3C64A

The mc179 portion of the cysteine-rich interdomain region (cidr) of a plasmodium falciparum erythrocyte membrane protein-1 (pfemp1)
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
166
structure length
152
Chain Sequence
DKIMSYNAFFWMWVHDMLIDSIKWRDEHGCNKKCICFQKWVEQKKTEWGKIKDHFRKQKDIPKDWTHDDFLQTLLMKDLLLEIIQDTYGDANEIKRIEALLEQAGVGGIDFAALAGLYTKGFVAEKDTTIDKLLQHEQKEADKCLKTHTDDT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PfEMP1 variant 2 of strain MC
publication title The Cysteine-Rich Interdomain Region from the Highly Variable Plasmodium falciparum Erythrocyte Membrane Protein-1 Exhibits a Conserved Structure.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Cd36-binding protein,cell adhesion
total genus 58
structure length 152
sequence length 166
ec nomenclature
pdb deposition date 2008-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03011 PFEMP PFEMP DBL domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.830 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3c64A00
2YK0A 3CPZA 4NUUA 3BQKA 3CMLA 3RRCA 2Y8DA 4YFSA 5F3JA 3C64A 2WAUA 3BQIA 4NUVA 3BQLA
chains in the Genus database with same CATH superfamily
3KBTA 2NTYA 4ANJA 3UU8A 4A98A 4GK5E 2AXDS 3AECA 2VL0A 5LJMA 3UU4A 5EZYE 4IT4A 2CHNA 3Q5XA 1HCIA 2XAFB 4HFVA 2QYWA 4WZXA 4X62T 4CI1B 2X67A 2A3DA 4UR9A 1ZV4X 4PK6A 1NAFA 4OK0A 5LBQB 5H6QB 1XMQT 5J0ZA 2Q9QA 3RX6A 2IW5B 3AAAB 4NXNT 3C50A 4A97A 3RRWA 2JQQA 2LJLA 2PBIA 2YN6A 4HWFA 1W0BA 5FVLA 2UUCT 5HCJA 5JTGA 2WBLA 4EGWA 3PDYA 3B5MA 2H7VC 4IE0A 3TLSA 3P4RA 2CM0A 2YDRA 2V6YA 4AISA 4YXDA 2VVSA 5L4HA 5J2UE 1XDPA 3F57A 4TNWA 5HXEA 3LSVA 2KMFA 2K3WA 4I43B 3ZMUB 5KMGP 5JDFA 4M1PA 2CBJA 3AAIA 4A56A 5HXSA 2XAHB 5JDNA 2LSYA 5AQPB 2X0YA 3MACA 4IDQA 2Q9QD 2KXPB 3SOLA 3RHWA 2JMHA 1ZHCA 2OLTA 3EUHA 3OPCA 4X20E 2L9QA 2E9XC 4DV6T 1NEKA 3T1YT 2CRBA 3T1HT 4P09A 1BR0A 2CPTA 4UELA 4JYAT 3L09A 1WYBA 4AKGA 1KNRA 4HE8A 2YU2A 3RKOA 1YW0A 1E2AA 4HKAA 4HFEA 3RH3A 3UTKA 3ZMVB 3J7Yq 2R6GF 3MXZA 4ZS2A 3L8RA 5L3GB 2IC9A 4PJJA 5HEHA 4OYJA 1S35A 3ANWB 4O4JE 1VRBA 4PNIA 2XQYA 4CN1A 4AQFA 2W4XA 1EZ3A 4KP3C 4ADZA 3UU6A 2CA5A 1OEDE 2Y8DA 4YSXA 2ZM0A 3GMIA 3RYCE 4UXNB 1M7KA 2B1EA 3AA0B 3F31A 2FJDA 1XMOT 3AEDA 4PJMA 3L39A 3LG7A 3HR0A 1OWAA 2BVMA 4GKKT 1HG2A 3GWHA 1HTJF 4IL4A 1LRZA 3AE5A 3N9LA 4LMJA 3I0OA 1N36T 1FMVA 4X5TA 1US7B 3DJBA 4TN7B 2WDVA 3AEAA 2W2UA 3HKBE 4F6RC 4IL9A 4X66T 4EV6A 3C98B 4DO0A 1IBKT 3I9YA 4QXHB 3RPUA 1VCSA 5AQVB 2GK9A 4CXYA 2C5JA 3ZCJA 2XQ8A 2A2FX 4DBRA 5J1GA 1UUSA 3NKZA 3IF8B 2K24A 2PJQA 4ZI2D 3O1JA 1MMDA 2W62A 3EVYA 3Q9DA 5JRCA 5AQUB 4WBNE 4DNDA 2HN1A 3JAEA 1HR0T 3UFGA 2BS3A 2NW7A 2WAUA 4O4LE 3TLTA 4EOZB 5E0OA 4F8HA 3AE6A 2XQAA 5AQJB 2LRKA 4X1YE 3HI2A 3PJAJ 2K48A 4Z91A 3FBZA 4H63H 3ZKRA 3I9WA 3RIUA 4GOUA 4YSYA 2EHOA 3PUVF 3KV6A 1MNDA 4H9RC 4KI0F 3ZYMA 3GN5A 4DIDB 5ABGA 3RIAA 2XQ9A 3PE0A 1I6ZA 5C8YE 3S4UA 3ZJ2A 1BR2A 2J4GA 2LLYA 1YD8G 2X0HA 3UQ7A 5EK3A 1E7PA 2K5BB 1WYCA 1ZOYA 4UVCB 3AAEB 4U72A 3G06A 3ONXA 5CB4E 3ZYKA 5DQWA 4B6XA 2RA1A 5ETWA 2FUPA 4NPPA 2VKDA 4U74A 3NVOA 4DV4T 3HKCE 1XNQT 4AKHA 2WU2A 3KV4A 4EB6E 2NP9A 2UXNB 3ZPOA 1NENA 3BQIA 2MTQA 3OYXA 3T8OA 4KHPT 2EHOD 3HKDE 5FXXA 2E9XB 3OTOT 5FYMA 1MNEA 5LOVE 4P0AA 2WU5A 1QUUA 4DV7T 4QH4A 5AQSB 4COFA 2VWAA 3ESLA 1W0AA 5LHHB 5L3DB 3LBXA 1WR0A 1H7CA 3SFEA 2QRXA 5FNVE 5FL1A 2CWOA 2NW8A 2BKOA 4UV8B 3TKLB 3EDVA 2XASB 4DV1T 3ETUA 2C5IT 4JLEA 2LSGA 3MK7C 3PUAA 4NUUA 2Q9QB 2V26A 1OEDC 4UVAB 1X79A 1E1HB 2DI4A 5HWXA 2YU1A 3AE7A 5L3EB 2WSSV 4PW8A 2Y6XA 2RPAA 2YINA 3M65A 3C64A 4L9IA 3F2EA 1CHUA 3ZMSB 4JBWF 3B57A 4IIJE 5HXRA 1FIOA 2BG9E 4JI3T 3A5XA 3AVRA 2UU9T 2KNDA 2BBJA 3SRZA 4B3RT 4YJ3E 4K0UA 3HA4A 2XAGB 1IZNB 1L0VA 3UUXB 4X64T 3KDSE 2ZM6T 4JV5T 5HXHA 5LGTB 3V5SA 2X9YA 3NRYA 4UIGA 2PFVA 2RP4A 3N2GE 3J9X1 3PUQA 2IMLA 1IAPA 1IJ5A 1G8XA 4MBQA 3Q5WA 2V7LA 3QNUA 4PFOA 2WM9A 2JPFA 4GYRA 3OJAA 4CZZB 2LM2A 3P50A 4H9OC 3AA1B 2X9XA 1BR1A 4ZI3D 4EXTA 3MZKB 3KVAA 5ABFA 3ZN0B 1UX5A 2W66A 2Z6EA 4O2AE 4ZOLE 5HEGA 5LHGB 4TWDA 5FMNA 3IA3A 1VOMA 5CA1E 2XAQB 4JI5T 5ABEA 4H9PC 1LVFA 2V6XA 3VRAA 5AQRB 3QB5K 3WI3A 1LKXA 1QLBA 4KX6A 4QWNB 1X9BA 3E22E 1N34T 4CI2B 2IHR1 5L4EA 3KBUA 3KINB 4JI0T 2BG9A 2V7JA 3CWZB 4BA9A 4ILBA 4ZZCA 2D0TA 1YKHB 3P4SA 2XUEA 1YKEB 2LRLA 3RQWA 4LF8T 4KBMB 4E7SA 2LSJA 2X68A 3LK42 4ASKA 2W67A 5CJ5A 2YOEA 2JIWA 2IUBA 2LSKA 2V7KA 5L47A 4DMWA 2IAKA 3K1SA 1N33T 5AQMB 2VKJA 5FXZA 3ZCIA 4YHHT 1D1AA 2W00A 2XM1A 4TNVA 1GQEA 4ILUA 5CA0E 5FXWA 3Q2MA 4A5XA 3CVRA 5KDMC 5AQOB 3FXEB 3LDQB 4MALA 3ZYLA 2VURA 5JH7E 4Q25A 4ZS3A 2H7OA 3QB5A 3AXJA 2UUAT 3HL6A 1ZKEA 2K9AA 3FZHB 3P4PA 5JR9A 2CBIA 2KINB 2N2NA 1CUNA 3ABVA 5JRCB 4ZEYA 3U3IA 2MYSA 2E5VA 3EAMA 3WAKA 3LJCA 3HKEE 2KWHA 4ZZBA 3ZEFB 3LK3B 2HN2A 3FZMB 4AXPA 5F8PA 3ZMTB 3UUNA 2Q9QC 2V8SV 3JAFA 4Z90A 2IC6A 1OEDB 4PAGA 1IJ6A 2EHOB 4AI6A 4MLKA 5JDGA 3GN5B 4YFSA 2A72A 3CQCB 1QSDA 3B13A 3O9XA 2C0SA 3ZC1A 1XZYA 3PUZF 2BDEA 3UU5A 5DJQC 3UUMA 3H37A 4X65T 4JEUB 2XM2A 3NZQA 2DNXA 3BQLA 2CWYA 2XJ7A 2X51A 4B3ST 4IDOA 3NZPA 5KX5E 2M6IA 1V9DA 2YDQA 1T98A 3K3NA 5L2LA 2L8KA 4LFCT 1VCTA 2YEVC 4EEBA 2LHRA 2WDRA 5LNKA 4U7IA 3PUGA 3N9MA 3A7MA 5LCYA 4ISSA 1U5PA 4KUMB 4IE6A 4HEAA 3OBVE 4CN4A 3LBXB 4BJMA 3O1IA 2CHOA 1MMNA 4JUYA 5BMVE 2CEAA 4UV9B 4DR5T 3RYHE 2Y48B 3NRXA 3IHRA 3AEFA 3O4XE 4AKLA 2LKHA 2YKSA 1D1BA 3CKDA 2I59A 2V7MA 3E0ZA 3BQKA 4JI1T 2X0LB 3DP7A 2LE8A 4MFRA 4L0RA 5LMUT 3ZT6A 4HWCA 5LGUB 3PV0F 4AQFC 3D0TA 2VVNA 5DABA 5HEJA 4LFAT 2AE9A 3AE2A 2WZHA 4YT0A 3L3PA 2D9DA 3AE3A 2HHHT 3VKGA 4IREA 4ZI2C 3VR8A 3CQGB 2DWKA 2XZEA 4JI8T 3CIRA 5FXVA 4HFIA 2LHNA 3QK6A 3C4ZA 5AQHB 5HXCA 3EDUA 3CMLA 2OV9A 4QH5A 4ILCA 3ETVA 3PUXF 3AA6B 1Z8UA 3K3OA 2X9HA 1YQ4A 3VKHA 3VRBA 1HX1B 2QVAA 4YY3T 2YDSA 2MBGA 5HAXA 4HFHA 1IBLT 1HFAA 4NUVA 5IHYA 5LGNB 2VQET 3TLUA 5AQNB 2OA5A 4DUYT 5AQTB 5JDMA 2BVLA 3FHNA 1SHZC 2V7IA 1J5ET 2SPCA 4TUYE 1FJGT 3ONLC 4U7YA 4JI6T 5LP6E 3QC9A 5DQVA 3RC3A 2FJBA 5EK4A 3N2KE 5HYAA 4OX9T 1Y64B 3PUWF 2D0UA 2DL1A 4Z8XA 5ABFB 3N2OA 5J2TE 4QXCB 2MPKA 1HX8A 3RQUA 5IUXA 5JDHA 4JEHB 1HF8A 2JQKA 5BR8T 1UX4A 3AE4A 4P0BA 3RIUC 1WRDA 2EHOC 3RF1A 2XQ7A 2VL8A 1HNZT 4E7ZA 4AKIA 4DV2T 3N9PA 1JNRA 2ZM8A 2B76A 4DV0T 1XWMA 2BG9B 4U33A 1B7TA 2WS3A 5AQQB 2JRKA 4CQIA 2BBHA 4DR7T 4LMLA 2H88A 2C5KT 1D0YA 5ABHA 3CX6B 2UXBT 3JC6D 1MIYA 4DR1T 2V6YB 1LVKA 4B3TT 4XZCA 4QHOA 3FXDB 2V1DB 5JDLA 3TLVA 3RGLA 4TX5A 1KFYA 5LJNA 3TLWA 1T72A 5FY0A 1UCUA 3MJXA 4CN6A 4IHJE 5JDQA 4TWHA 2V5DA 3R84B 2FJEA 2ACZA 5LYJE 2HPLA 1J1JA 2CLYB 4DR2T 4EZHA 2ODVA 4DV3T 3UUBA 5AQKB 4I4TE 3KV9A 3FBLA 2PTFA 4X1KE 3PTRB 3FZLB 3PUYF 1J5WA 5JR9B 3AE9A 4HTEA 1SA0E 4QKNA 4EIWA 2WP9A 4JI7T 4HFDA 2V5CA 2G0UA 3FB2A 3ZMZB 1S94A 2LOPA 4YTMA 4WW0A 4HFBA 2E9XA 4N78D 3N5LA 1ZEEA 2M67A 3N9OA 4EZ4A 2DHRA 3AEBA 2P9BA 3Q5EA 4YSZA 3SWHA 4OHFA 3AVSA 4PK4A 1MIWA 5LHIB 4WNKA 3IBPA 2JQHA 5CFBA 3NWIA 2YK0A 3DTOA 3NBXX 3Q5DA 1T7SA 5FVKA 3PU8A 2UUBT 3LK2B 4DUZT 5FP3A 4ZI3C 3PJAA 3MA9A 3ZSSA 4LF5T 4DR3T 1YXRA 2D2SA 2L3LA 5F3JA 3P4QA 4IDZA 2CXFA 2WMNA 5FY7A 3AEEA 4I0UA 2HPJA 2E9XD 4QX7B 4HWIB 1UGOA 2LT3A 2WMOA 2BS2A 3PUSA 2XAJB 5LA6E 4ZXLA 2A9UA 2ODUA 1MMAA 3N9QA 1O3XA 1HG5A 4WYVA 5L3BB 5M4YA 3OYZA 1DU2A 2WB5A 1WLXA 3EABA 2ZM2A 2E5LT 4IE7A 3ONJA 5AQGB 4BJNA 4KMCA 4K0KT 3UU3A 5IWAT 2UXDT 4YTNA 4U2YA 5AQFB 5TAOA 4LFBT 5L3FB 4UF0A 5FL0A 1KNPA 2H3RA 5H6RB 4EEDA 2HH7A 2DLRA 4CI3B 2E8IA 1SE7A 5EK2A 4TV8E 4LF9T 4DBQA 4ISTA 5LXTE 2DCFA 4G63A 2JMKA 5FKYA 2CXDA 4HFCA 2IIUA 5LG4A 4GKJT 4P1NA 4BAYB 2LKGA 4DR4T 2XHEB 3X1DA 3GA8A 2BZBA 2WDQA 2NW9A 3K8PC 1U4QA 4PFPA 3RKGA 1JNZA 1UK5A 3V5UA 5LMNT 3QOFA 4DR6T 1SUMB 4XAXB 1D1CA 1ZP0A 3UULA 2NTXA 2BG9C 3AA7B 2VKOA 2N9DA 1Y01A 4XBFB 4C91A 2ZMAA 5C3JA 4GIWA 2CE7A 2XSBA 5LBMA 2QA7A 3EI0A 3RYFE 2WY2A 2XTLA 2I0MA 4O2BE 4ERRA 3MKDA 2LOSA 1D0ZA 4EAHA 4IE5A 1W9RA 2IDOB 5HEOA 1FEWA 3WAJA 4LF6T 2X9WA 4QXBB 2WCAA 4J2CA 5FY1A 4YJ2E 3R6NA 2BS4A 5HCMA 3OVUA 2MAWA 5LB7B 5AFUL 5JQGE 2CLYC 2H89A 3C51A 4KHZF 5AQLB 3ZT5A 3P4WA 2MOZA 4HN9A 3ZSTA 2XQ4A 1HNXT 2J47A 3H3MA 2XSAA 2CCQA 5JR9C 2XQ6A 5KXJA 3KVBA 4I55E 4NIQA 2LEHA 2F4VT 3SS1A 3UT5E 5A1LA 1NWMX 4YLHA 1WR6A 3P8CD 2M6BA 4FJOA 3FZFB 4LF7T 1HS7A 2ZLYA 5JREA 4DMVA 1D0XA 4CXXA 4H63V 4B3MT 3C4XA 3RYIE 2X66A 4H9SE 4IDNA 4OYKA 2WWUA 4YTPA 3PU3A 2W61A 2NWBA 3C4WA 1AJ3A 3UFEA 3EHZA 3U78A 3QUJA 3AE1A 2ACXA 3ANWA 4GK0E 1OEDA 1BR4A 5ADXL 4GYSA 4TZ4C 5JVDE 4ILAA 5IYZE 2I6HA 3M3ZB 1UURA 4UVBB 3RIFA 3KFWX 3IEEA 4FI5A 1T8BA 5F5WA 3P7IA 3K3QC 3VU7H 3AB3B 4O4IE 4O4HE 1KEYA 4U3CA 4ZHQE 5AQIB 2N1GA 2VKHA 4L5GA 2BKNA 4G2AA 4IE4A 5CGMA 1W09A 3ZJ1A 2CXLA 3CPZA 4PJLA 4HGAA 2W0GA 4LMKA 4TWFA 3SFDA 4JI2T 3O1HA 2WZIA 4CXWA 2LSIA 3I1AA 4U2ZA 2ES0A 2FJAA 2VASA 2KLQA 4JI4T 1XNRT 1XDOA 2VQFT 4AQGA 3BK9A 3H3AA 4AKRB 4X1IE 4PK5A 2NOXA 3PURA 4C90A 5GONE 4UEMA 2VB6A 3E08A 4DVDA 3JADA 4IGUA 3RC8A 4V1Av 1N32T 2W63A 2KWIB 4HWHA 1OXZA 5HEUA 1HNWT 5LG3A 2XQ5A 1I94T 1WCRA 3A8YC 3RLFF 4WBOA 4PJNA 4U31A 4AIUA 2PG8A 2KT9A 3JCFA 5HWYA 2D5UA 2XQ3A 3RRCA 3CX7B 1YQ3A 2NR4A 3W15B 3CK6A 2WQYA 2JQ9A 3I0QA 4EYUA 2J62A 1KNZA 1IBMT 2KSRA 1G73A 2FBWA 2WWVA 3UQ4A 3N9NA 1FMWA 4ZI7E 3KV5A 2VK9A 4YHJA 3RI5A 3CX8B 1KF6A 4H9NC 4MHCA 4OFZA 4O8SA 1WFDA 2UXXB 2JJ9A 1MMGA 2J1DG 3FZKB 3OKQA 4H9QC 2XPKA 2CMRA 4AQYT 2DWGA 3ZLIA 2QGSA 4TV9E 4UF0B 3ZN1B 3AXJB 2UXCT 2LM9A 4NXMT 3AEGA 3JC6C 3ZT7A 5L3CB 1R8IA 3AE8A 4LF4T 4QH1A 2BKPA 3VHLA 1KK7A 3VR9A 4IDPA 2XY8B 4HWDA 1Z0PA 4DV5T 3ZC0A 3LFMA 3CQXC 4QX8B 1M62A 5C2TA 4I50E 1MIVA 2KZ7B 2E2AA 4EYYR
chains in the Genus database with same CATH topology
3KBTA 2NTYA 4ANJA 2CXDA 5FNVE 5LG4A 2V7MA 3E0ZA 3BQKA 4BAYB 4GK5E 2CWOA 2NW8A 2X0LB 3DP7A 5LJMA 5EZYE 2XHEB 2LE8A 3GA8A 4MFRA 4L0RA 2BZBA 4UV8B 3TKLB 2NW9A 3EDVA 3K8PC 2XASB 1U4QA 3Q5XA 1HCIA 4PFPA 5LGUB 2XAFB 4HFVA 3ETUA 4AQFC 2C5IT 4JLEA 4CI1B 3V5UA 3D0TA 2LSGA 3MK7C 3PUAA 4NUUA 2X67A 2Q9QB 2V26A 5DABA 2A3DA 4UVAB 1X79A 1E1HB 2DI4A 5HWXA 1ZV4X 3L3PA 1D1CA 4XAXB 2YU1A 4PK6A 2NTXA 3UULA 1NAFA 3AA7B 4OK0A 2VKOA 5L3EB 5LBQB 5H6QB 2Q9QA 2WSSV 4PW8A 2Y6XA 3RX6A 2N9DA 2YINA 3M65A 4XBFB 4C91A 2IW5B 3C64A 2ZMAA 4L9IA 3AAAB 3VKGA 3C50A 3F2EA 4GIWA 3ZMSB 2CE7A 4ZI2C 5LBMA 2QA7A 3RRWA 3RYFE 3CQGB 2XTLA 2DWKA 3B57A 4O2BE 4IIJE 5HXRA 2JQQA 1FIOA 2LJLA 5FXVA 2LHNA 4ERRA 3QK6A 3C4ZA 2PBIA 3MKDA 3A5XA 2LOSA 3AVRA 5HXCA 2KNDA 3SRZA 4YJ3E 3EDUA 3CMLA 2WBLA 1D0ZA 4EAHA 3PDYA 4K0UA 3HA4A 4IE5A 2H7VC 2XAGB 4IE0A 1IZNB 3UUXB 1FEWA 3ETVA 3WAJA 2CM0A 3AA6B 3KDSE 2X9WA 4QXBB 4J2CA 5FY1A 3K3OA 5HXHA 5LGTB 4YJ2E 2X9HA 3V5SA 5J2UE 3R6NA 3F57A 2X9YA 3VKHA 3NRYA 5HXEA 2KMFA 4UIGA 2PFVA 4I43B 2RP4A 5AFUL 2MBGA 3N2GE 3ZMUB 5HAXA 5JQGE 3PUQA 2CLYC 3J9X1 1HFAA 4NUVA 5IHYA 3C51A 4M1PA 5JDFA 5KMGP 5LGNB 3AAIA 1IAPA 1IJ5A 1G8XA 2MOZA 2OA5A 4MBQA 4A56A 4HN9A 5HXSA 5JDMA 2BVLA 3FHNA 1SHZC 2V7IA 2XAHB 3Q5WA 5JDNA 2LSYA 2V7LA 2CCQA 4PFOA 5JR9C 3MACA 2Q9QD 2WM9A 2SPCA 4TUYE 2KXPB 3SOLA 3KVBA 4I55E 2JPFA 2JMHA 1ZHCA 3EUHA 2LEHA 4GYRA 3SS1A 3UT5E 3OJAA 4X20E 4CZZB 2L9QA 5A1LA 1NWMX 5LP6E 2E9XC 4YLHA 1WR6A 3QC9A 3P8CD 5DQVA 3RC3A 4FJOA 4P09A 1BR0A 5EK4A 4UELA 3N2KE 5HYAA 3L09A 1WYBA 3AA1B 4H9OC 2X9XA 1HS7A 4AKGA 2ZLYA 1Y64B 5JREA 4DMVA 2D0UA 4Z8XA 1BR1A 4ZI3D 4EXTA 1D0XA 3MZKB 3N2OA 4CXXA 5J2TE 4QXCB 4H63V 4HE8A 2YU2A 3RKOA 1YW0A 3C4XA 4HKAA 3RYIE 1HX8A 2X66A 3RH3A 3UTKA 5JDHA 4H9SE 3ZMVB 3J7Yq 3KVAA 4JEHB 3ZN0B 3MXZA 1HF8A 4ZS2A 4OYKA 2WWUA 1UX5A 2Z6EA 4O2AE 4ZOLE 3PU3A 5LHGB 2W61A 5FMNA 5L3GB 1UX4A 4P0BA 1VOMA 2IC9A 5CA1E 4PJJA 2XAQB 1WRDA 2EHOC 2NWBA 2VL8A 3C4WA 4H9PC 1AJ3A 4OYJA 1LVFA 1S35A 4E7ZA 3ANWB 4O4JE 3UFEA 3N9PA 4AKIA 1VRBA 4PNIA 2XQYA 3WI3A 1LKXA 2ZM8A 3U78A 4QWNB 3QUJA 4AQFA 3E22E 1EZ3A 2ACXA 1B7TA 4KP3C 3ANWA 4CI2B 2JRKA 4ADZA 4GK0E 4CQIA 2CA5A 1BR4A 2Y8DA 5ADXL 4GYSA 3KBUA 3KINB 2ZM0A 4TZ4C 5JVDE 2V7JA 3CWZB 4BA9A 3GMIA 5IYZE 3RYCE 2C5KT 1D0YA 2D0TA 1YKHB 3CX6B 4UVBB 2XUEA 3JC6D 4UXNB 1YKEB 3KFWX 3IEEA 4FI5A 1MIYA 1LVKA 2B1EA 4XZCA 3P7IA 4QHOA 3K3QC 3FXDB 3AA0B 2V1DB 3F31A 3VU7H 3AB3B 4O4IE 4PJMA 4O4HE 4KBMB 3LG7A 2LSJA 2X68A 3LK42 4ASKA 4E7SA 3HR0A 5JDLA 1OWAA 2BVMA 4TX5A 5LJNA 4ZHQE 2N1GA 2VKHA 4L5GA 1HG2A 4G2AA 3GWHA 1HTJF 4IE4A 1LRZA 2LSKA 2V7KA 5FY0A 3N9LA 1UCUA 3ZJ1A 3MJXA 4DMWA 2CXLA 2IAKA 3I0OA 3CPZA 1FMVA 4PJLA 2VKJA 4HGAA 4IHJE 2W0GA 5FXZA 5JDQA 3ZCIA 1US7B 3DJBA 1D1AA 3R84B 2W00A 4TN7B 5LYJE 2HPLA 3O1HA 4ILUA 3HKBE 5CA0E 4CXWA 2CLYB 5FXWA 2LSIA 4F6RC 3I1AA 4EZHA 2ODVA 2ES0A 3Q2MA 2VASA 4I4TE 2KLQA 3KV9A 3FBLA 4X1KE 3CVRA 5KDMC 3PTRB 3FXEB 4MALA 3C98B 4DO0A 3ZYLA 4AQGA 3BK9A 3H3AA 4AKRB 3I9YA 4QXHB 4ZS3A 2H7OA 5JH7E 5JR9B 3RPUA 4X1IE 4PK5A 2NOXA 3PURA 1SA0E 4HTEA 2GK9A 5GONE 4C90A 4UEMA 4QKNA 4CXYA 3HL6A 1ZKEA 2C5JA 2VB6A 3E08A 4DVDA 4EIWA 3ZCJA 4IGUA 3RC8A 2A2FX 2K9AA 2G0UA 3FB2A 4DBRA 5JR9A 4V1Av 2KINB 5J1GA 2N2NA 1CUNA 3ZMZB 1S94A 2LOPA 3IF8B 2K24A 5JRCB 2W63A 4WW0A 2KWIB 2E9XA 2PJQA 4N78D 1OXZA 4ZI2D 3O1JA 1MMDA 3N5LA 3U3IA 1ZEEA 2MYSA 2W62A 3EVYA 3WAKA 3LJCA 3HKEE 2M67A 3N9OA 4EZ4A 2KWHA 3Q9DA 5JRCA 2DHRA 2P9BA 4WBNE 4DNDA 4WBOA 4PJNA 3ZEFB 3LK3B 3SWHA 4OHFA 2NW7A 2WAUA 3AVSA 4O4LE 4AXPA 4PK4A 5F8PA 1MIWA 2PG8A 4EOZB 2KT9A 3ZMTB 5HWYA 3UUNA 5E0OA 2D5UA 5LHIB 4WNKA 2Q9QC 3IBPA 4X1YE 3RRCA 3CX7B 2IC6A 3HI2A 4EYYR 4PAGA 2YK0A 3W15B 1IJ6A 3DTOA 2EHOB 2K48A 3NBXX 3FBZA 4H63H 4AI6A 4MLKA 5JDGA 3GN5B 3I9WA 3I0QA 3PU8A 4YFSA 4GOUA 4EYUA 2EHOA 2A72A 3LK2B 3CQCB 3KV6A 1MNDA 4H9RC 1KNZA 1QSDA 3B13A 5FP3A 3O9XA 2C0SA 4ZI3C 3GN5A 3ZC1A 3ZYMA 3MA9A 3PE0A 5C8YE 2D2SA 1G73A 2L3LA 3N9NA 5F3JA 1FMWA 4ZI7E 2BDEA 3KV5A 3S4UA 5DJQC 2VK9A 3UUMA 4IDZA 2CXFA 3ZJ2A 1BR2A 2WMNA 3H37A 4YHJA 3CX8B 5FY7A 1YD8G 4H9NC 4MHCA 2HPJA 4JEUB 4OFZA 2E9XD 4O8SA 4QX7B 5EK3A 2UXXB 2JJ9A 1MMGA 2J1DG 2LT3A 2WMOA 3PUSA 2XAJB 5LA6E 2ODUA 3NZQA 2K5BB 1WYCA 2DNXA 1MMAA 3AAEB 3BQLA 3N9QA 1O3XA 3OKQA 4U72A 4UVCB 1HG5A 3ONXA 2CWYA 5L3BB 5CB4E 3ZYKA 5M4YA 3OYZA 2X51A 1WLXA 5DQWA 2ZM2A 4H9QC 4B6XA 2RA1A 5ETWA 2CMRA 3NZPA 4IE7A 5KX5E 2DWGA 2VKDA 4U74A 1V9DA 3ZLIA 4BJNA 3HKCE 4KMCA 1T98A 2QGSA 3K3NA 4TV9E 4UF0B 3ZN1B 2L8KA 5L2LA 4AKHA 2LM9A 2YEVC 2LHRA 3KV4A 3JC6C 4EB6E 5TAOA 5LNKA 2NP9A 2UXNB 5L3FB 3ZPOA 4UF0A 3PUGA 5L3CB 3N9MA 3BQIA 2MTQA 3OYXA 5LCYA 3T8OA 4ISSA 2EHOD 1U5PA 4KUMB 3HKDE 2H3RA 3VHLA 1KK7A 5FXXA 4IE6A 5H6RB 2E9XB 1Z0PA 2HH7A 3ZC0A 5FYMA 1MNEA 5LOVE 4P0AA 4HEAA 1QUUA 3LFMA 3OBVE 3LBXB 3CQXC 4BJMA 2DLRA 3O1IA 4QX8B 4CI3B 4JUYA 1MMNA 5BMVE 4I50E 2CEAA 2E8IA 4UV9B 5EK2A 2VWAA 3ESLA 3RYHE 4TV8E 5LHHB 5L3DB 1MIVA 2Y48B 4DBQA 3NRXA 3IHRA 3O4XE 4ISTA 4AKLA 2KZ7B 3LBXA 5LXTE 1H7CA 2DCFA 4G63A 2JMKA 1D1BA 3CKDA 2I59A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YK0 A;  3CPZ A;  4NUU A;  3BQK A;  3CML A;  3RRC A;  2Y8D A;  4YFS A;  5F3J A;  3C64 A;  2WAU A;  3BQI A;  4NUV A;  3BQL A; 
#chains in the Genus database with same CATH topology
 3KBT A;  2NTY A;  4ANJ A;  3UU8 A;  4A98 A;  4GK5 E;  2AXD S;  3AEC A;  2VL0 A;  5LJM A;  3UU4 A;  5EZY E;  4IT4 A;  2CHN A;  3Q5X A;  1HCI A;  2XAF B;  4HFV A;  2QYW A;  4WZX A;  4X62 T;  4CI1 B;  2X67 A;  2A3D A;  4UR9 A;  1ZV4 X;  4PK6 A;  1NAF A;  4OK0 A;  5LBQ B;  5H6Q B;  1XMQ T;  5J0Z A;  2Q9Q A;  3RX6 A;  2IW5 B;  3AAA B;  4NXN T;  3C50 A;  4A97 A;  3RRW A;  2JQQ A;  2LJL A;  2PBI A;  2YN6 A;  4HWF A;  1W0B A;  5FVL A;  2UUC T;  5HCJ A;  5JTG A;  2WBL A;  4EGW A;  3PDY A;  3B5M A;  2H7V C;  4IE0 A;  3TLS A;  3P4R A;  2CM0 A;  2YDR A;  2V6Y A;  4AIS A;  4YXD A;  2VVS A;  5L4H A;  5J2U E;  1XDP A;  3F57 A;  4TNW A;  5HXE A;  3LSV A;  2KMF A;  2K3W A;  4I43 B;  3ZMU B;  5KMG P;  5JDF A;  4M1P A;  2CBJ A;  3AAI A;  4A56 A;  5HXS A;  2XAH B;  5JDN A;  2LSY A;  5AQP B;  2X0Y A;  3MAC A;  4IDQ A;  2Q9Q D;  2KXP B;  3SOL A;  3RHW A;  2JMH A;  1ZHC A;  2OLT A;  3EUH A;  3OPC A;  4X20 E;  2L9Q A;  2E9X C;  4DV6 T;  1NEK A;  3T1Y T;  2CRB A;  3T1H T;  4P09 A;  1BR0 A;  2CPT A;  4UEL A;  4JYA T;  3L09 A;  1WYB A;  4AKG A;  1KNR A;  4HE8 A;  2YU2 A;  3RKO A;  1YW0 A;  1E2A A;  4HKA A;  4HFE A;  3RH3 A;  3UTK A;  3ZMV B;  3J7Y q;  2R6G F;  3MXZ A;  4ZS2 A;  3L8R A;  5L3G B;  2IC9 A;  4PJJ A;  5HEH A;  4OYJ A;  1S35 A;  3ANW B;  4O4J E;  1VRB A;  4PNI A;  2XQY A;  4CN1 A;  4AQF A;  2W4X A;  1EZ3 A;  4KP3 C;  4ADZ A;  3UU6 A;  2CA5 A;  1OED E;  2Y8D A;  4YSX A;  2ZM0 A;  3GMI A;  3RYC E;  4UXN B;  1M7K A;  2B1E A;  3AA0 B;  3F31 A;  2FJD A;  1XMO T;  3AED A;  4PJM A;  3L39 A;  3LG7 A;  3HR0 A;  1OWA A;  2BVM A;  4GKK T;  1HG2 A;  3GWH A;  1HTJ F;  4IL4 A;  1LRZ A;  3AE5 A;  3N9L A;  4LMJ A;  3I0O A;  1N36 T;  1FMV A;  4X5T A;  1US7 B;  3DJB A;  4TN7 B;  2WDV A;  3AEA A;  2W2U A;  3HKB E;  4F6R C;  4IL9 A;  4X66 T;  4EV6 A;  3C98 B;  4DO0 A;  1IBK T;  3I9Y A;  4QXH B;  3RPU A;  1VCS A;  5AQV B;  2GK9 A;  4CXY A;  2C5J A;  3ZCJ A;  2XQ8 A;  2A2F X;  4DBR A;  5J1G A;  1UUS A;  3NKZ A;  3IF8 B;  2K24 A;  2PJQ A;  4ZI2 D;  3O1J A;  1MMD A;  2W62 A;  3EVY A;  3Q9D A;  5JRC A;  5AQU B;  4WBN E;  4DND A;  2HN1 A;  3JAE A;  1HR0 T;  3UFG A;  2BS3 A;  2NW7 A;  2WAU A;  4O4L E;  3TLT A;  4EOZ B;  5E0O A;  4F8H A;  3AE6 A;  2XQA A;  5AQJ B;  2LRK A;  4X1Y E;  3HI2 A;  3PJA J;  2K48 A;  4Z91 A;  3FBZ A;  4H63 H;  3ZKR A;  3I9W A;  3RIU A;  4GOU A;  4YSY A;  2EHO A;  3PUV F;  3KV6 A;  1MND A;  4H9R C;  4KI0 F;  3ZYM A;  3GN5 A;  4DID B;  5ABG A;  3RIA A;  2XQ9 A;  3PE0 A;  1I6Z A;  5C8Y E;  3S4U A;  3ZJ2 A;  1BR2 A;  2J4G A;  2LLY A;  1YD8 G;  2X0H A;  3UQ7 A;  5EK3 A;  1E7P A;  2K5B B;  1WYC A;  1ZOY A;  4UVC B;  3AAE B;  4U72 A;  3G06 A;  3ONX A;  5CB4 E;  3ZYK A;  5DQW A;  4B6X A;  2RA1 A;  5ETW A;  2FUP A;  4NPP A;  2VKD A;  4U74 A;  3NVO A;  4DV4 T;  3HKC E;  1XNQ T;  4AKH A;  2WU2 A;  3KV4 A;  4EB6 E;  2NP9 A;  2UXN B;  3ZPO A;  1NEN A;  3BQI A;  2MTQ A;  3OYX A;  3T8O A;  4KHP T;  2EHO D;  3HKD E;  5FXX A;  2E9X B;  3OTO T;  5FYM A;  1MNE A;  5LOV E;  4P0A A;  2WU5 A;  1QUU A;  4DV7 T;  4QH4 A;  5AQS B;  4COF A;  2VWA A;  3ESL A;  1W0A A;  5LHH B;  5L3D B;  3LBX A;  1WR0 A;  1H7C A;  3SFE A;  2QRX A;  5FNV E;  5FL1 A;  2CWO A;  2NW8 A;  2BKO A;  4UV8 B;  3TKL B;  3EDV A;  2XAS B;  4DV1 T;  3ETU A;  2C5I T;  4JLE A;  2LSG A;  3MK7 C;  3PUA A;  4NUU A;  2Q9Q B;  2V26 A;  1OED C;  4UVA B;  1X79 A;  1E1H B;  2DI4 A;  5HWX A;  2YU1 A;  3AE7 A;  5L3E B;  2WSS V;  4PW8 A;  2Y6X A;  2RPA A;  2YIN A;  3M65 A;  3C64 A;  4L9I A;  3F2E A;  1CHU A;  3ZMS B;  4JBW F;  3B57 A;  4IIJ E;  5HXR A;  1FIO A;  2BG9 E;  4JI3 T;  3A5X A;  3AVR A;  2UU9 T;  2KND A;  2BBJ A;  3SRZ A;  4B3R T;  4YJ3 E;  4K0U A;  3HA4 A;  2XAG B;  1IZN B;  1L0V A;  3UUX B;  4X64 T;  3KDS E;  2ZM6 T;  4JV5 T;  5HXH A;  5LGT B;  3V5S A;  2X9Y A;  3NRY A;  4UIG A;  2PFV A;  2RP4 A;  3N2G E;  3J9X 1;  3PUQ A;  2IML A;  1IAP A;  1IJ5 A;  1G8X A;  4MBQ A;  3Q5W A;  2V7L A;  3QNU A;  4PFO A;  2WM9 A;  2JPF A;  4GYR A;  3OJA A;  4CZZ B;  2LM2 A;  3P50 A;  4H9O C;  3AA1 B;  2X9X A;  1BR1 A;  4ZI3 D;  4EXT A;  3MZK B;  3KVA A;  5ABF A;  3ZN0 B;  1UX5 A;  2W66 A;  2Z6E A;  4O2A E;  4ZOL E;  5HEG A;  5LHG B;  4TWD A;  5FMN A;  3IA3 A;  1VOM A;  5CA1 E;  2XAQ B;  4JI5 T;  5ABE A;  4H9P C;  1LVF A;  2V6X A;  3VRA A;  5AQR B;  3QB5 K;  3WI3 A;  1LKX A;  1QLB A;  4KX6 A;  4QWN B;  1X9B A;  3E22 E;  1N34 T;  4CI2 B;  2IHR 1;  5L4E A;  3KBU A;  3KIN B;  4JI0 T;  2BG9 A;  2V7J A;  3CWZ B;  4BA9 A;  4ILB A;  4ZZC A;  2D0T A;  1YKH B;  3P4S A;  2XUE A;  1YKE B;  2LRL A;  3RQW A;  4LF8 T;  4KBM B;  4E7S A;  2LSJ A;  2X68 A;  3LK4 2;  4ASK A;  2W67 A;  5CJ5 A;  2YOE A;  2JIW A;  2IUB A;  2LSK A;  2V7K A;  5L47 A;  4DMW A;  2IAK A;  3K1S A;  1N33 T;  5AQM B;  2VKJ A;  5FXZ A;  3ZCI A;  4YHH T;  1D1A A;  2W00 A;  2XM1 A;  4TNV A;  1GQE A;  4ILU A;  5CA0 E;  5FXW A;  3Q2M A;  4A5X A;  3CVR A;  5KDM C;  5AQO B;  3FXE B;  3LDQ B;  4MAL A;  3ZYL A;  2VUR A;  5JH7 E;  4Q25 A;  4ZS3 A;  2H7O A;  3QB5 A;  3AXJ A;  2UUA T;  3HL6 A;  1ZKE A;  2K9A A;  3FZH B;  3P4P A;  5JR9 A;  2CBI A;  2KIN B;  2N2N A;  1CUN A;  3ABV A;  5JRC B;  4ZEY A;  3U3I A;  2MYS A;  2E5V A;  3EAM A;  3WAK A;  3LJC A;  3HKE E;  2KWH A;  4ZZB A;  3ZEF B;  3LK3 B;  2HN2 A;  3FZM B;  4AXP A;  5F8P A;  3ZMT B;  3UUN A;  2Q9Q C;  2V8S V;  3JAF A;  4Z90 A;  2IC6 A;  1OED B;  4PAG A;  1IJ6 A;  2EHO B;  4AI6 A;  4MLK A;  5JDG A;  3GN5 B;  4YFS A;  2A72 A;  3CQC B;  1QSD A;  3B13 A;  3O9X A;  2C0S A;  3ZC1 A;  1XZY A;  3PUZ F;  2BDE A;  3UU5 A;  5DJQ C;  3UUM A;  3H37 A;  4X65 T;  4JEU B;  2XM2 A;  3NZQ A;  2DNX A;  3BQL A;  2CWY A;  2XJ7 A;  2X51 A;  4B3S T;  4IDO A;  3NZP A;  5KX5 E;  2M6I A;  1V9D A;  2YDQ A;  1T98 A;  3K3N A;  5L2L A;  2L8K A;  4LFC T;  1VCT A;  2YEV C;  4EEB A;  2LHR A;  2WDR A;  5LNK A;  4U7I A;  3PUG A;  3N9M A;  3A7M A;  5LCY A;  4ISS A;  1U5P A;  4KUM B;  4IE6 A;  4HEA A;  3OBV E;  4CN4 A;  3LBX B;  4BJM A;  3O1I A;  2CHO A;  1MMN A;  4JUY A;  5BMV E;  2CEA A;  4UV9 B;  4DR5 T;  3RYH E;  2Y48 B;  3NRX A;  3IHR A;  3AEF A;  3O4X E;  4AKL A;  2LKH A;  2YKS A;  1D1B A;  3CKD A;  2I59 A;  2V7M A;  3E0Z A;  3BQK A;  4JI1 T;  2X0L B;  3DP7 A;  2LE8 A;  4MFR A;  4L0R A;  5LMU T;  3ZT6 A;  4HWC A;  5LGU B;  3PV0 F;  4AQF C;  3D0T A;  2VVN A;  5DAB A;  5HEJ A;  4LFA T;  2AE9 A;  3AE2 A;  2WZH A;  4YT0 A;  3L3P A;  2D9D A;  3AE3 A;  2HHH T;  3VKG A;  4IRE A;  4ZI2 C;  3VR8 A;  3CQG B;  2DWK A;  2XZE A;  4JI8 T;  3CIR A;  5FXV A;  4HFI A;  2LHN A;  3QK6 A;  3C4Z A;  5AQH B;  5HXC A;  3EDU A;  3CML A;  2OV9 A;  4QH5 A;  4ILC A;  3ETV A;  3PUX F;  3AA6 B;  1Z8U A;  3K3O A;  2X9H A;  1YQ4 A;  3VKH A;  3VRB A;  1HX1 B;  2QVA A;  4YY3 T;  2YDS A;  2MBG A;  5HAX A;  4HFH A;  1IBL T;  1HFA A;  4NUV A;  5IHY A;  5LGN B;  2VQE T;  3TLU A;  5AQN B;  2OA5 A;  4DUY T;  5AQT B;  5JDM A;  2BVL A;  3FHN A;  1SHZ C;  2V7I A;  1J5E T;  2SPC A;  4TUY E;  1FJG T;  3ONL C;  4U7Y A;  4JI6 T;  5LP6 E;  3QC9 A;  5DQV A;  3RC3 A;  2FJB A;  5EK4 A;  3N2K E;  5HYA A;  4OX9 T;  1Y64 B;  3PUW F;  2D0U A;  2DL1 A;  4Z8X A;  5ABF B;  3N2O A;  5J2T E;  4QXC B;  2MPK A;  1HX8 A;  3RQU A;  5IUX A;  5JDH A;  4JEH B;  1HF8 A;  2JQK A;  5BR8 T;  1UX4 A;  3AE4 A;  4P0B A;  3RIU C;  1WRD A;  2EHO C;  3RF1 A;  2XQ7 A;  2VL8 A;  1HNZ T;  4E7Z A;  4AKI A;  4DV2 T;  3N9P A;  1JNR A;  2ZM8 A;  2B76 A;  4DV0 T;  1XWM A;  2BG9 B;  4U33 A;  1B7T A;  2WS3 A;  5AQQ B;  2JRK A;  4CQI A;  2BBH A;  4DR7 T;  4LML A;  2H88 A;  2C5K T;  1D0Y A;  5ABH A;  3CX6 B;  2UXB T;  3JC6 D;  1MIY A;  4DR1 T;  2V6Y B;  1LVK A;  4B3T T;  4XZC A;  4QHO A;  3FXD B;  2V1D B;  5JDL A;  3TLV A;  3RGL A;  4TX5 A;  1KFY A;  5LJN A;  3TLW A;  1T72 A;  5FY0 A;  1UCU A;  3MJX A;  4CN6 A;  4IHJ E;  5JDQ A;  4TWH A;  2V5D A;  3R84 B;  2FJE A;  2ACZ A;  5LYJ E;  2HPL A;  1J1J A;  2CLY B;  4DR2 T;  4EZH A;  2ODV A;  4DV3 T;  3UUB A;  5AQK B;  4I4T E;  3KV9 A;  3FBL A;  2PTF A;  4X1K E;  3PTR B;  3FZL B;  3PUY F;  1J5W A;  5JR9 B;  3AE9 A;  4HTE A;  1SA0 E;  4QKN A;  4EIW A;  2WP9 A;  4JI7 T;  4HFD A;  2V5C A;  2G0U A;  3FB2 A;  3ZMZ B;  1S94 A;  2LOP A;  4YTM A;  4WW0 A;  4HFB A;  2E9X A;  4N78 D;  3N5L A;  1ZEE A;  2M67 A;  3N9O A;  4EZ4 A;  2DHR A;  3AEB A;  2P9B A;  3Q5E A;  4YSZ A;  3SWH A;  4OHF A;  3AVS A;  4PK4 A;  1MIW A;  5LHI B;  4WNK A;  3IBP A;  2JQH A;  5CFB A;  3NWI A;  2YK0 A;  3DTO A;  3NBX X;  3Q5D A;  1T7S A;  5FVK A;  3PU8 A;  2UUB T;  3LK2 B;  4DUZ T;  5FP3 A;  4ZI3 C;  3PJA A;  3MA9 A;  3ZSS A;  4LF5 T;  4DR3 T;  1YXR A;  2D2S A;  2L3L A;  5F3J A;  3P4Q A;  4IDZ A;  2CXF A;  2WMN A;  5FY7 A;  3AEE A;  4I0U A;  2HPJ A;  2E9X D;  4QX7 B;  4HWI B;  1UGO A;  2LT3 A;  2WMO A;  2BS2 A;  3PUS A;  2XAJ B;  5LA6 E;  4ZXL A;  2A9U A;  2ODU A;  1MMA A;  3N9Q A;  1O3X A;  1HG5 A;  4WYV A;  5L3B B;  5M4Y A;  3OYZ A;  1DU2 A;  2WB5 A;  1WLX A;  3EAB A;  2ZM2 A;  2E5L T;  4IE7 A;  3ONJ A;  5AQG B;  4BJN A;  4KMC A;  4K0K T;  3UU3 A;  5IWA T;  2UXD T;  4YTN A;  4U2Y A;  5AQF B;  5TAO A;  4LFB T;  5L3F B;  4UF0 A;  5FL0 A;  1KNP A;  2H3R A;  5H6R B;  4EED A;  2HH7 A;  2DLR A;  4CI3 B;  2E8I A;  1SE7 A;  5EK2 A;  4TV8 E;  4LF9 T;  4DBQ A;  4IST A;  5LXT E;  2DCF A;  4G63 A;  2JMK A;  5FKY A;  2CXD A;  4HFC A;  2IIU A;  5LG4 A;  4GKJ T;  4P1N A;  4BAY B;  2LKG A;  4DR4 T;  2XHE B;  3X1D A;  3GA8 A;  2BZB A;  2WDQ A;  2NW9 A;  3K8P C;  1U4Q A;  4PFP A;  3RKG A;  1JNZ A;  1UK5 A;  3V5U A;  5LMN T;  3QOF A;  4DR6 T;  1SUM B;  4XAX B;  1D1C A;  1ZP0 A;  3UUL A;  2NTX A;  2BG9 C;  3AA7 B;  2VKO A;  2N9D A;  1Y01 A;  4XBF B;  4C91 A;  2ZMA A;  5C3J A;  4GIW A;  2CE7 A;  2XSB A;  5LBM A;  2QA7 A;  3EI0 A;  3RYF E;  2WY2 A;  2XTL A;  2I0M A;  4O2B E;  4ERR A;  3MKD A;  2LOS A;  1D0Z A;  4EAH A;  4IE5 A;  1W9R A;  2IDO B;  5HEO A;  1FEW A;  3WAJ A;  4LF6 T;  2X9W A;  4QXB B;  2WCA A;  4J2C A;  5FY1 A;  4YJ2 E;  3R6N A;  2BS4 A;  5HCM A;  3OVU A;  2MAW A;  5LB7 B;  5AFU L;  5JQG E;  2CLY C;  2H89 A;  3C51 A;  4KHZ F;  5AQL B;  3ZT5 A;  3P4W A;  2MOZ A;  4HN9 A;  3ZST A;  2XQ4 A;  1HNX T;  2J47 A;  3H3M A;  2XSA A;  2CCQ A;  5JR9 C;  2XQ6 A;  5KXJ A;  3KVB A;  4I55 E;  4NIQ A;  2LEH A;  2F4V T;  3SS1 A;  3UT5 E;  5A1L A;  1NWM X;  4YLH A;  1WR6 A;  3P8C D;  2M6B A;  4FJO A;  3FZF B;  4LF7 T;  1HS7 A;  2ZLY A;  5JRE A;  4DMV A;  1D0X A;  4CXX A;  4H63 V;  4B3M T;  3C4X A;  3RYI E;  2X66 A;  4H9S E;  4IDN A;  4OYK A;  2WWU A;  4YTP A;  3PU3 A;  2W61 A;  2NWB A;  3C4W A;  1AJ3 A;  3UFE A;  3EHZ A;  3U78 A;  3QUJ A;  3AE1 A;  2ACX A;  3ANW A;  4GK0 E;  1OED A;  1BR4 A;  5ADX L;  4GYS A;  4TZ4 C;  5JVD E;  4ILA A;  5IYZ E;  2I6H A;  3M3Z B;  1UUR A;  4UVB B;  3RIF A;  3KFW X;  3IEE A;  4FI5 A;  1T8B A;  5F5W A;  3P7I A;  3K3Q C;  3VU7 H;  3AB3 B;  4O4I E;  4O4H E;  1KEY A;  4U3C A;  4ZHQ E;  5AQI B;  2N1G A;  2VKH A;  4L5G A;  2BKN A;  4G2A A;  4IE4 A;  5CGM A;  1W09 A;  3ZJ1 A;  2CXL A;  3CPZ A;  4PJL A;  4HGA A;  2W0G A;  4LMK A;  4TWF A;  3SFD A;  4JI2 T;  3O1H A;  2WZI A;  4CXW A;  2LSI A;  3I1A A;  4U2Z A;  2ES0 A;  2FJA A;  2VAS A;  2KLQ A;  4JI4 T;  1XNR T;  1XDO A;  2VQF T;  4AQG A;  3BK9 A;  3H3A A;  4AKR B;  4X1I E;  4PK5 A;  2NOX A;  3PUR A;  4C90 A;  5GON E;  4UEM A;  2VB6 A;  3E08 A;  4DVD A;  3JAD A;  4IGU A;  3RC8 A;  4V1A v;  1N32 T;  2W63 A;  2KWI B;  4HWH A;  1OXZ A;  5HEU A;  1HNW T;  5LG3 A;  2XQ5 A;  1I94 T;  1WCR A;  3A8Y C;  3RLF F;  4WBO A;  4PJN A;  4U31 A;  4AIU A;  2PG8 A;  2KT9 A;  3JCF A;  5HWY A;  2D5U A;  2XQ3 A;  3RRC A;  3CX7 B;  1YQ3 A;  2NR4 A;  3W15 B;  3CK6 A;  2WQY A;  2JQ9 A;  3I0Q A;  4EYU A;  2J62 A;  1KNZ A;  1IBM T;  2KSR A;  1G73 A;  2FBW A;  2WWV A;  3UQ4 A;  3N9N A;  1FMW A;  4ZI7 E;  3KV5 A;  2VK9 A;  4YHJ A;  3RI5 A;  3CX8 B;  1KF6 A;  4H9N C;  4MHC A;  4OFZ A;  4O8S A;  1WFD A;  2UXX B;  2JJ9 A;  1MMG A;  2J1D G;  3FZK B;  3OKQ A;  4H9Q C;  2XPK A;  2CMR A;  4AQY T;  2DWG A;  3ZLI A;  2QGS A;  4TV9 E;  4UF0 B;  3ZN1 B;  3AXJ B;  2UXC T;  2LM9 A;  4NXM T;  3AEG A;  3JC6 C;  3ZT7 A;  5L3C B;  1R8I A;  3AE8 A;  4LF4 T;  4QH1 A;  2BKP A;  3VHL A;  1KK7 A;  3VR9 A;  4IDP A;  2XY8 B;  4HWD A;  1Z0P A;  4DV5 T;  3ZC0 A;  3LFM A;  3CQX C;  4QX8 B;  1M62 A;  5C2T A;  4I50 E;  1MIV A;  2KZ7 B;  2E2A A;  4EYY R; 
#chains in the Genus database with same CATH homology
 3KBT A;  2NTY A;  4ANJ A;  2CXD A;  5FNV E;  5LG4 A;  2V7M A;  3E0Z A;  3BQK A;  4BAY B;  4GK5 E;  2CWO A;  2NW8 A;  2X0L B;  3DP7 A;  5LJM A;  5EZY E;  2XHE B;  2LE8 A;  3GA8 A;  4MFR A;  4L0R A;  2BZB A;  4UV8 B;  3TKL B;  2NW9 A;  3EDV A;  3K8P C;  2XAS B;  1U4Q A;  3Q5X A;  1HCI A;  4PFP A;  5LGU B;  2XAF B;  4HFV A;  3ETU A;  4AQF C;  2C5I T;  4JLE A;  4CI1 B;  3V5U A;  3D0T A;  2LSG A;  3MK7 C;  3PUA A;  4NUU A;  2X67 A;  2Q9Q B;  2V26 A;  5DAB A;  2A3D A;  4UVA B;  1X79 A;  1E1H B;  2DI4 A;  5HWX A;  1ZV4 X;  3L3P A;  1D1C A;  4XAX B;  2YU1 A;  4PK6 A;  2NTX A;  3UUL A;  1NAF A;  3AA7 B;  4OK0 A;  2VKO A;  5L3E B;  5LBQ B;  5H6Q B;  2Q9Q A;  2WSS V;  4PW8 A;  2Y6X A;  3RX6 A;  2N9D A;  2YIN A;  3M65 A;  4XBF B;  4C91 A;  2IW5 B;  3C64 A;  2ZMA A;  4L9I A;  3AAA B;  3VKG A;  3C50 A;  3F2E A;  4GIW A;  3ZMS B;  2CE7 A;  4ZI2 C;  5LBM A;  2QA7 A;  3RRW A;  3RYF E;  3CQG B;  2XTL A;  2DWK A;  3B57 A;  4O2B E;  4IIJ E;  5HXR A;  2JQQ A;  1FIO A;  2LJL A;  5FXV A;  2LHN A;  4ERR A;  3QK6 A;  3C4Z A;  2PBI A;  3MKD A;  3A5X A;  2LOS A;  3AVR A;  5HXC A;  2KND A;  3SRZ A;  4YJ3 E;  3EDU A;  3CML A;  2WBL A;  1D0Z A;  4EAH A;  3PDY A;  4K0U A;  3HA4 A;  4IE5 A;  2H7V C;  2XAG B;  4IE0 A;  1IZN B;  3UUX B;  1FEW A;  3ETV A;  3WAJ A;  2CM0 A;  3AA6 B;  3KDS E;  2X9W A;  4QXB B;  4J2C A;  5FY1 A;  3K3O A;  5HXH A;  5LGT B;  4YJ2 E;  2X9H A;  3V5S A;  5J2U E;  3R6N A;  3F57 A;  2X9Y A;  3VKH A;  3NRY A;  5HXE A;  2KMF A;  4UIG A;  2PFV A;  4I43 B;  2RP4 A;  5AFU L;  2MBG A;  3N2G E;  3ZMU B;  5HAX A;  5JQG E;  3PUQ A;  2CLY C;  3J9X 1;  1HFA A;  4NUV A;  5IHY A;  3C51 A;  4M1P A;  5JDF A;  5KMG P;  5LGN B;  3AAI A;  1IAP A;  1IJ5 A;  1G8X A;  2MOZ A;  2OA5 A;  4MBQ A;  4A56 A;  4HN9 A;  5HXS A;  5JDM A;  2BVL A;  3FHN A;  1SHZ C;  2V7I A;  2XAH B;  3Q5W A;  5JDN A;  2LSY A;  2V7L A;  2CCQ A;  4PFO A;  5JR9 C;  3MAC A;  2Q9Q D;  2WM9 A;  2SPC A;  4TUY E;  2KXP B;  3SOL A;  3KVB A;  4I55 E;  2JPF A;  2JMH A;  1ZHC A;  3EUH A;  2LEH A;  4GYR A;  3SS1 A;  3UT5 E;  3OJA A;  4X20 E;  4CZZ B;  2L9Q A;  5A1L A;  1NWM X;  5LP6 E;  2E9X C;  4YLH A;  1WR6 A;  3QC9 A;  3P8C D;  5DQV A;  3RC3 A;  4FJO A;  4P09 A;  1BR0 A;  5EK4 A;  4UEL A;  3N2K E;  5HYA A;  3L09 A;  1WYB A;  3AA1 B;  4H9O C;  2X9X A;  1HS7 A;  4AKG A;  2ZLY A;  1Y64 B;  5JRE A;  4DMV A;  2D0U A;  4Z8X A;  1BR1 A;  4ZI3 D;  4EXT A;  1D0X A;  3MZK B;  3N2O A;  4CXX A;  5J2T E;  4QXC B;  4H63 V;  4HE8 A;  2YU2 A;  3RKO A;  1YW0 A;  3C4X A;  4HKA A;  3RYI E;  1HX8 A;  2X66 A;  3RH3 A;  3UTK A;  5JDH A;  4H9S E;  3ZMV B;  3J7Y q;  3KVA A;  4JEH B;  3ZN0 B;  3MXZ A;  1HF8 A;  4ZS2 A;  4OYK A;  2WWU A;  1UX5 A;  2Z6E A;  4O2A E;  4ZOL E;  3PU3 A;  5LHG B;  2W61 A;  5FMN A;  5L3G B;  1UX4 A;  4P0B A;  1VOM A;  2IC9 A;  5CA1 E;  4PJJ A;  2XAQ B;  1WRD A;  2EHO C;  2NWB A;  2VL8 A;  3C4W A;  4H9P C;  1AJ3 A;  4OYJ A;  1LVF A;  1S35 A;  4E7Z A;  3ANW B;  4O4J E;  3UFE A;  3N9P A;  4AKI A;  1VRB A;  4PNI A;  2XQY A;  3WI3 A;  1LKX A;  2ZM8 A;  3U78 A;  4QWN B;  3QUJ A;  4AQF A;  3E22 E;  1EZ3 A;  2ACX A;  1B7T A;  4KP3 C;  3ANW A;  4CI2 B;  2JRK A;  4ADZ A;  4GK0 E;  4CQI A;  2CA5 A;  1BR4 A;  2Y8D A;  5ADX L;  4GYS A;  3KBU A;  3KIN B;  2ZM0 A;  4TZ4 C;  5JVD E;  2V7J A;  3CWZ B;  4BA9 A;  3GMI A;  5IYZ E;  3RYC E;  2C5K T;  1D0Y A;  2D0T A;  1YKH B;  3CX6 B;  4UVB B;  2XUE A;  3JC6 D;  4UXN B;  1YKE B;  3KFW X;  3IEE A;  4FI5 A;  1MIY A;  1LVK A;  2B1E A;  4XZC A;  3P7I A;  4QHO A;  3K3Q C;  3FXD B;  3AA0 B;  2V1D B;  3F31 A;  3VU7 H;  3AB3 B;  4O4I E;  4PJM A;  4O4H E;  4KBM B;  3LG7 A;  2LSJ A;  2X68 A;  3LK4 2;  4ASK A;  4E7S A;  3HR0 A;  5JDL A;  1OWA A;  2BVM A;  4TX5 A;  5LJN A;  4ZHQ E;  2N1G A;  2VKH A;  4L5G A;  1HG2 A;  4G2A A;  3GWH A;  1HTJ F;  4IE4 A;  1LRZ A;  2LSK A;  2V7K A;  5FY0 A;  3N9L A;  1UCU A;  3ZJ1 A;  3MJX A;  4DMW A;  2CXL A;  2IAK A;  3I0O A;  3CPZ A;  1FMV A;  4PJL A;  2VKJ A;  4HGA A;  4IHJ E;  2W0G A;  5FXZ A;  5JDQ A;  3ZCI A;  1US7 B;  3DJB A;  1D1A A;  3R84 B;  2W00 A;  4TN7 B;  5LYJ E;  2HPL A;  3O1H A;  4ILU A;  3HKB E;  5CA0 E;  4CXW A;  2CLY B;  5FXW A;  2LSI A;  4F6R C;  3I1A A;  4EZH A;  2ODV A;  2ES0 A;  3Q2M A;  2VAS A;  4I4T E;  2KLQ A;  3KV9 A;  3FBL A;  4X1K E;  3CVR A;  5KDM C;  3PTR B;  3FXE B;  4MAL A;  3C98 B;  4DO0 A;  3ZYL A;  4AQG A;  3BK9 A;  3H3A A;  4AKR B;  3I9Y A;  4QXH B;  4ZS3 A;  2H7O A;  5JH7 E;  5JR9 B;  3RPU A;  4X1I E;  4PK5 A;  2NOX A;  3PUR A;  1SA0 E;  4HTE A;  2GK9 A;  5GON E;  4C90 A;  4UEM A;  4QKN A;  4CXY A;  3HL6 A;  1ZKE A;  2C5J A;  2VB6 A;  3E08 A;  4DVD A;  4EIW A;  3ZCJ A;  4IGU A;  3RC8 A;  2A2F X;  2K9A A;  2G0U A;  3FB2 A;  4DBR A;  5JR9 A;  4V1A v;  2KIN B;  5J1G A;  2N2N A;  1CUN A;  3ZMZ B;  1S94 A;  2LOP A;  3IF8 B;  2K24 A;  5JRC B;  2W63 A;  4WW0 A;  2KWI B;  2E9X A;  2PJQ A;  4N78 D;  1OXZ A;  4ZI2 D;  3O1J A;  1MMD A;  3N5L A;  3U3I A;  1ZEE A;  2MYS A;  2W62 A;  3EVY A;  3WAK A;  3LJC A;  3HKE E;  2M67 A;  3N9O A;  4EZ4 A;  2KWH A;  3Q9D A;  5JRC A;  2DHR A;  2P9B A;  4WBN E;  4DND A;  4WBO A;  4PJN A;  3ZEF B;  3LK3 B;  3SWH A;  4OHF A;  2NW7 A;  2WAU A;  3AVS A;  4O4L E;  4AXP A;  4PK4 A;  5F8P A;  1MIW A;  2PG8 A;  4EOZ B;  2KT9 A;  3ZMT B;  5HWY A;  3UUN A;  5E0O A;  2D5U A;  5LHI B;  4WNK A;  2Q9Q C;  3IBP A;  4X1Y E;  3RRC A;  3CX7 B;  2IC6 A;  3HI2 A;  4EYY R;  4PAG A;  2YK0 A;  3W15 B;  1IJ6 A;  3DTO A;  2EHO B;  2K48 A;  3NBX X;  3FBZ A;  4H63 H;  4AI6 A;  4MLK A;  5JDG A;  3GN5 B;  3I9W A;  3I0Q A;  3PU8 A;  4YFS A;  4GOU A;  4EYU A;  2EHO A;  2A72 A;  3LK2 B;  3CQC B;  3KV6 A;  1MND A;  4H9R C;  1KNZ A;  1QSD A;  3B13 A;  5FP3 A;  3O9X A;  2C0S A;  4ZI3 C;  3GN5 A;  3ZC1 A;  3ZYM A;  3MA9 A;  3PE0 A;  5C8Y E;  2D2S A;  1G73 A;  2L3L A;  3N9N A;  5F3J A;  1FMW A;  4ZI7 E;  2BDE A;  3KV5 A;  3S4U A;  5DJQ C;  2VK9 A;  3UUM A;  4IDZ A;  2CXF A;  3ZJ2 A;  1BR2 A;  2WMN A;  3H37 A;  4YHJ A;  3CX8 B;  5FY7 A;  1YD8 G;  4H9N C;  4MHC A;  2HPJ A;  4JEU B;  4OFZ A;  2E9X D;  4O8S A;  4QX7 B;  5EK3 A;  2UXX B;  2JJ9 A;  1MMG A;  2J1D G;  2LT3 A;  2WMO A;  3PUS A;  2XAJ B;  5LA6 E;  2ODU A;  3NZQ A;  2K5B B;  1WYC A;  2DNX A;  1MMA A;  3AAE B;  3BQL A;  3N9Q A;  1O3X A;  3OKQ A;  4U72 A;  4UVC B;  1HG5 A;  3ONX A;  2CWY A;  5L3B B;  5CB4 E;  3ZYK A;  5M4Y A;  3OYZ A;  2X51 A;  1WLX A;  5DQW A;  2ZM2 A;  4H9Q C;  4B6X A;  2RA1 A;  5ETW A;  2CMR A;  3NZP A;  4IE7 A;  5KX5 E;  2DWG A;  2VKD A;  4U74 A;  1V9D A;  3ZLI A;  4BJN A;  3HKC E;  4KMC A;  1T98 A;  2QGS A;  3K3N A;  4TV9 E;  4UF0 B;  3ZN1 B;  2L8K A;  5L2L A;  4AKH A;  2LM9 A;  2YEV C;  2LHR A;  3KV4 A;  3JC6 C;  4EB6 E;  5TAO A;  5LNK A;  2NP9 A;  2UXN B;  5L3F B;  3ZPO A;  4UF0 A;  3PUG A;  5L3C B;  3N9M A;  3BQI A;  2MTQ A;  3OYX A;  5LCY A;  3T8O A;  4ISS A;  2EHO D;  1U5P A;  4KUM B;  3HKD E;  2H3R A;  3VHL A;  1KK7 A;  5FXX A;  4IE6 A;  5H6R B;  2E9X B;  1Z0P A;  2HH7 A;  3ZC0 A;  5FYM A;  1MNE A;  5LOV E;  4P0A A;  4HEA A;  1QUU A;  3LFM A;  3OBV E;  3LBX B;  3CQX C;  4BJM A;  2DLR A;  3O1I A;  4QX8 B;  4CI3 B;  4JUY A;  1MMN A;  5BMV E;  4I50 E;  2CEA A;  2E8I A;  4UV9 B;  5EK2 A;  2VWA A;  3ESL A;  3RYH E;  4TV8 E;  5LHH B;  5L3D B;  1MIV A;  2Y48 B;  4DBQ A;  3NRX A;  3IHR A;  3O4X E;  4IST A;  4AKL A;  2KZ7 B;  3LBX A;  5LXT E;  1H7C A;  2DCF A;  4G63 A;  2JMK A;  1D1B A;  3CKD A;  2I59 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...