2E5VA 3QUJA 2A2FX 4TV9E 3PDYA 3N9OA 4GIWA 5LHHB 2BG9B 1YKHB 3DJBA 4G2AA 4C91A 4L0RA 2JQ9A 2V8SV 2H88A 2V7JA 3PUVF 2K48A 2DNXA 4F8HA 1ZHCA 4A56A 2I0MA 3UQ4A 1YQ4A 2W66A 4CI2B 3TLUA 2WBLA 4PAGA 5CA0E 1N34T 5LP6E 2WDRA 2K3WA 4AQFA 3C98B 1XZYA 4HWCA 2H89A 4JLEA 5L4HA 5LBQB 1X9BA 4AXPA 1XMOT 2H3RA 2PTFA 3ZYLA 3AEAA 5JR9B 3HKCE 4YTMA 2W2UA 3CIRA 3AAAB 3C4WA 4PJLA 5H6RB 5LYJE 5JRCA 2CHNA 3RYHE 3QB5A 3ESLA 2NW7A 1HTJF 3PU8A 2RPAA 3ZC0A 5HXRA 3FZKB 2X9HA 2YKSA 2VKJA 4P0BA 4EIWA 4BJMA 5CFBA 4PFOA 3OYXA 3BQLA 2LSKA 3H37A 3FZHB 3ZYMA 2UU9T 3I9YA 4HFCA 4GK5E 3OJAA 1LKXA 2NOXA 4DUZT 2WS3A 2XQYA 3NWIA 4ZS3A 3VR8A 3ANWB 2Y48B 2LJLA 1W0AA 2CLYB 2UXXB 2XAGB 2YK0A 3ANWA 2XPKA 4JEUB 4P1NA 4CN6A 1KEYA 3LDQB 5KDMC 4IT4A 2EHOB 4EGWA 4YT0A 5DQWA 5CB4E 4LFBT 4UR9A 2UUCT 4N78D 2VVNA 2F4VT 2YN6A 2CHOA 3R6NA 4LMLA 4DV3T 1XNQT 3N2KE 1FMVA 4BAYB 5BMVE 1O3XA 4YHHT 5HXSA 4B3RT 4MHCA 4PJJA 3ZMSB 2ZM6T 5AQNB 2IC9A 4L5GA 1YKEB 4ISSA 3HR0A 3CKDA 4FJOA 2DLRA 4DV1T
chains in the Genus database with same CATH topology
2H7VC 3GMIA 2CM0A 3J9X1 2ZM8A 3N9QA 4DNDA 2Q9QA 1WYBA 3SWHA 4HEAA 4ZI2C 4GOUA 4O2AE 3CPZA 3TKLB 4AI6A 4AQGA 3LG7A 2MOZA 5F8PA 2XASB 5FMNA 2PG8A 5ADXL 3IF8B 5FXWA 5LGTB 4ISTA 3Q2MA 4I4TE 1UX5A 3K3OA 4QXHB 2V7KA 1G73A 1BR4A 3RRCA 4E7ZA 3CX8B 3E0ZA 1EZ3A 1FIOA 3MXZA 4H9SE 3RYCE 3P7IA 3EVYA 5L2LA 2WM9A 4ILUA 1WR6A 4O4JE 3C51A 2MBGA 1IJ5A 4ASKA 1E1HB 4I43B 4QWNB 3ZMTB 5FXZA 3ZMVB 4TUYE 3RYFE 4MBQA 2EHOC 2LE8A 3EDVA 4UV8B 4XAXB 3W15B 4IGUA 5E0OA 4ZS2A 2ZLYA 3ZN1B 1MMGA 1YW0A 1OXZA 5ETWA 1HFAA 2HPLA 3U78A 3MK7C 5KX5E 2DHRA 5L3CB 1IZNB 2ES0A 2XAHB 3UTKA 2CXFA 2P9BA 2LHRA 1CUNA 1US7B 2VKDA 4DVDA 2VB6A 2CE7A 2QGSA 3ZJ2A 4YJ2E 4EZHA 4CXYA 3C4ZA 5JH7E 2D0UA 1D1CA 2KLQA 2KZ7B 2NW8A 1VOMA 4UV9B 3B57A 2J1DG 2JQQA 1AJ3A 4YLHA 3GN5A 3FBLA 3HKDE 3B13A 3FB2A 1UCUA 3I0QA 4KMCA 1OWAA 4HKAA 4OK0A 1SHZC 4H63H 3ZEFB 5JDFA 3ZYKA 2YU1A 2X67A 4MLKA 1B7TA 1X79A 2ODUA 5LHGB 3A5XA 4XBFB 2PJQA 3ZN0B 3E08A 4PJMA 5JDLA 2DWGA 3HL6A 2CXDA 4CXWA 2YINA 4IE7A 3KVBA 3PU3A 4UVAB 3AVRA 4UF0B 4WBOA 5H6QB 3V5UA 4OHFA 5L3BB 1ZKEA 2LSIA 5FXXA 4IE6A 3IEEA 4L9IA 3N9NA 5IHYA 2C5KT 1ZV4X 3K8PC 3KV4A 4GK0E 4TV8E 3ZCJA 2X68A 2Z6EA 3C4XA 3OBVE 2JJ9A 5JQGE 4E7SA 2XHEB 5FY7A 3E22E 2CMRA 3HKBE 2RA1A 4X1YE 2PFVA 2CCQA 2X9WA 5J2UE 2V1DB 3LBXB 5LCYA 2KINB 2KT9A 3O1HA 5HAXA 3CQCB 3RRWA 1V9DA 2LOPA 3N9PA 2LEHA 4JUYA 2NWBA 1YD8G 4G63A 4PJNA 4EYUA 5J2TE 2VKOA 2H7OA 2Q9QB 3AAIA 3JC6C 2LM9A 2GK9A 2ZMAA 1BR2A 3GN5B 4EXTA 2E9XB 3I0OA 3F57A 4QHOA 4DMVA 1S94A 3S4UA 5CA1E 3CX6B 3MZKB 3RYIE 2MTQA 1MMDA 4UF0A 3KV6A 3ZJ1A 4HGAA 2W62A 5HXCA 3PUGA 5LXTE 1HX8A 5FY1A 3Q9DA 5LNKA 2KWIB 4UVBB 2D5UA 3VKGA 5FP3A 4IIJE 4QX8B 2I59A 3CVRA 2XAFB 4B6XA 2KWHA 4Z8XA 1S35A 5LOVE 3F2EA 3HI2A 2EHOA 4OFZA 3UUMA 2XTLA 2W0GA 1BR1A 1U4QA 2M67A 5FXVA 3O4XE 2N9DA 4FI5A 2HH7A 4GYRA 2QA7A 3BQKA 2WSSV 4AKHA 2C0SA 3AA6B 2LT3A 2WMNA 5DABA 5LGUB 3DTOA 1MNEA 2E9XC 3AA0B 3KV9A 2Q9QC 4HFVA 4EAHA 2X0LB 3VU7H 3SS1A 4P0AA 1ZEEA 4PFPA 3MKDA 2UXNB 4NUUA 3BQIA 4ZI2D 2YEVC 5L3FB 2X9XA 3ZMUB 5L3GB 5JR9A 4ZI7E 3O9XA 1SA0E 4WW0A 1D0XA 4DMWA 3MACA 2X66A 4O4IE 4P09A 2NTYA 3SRZA 1NAFA 2ACXA 1MIVA 4EYYR 1IJ6A 4O2BE 2IAKA 2ODVA 4ZOLE 5EZYE 4YHJA 4HTEA 1MNDA 5F3JA 2W61A 1D1AA 2G0UA 2JPFA 4V1Av 4O4LE 4AKGA 1D0ZA 1HF8A 4BA9A 5JDHA 5IYZE 4DBQA 4XZCA 3PUAA 2SPCA 2VKHA 3SOLA 5A1LA 3ZCIA 2W00A 3RH3A 2D0TA 4UEMA 4ADZA 3KVAA 3J7Yq 4IE0A 4DBRA 2C5JA 5LHIB 3EDUA 5C8YE 4J2CA 2CWYA 1MIWA 4K0UA 2NW9A 2LSGA 3RPUA 2V7MA 2KXPB 2JMHA 4YFSA 5L3DB 2JRKA 2L8KA 3AAEB 2Q9QD 3FXDB 3O1JA 2B1EA 1T98A 2WMOA 3HA4A 4PK4A 3FXEB 4AQFC 2E9XD 3LFMA 1NWMX 3NRYA 3AB3B 4GYSA 1HCIA 5JDMA 5J1GA 5LJMA 4DO0A 2WAUA 3M65A 2D2SA 3LK2B 3LK3B 2YU2A 4ANJA 3PUQA 2XAQB 4QXCB 5JDQA 1HG2A 1KNZA 2LSYA 5HXEA 3AA1B 2IC6A 2XAJB 4H9QC 3K3QC 3UUXB 2JMKA 2WWUA 4PK5A 4WNKA 3KBTA 2OA5A 3JC6D 3N9MA 4UELA 5JVDE 4IE5A 4OYKA 4PW8A 5JREA 4BJNA 4M1PA 3VKHA 3D0TA 3QK6A 5HYAA 3V5SA 3ETUA 2LOSA 4UVCB 3WI3A 1D1BA 5LJNA 3K3NA 3PTRB 2ZM0A 4IE4A 4QKNA 2LSJA 4AKLA 4H63V 1HG5A 4H9OC 4HE8A 3NZPA 5TAOA 4TX5A 3N2OA 1H7CA 5DJQC 1G8XA 3OYZA 4CZZB 1Y64B 2C5IT 3RC3A 1QSDA 4F6RC 2Y6XA 4O4HE 5EK2A 3AVSA 4OYJA 3CMLA 3CX7B 3GA8A 4TZ4C 3UULA 3MA9A 4CI3B 4O8SA 2A72A 2CWOA 1IAPA 3GWHA 3PUSA 3C50A 4NUVA 2L3LA 1WRDA 1FMWA 2V26A 4ERRA 4KUMB 5LG4A 3QC9A 4H9NC 3FHNA 3BK9A 3L3PA 3UFEA 5JDGA 5FY0A 5M4YA 2X9YA 3ZC1A 2DI4A 4EOZB 2V7IA 5JRCB 3U3IA 3WAJA 1LVFA 1HS7A 1MMAA 2NP9A 4EB6E 2BZBA 4ZI3C 3CQGB 2E8IA 4AKIA 4EZ4A 4PK6A 2RP4A 3IBPA 2VK9A 4ZHQE 2EHOD 2DCFA 2W63A 3DP7A 1Z0PA 4IHJE 4KBMB 1BR0A 2NTXA 1WLXA 3O1IA 3ZPOA 3RKOA 3AA7B 4WBNE 1MIYA 3KV5A 4MALA 4X1KE 3ZMZB 4AKRB 2CLYC 4HN9A 2L9QA 3ZLIA 4I50E 2IW5B 3ETVA 2MYSA 4TN7B 5GONE 3LBXA 2BVLA 2BDEA 5DQVA 3Q5XA 3ONXA 4CI1B 2K5BB 3N2GE 4JEHB 3NRXA 3FBZA 3NBXX 2N1GA 2CA5A 2LHNA 2A3DA 5FYMA 3CQXC 2CXLA 2K9AA 2XUEA 4MFRA 2DWKA 1WYCA 4UIGA 4C90A 5JR9C 5HWXA 3KDSE 4H9RC 5FNVE 5HWYA 4CXXA 1D0YA 3R84B 3HKEE 3LK42 2VASA 3H3AA 1LVKA 3N9LA 5L3EB 2KNDA 2E9XA 2V7LA 1UX4A 4H9PC 3EUHA 1KK7A 1MMNA 4KP3C 3KFWX 4PNIA 2N2NA 4U72A 2CEAA 4QXBB 3IHRA 3C64A 5LGNB 2BVMA 2X51A 3MJXA 1QUUA 2ZM2A 3N5LA 4UXNB 1LRZA 1VRBA 3L09A 3LJCA 4ZI3D 3CWZB 3F31A 3KBUA 3T8OA 5HXHA 5LA6E 3VHLA 5KMGP 4U74A 2VL8A 2KMFA 3KINB 2VWAA 3I9WA 4CQIA 5JDNA 3Q5WA 3WAKA 1U5PA 3OKQA 3UT5E 1FEWA 2K24A 5EK4A 5AFUL 5LBMA 3PURA 2Y8DA 4I55E 3NZQA 4IDZA 4X1IE 3UUNA 5EK3A 3RX6A 2PBIA 4QX7B 3P8CD 4X20E 4YJ3E 3I1AA 2HPJA 3PE0A 3QUJA 2A2FX 4TV9E 3PDYA 3N9OA 4GIWA 5LHHB 3DJBA 1YKHB 4G2AA 4C91A 4L0RA 2V7JA 2K48A 2DNXA 1ZHCA 4A56A 4CI2B 2WBLA 4PAGA 5CA0E 3RC8A 5LP6E 4AQFA 3C98B 4JLEA 5LBQB 4AXPA 2H3RA 3ZYLA 5JR9B 3HKCE 5JRCA 3AAAB 3C4WA 4PJLA 5H6RB 5LYJE 3RYHE 3ESLA 2NW7A 1HTJF 3PU8A 3ZC0A 5HXRA 2X9HA 4P0BA 2VKJA 4EIWA 4BJMA 4PFOA 3OYXA 3BQLA 2LSKA 3H37A 3ZYMA 3I9YA 4GK5E 3OJAA 1LKXA 2NOXA 2XQYA 4ZS3A 3ANWB 2Y48B 2LJLA 2CLYB 2UXXB 2XAGB 2YK0A 3ANWA 4JEUB 5KDMC 2EHOB 5DQWA 5CB4E 4N78D 3R6NA 3N2KE 1FMVA 4BAYB 5BMVE 1O3XA 5HXSA 4MHCA 4PJJA 3ZMSB 2IC9A 4L5GA 1YKEB 4ISSA 3HR0A 3CKDA 4FJOA 2DLRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BQL A;  4NUU A;  3BQI A;  2YK0 A;  5F3J A;  3C64 A;  4YFS A;  3RRC A;  3BQK A;  2WAU A;  4NUV A;  3CML A;  3CPZ A;  2Y8D A; 
#chains in the Genus database with same CATH topology
 5HEO A;  4DR1 T;  2H7V C;  3GMI A;  2CM0 A;  3J9X 1;  4JI7 T;  2ZM8 A;  3N9Q A;  4DND A;  4JI8 T;  2Q9Q A;  1WYB A;  5ABG A;  2BS3 A;  4HEA A;  1VCS A;  3SWH A;  4DR2 T;  4ZI2 C;  4GOU A;  4O2A E;  3CPZ A;  3TKL B;  2MPK A;  5FL1 A;  5AQQ B;  3AEG A;  4X66 T;  4AI6 A;  4Q25 A;  4AQG A;  3LG7 A;  2MOZ A;  4DR6 T;  5F8P A;  1J1J A;  1HNX T;  4JV5 T;  2XAS B;  5FMN A;  2PG8 A;  5C2T A;  5ADX L;  3IF8 B;  5FXW A;  4KX6 A;  5LGT B;  2D9D A;  3JAE A;  4IST A;  3Q2M A;  4I4T E;  1UX5 A;  2BKP A;  3K3O A;  2V7K A;  1G73 A;  1BR4 A;  4QXH B;  3RRC A;  4E7Z A;  4TNW A;  1J5E T;  2FBW A;  3CX8 B;  3E0Z A;  4LFA T;  1EZ3 A;  1FIO A;  3MXZ A;  4H9S E;  3RYC E;  3P7I A;  3EVY A;  3AE4 A;  4IDP A;  4JI1 T;  5L2L A;  2WM9 A;  4ILU A;  1WR6 A;  2J47 A;  4O4J E;  2MAW A;  5FKY A;  3C51 A;  2MBG A;  4X5T A;  1IJ5 A;  4ASK A;  1E1H B;  5AQJ B;  4I43 B;  4QWN B;  5AQM B;  1HNW T;  3ZMT B;  4U7Y A;  5FXZ A;  3ZMV B;  5LMN T;  2V5C A;  4TUY E;  3AE7 A;  3RYF E;  4MBQ A;  1M7K A;  2EHO C;  2LE8 A;  3EDV A;  3PJA J;  4UV8 B;  4XAX B;  1WFD A;  3W15 B;  4IGU A;  5E0O A;  4ZS2 A;  2ZLY A;  3ZN1 B;  1JNZ A;  1MMG A;  1YW0 A;  3PUX F;  1OXZ A;  5ETW A;  3TLV A;  1IBK T;  1HFA A;  3AE8 A;  2HPL A;  3P4Q A;  3U78 A;  3MK7 C;  5KX5 E;  2DHR A;  5L3C B;  1IZN B;  2ES0 A;  2XAH B;  3UTK A;  3VRB A;  2CXF A;  2P9B A;  2WB5 A;  2LHR A;  3ONJ A;  3RIA A;  1CUN A;  1N33 T;  2X0H A;  4AIU A;  1US7 B;  2VKD A;  4JI2 T;  4DVD A;  1UK5 A;  2VB6 A;  2CE7 A;  2CRB A;  2QGS A;  3ZJ2 A;  4EZH A;  4YJ2 E;  4CXY A;  1YXR A;  3PUY F;  4A98 A;  3C4Z A;  4JYA T;  4LFC T;  2BBJ A;  2W67 A;  5JH7 E;  2D0U A;  3AXJ A;  4YSX A;  4IL4 A;  1D1C A;  3ABV A;  2KLQ A;  2KZ7 B;  2NW8 A;  1VOM A;  4UV9 B;  5LMU T;  1R8I A;  3B57 A;  2WQY A;  4CN1 A;  2J1D G;  2JQQ A;  4COF A;  3EAB A;  1AJ3 A;  4NIQ A;  4YLH A;  3P4R A;  2XM2 A;  3FBL A;  3GN5 A;  4HWH A;  2WCA A;  4YXD A;  3HKD E;  3B13 A;  3FB2 A;  1UCU A;  3I0Q A;  4DR7 T;  4KMC A;  1OWA A;  4HKA A;  3AE3 A;  4OK0 A;  3EI0 A;  3RGL A;  1SHZ C;  2R6G F;  4H63 H;  4Z90 A;  3ZEF B;  5JDF A;  3ZYK A;  2YU1 A;  4ZZC A;  2X67 A;  5ABE A;  4MLK A;  2HN2 A;  1B7T A;  1X79 A;  2ODU A;  3QB5 K;  3A5X A;  3UUL A;  5LHG B;  4XBF B;  2PJQ A;  3ZN0 B;  3E08 A;  1YQ3 A;  4PJM A;  5JDL A;  1XDO A;  5AQI B;  2DWG A;  3HL6 A;  2CXD A;  4CXW A;  2DL1 A;  4U2Y A;  2VUR A;  2B76 A;  2YIN A;  3KVB A;  3PU3 A;  4IE7 A;  2V6Y B;  3AVR A;  4UVA B;  4UF0 B;  5L4E A;  4QH1 A;  4WBO A;  5H6Q B;  3V5U A;  2JQH A;  3T1H T;  4OHF A;  5L3B B;  1ZKE A;  4TNV A;  2LSI A;  2XSA A;  5FXX A;  2FJE A;  3FZF B;  3IEE A;  4IE6 A;  3N9N A;  4L9I A;  5IHY A;  5IUX A;  3H3M A;  2C5K T;  1ZV4 X;  3K8P C;  3KV4 A;  4GK0 E;  4TV8 E;  3ZCJ A;  2X68 A;  4LF4 T;  2Z6E A;  3C4X A;  3OBV E;  3AEC A;  2JJ9 A;  5JQG E;  4E7S A;  2XHE B;  5FY7 A;  3E22 E;  2FJD A;  4AQY T;  1SE7 A;  2CMR A;  3HKB E;  2RA1 A;  4X1Y E;  3OVU A;  2PFV A;  2CCQ A;  2X9W A;  3PV0 F;  4JBW F;  5FVL A;  1UGO A;  2V1D B;  1Y01 A;  5J2U E;  2IIU A;  3LBX B;  5LCY A;  2KIN B;  2KT9 A;  3O1H A;  5HAX A;  4X65 T;  3M3Z B;  4HFE A;  3CQC B;  3RRW A;  1GQE A;  1V9D A;  2LOP A;  3N9P A;  4CI3 B;  2LEH A;  1XWM A;  4JUY A;  2NWB A;  1YD8 G;  4G63 A;  4PJN A;  4EYU A;  2W4X A;  5J2T E;  3RC8 A;  2VKO A;  2H7O A;  2Q9Q B;  3AAI A;  3P4S A;  4U31 A;  5C3J A;  1W9R A;  3RF1 A;  2WZH A;  2LM9 A;  3JC6 C;  2VL0 A;  1ZP0 A;  1QLB A;  2GK9 A;  3IA3 A;  3UU3 A;  2ZMA A;  2LKH A;  2LRK A;  1OED C;  1BR2 A;  3GN5 B;  4EXT A;  2E9X B;  3I0O A;  3F57 A;  4QHO A;  2LKG A;  5AQS B;  1S94 A;  1XDP A;  3S4U A;  3RIU A;  4DMV A;  5CA1 E;  4B3S T;  3CX6 B;  2BBH A;  3MZK B;  4TWF A;  3NVO A;  3RYI E;  2MTQ A;  1MMD A;  2CBI A;  2JQK A;  4UF0 A;  2XQ4 A;  3KV6 A;  3ZJ1 A;  4HGA A;  2W62 A;  5HXC A;  2XJ7 A;  5CGM A;  3PUG A;  5LXT E;  4GKK T;  1IBL T;  1HX8 A;  5FY1 A;  1I94 T;  2XQ7 A;  3Q9D A;  1SUM B;  5LNK A;  2KWI B;  1KFY A;  4UVB B;  2AE9 A;  5J0Z A;  4YY3 T;  1T8B A;  2D5U A;  3A8Y C;  5FP3 A;  2VQE T;  3VKG A;  1JNR A;  4DV5 T;  4IIJ E;  4QX8 B;  2I59 A;  3LSV A;  5HEG A;  4HWD A;  5AQL B;  3CVR A;  2XAF B;  4B6X A;  4DR4 T;  2KWH A;  2LLY A;  4Z8X A;  1S35 A;  2I6H A;  5AQF B;  5LOV E;  4DV2 T;  3F2E A;  3HI2 A;  1CHU A;  2EHO A;  4OFZ A;  4KHP T;  3UUM A;  4X62 T;  3T1Y T;  2XTL A;  2W0G A;  4ILC A;  5JTG A;  1BR1 A;  3CK6 A;  1U4Q A;  2M67 A;  5FXV A;  2YDQ A;  3O4X E;  2ACZ A;  2N9D A;  4FI5 A;  5AQO B;  2HH7 A;  4GYR A;  2QA7 A;  4DR5 T;  4NXM T;  3BQK A;  2WSS V;  4ZXL A;  1FJG T;  4AKH A;  4HWI B;  5AQK B;  2C0S A;  3AA6 B;  2LT3 A;  3OTO T;  3Q5E A;  3UU5 A;  2WMN A;  5DAB A;  5LGU B;  4JI3 T;  3DTO A;  1MNE A;  5HEH A;  2E9X C;  3AA0 B;  3KV9 A;  2Q9Q C;  1OED B;  4HFV A;  4LMJ A;  4EAH A;  2BG9 C;  3RKG A;  2X0L B;  3VU7 H;  3SS1 A;  4LF6 T;  4P0A A;  2UUB T;  1NEK A;  1ZEE A;  3TLW A;  4PFP A;  2XQ8 A;  2UXN B;  2XZE A;  3BQI A;  3MKD A;  4NUU A;  3RIF A;  3AE9 A;  4ZI2 D;  2YEV C;  2YOE A;  4TWD A;  2X9X A;  5L3F B;  3ZMU B;  5L3G B;  5JR9 A;  1HX1 B;  3RI5 A;  4ZI7 E;  3O9X A;  3A7M A;  2IDO B;  1SA0 E;  2XQ3 A;  1D0X A;  4WW0 A;  3MAC A;  4TWH A;  2X66 A;  4DMW A;  3TLS A;  4O4I E;  4P09 A;  2NTY A;  3ZT7 A;  4IL9 A;  2WZI A;  3SRZ A;  1NAF A;  2ACX A;  1MIV A;  4EYY R;  2UXD T;  3AE2 A;  1IJ6 A;  2WU5 A;  4O2B E;  2IAK A;  2XM1 A;  2ODV A;  5AQT B;  4NPP A;  2OV9 A;  4ZOL E;  3AEE A;  5EZY E;  4YHJ A;  4HTE A;  3UFG A;  2YDR A;  2BS2 A;  2CPT A;  1MND A;  5F3J A;  2W61 A;  1D1A A;  2G0U A;  2JPF A;  1KF6 A;  4O4L E;  4V1A v;  4AKG A;  4GKJ T;  5AQP B;  1D0Z A;  1HF8 A;  5AQR B;  4BA9 A;  5IYZ E;  5JDH A;  4DBQ A;  4XZC A;  4DR3 T;  3PUA A;  2SPC A;  2VKH A;  3SOL A;  5A1L A;  3ZCI A;  5AQU B;  2W00 A;  3RH3 A;  2D0T A;  4UEM A;  4ADZ A;  3FZM B;  3KVA A;  4IRE A;  3J7Y q;  4DV4 T;  4IE0 A;  4ZEY A;  4DBR A;  2C5J A;  2XSB A;  3EDU A;  3EHZ A;  5C8Y E;  5LHI B;  4J2C A;  4DUY T;  2E5L T;  2CWY A;  1MIW A;  4K0U A;  2NW9 A;  4B3M T;  2LSG A;  3RPU A;  2V7M A;  3L39 A;  2KXP B;  4HFB A;  2HHH T;  2JMH A;  4YFS A;  5L3D B;  2JRK A;  2L8K A;  3AAE B;  5HEU A;  3RHW A;  2Q9Q D;  2HN1 A;  3FXD B;  4B3T T;  3O1J A;  2B1E A;  1T98 A;  2WMO A;  3G06 A;  3HA4 A;  3FXE B;  4PK4 A;  1L0V A;  4AQF C;  2E9X D;  3LFM A;  3ZSS A;  1NWM X;  2FUP A;  1HR0 T;  3NRY A;  1VCT A;  3AB3 B;  4GYS A;  3UUB A;  1HCI A;  5JDM A;  2E2A A;  5J1G A;  2WWV A;  5LJM A;  5ABF A;  5AQV B;  4DO0 A;  2WAU A;  3M65 A;  3UU6 A;  1E2A A;  2D2S A;  3LK2 B;  2IUB A;  2YU2 A;  3LK3 B;  3PUQ A;  4ANJ A;  2XAQ B;  4ILA A;  4QXC B;  5JDQ A;  1HG2 A;  1KNZ A;  2LSY A;  5HXE A;  1ZOY A;  1E7P A;  3AA1 B;  2IC6 A;  2XAJ B;  4H9Q C;  3K3Q C;  4HFI A;  4WZX A;  3UUX B;  4ZZB A;  2JMK A;  2WWU A;  4PK5 A;  4WNK A;  5HCJ A;  2NR4 A;  1WR0 A;  2OA5 A;  3KBT A;  3JC6 D;  3N9M A;  4UEL A;  5JVD E;  2V5D A;  4IE5 A;  1IBM T;  4OYK A;  4PW8 A;  5JRE A;  2BS4 A;  4M1P A;  2V6Y A;  3AE5 A;  4BJN A;  4LF7 T;  3D0T A;  3QK6 A;  5HYA A;  3VKH A;  3V5S A;  3PUW F;  3ETU A;  2LOS A;  4UVC B;  3WI3 A;  2UUA T;  1D1B A;  5LJN A;  3UQ7 A;  3K3N A;  2LRL A;  2ZM0 A;  3PTR B;  4IE4 A;  4CN4 A;  4QKN A;  1WCR A;  2LSJ A;  4U7I A;  4H63 V;  4AKL A;  1HG5 A;  4H9O C;  4HE8 A;  3NZP A;  5TAO A;  5CJ5 A;  4DV0 T;  4U2Z A;  4TX5 A;  3N2O A;  1H7C A;  4KI0 F;  2FJB A;  5DJQ C;  1G8X A;  3OYZ A;  3UU4 A;  4CZZ B;  1Y64 B;  2C5I T;  3RC3 A;  4QH4 A;  3AE1 A;  3ZT6 A;  2AXD S;  4DV7 T;  1QSD A;  5AQH B;  2BKO A;  4A97 A;  2Y6X A;  4F6R C;  4O4H E;  3VRA A;  4YSY A;  2OLT A;  5EK2 A;  3ZST A;  3AVS A;  4HFD A;  3CML A;  1T7S A;  2WU2 A;  3AE6 A;  3CX7 B;  3GA8 A;  3MA9 A;  4OYJ A;  4QH5 A;  4TZ4 C;  4O8S A;  2A72 A;  5ABH A;  2CWO A;  1IAP A;  2QVA A;  3GWH A;  1OED A;  3PUS A;  1I6Z A;  1DU2 A;  3C50 A;  3QOF A;  4NUV A;  3OPC A;  2FJA A;  1WRD A;  1FMW A;  2L3L A;  2YDS A;  3P4W A;  4HFH A;  2V26 A;  3JAD A;  2BKN A;  4ERR A;  2UXC T;  3B5M A;  4KUM B;  3RIU C;  5LG4 A;  3QC9 A;  4H9N C;  3FHN A;  4LMK A;  3BK9 A;  3TLT A;  2QYW A;  3L3P A;  4I0U A;  5FL0 A;  3UFE A;  3PJA A;  5JDG A;  2JIW A;  3JCF A;  5FY0 A;  2X9Y A;  3ZC1 A;  2DI4 A;  5M4Y A;  4EOZ B;  2V7I A;  5JRC B;  3P4P A;  4IDO A;  3U3I A;  3WAJ A;  1LVF A;  1HS7 A;  1MMA A;  4YTP A;  1N36 T;  2NP9 A;  4EB6 E;  2BZB A;  4ZI3 C;  3CQG B;  2E8I A;  4AKI A;  4EZ4 A;  2XQ9 A;  4PK6 A;  2RP4 A;  3IBP A;  2VK9 A;  4ZHQ E;  4YSZ A;  2EHO D;  4LF5 T;  4IDN A;  2DCF A;  2W63 A;  3DP7 A;  2M6I A;  1Z0P A;  4IHJ E;  4KBM B;  1BR0 A;  1Z8U A;  2NTX A;  1WLX A;  3O1I A;  3ZPO A;  5L47 A;  3RKO A;  2V6X A;  3AA7 B;  4WBN E;  3AED A;  4NXN T;  1MIY A;  5KXJ A;  3KV5 A;  4MAL A;  4OX9 T;  2LM2 A;  5AQG B;  3RQU A;  1T72 A;  4X1K E;  3ZMZ B;  4AKR B;  2CLY C;  3QNU A;  2J62 A;  1KNP A;  2L9Q A;  4HN9 A;  3ZLI A;  4JI0 T;  4I50 E;  2IW5 B;  3ETV A;  1XMQ T;  2MYS A;  1KNR A;  1UUS A;  4TN7 B;  3LBX A;  5GON E;  2BVL A;  4AIS A;  2BDE A;  2BG9 E;  5DQV A;  3Q5X A;  3ONX A;  4CI1 B;  2K5B B;  3N2G E;  4JEH B;  2WDQ A;  5HEJ A;  3NRX A;  3FBZ A;  1OED E;  1W0B A;  3NBX X;  4WYV A;  4IDQ A;  2N1G A;  2CA5 A;  2LHN A;  2A3D A;  2VQF T;  5FYM A;  4U3C A;  5LG3 A;  3CQX C;  2CXL A;  2WY2 A;  2X0Y A;  4DV6 T;  2K9A A;  2XUE A;  4MFR A;  4HWF A;  2DWK A;  1WYC A;  4UIG A;  4C90 A;  3AEB A;  5JR9 C;  5HWX A;  2XQ5 A;  3KDS E;  2XY8 B;  4H9R C;  5FNV E;  5HWY A;  4CXX A;  2XQ6 A;  1D0Y A;  2KSR A;  3AEF A;  2QRX A;  3HKE E;  4JI5 T;  3LK4 2;  2VAS A;  3L8R A;  3R84 B;  3SFD A;  5ABF B;  3H3A A;  1LVK A;  3N9L A;  2BG9 A;  4K0K T;  2J4G A;  5L3E B;  2KND A;  2E9X A;  2V7L A;  4EEB A;  1UX4 A;  4H9P C;  3EUH A;  4A5X A;  1KK7 A;  1MMN A;  3ZKR A;  3ZT5 A;  3UU8 A;  4KP3 C;  3KFW X;  4PNI A;  2N2N A;  4U72 A;  2CEA A;  4QXB B;  4LF8 T;  3IHR A;  3C64 A;  1UUR A;  5LGN B;  2BVM A;  2X51 A;  3MJX A;  3NKZ A;  1QUU A;  5HCM A;  2ZM2 A;  3X1D A;  4EED A;  2IML A;  3VR9 A;  4JI4 T;  2IHR 1;  3EAM A;  3N5L A;  5LB7 B;  2XQA A;  4Z91 A;  3ONL C;  4UXN B;  4DID B;  1N32 T;  1LRZ A;  1VRB A;  3L09 A;  3LJC A;  4ZI3 D;  3CWZ B;  2M6B A;  3F31 A;  3KBU A;  2WP9 A;  3T8O A;  1W09 A;  5HXH A;  5IWA T;  4YTN A;  5LA6 E;  5F5W A;  3RLF F;  5FVK A;  5BR8 T;  3PUZ F;  3VHL A;  1HNZ T;  5KMG P;  2WDV A;  2VL8 A;  2KMF A;  3JAF A;  3KIN B;  4U74 A;  2VWA A;  2A9U A;  3I9W A;  2UXB T;  4CQI A;  5JDN A;  3Q5W A;  3WAK A;  3RQW A;  3FZL B;  1U5P A;  3OKQ A;  4X64 T;  4U33 A;  2CBJ A;  3UT5 E;  3Q5D A;  4LF9 T;  1FEW A;  1J5W A;  2K24 A;  4ILB A;  5EK4 A;  5AFU L;  5LBM A;  3PUR A;  2Y8D A;  3P50 A;  4I55 E;  3NZQ A;  4IDZ A;  4X1I E;  3UUN A;  5EK3 A;  2VVS A;  3RX6 A;  2PBI A;  4JI6 T;  1XNR T;  4QX7 B;  3P8C D;  4X20 E;  4YJ3 E;  3K1S A;  4EV6 A;  1M62 A;  1NEN A;  3AXJ B;  3I1A A;  4KHZ F;  3SFE A;  2HPJ A;  3PE0 A;  2E5V A;  3QUJ A;  2A2F X;  4TV9 E;  3PDY A;  3N9O A;  4GIW A;  5LHH B;  2BG9 B;  1YKH B;  3DJB A;  4G2A A;  4C91 A;  4L0R A;  2JQ9 A;  2V8S V;  2H88 A;  2V7J A;  3PUV F;  2K48 A;  2DNX A;  4F8H A;  1ZHC A;  4A56 A;  2I0M A;  3UQ4 A;  1YQ4 A;  2W66 A;  4CI2 B;  3TLU A;  2WBL A;  4PAG A;  5CA0 E;  1N34 T;  5LP6 E;  2WDR A;  2K3W A;  4AQF A;  3C98 B;  1XZY A;  4HWC A;  2H89 A;  4JLE A;  5L4H A;  5LBQ B;  1X9B A;  4AXP A;  1XMO T;  2H3R A;  2PTF A;  3ZYL A;  3AEA A;  5JR9 B;  3HKC E;  4YTM A;  2W2U A;  3CIR A;  3AAA B;  3C4W A;  4PJL A;  5H6R B;  5LYJ E;  5JRC A;  2CHN A;  3RYH E;  3QB5 A;  3ESL A;  2NW7 A;  1HTJ F;  3PU8 A;  2RPA A;  3ZC0 A;  5HXR A;  3FZK B;  2X9H A;  2YKS A;  2VKJ A;  4P0B A;  4EIW A;  4BJM A;  5CFB A;  4PFO A;  3OYX A;  3BQL A;  2LSK A;  3H37 A;  3FZH B;  3ZYM A;  2UU9 T;  3I9Y A;  4HFC A;  4GK5 E;  3OJA A;  1LKX A;  2NOX A;  4DUZ T;  2WS3 A;  2XQY A;  3NWI A;  4ZS3 A;  3VR8 A;  3ANW B;  2Y48 B;  2LJL A;  1W0A A;  2CLY B;  2UXX B;  2XAG B;  2YK0 A;  3ANW A;  2XPK A;  4JEU B;  4P1N A;  4CN6 A;  1KEY A;  3LDQ B;  5KDM C;  4IT4 A;  2EHO B;  4EGW A;  4YT0 A;  5DQW A;  5CB4 E;  4LFB T;  4UR9 A;  2UUC T;  4N78 D;  2VVN A;  2F4V T;  2YN6 A;  2CHO A;  3R6N A;  4LML A;  4DV3 T;  1XNQ T;  3N2K E;  1FMV A;  4BAY B;  5BMV E;  1O3X A;  4YHH T;  5HXS A;  4B3R T;  4MHC A;  4PJJ A;  3ZMS B;  2ZM6 T;  5AQN B;  2IC9 A;  4L5G A;  1YKE B;  4ISS A;  3HR0 A;  3CKD A;  4FJO A;  2DLR A;  4DV1 T; 
#chains in the Genus database with same CATH homology
 2H7V C;  3GMI A;  2CM0 A;  3J9X 1;  2ZM8 A;  3N9Q A;  4DND A;  2Q9Q A;  1WYB A;  3SWH A;  4HEA A;  4ZI2 C;  4GOU A;  4O2A E;  3CPZ A;  3TKL B;  4AI6 A;  4AQG A;  3LG7 A;  2MOZ A;  5F8P A;  2XAS B;  5FMN A;  2PG8 A;  5ADX L;  3IF8 B;  5FXW A;  5LGT B;  4IST A;  3Q2M A;  4I4T E;  1UX5 A;  3K3O A;  4QXH B;  2V7K A;  1G73 A;  1BR4 A;  3RRC A;  4E7Z A;  3CX8 B;  3E0Z A;  1EZ3 A;  1FIO A;  3MXZ A;  4H9S E;  3RYC E;  3P7I A;  3EVY A;  5L2L A;  2WM9 A;  4ILU A;  1WR6 A;  4O4J E;  3C51 A;  2MBG A;  1IJ5 A;  4ASK A;  1E1H B;  4I43 B;  4QWN B;  3ZMT B;  5FXZ A;  3ZMV B;  4TUY E;  3RYF E;  4MBQ A;  2EHO C;  2LE8 A;  3EDV A;  4UV8 B;  4XAX B;  3W15 B;  4IGU A;  5E0O A;  4ZS2 A;  2ZLY A;  3ZN1 B;  1MMG A;  1YW0 A;  1OXZ A;  5ETW A;  1HFA A;  2HPL A;  3U78 A;  3MK7 C;  5KX5 E;  2DHR A;  5L3C B;  1IZN B;  2ES0 A;  2XAH B;  3UTK A;  2CXF A;  2P9B A;  2LHR A;  1CUN A;  1US7 B;  2VKD A;  4DVD A;  2VB6 A;  2CE7 A;  2QGS A;  3ZJ2 A;  4YJ2 E;  4EZH A;  4CXY A;  3C4Z A;  5JH7 E;  2D0U A;  1D1C A;  2KLQ A;  2KZ7 B;  2NW8 A;  1VOM A;  4UV9 B;  3B57 A;  2J1D G;  2JQQ A;  1AJ3 A;  4YLH A;  3GN5 A;  3FBL A;  3HKD E;  3B13 A;  3FB2 A;  1UCU A;  3I0Q A;  4KMC A;  1OWA A;  4HKA A;  4OK0 A;  1SHZ C;  4H63 H;  3ZEF B;  5JDF A;  3ZYK A;  2YU1 A;  2X67 A;  4MLK A;  1B7T A;  1X79 A;  2ODU A;  5LHG B;  3A5X A;  4XBF B;  2PJQ A;  3ZN0 B;  3E08 A;  4PJM A;  5JDL A;  2DWG A;  3HL6 A;  2CXD A;  4CXW A;  2YIN A;  4IE7 A;  3KVB A;  3PU3 A;  4UVA B;  3AVR A;  4UF0 B;  4WBO A;  5H6Q B;  3V5U A;  4OHF A;  5L3B B;  1ZKE A;  2LSI A;  5FXX A;  4IE6 A;  3IEE A;  4L9I A;  3N9N A;  5IHY A;  2C5K T;  1ZV4 X;  3K8P C;  3KV4 A;  4GK0 E;  4TV8 E;  3ZCJ A;  2X68 A;  2Z6E A;  3C4X A;  3OBV E;  2JJ9 A;  5JQG E;  4E7S A;  2XHE B;  5FY7 A;  3E22 E;  2CMR A;  3HKB E;  2RA1 A;  4X1Y E;  2PFV A;  2CCQ A;  2X9W A;  5J2U E;  2V1D B;  3LBX B;  5LCY A;  2KIN B;  2KT9 A;  3O1H A;  5HAX A;  3CQC B;  3RRW A;  1V9D A;  2LOP A;  3N9P A;  2LEH A;  4JUY A;  2NWB A;  1YD8 G;  4G63 A;  4PJN A;  4EYU A;  5J2T E;  2VKO A;  2H7O A;  2Q9Q B;  3AAI A;  3JC6 C;  2LM9 A;  2GK9 A;  2ZMA A;  1BR2 A;  3GN5 B;  4EXT A;  2E9X B;  3I0O A;  3F57 A;  4QHO A;  4DMV A;  1S94 A;  3S4U A;  5CA1 E;  3CX6 B;  3MZK B;  3RYI E;  2MTQ A;  1MMD A;  4UF0 A;  3KV6 A;  3ZJ1 A;  4HGA A;  2W62 A;  5HXC A;  3PUG A;  5LXT E;  1HX8 A;  5FY1 A;  3Q9D A;  5LNK A;  2KWI B;  4UVB B;  2D5U A;  3VKG A;  5FP3 A;  4IIJ E;  4QX8 B;  2I59 A;  3CVR A;  2XAF B;  4B6X A;  2KWH A;  4Z8X A;  1S35 A;  5LOV E;  3F2E A;  3HI2 A;  2EHO A;  4OFZ A;  3UUM A;  2XTL A;  2W0G A;  1BR1 A;  1U4Q A;  2M67 A;  5FXV A;  3O4X E;  2N9D A;  4FI5 A;  2HH7 A;  4GYR A;  2QA7 A;  3BQK A;  2WSS V;  4AKH A;  2C0S A;  3AA6 B;  2LT3 A;  2WMN A;  5DAB A;  5LGU B;  3DTO A;  1MNE A;  2E9X C;  3AA0 B;  3KV9 A;  2Q9Q C;  4HFV A;  4EAH A;  2X0L B;  3VU7 H;  3SS1 A;  4P0A A;  1ZEE A;  4PFP A;  3MKD A;  2UXN B;  4NUU A;  3BQI A;  4ZI2 D;  2YEV C;  5L3F B;  2X9X A;  3ZMU B;  5L3G B;  5JR9 A;  4ZI7 E;  3O9X A;  1SA0 E;  4WW0 A;  1D0X A;  4DMW A;  3MAC A;  2X66 A;  4O4I E;  4P09 A;  2NTY A;  3SRZ A;  1NAF A;  2ACX A;  1MIV A;  4EYY R;  1IJ6 A;  4O2B E;  2IAK A;  2ODV A;  4ZOL E;  5EZY E;  4YHJ A;  4HTE A;  1MND A;  5F3J A;  2W61 A;  1D1A A;  2G0U A;  2JPF A;  4V1A v;  4O4L E;  4AKG A;  1D0Z A;  1HF8 A;  4BA9 A;  5JDH A;  5IYZ E;  4DBQ A;  4XZC A;  3PUA A;  2SPC A;  2VKH A;  3SOL A;  5A1L A;  3ZCI A;  2W00 A;  3RH3 A;  2D0T A;  4UEM A;  4ADZ A;  3KVA A;  3J7Y q;  4IE0 A;  4DBR A;  2C5J A;  5LHI B;  3EDU A;  5C8Y E;  4J2C A;  2CWY A;  1MIW A;  4K0U A;  2NW9 A;  2LSG A;  3RPU A;  2V7M A;  2KXP B;  2JMH A;  4YFS A;  5L3D B;  2JRK A;  2L8K A;  3AAE B;  2Q9Q D;  3FXD B;  3O1J A;  2B1E A;  1T98 A;  2WMO A;  3HA4 A;  4PK4 A;  3FXE B;  4AQF C;  2E9X D;  3LFM A;  1NWM X;  3NRY A;  3AB3 B;  4GYS A;  1HCI A;  5JDM A;  5J1G A;  5LJM A;  4DO0 A;  2WAU A;  3M65 A;  2D2S A;  3LK2 B;  3LK3 B;  2YU2 A;  4ANJ A;  3PUQ A;  2XAQ B;  4QXC B;  5JDQ A;  1HG2 A;  1KNZ A;  2LSY A;  5HXE A;  3AA1 B;  2IC6 A;  2XAJ B;  4H9Q C;  3K3Q C;  3UUX B;  2JMK A;  2WWU A;  4PK5 A;  4WNK A;  3KBT A;  2OA5 A;  3JC6 D;  3N9M A;  4UEL A;  5JVD E;  4IE5 A;  4OYK A;  4PW8 A;  5JRE A;  4BJN A;  4M1P A;  3VKH A;  3D0T A;  3QK6 A;  5HYA A;  3V5S A;  3ETU A;  2LOS A;  4UVC B;  3WI3 A;  1D1B A;  5LJN A;  3K3N A;  3PTR B;  2ZM0 A;  4IE4 A;  4QKN A;  2LSJ A;  4AKL A;  4H63 V;  1HG5 A;  4H9O C;  4HE8 A;  3NZP A;  5TAO A;  4TX5 A;  3N2O A;  1H7C A;  5DJQ C;  1G8X A;  3OYZ A;  4CZZ B;  1Y64 B;  2C5I T;  3RC3 A;  1QSD A;  4F6R C;  2Y6X A;  4O4H E;  5EK2 A;  3AVS A;  4OYJ A;  3CML A;  3CX7 B;  3GA8 A;  4TZ4 C;  3UUL A;  3MA9 A;  4CI3 B;  4O8S A;  2A72 A;  2CWO A;  1IAP A;  3GWH A;  3PUS A;  3C50 A;  4NUV A;  2L3L A;  1WRD A;  1FMW A;  2V26 A;  4ERR A;  4KUM B;  5LG4 A;  3QC9 A;  4H9N C;  3FHN A;  3BK9 A;  3L3P A;  3UFE A;  5JDG A;  5FY0 A;  5M4Y A;  2X9Y A;  3ZC1 A;  2DI4 A;  4EOZ B;  2V7I A;  5JRC B;  3U3I A;  3WAJ A;  1LVF A;  1HS7 A;  1MMA A;  2NP9 A;  4EB6 E;  2BZB A;  4ZI3 C;  3CQG B;  2E8I A;  4AKI A;  4EZ4 A;  4PK6 A;  2RP4 A;  3IBP A;  2VK9 A;  4ZHQ E;  2EHO D;  2DCF A;  2W63 A;  3DP7 A;  1Z0P A;  4IHJ E;  4KBM B;  1BR0 A;  2NTX A;  1WLX A;  3O1I A;  3ZPO A;  3RKO A;  3AA7 B;  4WBN E;  1MIY A;  3KV5 A;  4MAL A;  4X1K E;  3ZMZ B;  4AKR B;  2CLY C;  4HN9 A;  2L9Q A;  3ZLI A;  4I50 E;  2IW5 B;  3ETV A;  2MYS A;  4TN7 B;  5GON E;  3LBX A;  2BVL A;  2BDE A;  5DQV A;  3Q5X A;  3ONX A;  4CI1 B;  2K5B B;  3N2G E;  4JEH B;  3NRX A;  3FBZ A;  3NBX X;  2N1G A;  2CA5 A;  2LHN A;  2A3D A;  5FYM A;  3CQX C;  2CXL A;  2K9A A;  2XUE A;  4MFR A;  2DWK A;  1WYC A;  4UIG A;  4C90 A;  5JR9 C;  5HWX A;  3KDS E;  4H9R C;  5FNV E;  5HWY A;  4CXX A;  1D0Y A;  3R84 B;  3HKE E;  3LK4 2;  2VAS A;  3H3A A;  1LVK A;  3N9L A;  5L3E B;  2KND A;  2E9X A;  2V7L A;  1UX4 A;  4H9P C;  3EUH A;  1KK7 A;  1MMN A;  4KP3 C;  3KFW X;  4PNI A;  2N2N A;  4U72 A;  2CEA A;  4QXB B;  3IHR A;  3C64 A;  5LGN B;  2BVM A;  2X51 A;  3MJX A;  1QUU A;  2ZM2 A;  3N5L A;  4UXN B;  1LRZ A;  1VRB A;  3L09 A;  3LJC A;  4ZI3 D;  3CWZ B;  3F31 A;  3KBU A;  3T8O A;  5HXH A;  5LA6 E;  3VHL A;  5KMG P;  4U74 A;  2VL8 A;  2KMF A;  3KIN B;  2VWA A;  3I9W A;  4CQI A;  5JDN A;  3Q5W A;  3WAK A;  1U5P A;  3OKQ A;  3UT5 E;  1FEW A;  2K24 A;  5EK4 A;  5AFU L;  5LBM A;  3PUR A;  2Y8D A;  4I55 E;  3NZQ A;  4IDZ A;  4X1I E;  3UUN A;  5EK3 A;  3RX6 A;  2PBI A;  4QX7 B;  3P8C D;  4X20 E;  4YJ3 E;  3I1A A;  2HPJ A;  3PE0 A;  3QUJ A;  2A2F X;  4TV9 E;  3PDY A;  3N9O A;  4GIW A;  5LHH B;  3DJB A;  1YKH B;  4G2A A;  4C91 A;  4L0R A;  2V7J A;  2K48 A;  2DNX A;  1ZHC A;  4A56 A;  4CI2 B;  2WBL A;  4PAG A;  5CA0 E;  3RC8 A;  5LP6 E;  4AQF A;  3C98 B;  4JLE A;  5LBQ B;  4AXP A;  2H3R A;  3ZYL A;  5JR9 B;  3HKC E;  5JRC A;  3AAA B;  3C4W A;  4PJL A;  5H6R B;  5LYJ E;  3RYH E;  3ESL A;  2NW7 A;  1HTJ F;  3PU8 A;  3ZC0 A;  5HXR A;  2X9H A;  4P0B A;  2VKJ A;  4EIW A;  4BJM A;  4PFO A;  3OYX A;  3BQL A;  2LSK A;  3H37 A;  3ZYM A;  3I9Y A;  4GK5 E;  3OJA A;  1LKX A;  2NOX A;  2XQY A;  4ZS3 A;  3ANW B;  2Y48 B;  2LJL A;  2CLY B;  2UXX B;  2XAG B;  2YK0 A;  3ANW A;  4JEU B;  5KDM C;  2EHO B;  5DQW A;  5CB4 E;  4N78 D;  3R6N A;  3N2K E;  1FMV A;  4BAY B;  5BMV E;  1O3X A;  5HXS A;  4MHC A;  4PJJ A;  3ZMS B;  2IC9 A;  4L5G A;  1YKE B;  4ISS A;  3HR0 A;  3CKD A;  4FJO A;  2DLR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...