3C64A

The mc179 portion of the cysteine-rich interdomain region (cidr) of a plasmodium falciparum erythrocyte membrane protein-1 (pfemp1)
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
166
structure length
152
Chain Sequence
DKIMSYNAFFWMWVHDMLIDSIKWRDEHGCNKKCICFQKWVEQKKTEWGKIKDHFRKQKDIPKDWTHDDFLQTLLMKDLLLEIIQDTYGDANEIKRIEALLEQAGVGGIDFAALAGLYTKGFVAEKDTTIDKLLQHEQKEADKCLKTHTDDT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Cysteine-Rich Interdomain Region from the Highly Variable Plasmodium falciparum Erythrocyte Membrane Protein-1 Exhibits a Conserved Structure.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Cd36-binding protein,cell adhesion
molecule keywords PfEMP1 variant 2 of strain MC
total genus 58
structure length 152
sequence length 166
ec nomenclature
pdb deposition date 2008-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03011 PFEMP PFEMP DBL domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.830 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3c64A00
5F3JA 3CMLA 4YFSA 2YK0A 4NUUA 3C64A 2Y8DA 3BQLA 3CPZA 4NUVA 3RRCA 3BQKA 3BQIA 2WAUA
chains in the Genus database with same CATH superfamily
1NEKA 1VCTA 4TWDA 5AQNB 3RI5A 3RYIE 4A5XA 3K8PC 3AB3B 4JLEA 5JR9B 5L3DB 3P4QA 4JI0T 4HFEA 2LRLA 3C51A 2I6HA 2ZM0A 3IHRA 2WMOA 3TLWA 5C8YE 5AQTB 2BVLA 4MFRA 3EAMA 3RYFE 2WAUA 3PUQA 4UVBB 1KK7A 5J2UE 3Q2MA 4DO0A 3AEFA 5LJNA 3J7Yq 4DR6T 2VASA 3OYZA 3FHNA 4DMVA 5L3CB 3NWIA 2K24A 2NW9A 4YTPA 3KDSE 2XAQB 2E2AA 4JI5T 3O9XA 2YN6A 3KBUA 3KBTA 5LXTE 2LT3A 2H88A 2Z6EA 3LK3B 3ESLA 2I59A 5F5WA 3CK6A 2AXDS 2X9XA 4DIDB 4I50E 4J2CA 3OYXA 3RRWA 2XASB 3ONLC 1HNXT 2Y8DA 2UUAT 2I0MA 2X9YA 2B76A 3UFGA 2LE8A 3AA6B 3IF8B 5KX5E 4OHFA 3AXJA 5EZYE 5IYZE 1M62A 2BKOA 4IGUA 2E9XC 4UIGA 4AQGA 2GK9A 3JCFA 3RYHE 4MLKA 4BJMA 4GYRA 4HN9A 3QB5A 3ZN0B 1BR1A 2NTYA 3T1YT 1KF6A 2FJDA 1VCSA 4LF8T 3PE0A 1D0YA 2NOXA 4JEHB 2BS2A 1HX1B 3BK9A 3TLSA 3B13A 5AQLB 1XMQT 3AAIA 2DI4A 5FY1A 5F3JA 3HA4A 4HWCA 2LEHA 4MALA 1MIYA 2RP4A 4UF0A 3RIUC 4HEAA 2WU5A 5AQMB 2N2NA 3P8CD 4ISTA 3GWHA 2BG9E 2FUPA 5L3EB 5LP6E 5IWAT 2UU9T 4ZS2A 4X62T 1D1BA 2WWVA 2XUEA 2LLYA 5FL0A 3ETVA 5LHHB 4P09A 5LG3A 5J1GA 4O2BE 1HX8A 4BA9A 4DVDA 1FMVA 2KLQA 1J1JA 1CUNA 2DHRA 4ZOLE 3ZMVB 4OYKA 4YHHT 4U2ZA 1UGOA 2VKJA 3CKDA 4EAHA 4EV6A 4LFAT 2A3DA 3K1SA 5HXCA 4ANJA 5LB7B 4HFCA 4UV9B 4KMCA 1SE7A 4AQYT 2WU2A 3N2OA 4HTEA 3AA1B 4U3CA 2ODVA 1V9DA 3O1HA 3NRYA 2LOPA 5JDFA 2CHOA 2LSIA 3C4ZA 5FY0A 1HS7A 4ERRA 3K3NA 2VWAA 5ABFB 2CPTA 3NKZA 4QWNB 3AE6A 3ZKRA 5AQSB 4CN4A 2XTLA 3I0QA 2LHNA 3I0OA 4LF7T 2JMHA 4HE8A 2H7OA 4P0BA 4YT0A 1WR6A 3RRCA 3ZYKA 2CXDA 3PJAA 4JI3T 2WBLA 3CQGB 3RYCE 4DV6T 2BBHA 2LSKA 4H63V 4JBWF 1FMWA 2SPCA 3N9MA 1UX4A 3UUXB 3UU3A 3AAEB 4CI1B 2QA7A 2FJEA 4PFOA 2EHOD 5JH7E 1R8IA 4CXWA 1IBLT 4EXTA 1D0ZA 2DWKA 1YD8G 2X9HA 4OK0A 2WSSV 3VU7H 3CMLA 4JUYA 3ZMUB 1FEWA 4DBRA 3AXJB 4B3TT 3F31A 5FMNA 4L0RA 3AEEA 1JNRA 2VKOA 2CLYC 2Q9QC 4PJNA 4TX5A 3N2KE 2K48A 4UVAB 2V7KA 4MHCA 3IBPA 5LYJE 2C5JA 4EOZB 2ZM8A 3DJBA 4JI4T 3TKLB 1CHUA 3CQXC 3GA8A 2Q9QA 4I0UA 4DR1T 1M7KA 1W0BA 2L8KA 3AVRA 3VR9A 1I6ZA 5LMNT 3O4XE 1ZV4X 4IIJE 4CXXA 3Q9DA 2UUBT 4LMLA 5JTGA 5CGMA 4OFZA 2JQ9A 2B1EA 3FZLB 4B3ST 3TLTA 2MTQA 5LOVE 3CWZB 3EDVA 5LG4A 4PK5A 5FXVA 2ZM6T 1SA0E 4O4HE 1N36T 2YOEA 3AEBA 5M4YA 2F4VT 3FB2A 4X65T 2IIUA 1KNPA 3DTOA 3AE3A 3M65A 3U3IA 4AKLA 1MIVA 3L8RA 2CRBA 3ANWA 4YTMA 2N9DA 2V6YB 4PJMA 1AJ3A 2ES0A 2X66A 5JDGA 2KXPB 4HFVA 3MKDA 4QKNA 4CN6A 5EK4A 4QXBB 4H9SE 3AE8A 3D0TA 5HEGA 1HF8A 5HXEA 1QSDA 2FBWA 2CA5A 2WMNA 5HXRA 5CFBA 2XHEB 4C90A 3ONXA 4GK5E 2DNXA 4EGWA 4YSXA 1D1CA 3L3PA 4U7YA 3C98B 2H89A 4WZXA 1MMNA 3PUSA 3FXEB 1MNEA 2J4GA 3PUYF 4HWIB 5AQOB 3RPUA 4ZI2D 5C2TA 5FL1A 4JI1T 3P4WA 1HFAA 1WYCA 2E9XD 2H7VC 4I4TE 2QRXA 4WW0A 2D9DA 4X1IE 1MNDA 4DV4T 3K3OA 4DV5T 1N33T 4AKHA 2OLTA 5LBMA 2PG8A 4NIQA 3AE4A 5FXWA 1W9RA 3KINB 4PFPA 4U7IA 1NWMX 3PU3A 2FJAA 2D0UA 5E0OA 2W2UA 2X9WA 5ABGA 1Z8UA 4PJJA 2LKGA 2XPKA 4QXHB 3ZYLA 2VK9A 4EZHA 4NXNT 5JRCB 4IE0A 4XAXB 2NTXA 4COFA 3VKHA 4DNDA 4IDQA 1KNRA 2PBIA 4MBQA 3RHWA 2MOZA 3N5LA 4IHJE 1MMDA 4EIWA 2V26A 4YLHA 4JI6T 3UFEA 1XZYA 2V6YA 3KV5A 4NXMT 3ZLIA 2ZLYA 2VVSA 3MJXA 3QOFA 3LDQB 3JC6C 5HCJA 3ZT7A 2V7LA 3ZYMA 5BR8T 4ZXLA 3N9PA 2W0GA 2BKNA 3BQIA 2VQET 4PJLA 5AQPB 4DR7T 3J9X1 5LA6E 2CBIA 5AQIB 3SFDA 3TLVA 4LMKA 1NAFA 5LHIB 5CA1E 2YDRA 4HWFA 4CN1A 4IE7A 1N32T 4DUYT 4BJNA 2KWHA 3N2GE 4ZI3C 5IUXA 4Z91A 2VB6A 1SUMB 2XJ7A 5F8PA 5CB4E 3CX6B 2KINB 4YJ2E 5ABEA 4V1Av 5AQKB 4DR4T 5JDHA 2MYSA 4CI3B 2E5LT 1BR4A 2BDEA 2XQAA 4E7SA 2X0LB 2LOSA 4Z90A 4I43B 4NUVA 1NENA 2X0YA 4U2YA 3SWHA 5ABFA 2XAFB 5JRCA 3IA3A 2C5IT 2V8SV 2KNDA 2G0UA 2YU1A 2E5VA 3H37A 3HKBE 4U72A 3UUNA 4O4LE 5JDLA 3VKGA 2MPKA 3S4UA 3KV4A 3UQ4A 3P50A 4TV8E 4ISSA 2LM9A 4X66T 4HFDA 4U31A 2K3WA 3LSVA 1T72A 2JMKA 4HFIA 3AEDA 4AISA 3NRXA 4LF5T 5FVKA 1OEDB 3PUZF 3FZFB 3NZPA 4FJOA 2BG9A 1G8XA 1HCIA 1T98A 2W4XA 1QUUA 5FYMA 3X1DA 4EEDA 1UX5A 4DV0T 2V6XA 3KVAA 2BG9C 4JI8T 2WP9A 2UXCT 3AEGA 5L4HA 3UU5A 4BAYB 2YKSA 4F8HA 4P1NA 2XQYA 3GMIA 3HR0A 3P7IA 3N9NA 3PDYA 2W62A 2JQKA 3LG7A 3O1IA 1XDPA 4I55E 4TN7B 2WDQA 4UV8B 4QH1A 1L0VA 1UUSA 4AQFC 2XQ4A 4ZZCA 1HR0T 2C5KT 2KT9A 3LBXB 5L3BB 2BVMA 3KFWX 5HEHA 4ZEYA 2QYWA 4CZZB 4KI0F 4O2AE 2CCQA 2XQ8A 5DABA 2KWIB 5KMGP 4XBFB 4ZI3D 1MMAA 2IAKA 1LKXA 2V1DB 1X9BA 4ZZBA 3LFMA 2JQQA 5HXSA 1XMOT 2VVNA 2KMFA 2EHOB 3Q5DA 4A56A 2XAJB 5JVDE 3ZJ1A 1W09A 3N9LA 3AE9A 3RQWA 4A97A 4TWFA 2M6IA 3PU8A 1IAPA 3FBZA 3QK6A 3IEEA 3UUMA 2PFVA 2J47A 2OA5A 1WRDA 1U4QA 2XQ7A 4X1KE 3RH3A 3V5SA 3WAKA 3ZC1A 5LJMA 1HNWT 2XAHB 3AECA 3ETUA 4IDPA 4TWHA 3ZCIA 4ASKA 4GKKT 2CXFA 3GN5A 4AIUA 5ABHA 5HEUA 5HXHA 1N34T 5AQJB 1ZP0A 5JDMA 3RLFF 3EVYA 3OJAA 1BR2A 4GOUA 2WCAA 4FI5A 4H9RC 2IC6A 3RKOA 2UUCT 4JEUB 2VQFT 3W15B 3MA9A 3UUBA 4G2AA 4WYVA 1LRZA 5HEJA 5LGNB 3ZCJA 1IJ6A 2KZ7B 3P4SA 5HWXA 5L3GB 5HEOA 2UXNB 4IE6A 4KP3C 3NZQA 1HNZT 1YKEB 3RC3A 5HYAA 4P0AA 4UF0B 3OVUA 4GIWA 4ILBA 1UURA 4KX6A 3RF1A 4AXPA 4TUYE 1Z0PA 4A98A 5AFUL 4LF6T 4LF9T 3SRZA 2DLRA 2YINA 1Y64B 4OX9T 1E2AA 3ANWB 4ZHQE 5FXZA 2PTFA 3C64A 3NVOA 3RGLA 1D1AA 1YQ4A 2BS3A 3Q5EA 3RIUA 3ZMTB 2IHR1 2Y6XA 2YDQA 3PUAA 1FJGT 5JR9C 2LRKA 3CIRA 4HKAA 3O1JA 3SS1A 3MACA 2WDVA 3RX6A 1EZ3A 4KUMB 4KHPT 1WLXA 2DCFA 2XQ9A 2BBJA 2XY8B 1G73A 1J5ET 4DMWA 4HFHA 4GKJT 2WY2A 4B6XA 2WB5A 2JJ9A 3AE2A 3UT5E 5CJ5A 1YKHB 3RC8A 2J62A 3LBXA 2UXBT 5C3JA 2LM2A 1JNZA 1FIOA 2CHNA 1ZHCA 1WFDA 4ILAA 2X51A 2MAWA 2RA1A 1HG2A 2HPLA 2LHRA 1IZNB 1ZEEA 2L3LA 2UXDT 5LBQB 4PW8A 1U5PA 5LGUB 4UVCB 3I1AA 4AKGA 3LK42 4B3RT 3DP7A 3MK7C 2EHOA 2W66A 3C50A 4G63A 4N78D 3ONJA 5DQWA 4DBQA 4CXYA 2ZMAA 4EYYR 2XQ5A 1BR0A 5FXXA 5LMUT 2VL8A 4M1PA 2JIWA 3JAFA 5J2TE 3CX7B 4NUUA 4UELA 5HAXA 4UEMA 4OYJA 4EYUA 4IREA 3KV9A 3QUJA 4CQIA 1GQEA 1SHZC 3GN5B 1X79A 2DWGA 4HWDA 4GYSA 5LCYA 2CXLA 3ZPOA 3VRAA 3Q5XA 3NBXX 3SOLA 3AE7A 4NPPA 4TNWA 4WNKA 4YXDA 3AAAB 3A8YC 2LKHA 3N9QA 1D0XA 2YU2A 3HI2A 2M67A 5AQVB 3TLUA 3ZT6A 1E1HB 4LMJA 1WYBA 5KDMC 4YY3T 2V7IA 5FNVE 3B57A 1YXRA 4KHZF 4UR9A 4X20E 3CX8B 4QHOA 3ZMSB 4AKRB 2CM0A 3AEAA 2W63A 3EABA 4H9NC 3UULA 3Q5WA 5BMVE 3JC6D 1LVKA 3G06A 3I9YA 1OXZA 4B3MT 3ZT5A 4F6RC 3RQUA 4H9PC 3UU6A 1W0AA 3OTOT 4AI6A 2JPFA 3E08A 2BKPA 3LJCA 1UCUA 4LFBT 1WR0A 2BS4A 4DR3T 2WZHA 2QVAA 2V7MA 2IW5B 3VRBA 3RIAA 3KVBA 2YEVC 2RPAA 4JV5T 5L47A 3QNUA 2V7JA 2C0SA 3PTRB 2AE9A 2ODUA 2CEAA 4Q25A 2XM2A 3KV6A 2D0TA 2Q9QB 2CLYB 3H3AA 2CWYA 3VR8A 2ACXA 4U33A 3M3ZB 3FZHB 2J1DG 5HWYA 3MZKB 4IL4A 4PK4A 2WS3A 2HN1A 3HKDE 5AQGB 4JI2T 1VRBA 2R6GF 5TAOA 5AQFB 1OWAA 5DQVA 1O3XA 1T7SA 3AA7B 4X5TA 1ZOYA 2XQ3A 3PJAJ 3QC9A 4HWHA 1XNQT 2M6BA 1XNRT 1UK5A 3AA0B 4AQFA 3ZSSA 3U78A 1IBKT 1KNZA 3E22E 3ZEFB 3ABVA 3EDUA 2XSBA 4QXCB 1QLBA 5AQQB 2HH7A 3EUHA 3PV0F 3AE5A 4L9IA 4E7ZA 1DU2A 3F2EA 3HKEE 1XDOA 2CWOA 2XM1A 2NW7A 1WCRA 3ZC0A 3UU4A 5J0ZA 2NWBA 2P9BA 3CQCB 4IE5A 4U74A 3AE1A 2A9UA 2H3RA 2L9QA 3OBVE 3FZMB 5LNKA 2OV9A 2E9XA 4QH5A 2NW8A 5EK3A 5GONE 5AQRB 2FJBA 1T8BA 3A7MA 2CBJA 3B5MA 3QB5K 5AQHB 5L4EA 4DV1T 1YQ3A 2WWUA 3A5XA 3EHZA 4YJ3E 5LHGB 2WZIA 4WBOA 4PAGA 3UU8A 5JDQA 3OKQA 3F57A 3MXZA 2X0HA 4Z8XA 2XQ6A 1IJ5A 2WQYA 5JQGE 2VL0A 2X67A 5H6QB 1J5WA 4K0UA 5FY7A 5H6RB 2DL1A 5JR9A 4H63H 4ADZA 1KFYA 1H7CA 1HG5A 4YSZA 5HCMA 5KXJA 3FXDB 3PUWF 4HFBA 2K9AA 4O8SA 4YFSA 5A1LA 3PUXF 4ILCA 4DUZT 2XAGB 3L39A 5FP3A 2EHOC 1ZKEA 2NP9A 3OPCA 4JYAT 4H9OC 4ZI7E 1XWMA 1OEDE 3H3MA 3I9WA 5ETWA 3R6NA 3VHLA 3ZN1B 2KSRA 4QX8B 5LGTB 4X64T 3SFEA 2IDOB 4L5GA 1LVFA 2HPJA 2IMLA 2VKDA 3CPZA 5EK2A 3WI3A 2LSGA 5DJQC 4O4JE 4WBNE 4YTNA 1S35A 2N1GA 2UXXB 3P4PA 4KBMB 4IT4A 4YHJA 3C4XA 4XZCA 2YDSA 2LSJA 2PJQA 4TV9E 1OEDC 2W61A 2XZEA 3LK2B 4EZ4A 4DV7T 2E9XB 4K0KT 2XSAA 3P4RA 5ADXL 2ZM2A 2NR4A 1OEDA 1E7PA 3CVRA 4YSYA 2V5DA 4DV3T 2BG9B 3BQLA 4IDNA 4EEBA 3ZJ2A 3N9OA 5JDNA 1Y01A 4DV2T 1I94T 1IBMT 3T8OA 2VURA 4IDOA 4PNIA 2WDRA 3AVSA 2IC9A 5AQUB 5L2LA 2BZBA 5FKYA 5JREA 4LFCT 2D5UA 3E0ZA 2WM9A 4HGAA 3RIFA 2W00A 4DR5T 2CMRA 4QH4A 5CA0E 2A2FX 3JAEA 3JADA 4IE4A 1KEYA 2X68A 2E8IA 3EI0A 4GK0E 3ZSTA 3K3QC 4CI2B 4ZI2C 2V5CA 2JRKA 2Y48B 2VKHA 2LJLA 4DR2T 4H9QC 3T1HT 2HN2A 3UTKA 4JI7T 3HL6A 4IL9A 3PURA 2HHHT 3L09A 3V5UA 2IUBA 4QX7B 4TNVA 4C91A 4ILUA 4TZ4C 5FVLA 3UQ7A 2K5BB 2ACZA 2QGSA 2A72A 3FBLA 3PUGA 3PUVF 4UXNB 3ZMZB 2D2SA 4ZS3A 2Q9QD 4O4IE 4PK6A 3R84B 2JQHA 1HTJF 1MMGA 3FZKB 1MIWA 1S94A 3HKCE 1B7TA 2YK0A 4IDZA 3C4WA 2W67A 3WAJA 4LF4T 2CE7A 4X1YE 4AKIA 2LSYA 1US7B 3RKGA 1VOMA 4EB6E 5L3FB 2MBGA 5IHYA 3BQKA 1YW0A
chains in the Genus database with same CATH topology
5JR9B 3RYIE 5L3DB 3K8PC 3AB3B 4JLEA 3C51A 2ZM0A 3IHRA 2WMOA 5C8YE 3RYFE 2BVLA 4MFRA 5J2UE 2WAUA 3PUQA 4UVBB 1KK7A 3Q2MA 4DO0A 3J7Yq 2VASA 3OYZA 3FHNA 4DMVA 5L3CB 2K24A 2NW9A 3KDSE 2XAQB 3O9XA 3KBUA 3KBTA 5LXTE 2LT3A 2Z6EA 3LK3B 3ESLA 2I59A 2X9XA 4I50E 4J2CA 3OYXA 3RRWA 2XASB 2Y8DA 2X9YA 5KX5E 2LE8A 3AA6B 3IF8B 4OHFA 5EZYE 5IYZE 4IGUA 2E9XC 4UIGA 4AQGA 2GK9A 3RYHE 4MLKA 4BJMA 4GYRA 4HN9A 3ZN0B 1BR1A 2NTYA 3PE0A 1D0YA 2NOXA 4JEHB 3BK9A 1YW0A 3B13A 3AAIA 2DI4A 5FY1A 5F3JA 3HA4A 2LEHA 4MALA 1MIYA 2RP4A 4UF0A 4HEAA 2N2NA 3P8CD 4ISTA 3GWHA 5L3EB 5LP6E 1D1BA 2XUEA 5LHHB 4P09A 5J1GA 4O2BE 1HX8A 4BA9A 4DVDA 1FMVA 2KLQA 1CUNA 2DHRA 4ZOLE 3ZMVB 4OYKA 2VKJA 3CKDA 4EAHA 2A3DA 5HXCA 4ANJA 4UV9B 4KMCA 3N2OA 4HTEA 3AA1B 2ODVA 1V9DA 3O1HA 3NRYA 2LOPA 5JDFA 2LSIA 3C4ZA 5FY0A 4ERRA 3K3NA 2VWAA 4QWNB 2XTLA 3I0QA 2LHNA 3I0OA 2JMHA 4HE8A 2H7OA 4P0BA 1WR6A 3RRCA 3ZYKA 2CXDA 2WBLA 3CQGB 3RYCE 1HS7A 2LSKA 4H63V 1FMWA 2SPCA 3N9MA 1UX4A 3UUXB 4CI1B 3AAEB 5JH7E 2QA7A 4PFOA 2EHOD 4CXWA 4EXTA 1D0ZA 2DWKA 1YD8G 2X9HA 4OK0A 2WSSV 3VU7H 3CMLA 4JUYA 3ZMUB 1FEWA 4DBRA 3F31A 5FMNA 4L0RA 2VKOA 2CLYC 2Q9QC 4PJNA 4TX5A 3N2KE 2K48A 4UVAB 2V7KA 4MHCA 3IBPA 5LYJE 2C5JA 2ZM8A 3DJBA 3TKLB 3CQXC 3GA8A 2Q9QA 2L8KA 3AVRA 3O4XE 1ZV4X 4IIJE 4CXXA 3Q9DA 4OFZA 2B1EA 2MTQA 5LOVE 3CWZB 3EDVA 5LG4A 4PK5A 5FXVA 1SA0E 5M4YA 3FB2A 3DTOA 3M65A 3U3IA 4AKLA 1MIVA 3ANWA 2N9DA 4PJMA 1AJ3A 2ES0A 2X66A 5JDGA 2KXPB 4HFVA 3MKDA 4QKNA 5EK4A 4QXBB 4H9SE 3D0TA 5HXEA 1HF8A 1QSDA 2CA5A 2WMNA 5HXRA 2XHEB 4C90A 3ONXA 4GK5E 2DNXA 1D1CA 3L3PA 3C98B 4EOZB 1MMNA 3PUSA 3FXEB 1MNEA 3RPUA 4ZI2D 4I4TE 1HFAA 1WYCA 2E9XD 2H7VC 4WW0A 4X1IE 1MNDA 3K3OA 4AKHA 5LBMA 2PG8A 5FXWA 3KINB 4PFPA 1NWMX 3PU3A 2D0UA 5E0OA 2X9WA 4EZHA 4PJJA 4QXHB 3ZYLA 5LJNA 5JRCB 2VK9A 4IE0A 4XAXB 2NTXA 3VKHA 4DNDA 2PBIA 4EIWA 4MBQA 2MOZA 3N5LA 4IHJE 1MMDA 2V26A 4YLHA 3UFEA 3KV5A 3ZLIA 2ZLYA 3MJXA 3JC6C 2V7LA 3ZYMA 3N9PA 2W0GA 3BQIA 4PJLA 3J9X1 5LA6E 5LHIB 1NAFA 5CA1E 4IE7A 4BJNA 2KWHA 3N2GE 4ZI3C 2VB6A 5F8PA 5CB4E 3CX6B 2KINB 4YJ2E 4V1Av 5JDHA 2MYSA 4CI3B 1BR4A 2BDEA 4E7SA 2X0LB 2LOSA 4I43B 4NUVA 3SWHA 2XAFB 5JRCA 3UT5E 2C5IT 2YU1A 2KNDA 2G0UA 3H37A 3HKBE 3UUNA 5ADXL 4U72A 5JDLA 4O4LE 3VKGA 3S4UA 3KV4A 4TV8E 4ISSA 2LM9A 2JMKA 3NRXA 4FJOA 3NZPA 1G8XA 1HCIA 1T98A 1QUUA 5FYMA 1UX5A 3KVAA 4BAYB 2XQYA 3GMIA 3HR0A 3P7IA 3N9NA 3PDYA 2W62A 3LG7A 3O1IA 4I55E 4TN7B 4UV8B 4P0AA 4AQFC 2C5KT 2KT9A 3LBXB 5L3BB 2BVMA 3KFWX 4CZZB 4O2AE 5KMGP 2CCQA 4XBFB 5DABA 2KWIB 4ZI3D 1MMAA 2IAKA 1LKXA 2V1DB 5HXSA 3LFMA 2JQQA 2KMFA 2EHOB 4A56A 2XAJB 5JVDE 3ZJ1A 3N9LA 3PU8A 1IAPA 3FBZA 3QK6A 3IEEA 3UUMA 2PFVA 2OA5A 4X1KE 1WRDA 1U4QA 3RH3A 3WAKA 3V5SA 3ZC1A 5LJMA 2XAHB 3ETUA 4ASKA 3ZCIA 2CXFA 3GN5A 5HXHA 5JDMA 3EVYA 3OJAA 1BR2A 4GOUA 4FI5A 4H9RC 2IC6A 3RKOA 4JEUB 3W15B 3MA9A 4G2AA 1LRZA 5LGNB 3ZCJA 1IJ6A 2KZ7B 5HWXA 5L3GB 2UXNB 4IE6A 4KP3C 3NZQA 1YKEB 3RC3A 5HYAA 4UF0B 4GIWA 5AFUL 4AXPA 4TUYE 1Z0PA 3SRZA 2DLRA 2YINA 1Y64B 3ANWB 4ZHQE 5FXZA 3C64A 1D1AA 3ZMTB 2Y6XA 3PUAA 5JR9C 4HKAA 3O1JA 3SS1A 3MACA 3RX6A 1EZ3A 4KUMB 1WLXA 2DCFA 1G73A 4DMWA 4B6XA 3RC8A 2JJ9A 1YKHB 3LBXA 1FIOA 4O4HE 1ZHCA 2X51A 2RA1A 1HG2A 2HPLA 2LHRA 1ZEEA 1IZNB 2L3LA 5LBQB 4PW8A 1U5PA 5LGUB 4UVCB 3I1AA 4AKGA 3LK42 3DP7A 3MK7C 2EHOA 3C50A 4G63A 4N78D 5DQWA 4DBQA 4CXYA 2ZMAA 4EYYR 1BR0A 5FXXA 2VL8A 4M1PA 5J2TE 3CX7B 4NUUA 4UELA 5HAXA 4UEMA 4OYJA 4EYUA 3KV9A 3QUJA 4CQIA 1SHZC 3GN5B 1X79A 2DWGA 5LCYA 4GYSA 2CXLA 3ZPOA 3Q5XA 3NBXX 3SOLA 4WNKA 3AAAB 3N9QA 1D0XA 2YU2A 3HI2A 2M67A 1E1HB 1WYBA 5KDMC 2V7IA 5FNVE 3B57A 4X20E 3CX8B 3ZMSB 4AKRB 2CM0A 4H9NC 2W63A 3UULA 5BMVE 3Q5WA 3JC6D 1LVKA 3I9YA 1OXZA 4F6RC 4H9PC 4AI6A 2JPFA 3E08A 3LJCA 1UCUA 2V7MA 2IW5B 3KVBA 2YEVC 2V7JA 2C0SA 3PTRB 2ODUA 2CEAA 3KV6A 2D0TA 2Q9QB 2CLYB 3H3AA 2CWYA 2ACXA 2J1DG 5HWYA 3MZKB 4PK4A 3HKDE 1VRBA 5TAOA 1OWAA 5DQVA 1O3XA 3AA7B 3QC9A 3AA0B 4AQFA 1KNZA 3U78A 3E22E 3ZEFB 3EDUA 4QXCB 2HH7A 3EUHA 4L9IA 4E7ZA 3F2EA 3HKEE 2CWOA 2NW7A 3ZC0A 2NWBA 2P9BA 3CQCB 4IE5A 4U74A 2H3RA 3OBVE 2L9QA 5LNKA 2E9XA 2NW8A 5EK3A 5GONE 2WWUA 3A5XA 4YJ3E 5LHGB 4WBOA 4PAGA 5JDQA 3OKQA 3F57A 3MXZA 4Z8XA 1IJ5A 5JQGE 2X67A 5H6QB 4K0UA 5FY7A 5H6RB 5JR9A 4ADZA 4H63H 1H7CA 1HG5A 3FXDB 4O8SA 4YFSA 2K9AA 5A1LA 2XAGB 5FP3A 2EHOC 1ZKEA 2NP9A 4H9OC 4ZI7E 3I9WA 3VHLA 3ZN1B 5ETWA 3R6NA 5LGTB 4QX8B 4L5GA 1LVFA 2HPJA 2VKDA 3CPZA 5EK2A 3WI3A 2LSGA 5DJQC 4O4JE 4WBNE 1S35A 2N1GA 2UXXB 4KBMB 4YHJA 4ZS2A 3C4XA 4XZCA 2LSJA 2PJQA 4TV9E 2W61A 3LK2B 4EZ4A 2E9XB 2ZM2A 3CVRA 3BQLA 3ZJ2A 3N9OA 5JDNA 3T8OA 4PNIA 3AVSA 2IC9A 5L2LA 2BZBA 5JREA 2D5UA 3E0ZA 2WM9A 4HGAA 2W00A 2CMRA 5CA0E 2A2FX 4IE4A 2X68A 2E8IA 4GK0E 3K3QC 4CI2B 4ZI2C 2JRKA 2Y48B 2VKHA 2LJLA 4H9QC 3UTKA 3HL6A 3PURA 3L09A 3V5UA 4QX7B 4C91A 4ILUA 4TZ4C 2K5BB 2QGSA 2A72A 3FBLA 3PUGA 4UXNB 3ZMZB 2D2SA 4ZS3A 2Q9QD 4O4IE 4PK6A 3R84B 1HTJF 1MMGA 4QHOA 1MIWA 1S94A 3HKCE 1B7TA 2YK0A 4IDZA 3C4WA 3WAJA 2CE7A 4X1YE 4AKIA 2LSYA 1US7B 4EB6E 1VOMA 5L3FB 2MBGA 5IHYA 3BQKA 3ETVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5F3J A;  3CML A;  4YFS A;  2YK0 A;  4NUU A;  3C64 A;  2Y8D A;  3BQL A;  3CPZ A;  4NUV A;  3RRC A;  3BQK A;  3BQI A;  2WAU A; 
#chains in the Genus database with same CATH topology
 1NEK A;  1VCT A;  4TWD A;  5AQN B;  3RI5 A;  3RYI E;  4A5X A;  3K8P C;  3AB3 B;  4JLE A;  5JR9 B;  5L3D B;  3P4Q A;  4JI0 T;  4HFE A;  2LRL A;  3C51 A;  2I6H A;  2ZM0 A;  3IHR A;  2WMO A;  3TLW A;  5C8Y E;  5AQT B;  2BVL A;  4MFR A;  3EAM A;  3RYF E;  2WAU A;  3PUQ A;  4UVB B;  1KK7 A;  5J2U E;  3Q2M A;  4DO0 A;  3AEF A;  5LJN A;  3J7Y q;  4DR6 T;  2VAS A;  3OYZ A;  3FHN A;  4DMV A;  5L3C B;  3NWI A;  2K24 A;  2NW9 A;  4YTP A;  3KDS E;  2XAQ B;  2E2A A;  4JI5 T;  3O9X A;  2YN6 A;  3KBU A;  3KBT A;  5LXT E;  2LT3 A;  2H88 A;  2Z6E A;  3LK3 B;  3ESL A;  2I59 A;  5F5W A;  3CK6 A;  2AXD S;  2X9X A;  4DID B;  4I50 E;  4J2C A;  3OYX A;  3RRW A;  2XAS B;  3ONL C;  1HNX T;  2Y8D A;  2UUA T;  2I0M A;  2X9Y A;  2B76 A;  3UFG A;  2LE8 A;  3AA6 B;  3IF8 B;  5KX5 E;  4OHF A;  3AXJ A;  5EZY E;  5IYZ E;  1M62 A;  2BKO A;  4IGU A;  2E9X C;  4UIG A;  4AQG A;  2GK9 A;  3JCF A;  3RYH E;  4MLK A;  4BJM A;  4GYR A;  4HN9 A;  3QB5 A;  3ZN0 B;  1BR1 A;  2NTY A;  3T1Y T;  1KF6 A;  2FJD A;  1VCS A;  4LF8 T;  3PE0 A;  1D0Y A;  2NOX A;  4JEH B;  2BS2 A;  1HX1 B;  3BK9 A;  3TLS A;  3B13 A;  5AQL B;  1XMQ T;  3AAI A;  2DI4 A;  5FY1 A;  5F3J A;  3HA4 A;  4HWC A;  2LEH A;  4MAL A;  1MIY A;  2RP4 A;  4UF0 A;  3RIU C;  4HEA A;  2WU5 A;  5AQM B;  2N2N A;  3P8C D;  4IST A;  3GWH A;  2BG9 E;  2FUP A;  5L3E B;  5LP6 E;  5IWA T;  2UU9 T;  4ZS2 A;  4X62 T;  1D1B A;  2WWV A;  2XUE A;  2LLY A;  5FL0 A;  3ETV A;  5LHH B;  4P09 A;  5LG3 A;  5J1G A;  4O2B E;  1HX8 A;  4BA9 A;  4DVD A;  1FMV A;  2KLQ A;  1J1J A;  1CUN A;  2DHR A;  4ZOL E;  3ZMV B;  4OYK A;  4YHH T;  4U2Z A;  1UGO A;  2VKJ A;  3CKD A;  4EAH A;  4EV6 A;  4LFA T;  2A3D A;  3K1S A;  5HXC A;  4ANJ A;  5LB7 B;  4HFC A;  4UV9 B;  4KMC A;  1SE7 A;  4AQY T;  2WU2 A;  3N2O A;  4HTE A;  3AA1 B;  4U3C A;  2ODV A;  1V9D A;  3O1H A;  3NRY A;  2LOP A;  5JDF A;  2CHO A;  2LSI A;  3C4Z A;  5FY0 A;  1HS7 A;  4ERR A;  3K3N A;  2VWA A;  5ABF B;  2CPT A;  3NKZ A;  4QWN B;  3AE6 A;  3ZKR A;  5AQS B;  4CN4 A;  2XTL A;  3I0Q A;  2LHN A;  3I0O A;  4LF7 T;  2JMH A;  4HE8 A;  2H7O A;  4P0B A;  4YT0 A;  1WR6 A;  3RRC A;  3ZYK A;  2CXD A;  3PJA A;  4JI3 T;  2WBL A;  3CQG B;  3RYC E;  4DV6 T;  2BBH A;  2LSK A;  4H63 V;  4JBW F;  1FMW A;  2SPC A;  3N9M A;  1UX4 A;  3UUX B;  3UU3 A;  3AAE B;  4CI1 B;  2QA7 A;  2FJE A;  4PFO A;  2EHO D;  5JH7 E;  1R8I A;  4CXW A;  1IBL T;  4EXT A;  1D0Z A;  2DWK A;  1YD8 G;  2X9H A;  4OK0 A;  2WSS V;  3VU7 H;  3CML A;  4JUY A;  3ZMU B;  1FEW A;  4DBR A;  3AXJ B;  4B3T T;  3F31 A;  5FMN A;  4L0R A;  3AEE A;  1JNR A;  2VKO A;  2CLY C;  2Q9Q C;  4PJN A;  4TX5 A;  3N2K E;  2K48 A;  4UVA B;  2V7K A;  4MHC A;  3IBP A;  5LYJ E;  2C5J A;  4EOZ B;  2ZM8 A;  3DJB A;  4JI4 T;  3TKL B;  1CHU A;  3CQX C;  3GA8 A;  2Q9Q A;  4I0U A;  4DR1 T;  1M7K A;  1W0B A;  2L8K A;  3AVR A;  3VR9 A;  1I6Z A;  5LMN T;  3O4X E;  1ZV4 X;  4IIJ E;  4CXX A;  3Q9D A;  2UUB T;  4LML A;  5JTG A;  5CGM A;  4OFZ A;  2JQ9 A;  2B1E A;  3FZL B;  4B3S T;  3TLT A;  2MTQ A;  5LOV E;  3CWZ B;  3EDV A;  5LG4 A;  4PK5 A;  5FXV A;  2ZM6 T;  1SA0 E;  4O4H E;  1N36 T;  2YOE A;  3AEB A;  5M4Y A;  2F4V T;  3FB2 A;  4X65 T;  2IIU A;  1KNP A;  3DTO A;  3AE3 A;  3M65 A;  3U3I A;  4AKL A;  1MIV A;  3L8R A;  2CRB A;  3ANW A;  4YTM A;  2N9D A;  2V6Y B;  4PJM A;  1AJ3 A;  2ES0 A;  2X66 A;  5JDG A;  2KXP B;  4HFV A;  3MKD A;  4QKN A;  4CN6 A;  5EK4 A;  4QXB B;  4H9S E;  3AE8 A;  3D0T A;  5HEG A;  1HF8 A;  5HXE A;  1QSD A;  2FBW A;  2CA5 A;  2WMN A;  5HXR A;  5CFB A;  2XHE B;  4C90 A;  3ONX A;  4GK5 E;  2DNX A;  4EGW A;  4YSX A;  1D1C A;  3L3P A;  4U7Y A;  3C98 B;  2H89 A;  4WZX A;  1MMN A;  3PUS A;  3FXE B;  1MNE A;  2J4G A;  3PUY F;  4HWI B;  5AQO B;  3RPU A;  4ZI2 D;  5C2T A;  5FL1 A;  4JI1 T;  3P4W A;  1HFA A;  1WYC A;  2E9X D;  2H7V C;  4I4T E;  2QRX A;  4WW0 A;  2D9D A;  4X1I E;  1MND A;  4DV4 T;  3K3O A;  4DV5 T;  1N33 T;  4AKH A;  2OLT A;  5LBM A;  2PG8 A;  4NIQ A;  3AE4 A;  5FXW A;  1W9R A;  3KIN B;  4PFP A;  4U7I A;  1NWM X;  3PU3 A;  2FJA A;  2D0U A;  5E0O A;  2W2U A;  2X9W A;  5ABG A;  1Z8U A;  4PJJ A;  2LKG A;  2XPK A;  4QXH B;  3ZYL A;  2VK9 A;  4EZH A;  4NXN T;  5JRC B;  4IE0 A;  4XAX B;  2NTX A;  4COF A;  3VKH A;  4DND A;  4IDQ A;  1KNR A;  2PBI A;  4MBQ A;  3RHW A;  2MOZ A;  3N5L A;  4IHJ E;  1MMD A;  4EIW A;  2V26 A;  4YLH A;  4JI6 T;  3UFE A;  1XZY A;  2V6Y A;  3KV5 A;  4NXM T;  3ZLI A;  2ZLY A;  2VVS A;  3MJX A;  3QOF A;  3LDQ B;  3JC6 C;  5HCJ A;  3ZT7 A;  2V7L A;  3ZYM A;  5BR8 T;  4ZXL A;  3N9P A;  2W0G A;  2BKN A;  3BQI A;  2VQE T;  4PJL A;  5AQP B;  4DR7 T;  3J9X 1;  5LA6 E;  2CBI A;  5AQI B;  3SFD A;  3TLV A;  4LMK A;  1NAF A;  5LHI B;  5CA1 E;  2YDR A;  4HWF A;  4CN1 A;  4IE7 A;  1N32 T;  4DUY T;  4BJN A;  2KWH A;  3N2G E;  4ZI3 C;  5IUX A;  4Z91 A;  2VB6 A;  1SUM B;  2XJ7 A;  5F8P A;  5CB4 E;  3CX6 B;  2KIN B;  4YJ2 E;  5ABE A;  4V1A v;  5AQK B;  4DR4 T;  5JDH A;  2MYS A;  4CI3 B;  2E5L T;  1BR4 A;  2BDE A;  2XQA A;  4E7S A;  2X0L B;  2LOS A;  4Z90 A;  4I43 B;  4NUV A;  1NEN A;  2X0Y A;  4U2Y A;  3SWH A;  5ABF A;  2XAF B;  5JRC A;  3IA3 A;  2C5I T;  2V8S V;  2KND A;  2G0U A;  2YU1 A;  2E5V A;  3H37 A;  3HKB E;  4U72 A;  3UUN A;  4O4L E;  5JDL A;  3VKG A;  2MPK A;  3S4U A;  3KV4 A;  3UQ4 A;  3P50 A;  4TV8 E;  4ISS A;  2LM9 A;  4X66 T;  4HFD A;  4U31 A;  2K3W A;  3LSV A;  1T72 A;  2JMK A;  4HFI A;  3AED A;  4AIS A;  3NRX A;  4LF5 T;  5FVK A;  1OED B;  3PUZ F;  3FZF B;  3NZP A;  4FJO A;  2BG9 A;  1G8X A;  1HCI A;  1T98 A;  2W4X A;  1QUU A;  5FYM A;  3X1D A;  4EED A;  1UX5 A;  4DV0 T;  2V6X A;  3KVA A;  2BG9 C;  4JI8 T;  2WP9 A;  2UXC T;  3AEG A;  5L4H A;  3UU5 A;  4BAY B;  2YKS A;  4F8H A;  4P1N A;  2XQY A;  3GMI A;  3HR0 A;  3P7I A;  3N9N A;  3PDY A;  2W62 A;  2JQK A;  3LG7 A;  3O1I A;  1XDP A;  4I55 E;  4TN7 B;  2WDQ A;  4UV8 B;  4QH1 A;  1L0V A;  1UUS A;  4AQF C;  2XQ4 A;  4ZZC A;  1HR0 T;  2C5K T;  2KT9 A;  3LBX B;  5L3B B;  2BVM A;  3KFW X;  5HEH A;  4ZEY A;  2QYW A;  4CZZ B;  4KI0 F;  4O2A E;  2CCQ A;  2XQ8 A;  5DAB A;  2KWI B;  5KMG P;  4XBF B;  4ZI3 D;  1MMA A;  2IAK A;  1LKX A;  2V1D B;  1X9B A;  4ZZB A;  3LFM A;  2JQQ A;  5HXS A;  1XMO T;  2VVN A;  2KMF A;  2EHO B;  3Q5D A;  4A56 A;  2XAJ B;  5JVD E;  3ZJ1 A;  1W09 A;  3N9L A;  3AE9 A;  3RQW A;  4A97 A;  4TWF A;  2M6I A;  3PU8 A;  1IAP A;  3FBZ A;  3QK6 A;  3IEE A;  3UUM A;  2PFV A;  2J47 A;  2OA5 A;  1WRD A;  1U4Q A;  2XQ7 A;  4X1K E;  3RH3 A;  3V5S A;  3WAK A;  3ZC1 A;  5LJM A;  1HNW T;  2XAH B;  3AEC A;  3ETU A;  4IDP A;  4TWH A;  3ZCI A;  4ASK A;  4GKK T;  2CXF A;  3GN5 A;  4AIU A;  5ABH A;  5HEU A;  5HXH A;  1N34 T;  5AQJ B;  1ZP0 A;  5JDM A;  3RLF F;  3EVY A;  3OJA A;  1BR2 A;  4GOU A;  2WCA A;  4FI5 A;  4H9R C;  2IC6 A;  3RKO A;  2UUC T;  4JEU B;  2VQF T;  3W15 B;  3MA9 A;  3UUB A;  4G2A A;  4WYV A;  1LRZ A;  5HEJ A;  5LGN B;  3ZCJ A;  1IJ6 A;  2KZ7 B;  3P4S A;  5HWX A;  5L3G B;  5HEO A;  2UXN B;  4IE6 A;  4KP3 C;  3NZQ A;  1HNZ T;  1YKE B;  3RC3 A;  5HYA A;  4P0A A;  4UF0 B;  3OVU A;  4GIW A;  4ILB A;  1UUR A;  4KX6 A;  3RF1 A;  4AXP A;  4TUY E;  1Z0P A;  4A98 A;  5AFU L;  4LF6 T;  4LF9 T;  3SRZ A;  2DLR A;  2YIN A;  1Y64 B;  4OX9 T;  1E2A A;  3ANW B;  4ZHQ E;  5FXZ A;  2PTF A;  3C64 A;  3NVO A;  3RGL A;  1D1A A;  1YQ4 A;  2BS3 A;  3Q5E A;  3RIU A;  3ZMT B;  2IHR 1;  2Y6X A;  2YDQ A;  3PUA A;  1FJG T;  5JR9 C;  2LRK A;  3CIR A;  4HKA A;  3O1J A;  3SS1 A;  3MAC A;  2WDV A;  3RX6 A;  1EZ3 A;  4KUM B;  4KHP T;  1WLX A;  2DCF A;  2XQ9 A;  2BBJ A;  2XY8 B;  1G73 A;  1J5E T;  4DMW A;  4HFH A;  4GKJ T;  2WY2 A;  4B6X A;  2WB5 A;  2JJ9 A;  3AE2 A;  3UT5 E;  5CJ5 A;  1YKH B;  3RC8 A;  2J62 A;  3LBX A;  2UXB T;  5C3J A;  2LM2 A;  1JNZ A;  1FIO A;  2CHN A;  1ZHC A;  1WFD A;  4ILA A;  2X51 A;  2MAW A;  2RA1 A;  1HG2 A;  2HPL A;  2LHR A;  1IZN B;  1ZEE A;  2L3L A;  2UXD T;  5LBQ B;  4PW8 A;  1U5P A;  5LGU B;  4UVC B;  3I1A A;  4AKG A;  3LK4 2;  4B3R T;  3DP7 A;  3MK7 C;  2EHO A;  2W66 A;  3C50 A;  4G63 A;  4N78 D;  3ONJ A;  5DQW A;  4DBQ A;  4CXY A;  2ZMA A;  4EYY R;  2XQ5 A;  1BR0 A;  5FXX A;  5LMU T;  2VL8 A;  4M1P A;  2JIW A;  3JAF A;  5J2T E;  3CX7 B;  4NUU A;  4UEL A;  5HAX A;  4UEM A;  4OYJ A;  4EYU A;  4IRE A;  3KV9 A;  3QUJ A;  4CQI A;  1GQE A;  1SHZ C;  3GN5 B;  1X79 A;  2DWG A;  4HWD A;  4GYS A;  5LCY A;  2CXL A;  3ZPO A;  3VRA A;  3Q5X A;  3NBX X;  3SOL A;  3AE7 A;  4NPP A;  4TNW A;  4WNK A;  4YXD A;  3AAA B;  3A8Y C;  2LKH A;  3N9Q A;  1D0X A;  2YU2 A;  3HI2 A;  2M67 A;  5AQV B;  3TLU A;  3ZT6 A;  1E1H B;  4LMJ A;  1WYB A;  5KDM C;  4YY3 T;  2V7I A;  5FNV E;  3B57 A;  1YXR A;  4KHZ F;  4UR9 A;  4X20 E;  3CX8 B;  4QHO A;  3ZMS B;  4AKR B;  2CM0 A;  3AEA A;  2W63 A;  3EAB A;  4H9N C;  3UUL A;  3Q5W A;  5BMV E;  3JC6 D;  1LVK A;  3G06 A;  3I9Y A;  1OXZ A;  4B3M T;  3ZT5 A;  4F6R C;  3RQU A;  4H9P C;  3UU6 A;  1W0A A;  3OTO T;  4AI6 A;  2JPF A;  3E08 A;  2BKP A;  3LJC A;  1UCU A;  4LFB T;  1WR0 A;  2BS4 A;  4DR3 T;  2WZH A;  2QVA A;  2V7M A;  2IW5 B;  3VRB A;  3RIA A;  3KVB A;  2YEV C;  2RPA A;  4JV5 T;  5L47 A;  3QNU A;  2V7J A;  2C0S A;  3PTR B;  2AE9 A;  2ODU A;  2CEA A;  4Q25 A;  2XM2 A;  3KV6 A;  2D0T A;  2Q9Q B;  2CLY B;  3H3A A;  2CWY A;  3VR8 A;  2ACX A;  4U33 A;  3M3Z B;  3FZH B;  2J1D G;  5HWY A;  3MZK B;  4IL4 A;  4PK4 A;  2WS3 A;  2HN1 A;  3HKD E;  5AQG B;  4JI2 T;  1VRB A;  2R6G F;  5TAO A;  5AQF B;  1OWA A;  5DQV A;  1O3X A;  1T7S A;  3AA7 B;  4X5T A;  1ZOY A;  2XQ3 A;  3PJA J;  3QC9 A;  4HWH A;  1XNQ T;  2M6B A;  1XNR T;  1UK5 A;  3AA0 B;  4AQF A;  3ZSS A;  3U78 A;  1IBK T;  1KNZ A;  3E22 E;  3ZEF B;  3ABV A;  3EDU A;  2XSB A;  4QXC B;  1QLB A;  5AQQ B;  2HH7 A;  3EUH A;  3PV0 F;  3AE5 A;  4L9I A;  4E7Z A;  1DU2 A;  3F2E A;  3HKE E;  1XDO A;  2CWO A;  2XM1 A;  2NW7 A;  1WCR A;  3ZC0 A;  3UU4 A;  5J0Z A;  2NWB A;  2P9B A;  3CQC B;  4IE5 A;  4U74 A;  3AE1 A;  2A9U A;  2H3R A;  2L9Q A;  3OBV E;  3FZM B;  5LNK A;  2OV9 A;  2E9X A;  4QH5 A;  2NW8 A;  5EK3 A;  5GON E;  5AQR B;  2FJB A;  1T8B A;  3A7M A;  2CBJ A;  3B5M A;  3QB5 K;  5AQH B;  5L4E A;  4DV1 T;  1YQ3 A;  2WWU A;  3A5X A;  3EHZ A;  4YJ3 E;  5LHG B;  2WZI A;  4WBO A;  4PAG A;  3UU8 A;  5JDQ A;  3OKQ A;  3F57 A;  3MXZ A;  2X0H A;  4Z8X A;  2XQ6 A;  1IJ5 A;  2WQY A;  5JQG E;  2VL0 A;  2X67 A;  5H6Q B;  1J5W A;  4K0U A;  5FY7 A;  5H6R B;  2DL1 A;  5JR9 A;  4H63 H;  4ADZ A;  1KFY A;  1H7C A;  1HG5 A;  4YSZ A;  5HCM A;  5KXJ A;  3FXD B;  3PUW F;  4HFB A;  2K9A A;  4O8S A;  4YFS A;  5A1L A;  3PUX F;  4ILC A;  4DUZ T;  2XAG B;  3L39 A;  5FP3 A;  2EHO C;  1ZKE A;  2NP9 A;  3OPC A;  4JYA T;  4H9O C;  4ZI7 E;  1XWM A;  1OED E;  3H3M A;  3I9W A;  5ETW A;  3R6N A;  3VHL A;  3ZN1 B;  2KSR A;  4QX8 B;  5LGT B;  4X64 T;  3SFE A;  2IDO B;  4L5G A;  1LVF A;  2HPJ A;  2IML A;  2VKD A;  3CPZ A;  5EK2 A;  3WI3 A;  2LSG A;  5DJQ C;  4O4J E;  4WBN E;  4YTN A;  1S35 A;  2N1G A;  2UXX B;  3P4P A;  4KBM B;  4IT4 A;  4YHJ A;  3C4X A;  4XZC A;  2YDS A;  2LSJ A;  2PJQ A;  4TV9 E;  1OED C;  2W61 A;  2XZE A;  3LK2 B;  4EZ4 A;  4DV7 T;  2E9X B;  4K0K T;  2XSA A;  3P4R A;  5ADX L;  2ZM2 A;  2NR4 A;  1OED A;  1E7P A;  3CVR A;  4YSY A;  2V5D A;  4DV3 T;  2BG9 B;  3BQL A;  4IDN A;  4EEB A;  3ZJ2 A;  3N9O A;  5JDN A;  1Y01 A;  4DV2 T;  1I94 T;  1IBM T;  3T8O A;  2VUR A;  4IDO A;  4PNI A;  2WDR A;  3AVS A;  2IC9 A;  5AQU B;  5L2L A;  2BZB A;  5FKY A;  5JRE A;  4LFC T;  2D5U A;  3E0Z A;  2WM9 A;  4HGA A;  3RIF A;  2W00 A;  4DR5 T;  2CMR A;  4QH4 A;  5CA0 E;  2A2F X;  3JAE A;  3JAD A;  4IE4 A;  1KEY A;  2X68 A;  2E8I A;  3EI0 A;  4GK0 E;  3ZST A;  3K3Q C;  4CI2 B;  4ZI2 C;  2V5C A;  2JRK A;  2Y48 B;  2VKH A;  2LJL A;  4DR2 T;  4H9Q C;  3T1H T;  2HN2 A;  3UTK A;  4JI7 T;  3HL6 A;  4IL9 A;  3PUR A;  2HHH T;  3L09 A;  3V5U A;  2IUB A;  4QX7 B;  4TNV A;  4C91 A;  4ILU A;  4TZ4 C;  5FVL A;  3UQ7 A;  2K5B B;  2ACZ A;  2QGS A;  2A72 A;  3FBL A;  3PUG A;  3PUV F;  4UXN B;  3ZMZ B;  2D2S A;  4ZS3 A;  2Q9Q D;  4O4I E;  4PK6 A;  3R84 B;  2JQH A;  1HTJ F;  1MMG A;  3FZK B;  1MIW A;  1S94 A;  3HKC E;  1B7T A;  2YK0 A;  4IDZ A;  3C4W A;  2W67 A;  3WAJ A;  4LF4 T;  2CE7 A;  4X1Y E;  4AKI A;  2LSY A;  1US7 B;  3RKG A;  1VOM A;  4EB6 E;  5L3F B;  2MBG A;  5IHY A;  3BQK A;  1YW0 A; 
#chains in the Genus database with same CATH homology
 5JR9 B;  3RYI E;  5L3D B;  3K8P C;  3AB3 B;  4JLE A;  3C51 A;  2ZM0 A;  3IHR A;  2WMO A;  5C8Y E;  3RYF E;  2BVL A;  4MFR A;  5J2U E;  2WAU A;  3PUQ A;  4UVB B;  1KK7 A;  3Q2M A;  4DO0 A;  3J7Y q;  2VAS A;  3OYZ A;  3FHN A;  4DMV A;  5L3C B;  2K24 A;  2NW9 A;  3KDS E;  2XAQ B;  3O9X A;  3KBU A;  3KBT A;  5LXT E;  2LT3 A;  2Z6E A;  3LK3 B;  3ESL A;  2I59 A;  2X9X A;  4I50 E;  4J2C A;  3OYX A;  3RRW A;  2XAS B;  2Y8D A;  2X9Y A;  5KX5 E;  2LE8 A;  3AA6 B;  3IF8 B;  4OHF A;  5EZY E;  5IYZ E;  4IGU A;  2E9X C;  4UIG A;  4AQG A;  2GK9 A;  3RYH E;  4MLK A;  4BJM A;  4GYR A;  4HN9 A;  3ZN0 B;  1BR1 A;  2NTY A;  3PE0 A;  1D0Y A;  2NOX A;  4JEH B;  3BK9 A;  1YW0 A;  3B13 A;  3AAI A;  2DI4 A;  5FY1 A;  5F3J A;  3HA4 A;  2LEH A;  4MAL A;  1MIY A;  2RP4 A;  4UF0 A;  4HEA A;  2N2N A;  3P8C D;  4IST A;  3GWH A;  5L3E B;  5LP6 E;  1D1B A;  2XUE A;  5LHH B;  4P09 A;  5J1G A;  4O2B E;  1HX8 A;  4BA9 A;  4DVD A;  1FMV A;  2KLQ A;  1CUN A;  2DHR A;  4ZOL E;  3ZMV B;  4OYK A;  2VKJ A;  3CKD A;  4EAH A;  2A3D A;  5HXC A;  4ANJ A;  4UV9 B;  4KMC A;  3N2O A;  4HTE A;  3AA1 B;  2ODV A;  1V9D A;  3O1H A;  3NRY A;  2LOP A;  5JDF A;  2LSI A;  3C4Z A;  5FY0 A;  4ERR A;  3K3N A;  2VWA A;  4QWN B;  2XTL A;  3I0Q A;  2LHN A;  3I0O A;  2JMH A;  4HE8 A;  2H7O A;  4P0B A;  1WR6 A;  3RRC A;  3ZYK A;  2CXD A;  2WBL A;  3CQG B;  3RYC E;  1HS7 A;  2LSK A;  4H63 V;  1FMW A;  2SPC A;  3N9M A;  1UX4 A;  3UUX B;  4CI1 B;  3AAE B;  5JH7 E;  2QA7 A;  4PFO A;  2EHO D;  4CXW A;  4EXT A;  1D0Z A;  2DWK A;  1YD8 G;  2X9H A;  4OK0 A;  2WSS V;  3VU7 H;  3CML A;  4JUY A;  3ZMU B;  1FEW A;  4DBR A;  3F31 A;  5FMN A;  4L0R A;  2VKO A;  2CLY C;  2Q9Q C;  4PJN A;  4TX5 A;  3N2K E;  2K48 A;  4UVA B;  2V7K A;  4MHC A;  3IBP A;  5LYJ E;  2C5J A;  2ZM8 A;  3DJB A;  3TKL B;  3CQX C;  3GA8 A;  2Q9Q A;  2L8K A;  3AVR A;  3O4X E;  1ZV4 X;  4IIJ E;  4CXX A;  3Q9D A;  4OFZ A;  2B1E A;  2MTQ A;  5LOV E;  3CWZ B;  3EDV A;  5LG4 A;  4PK5 A;  5FXV A;  1SA0 E;  5M4Y A;  3FB2 A;  3DTO A;  3M65 A;  3U3I A;  4AKL A;  1MIV A;  3ANW A;  2N9D A;  4PJM A;  1AJ3 A;  2ES0 A;  2X66 A;  5JDG A;  2KXP B;  4HFV A;  3MKD A;  4QKN A;  5EK4 A;  4QXB B;  4H9S E;  3D0T A;  5HXE A;  1HF8 A;  1QSD A;  2CA5 A;  2WMN A;  5HXR A;  2XHE B;  4C90 A;  3ONX A;  4GK5 E;  2DNX A;  1D1C A;  3L3P A;  3C98 B;  4EOZ B;  1MMN A;  3PUS A;  3FXE B;  1MNE A;  3RPU A;  4ZI2 D;  4I4T E;  1HFA A;  1WYC A;  2E9X D;  2H7V C;  4WW0 A;  4X1I E;  1MND A;  3K3O A;  4AKH A;  5LBM A;  2PG8 A;  5FXW A;  3KIN B;  4PFP A;  1NWM X;  3PU3 A;  2D0U A;  5E0O A;  2X9W A;  4EZH A;  4PJJ A;  4QXH B;  3ZYL A;  5LJN A;  5JRC B;  2VK9 A;  4IE0 A;  4XAX B;  2NTX A;  3VKH A;  4DND A;  2PBI A;  4EIW A;  4MBQ A;  2MOZ A;  3N5L A;  4IHJ E;  1MMD A;  2V26 A;  4YLH A;  3UFE A;  3KV5 A;  3ZLI A;  2ZLY A;  3MJX A;  3JC6 C;  2V7L A;  3ZYM A;  3N9P A;  2W0G A;  3BQI A;  4PJL A;  3J9X 1;  5LA6 E;  5LHI B;  1NAF A;  5CA1 E;  4IE7 A;  4BJN A;  2KWH A;  3N2G E;  4ZI3 C;  2VB6 A;  5F8P A;  5CB4 E;  3CX6 B;  2KIN B;  4YJ2 E;  4V1A v;  5JDH A;  2MYS A;  4CI3 B;  1BR4 A;  2BDE A;  4E7S A;  2X0L B;  2LOS A;  4I43 B;  4NUV A;  3SWH A;  2XAF B;  5JRC A;  3UT5 E;  2C5I T;  2YU1 A;  2KND A;  2G0U A;  3H37 A;  3HKB E;  3UUN A;  5ADX L;  4U72 A;  5JDL A;  4O4L E;  3VKG A;  3S4U A;  3KV4 A;  4TV8 E;  4ISS A;  2LM9 A;  2JMK A;  3NRX A;  4FJO A;  3NZP A;  1G8X A;  1HCI A;  1T98 A;  1QUU A;  5FYM A;  1UX5 A;  3KVA A;  4BAY B;  2XQY A;  3GMI A;  3HR0 A;  3P7I A;  3N9N A;  3PDY A;  2W62 A;  3LG7 A;  3O1I A;  4I55 E;  4TN7 B;  4UV8 B;  4P0A A;  4AQF C;  2C5K T;  2KT9 A;  3LBX B;  5L3B B;  2BVM A;  3KFW X;  4CZZ B;  4O2A E;  5KMG P;  2CCQ A;  4XBF B;  5DAB A;  2KWI B;  4ZI3 D;  1MMA A;  2IAK A;  1LKX A;  2V1D B;  5HXS A;  3LFM A;  2JQQ A;  2KMF A;  2EHO B;  4A56 A;  2XAJ B;  5JVD E;  3ZJ1 A;  3N9L A;  3PU8 A;  1IAP A;  3FBZ A;  3QK6 A;  3IEE A;  3UUM A;  2PFV A;  2OA5 A;  4X1K E;  1WRD A;  1U4Q A;  3RH3 A;  3WAK A;  3V5S A;  3ZC1 A;  5LJM A;  2XAH B;  3ETU A;  4ASK A;  3ZCI A;  2CXF A;  3GN5 A;  5HXH A;  5JDM A;  3EVY A;  3OJA A;  1BR2 A;  4GOU A;  4FI5 A;  4H9R C;  2IC6 A;  3RKO A;  4JEU B;  3W15 B;  3MA9 A;  4G2A A;  1LRZ A;  5LGN B;  3ZCJ A;  1IJ6 A;  2KZ7 B;  5HWX A;  5L3G B;  2UXN B;  4IE6 A;  4KP3 C;  3NZQ A;  1YKE B;  3RC3 A;  5HYA A;  4UF0 B;  4GIW A;  5AFU L;  4AXP A;  4TUY E;  1Z0P A;  3SRZ A;  2DLR A;  2YIN A;  1Y64 B;  3ANW B;  4ZHQ E;  5FXZ A;  3C64 A;  1D1A A;  3ZMT B;  2Y6X A;  3PUA A;  5JR9 C;  4HKA A;  3O1J A;  3SS1 A;  3MAC A;  3RX6 A;  1EZ3 A;  4KUM B;  1WLX A;  2DCF A;  1G73 A;  4DMW A;  4B6X A;  3RC8 A;  2JJ9 A;  1YKH B;  3LBX A;  1FIO A;  4O4H E;  1ZHC A;  2X51 A;  2RA1 A;  1HG2 A;  2HPL A;  2LHR A;  1ZEE A;  1IZN B;  2L3L A;  5LBQ B;  4PW8 A;  1U5P A;  5LGU B;  4UVC B;  3I1A A;  4AKG A;  3LK4 2;  3DP7 A;  3MK7 C;  2EHO A;  3C50 A;  4G63 A;  4N78 D;  5DQW A;  4DBQ A;  4CXY A;  2ZMA A;  4EYY R;  1BR0 A;  5FXX A;  2VL8 A;  4M1P A;  5J2T E;  3CX7 B;  4NUU A;  4UEL A;  5HAX A;  4UEM A;  4OYJ A;  4EYU A;  3KV9 A;  3QUJ A;  4CQI A;  1SHZ C;  3GN5 B;  1X79 A;  2DWG A;  5LCY A;  4GYS A;  2CXL A;  3ZPO A;  3Q5X A;  3NBX X;  3SOL A;  4WNK A;  3AAA B;  3N9Q A;  1D0X A;  2YU2 A;  3HI2 A;  2M67 A;  1E1H B;  1WYB A;  5KDM C;  2V7I A;  5FNV E;  3B57 A;  4X20 E;  3CX8 B;  3ZMS B;  4AKR B;  2CM0 A;  4H9N C;  2W63 A;  3UUL A;  5BMV E;  3Q5W A;  3JC6 D;  1LVK A;  3I9Y A;  1OXZ A;  4F6R C;  4H9P C;  4AI6 A;  2JPF A;  3E08 A;  3LJC A;  1UCU A;  2V7M A;  2IW5 B;  3KVB A;  2YEV C;  2V7J A;  2C0S A;  3PTR B;  2ODU A;  2CEA A;  3KV6 A;  2D0T A;  2Q9Q B;  2CLY B;  3H3A A;  2CWY A;  2ACX A;  2J1D G;  5HWY A;  3MZK B;  4PK4 A;  3HKD E;  1VRB A;  5TAO A;  1OWA A;  5DQV A;  1O3X A;  3AA7 B;  3QC9 A;  3AA0 B;  4AQF A;  1KNZ A;  3U78 A;  3E22 E;  3ZEF B;  3EDU A;  4QXC B;  2HH7 A;  3EUH A;  4L9I A;  4E7Z A;  3F2E A;  3HKE E;  2CWO A;  2NW7 A;  3ZC0 A;  2NWB A;  2P9B A;  3CQC B;  4IE5 A;  4U74 A;  2H3R A;  3OBV E;  2L9Q A;  5LNK A;  2E9X A;  2NW8 A;  5EK3 A;  5GON E;  2WWU A;  3A5X A;  4YJ3 E;  5LHG B;  4WBO A;  4PAG A;  5JDQ A;  3OKQ A;  3F57 A;  3MXZ A;  4Z8X A;  1IJ5 A;  5JQG E;  2X67 A;  5H6Q B;  4K0U A;  5FY7 A;  5H6R B;  5JR9 A;  4ADZ A;  4H63 H;  1H7C A;  1HG5 A;  3FXD B;  4O8S A;  4YFS A;  2K9A A;  5A1L A;  2XAG B;  5FP3 A;  2EHO C;  1ZKE A;  2NP9 A;  4H9O C;  4ZI7 E;  3I9W A;  3VHL A;  3ZN1 B;  5ETW A;  3R6N A;  5LGT B;  4QX8 B;  4L5G A;  1LVF A;  2HPJ A;  2VKD A;  3CPZ A;  5EK2 A;  3WI3 A;  2LSG A;  5DJQ C;  4O4J E;  4WBN E;  1S35 A;  2N1G A;  2UXX B;  4KBM B;  4YHJ A;  4ZS2 A;  3C4X A;  4XZC A;  2LSJ A;  2PJQ A;  4TV9 E;  2W61 A;  3LK2 B;  4EZ4 A;  2E9X B;  2ZM2 A;  3CVR A;  3BQL A;  3ZJ2 A;  3N9O A;  5JDN A;  3T8O A;  4PNI A;  3AVS A;  2IC9 A;  5L2L A;  2BZB A;  5JRE A;  2D5U A;  3E0Z A;  2WM9 A;  4HGA A;  2W00 A;  2CMR A;  5CA0 E;  2A2F X;  4IE4 A;  2X68 A;  2E8I A;  4GK0 E;  3K3Q C;  4CI2 B;  4ZI2 C;  2JRK A;  2Y48 B;  2VKH A;  2LJL A;  4H9Q C;  3UTK A;  3HL6 A;  3PUR A;  3L09 A;  3V5U A;  4QX7 B;  4C91 A;  4ILU A;  4TZ4 C;  2K5B B;  2QGS A;  2A72 A;  3FBL A;  3PUG A;  4UXN B;  3ZMZ B;  2D2S A;  4ZS3 A;  2Q9Q D;  4O4I E;  4PK6 A;  3R84 B;  1HTJ F;  1MMG A;  4QHO A;  1MIW A;  1S94 A;  3HKC E;  1B7T A;  2YK0 A;  4IDZ A;  3C4W A;  3WAJ A;  2CE7 A;  4X1Y E;  4AKI A;  2LSY A;  1US7 B;  4EB6 E;  1VOM A;  5L3F B;  2MBG A;  5IHY A;  3BQK A;  3ETV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...