3C64A

The mc179 portion of the cysteine-rich interdomain region (cidr) of a plasmodium falciparum erythrocyte membrane protein-1 (pfemp1)
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
166
structure length
152
Chain Sequence
b'DKIMSYNAFFWMWVHDMLIDSIKWRDEHGCNKKCICFQKWVEQKKTEWGKIKDHFRKQKDIPKDWTHDDFLQTLLMKDLLLEIIQDTYGDANEIKRIEALLEQAGVGGIDFAALAGLYTKGFVAEKDTTIDKLLQHEQKEADKCLKTHTDDT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PfEMP1 variant 2 of strain MC
publication title The Cysteine-Rich Interdomain Region from the Highly Variable Plasmodium falciparum Erythrocyte Membrane Protein-1 Exhibits a Conserved Structure.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Cd36-binding protein,cell adhesion
total genus 58
structure length 152
sequence length 166
ec nomenclature
pdb deposition date 2008-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03011 PFEMP PFEMP DBL domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.830 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3c64A00
2YK0A 3BQIA 2WAUA 3RRCA 4YFSA 3BQKA 4NUVA 5F3JA 3BQLA 3CPZA 3C64A 4NUUA 2Y8DA 3CMLA
chains in the Genus database with same CATH superfamily
2WSSV 2VVSA 2UUBT 1HNXT 1D0ZA 2V7JA 3EHZA 2XTLA 4U2YA 2W00A 1MMAA 3PJAA 3KFWX 4YHHT 3HR0A 4HKAA 1NWMX 4U74A 4EV6A 4U33A 3OKQA 2VKHA 4PFOA 3S4UA 3TLUA 3RX6A 4PJLA 4UELA 4LF5T 1T72A 4DNDA 2ZM8A 4H9SE 4BAYB 4MFRA 1W0BA 2XUEA 2IMLA 2Q9QC 3FBLA 1MMGA 3K3QC 4U3CA 2M6BA 5CA0E 3RIUA 4YSZA 4ZZBA 2A72A 2V7IA 2MTQA 3L3PA 5DABA 3GMIA 3MKDA 5ABFB 1XDPA 5KMGP 2J1DG 1T7SA 4X20E 3HKDE 4HWFA 3AEDA 5AQRB 2XQ7A 3AA1B 1YKHB 5H6QB 1HNWT 1HS7A 2W66A 3QC9A 3FXDB 5AQTB 5L3FB 4B3TT 4DBRA 1H7CA 5KXJA 2ES0A 2IHR1 3W15B 4O4LE 5LJNA 4ASKA 1V9DA 4X1YE 3UTKA 2H88A 3ZMSB 3RC8A 4DV1T 2VWAA 1U5PA 1Y64B 3WAKA 2JRKA 2BS2A 3P4PA 5FMNA 2H7VC 2I0MA 4H9RC 3I1AA 3Q5DA 3UQ7A 3E08A 4H9OC 4IL4A 1WR0A 3CX8B 3O1HA 3AEGA 3A5XA 5JTGA 3K8PC 3VR8A 3AA0B 4GK5E 2WU2A 2K3WA 3GWHA 3ANWA 1FMVA 5F8PA 4YFSA 4H9QC 3PURA 2NW8A 1UURA 4CN4A 4ZZCA 1I6ZA 3Q2MA 5FVLA 3H37A 3K1SA 3U78A 5J2UE 4A5XA 2MOZA 3JC6D 5AQQB 2Q9QB 3BQKA 4QH1A 3A8YC 2WCAA 1FMWA 5CJ5A 1MMNA 3DP7A 2RA1A 1YXRA 5JDHA 2NTXA 5FL1A 4I43B 5JDQA 4ILUA 2PBIA 4E7ZA 3GN5B 4EIWA 3AEBA 2WQYA 2PTFA 4CXYA 3G06A 2JQQA 2E9XC 3SWHA 2LSIA 4QXCB 2UUAT 2CMRA 4CXWA 2WDRA 2DCFA 1LRZA 3UUMA 2XQYA 5L2LA 4AKHA 3UULA 4JUYA 2Y6XA 3LJCA 5JR9A 2OA5A 4UF0B 3MZKB 2NOXA 2YDSA 4KUMB 4NUVA 3CQGB 4CXXA 1SUMB 5JDFA 2JJ9A 2CWYA 4ERRA 3IBPA 3RHWA 3KVBA 1GQEA 4UVBB 3UU3A 3OJAA 1HG5A 2E2AA 1OWAA 3VR9A 4JI0T 2V6YA 4G2AA 2YK0A 4QXBB 5L3BB 1WLXA 3CPZA 5FXWA 3ONXA 4L9IA 4QHOA 2K5BB 3C51A 1AJ3A 4AI6A 3PUZF 5HWXA 3I9WA 1O3XA 3AE3A 2V7LA 5H6RB 4JI7T 3UUBA 3ZYMA 3JAFA 4ZXLA 3KV4A 4EYYR 5LXTE 1YW0A 4IE6A 3ZMUB 2SPCA 3DTOA 5HEJA 2E9XB 5LCYA 1BR2A 3HI2A 3KDSE 4AXPA 3LG7A 2HN1A 5AQSB 4YJ2E 1X9BA 2DHRA 3AE5A 4AQFC 2EHOA 2V5DA 4WNKA 4KMCA 4UXNB 3EAMA 3OYXA 1LKXA 2VKJA 1QLBA 4ADZA 1XMOT 3AAIA 4QKNA 3P4WA 1KK7A 3UT5E 3RRWA 2HPJA 4IHJE 1BR1A 4IE5A 4AKGA 1G73A 2XHEB 2HN2A 5AQVB 5LYJE 3QNUA 1VRBA 4HFEA 3CIRA 1KNRA 4PJMA 3CX6B 3EVYA 4JI1T 5LNKA 2DI4A 2ZM6T 3IF8B 3L8RA 2UXBT 3PE0A 5JH7E 1WYBA 4DR4T 3NZQA 3UQ4A 2LSKA 4JEHB 5KDMC 3V5UA 2KWIB 3PV0F 3UU6A 3RYHE 5L4HA 2PJQA 2VL8A 4U7YA 3ZMZB 3VHLA 1UX5A 2MAWA 4LMJA 3NZPA 1YD8G 3NRYA 2LT3A 2IIUA 1ZP0A 2EHOD 5FY1A 3Q9DA 4ZHQE 3MXZA 5ADXL 2X67A 1OEDA 2J62A 1S94A 5FL0A 3ZC0A 2LKGA 3PU3A 2BZBA 2IDOB 2WS3A 1HX1B 4AISA 1WR6A 3X1DA 4MALA 4UVCB 2D0UA 2W0GA 2VURA 3C98B 4KHPT 4IGUA 2X9YA 4CI2B 5L4EA 5LGTB 4HE8A 1R8IA 5FNVE 3AE1A 2V7KA 2F4VT 5J2TE 4ISTA 2QRXA 3E22E 3LSVA 3EDVA 4K0UA 4QWNB 4DR1T 2BG9E 3N2OA 2XQ4A 2WWVA 1IJ5A 4JI5T 3Q5XA 3ZC1A 1HR0T 2BKPA 3AAAB 4IREA 3P8CD 1HTJF 3ZYLA 5JREA 2QVAA 3RI5A 1D1BA 1WCRA 4WBNE 4TX5A 4IE7A 4ZS3A 4P0BA 2UXDT 2XAQB 5EZYE 3KV9A 4CN6A 5LHGB 4JYAT 3T1HT 1E7PA 3OTOT 4YSXA 1CHUA 3C4WA 3QUJA 3F31A 3ZKRA 4WYVA 4QH4A 2Q9QA 4AQYT 4EYUA 3BK9A 3CMLA 2LJLA 3J9X1 1FEWA 4EZHA 4AKLA 4BJNA 4BJMA 1Z0PA 5C8YE 3Q5WA 4U2ZA 4IDOA 5HXHA 5LMUT 4HEAA 2YU1A 2KINB 4YTNA 2C5KT 2KXPB 1NEKA 3NVOA 3ZN0B 2WB5A 3AVSA 4C90A 4LFBT 4CI1B 1N36T 1MIYA 4JI8T 5AQIB 4LMKA 2XQ5A 1HCIA 3FZLB 1KNZA 3SFDA 4NXNT 2VKOA 1N33T 3I0QA 2D2SA 2WWUA 1UK5A 3LBXA 1XMQT 4HN9A 4JEUB 5J1GA 1MNDA 2JQ9A 2YDRA 2QYWA 4ZI3D 2LOSA 3AA6B 3A7MA 2LKHA 3K3NA 1VCTA 2I59A 2CM0A 2LM9A 2XQ3A 2XPKA 2Q9QD 2NR4A 2QGSA 4DBQA 5FXVA 5JQGE 1W0AA 3O9XA 3KBTA 4CN1A 4MHCA 4OK0A 4U72A 2ZM0A 3TLVA 3ZLIA 1IAPA 4DV2T 3AECA 1HNZT 1XZYA 2V1DB 3FB2A 4H63H 2BKOA 1YKEB 3AXJB 3UFGA 5LA6E 2FBWA 2BVLA 1VCSA 3BQIA 5LHIB 3ZT7A 4NIQA 3CK6A 2ACZA 1KEYA 2C5IT 4DR2T 2YKSA 1M62A 2YOEA 4KBMB 3IA3A 2MYSA 3HKBE 5L3DB 4WBOA 3ZYKA 5HXSA 1SE7A 5HEGA 3RIUC 5CGMA 3AAEB 3JC6C 2XZEA 5JRCA 1FJGT 5F5WA 4EEBA 1MIWA 2CEAA 2L9QA 1UCUA 4F6RC 2JMHA 1ZHCA 3EUHA 3KINB 4YJ3E 2CXDA 3QB5A 3RGLA 2VQET 4TWDA 2CCQA 4PK4A 5GONE 2W67A 3JADA 4JI2T 2X68A 3N9LA 1IBLT 2JQKA 5HXCA 5TAOA 5BR8T 3UUNA 3FXEB 4HFIA 2WDVA 3KBUA 3PUXF 3FHNA 3NBXX 2UXXB 2ODUA 1CUNA 4DUYT 3QK6A 3OVUA 2DL1A 2E5VA 2X0YA 3O1IA 2W61A 3TKLB 3T8OA 3V5SA 3RKOA 3UUXB 4DVDA 4QX7B 3I9YA 3VU7H 3B5MA 2CHNA 4IT4A 4ZI7E 1HX8A 2JIWA 2KMFA 2HH7A 1J5WA 3K3OA 4KI0F 1LVKA 3N5LA 2W62A 3JAEA 4LF4T 1E2AA 3TLTA 2XQAA 1EZ3A 4FJOA 3WAJA 3C64A 4IDNA 4TNWA 3B13A 2H3RA 2NW9A 3OBVE 1US7B 2ACXA 1U4QA 2N9DA 1ZV4X 2W4XA 2WDQA 1G8XA 4O4HE 2XASB 4IDQA 2LOPA 5JDGA 2D9DA 4X66T 4UV9B 2BG9A 4M1PA 3R6NA 2B76A 2LSGA 2ZM2A 4LMLA 4B3MT 4KP3C 2BS3A 1UUSA 2CXFA 3PUAA 5JR9C 1T8BA 2DLRA 4CZZB 3UU4A 4U7IA 4Q25A 4PJJA 5AQUB 2K24A 2VB6A 3ZT6A 3ZCJA 3ZCIA 2CBIA 2XSAA 4HFBA 4HTEA 5EK2A 1HG2A 1I94T 1NAFA 4V1Av 3KV5A 4P1NA 5J0ZA 4K0KT 3ANWB 2YN6A 4AKRB 2OV9A 4O2AE 3P7IA 4DR6T 5L47A 2LSYA 3ZMTB 1YQ4A 3N9MA 1N32T 2Y48B 5ABEA 1J5ET 4GYRA 3HA4A 5LJMA 4JBWF 3ETUA 2YINA 3P4SA 4UEMA 5E0OA 4KHZF 2DWKA 4PW8A 4IL9A 2L3LA 5LHHB 1L0VA 3AE9A 2EHOC 1VOMA 4YTPA 2J47A 1E1HB 4U31A 2V8SV 1ZEEA 3VRBA 3ONLC 4OHFA 5ABGA 5FY0A 4CI3B 2BKNA 4PK5A 5FKYA 5JR9B 5FVKA 1WYCA 5FXZA 4TUYE 2WY2A 4NUUA 2JMKA 3NRXA 5BMVE 4X64T 4OYKA 2W2UA 1D0YA 4IE4A 2G0UA 3CQXC 3D0TA 4ZI2C 4B3RT 3N9QA 5ABFA 3R84B 4X1KE 4TWHA 1MIVA 3DJBA 4TN7B 4LFCT 1S35A 2BDEA 4BA9A 4XAXB 2V6YB 1Y01A 2N1GA 4ANJA 4EEDA 2E8IA 2M6IA 3AE6A 5HYAA 4CQIA 2B1EA 4QX8B 5C2TA 5AQMB 4EZ4A 4UV8B 3RQWA 3SRZA 1D1AA 2LSJA 2LEHA 5AQOB 1UGOA 2PG8A 3JCFA 3EABA 4JI6T 3F2EA 3BQLA 4QXHB 3LFMA 2QA7A 4DV6T 3UU5A 2KLQA 5LP6E 2Y8DA 1W9RA 2A9UA 2X51A 4P09A 1BR4A 4HWHA 2WM9A 4TV8E 5EK3A 4DV3T 1OEDC 4TZ4C 2H89A 2XQ8A 4LF7T 2EHOB 5DQVA 2WAUA 4GIWA 5HCJA 3HKCE 5HEHA 5M4YA 2WU5A 4TWFA 3IHRA 4A97A 2KZ7B 5LGUB 1OXZA 1ZOYA 2XM1A 5FYMA 4EOZB 4ISSA 3KV6A 4IDZA 2KWHA 4J2CA 1B7TA 3AE7A 2YEVC 3GN5A 4I4TE 1YQ3A 3GA8A 4P0AA 3ZT5A 2IW5B 3MA9A 2HHHT 2ZMAA 4DUZT 3ESLA 3RRCA 5L3GB 4LFAT 4X65T 3ZN1B 3CKDA 2RP4A 2M67A 4DR7T 3NKZA 4O8SA 3C4ZA 4Z8XA 4A98A 5AQHB 2NP9A 2OLTA 3FZHB 4UF0A 3N2GE 5HXEA 5HXRA 4IE0A 3RYIE 4WW0A 5CFBA 2AXDS 3RC3A 3VRAA 2CE7A 4PNIA 2NW7A 1MNEA 4ZI3C 2WMOA 3ZSSA 2I6HA 3E0ZA 2CLYC 3ABVA 1OEDB 2LHNA 2MPKA 2HPLA 2LM2A 4UVAB 3H3MA 5IUXA 3L39A 4YSYA 2N2NA 1OEDE 3RLFF 2K48A 4I55E 2V7MA 4H9NC 4JI4T 2KNDA 3MK7C 4HFCA 1SA0E 3O4XE 4NPPA 4L0RA 2XAFB 2E9XA 3M3ZB 3HL6A 2IC6A 3N9PA 3ZEFB 2YDQA 3TLWA 2GK9A 4N78D 2UU9T 2UXCT 1KNPA 5HAXA 4E7SA 4DR3T 1XNRT 5JVDE 3RIAA 3AE8A 4Z90A 3N9NA 2V5CA 5FXXA 1T98A 4I50E 4YHJA 3T1YT 4GKKT 5IWAT 3UU8A 2CBJA 2CWOA 3CX7B 2Z6EA 4L5GA 2KT9A 5ABHA 1MMDA 3UFEA 2XAHB 2LE8A 5AQGB 3J7Yq 4YTMA 2A2FX 2DWGA 1FIOA 4ZOLE 1XWMA 4AQGA 2CLYB 3OPCA 2VVNA 2W63A 3M65A 3LK42 3LDQB 4DMWA 1HF8A 2FJDA 2JPFA 2VKDA 1IZNB 3N9OA 4DMVA 2X66A 3PDYA 2ZLYA 3SFEA 1N34T 2NTYA 2XQ6A 4JLEA 5JDLA 2XAJB 5IYZE 5JDNA 4HFHA 5A1LA 4DV0T 5LMNT 2E9XD 2ODVA 3AVRA 4HGAA 4XBFB 3LK3B 4WZXA 3OYZA 3AE2A 3NWIA 4AIUA 3FZFB 4Z91A 4LF9T 1J1JA 3EI0A 1KFYA 4ILAA 5DQWA 2XAGB 2L8KA 3PJAJ 3O1JA 4PFPA 3B57A 3AE4A 2LLYA 4DIDB 4AQFA 1LVFA 3ZJ2A 2WP9A 3SS1A 2JQHA 1JNZA 4PK6A 5LG3A 1QUUA 3LBXB 4GK0E 2WBLA 2KSRA 2UUCT 5ETWA 2CXLA 4EB6E 5LB7B 2IC9A 3CQCB 2E5LT 4MBQA 2WMNA 1ZKEA 2BS4A 3AEEA 2DNXA 2XY8B 4O4IE 3LK2B 3ZSTA 4ZS2A 4PJNA 2NWBA 1X79A 5AQFB 3EDUA 3VKHA 4B6XA 3RYFE 2XSBA 2R6GF 2K9AA 5IHYA 2FJBA 4UR9A 3AA7B 4ILBA 1QSDA 1WFDA 2WZHA 5L3CB 4MLKA 5F3JA 2VK9A 4HWIB 4YLHA 4H9PC 2CA5A 3AB3B 2FJEA 4COFA 4DO0A 2IUBA 2A3DA 3Q5EA 2X0LB 3KVAA 4OYJA 2XM2A 2LRLA 3QOFA 4HFVA 2PFVA 5FP3A 5HCMA 2CRBA 4LF6T 2C5JA 5AFUL 3U3IA 3FZKB 3MJXA 3PUQA 2BVMA 5LBQB 4ZEYA 3ONJA 1M7KA 2RPAA 3PU8A 4TV9E 4IDPA 5AQLB 1WRDA 1IBKT 2CHOA 4DV4T 2CPTA 4HWDA 3ZMVB 5LGNB 5JRCB 3ZPOA 3RH3A 3WI3A 1NENA 2VASA 3TLSA 3RKGA 2LHRA 2BG9C 4GKJT 4O2BE 2WZIA 4EXTA 4OFZA 4DV5T 3VKGA 4ILCA 3QB5K 1XDOA 3RQUA 3IEEA 2FUPA 3FZMB 2X0HA 4HFDA 2VL0A 4EGWA 4DR5T 4F8HA 3C4XA 5FY7A 2BBJA 5AQPB 5HWYA 3PTRB 3MACA 3H3AA 2UXNB 3HKEE 4G63A 5LOVE 5AQKB 4LF8T 2X9WA 4JV5T 4NXMT 3RPUA 4C91A 1W09A 2FJAA 3ZJ1A 3AEAA 2V6XA 2AE9A 2LRKA 2H7OA 1Z8UA 3RYCE 5LG4A 4H63V 5DJQC 1DU2A 2D0TA 1D1CA 4JI3T 4XZCA 5KX5E 4X62T 3CWZB 2P9BA 4ZI2D 5HEUA 4X1IE 5C3JA 2XQ9A 2X9XA 3PUSA 3C50A 3CVRA 3P50A 2BG9B 3N2KE 1IJ6A 3AXJA 1BR0A 3AEFA 4O4JE 4YY3T 1KF6A 1HFAA 4EAHA 3P4QA 4QH5A 1UX4A 3P4RA 4I0UA 2C0SA 3L09A 4HWCA 5CB4E 5AQJB 4B3ST 5L3EB 5LBMA 2IAKA 5EK4A 4GYSA 3RF1A 4TNVA 2D5UA 4YXDA 2J4GA 4AKIA 4FI5A 1IBMT 4YT0A 4UIGA 5JDMA 2VQFT 3ETVA 3PUYF 4DV7T 1JNRA 2BBHA 1D0XA 2V26A 3SOLA 5CA1E 1XNQT 4KX6A 2X9HA 3RIFA 3FBZA 1SHZC 4X5TA 4A56A 3F57A 4PAGA 4IIJE 4GOUA 2MBGA 3I0OA 3PUVF 2XJ7A 5AQNB 5HEOA 3PUWF 3PUGA 2YU2A 4OX9T
chains in the Genus database with same CATH topology
2WSSV 1S94A 4L5GA 2KT9A 1MMDA 3UFEA 2LSGA 2ZM2A 2XAHB 2LE8A 3ZC0A 3PU3A 2BZBA 3J7Yq 4KP3C 2A2FX 1WR6A 2DWGA 4MALA 1D0ZA 4UVCB 1FIOA 2V7JA 2CXFA 2D0UA 3PUAA 2XTLA 4ZOLE 4AQGA 5JR9C 2DLRA 2W00A 4CZZB 1MMAA 2CLYB 2W0GA 3C98B 2W63A 4PJJA 3KFWX 3M65A 3LK42 2K24A 3HR0A 4IGUA 2VB6A 2X9YA 4HKAA 4DMWA 1NWMX 1HF8A 3ZCJA 4CI2B 4U74A 3ZCIA 5LGTB 2JPFA 2VKDA 1IZNB 4HE8A 3OKQA 2VKHA 4PFOA 3S4UA 3N9OA 3RX6A 4PJLA 4DMVA 4UELA 5FNVE 4DNDA 2ZM8A 2X66A 2V7KA 4H9SE 4HTEA 4MFRA 4BAYB 3PDYA 5EK2A 1HG2A 2ZLYA 1NAFA 4V1Av 3KV5A 5J2TE 4ISTA 2NTYA 4JLEA 2XUEA 3ANWB 5JDLA 3E22E 2Q9QC 2XAJB 3FBLA 1MMGA 5IYZE 3EDVA 3K3QC 4K0UA 5JDNA 5CA0E 5A1LA 4QWNB 2E9XD 2ODVA 3AVRA 2A72A 2V7IA 2MTQA 3L3PA 4HGAA 5DABA 3LK3B 4AKRB 4XBFB 3N2OA 3GMIA 3OYZA 3MKDA 1IJ5A 2J1DG 4O2AE 5KMGP 4X20E 3P7IA 3Q5XA 3ZC1A 3AAAB 2LSYA 3HKDE 3P8CD 3ZMTB 5DQWA 1HTJF 2XAGB 3AA1B 1YKHB 2L8KA 5H6QB 3ZYLA 3N9MA 1HS7A 5JREA 2Y48B 3O1JA 4PFPA 3B57A 3QC9A 3FXDB 1D1BA 5L3FB 4AQFA 4WBNE 4TX5A 4DBRA 1H7CA 4GYRA 1LVFA 3HA4A 4IE7A 4P0BA 4ZS3A 3ZJ2A 2XAQB 3SS1A 5EZYE 2ES0A 5LJMA 3W15B 3KV9A 4O4LE 5LJNA 4PK6A 3ETUA 4ASKA 1V9DA 1QUUA 3LBXB 2YINA 4UEMA 4X1YE 4GK0E 3UTKA 3ZMSB 5E0OA 5LHGB 3RC8A 2VWAA 2WBLA 1U5PA 1Y64B 2DWKA 5ETWA 4PW8A 2CXLA 2JRKA 3WAKA 4EB6E 2L3LA 2IC9A 3CQCB 5FMNA 3C4WA 3QUJA 5LHHB 2H7VC 4MBQA 3F31A 2WMNA 4H9RC 1ZKEA 2EHOC 1VOMA 3I1AA 2DNXA 2Q9QA 3E08A 1E1HB 4H9OC 4O4IE 4EYUA 3BK9A 3CMLA 3CX8B 3LK2B 1ZEEA 2LJLA 3J9X1 3O1HA 1FEWA 4EZHA 4ZS2A 4AKLA 3A5XA 4BJNA 4BJMA 1Z0PA 4OHFA 4PJNA 2NWBA 5C8YE 1X79A 5FY0A 4CI3B 3EDUA 4PK5A 3VKHA 4B6XA 5JR9B 3K8PC 3Q5WA 3RYFE 3AA0B 1WYCA 5FXZA 2K9AA 4GK5E 5HXHA 3GWHA 5IHYA 4TUYE 3ANWA 4NUUA 3AA7B 2JMKA 1FMVA 4HEAA 3NRXA 5F8PA 2YU1A 2KINB 4YFSA 1QSDA 5BMVE 4H9QC 4OYKA 3PURA 2NW8A 2C5KT 2KXPB 5L3CB 1D0YA 4IE4A 4MLKA 2G0UA 3ZN0B 5F3JA 2VK9A 3AVSA 3CQXC 3D0TA 3Q2MA 4YLHA 4ZI2C 3H37A 4H9PC 2CA5A 4C90A 3AB3B 4CI1B 4DO0A 3N9QA 2A3DA 2X0LB 3KVAA 4OYJA 3U78A 5J2UE 3R84B 4X1KE 4HFVA 2PFVA 5FP3A 2MOZA 1MIVA 2C5JA 3DJBA 3JC6D 1MIYA 4TN7B 5AFUL 1S35A 2BDEA 2Q9QB 3U3IA 4BA9A 3BQKA 4XAXB 1HCIA 1KNZA 2N1GA 1FMWA 4ANJA 2E8IA 1MMNA 3DP7A 5HYAA 2RA1A 3MJXA 2VKOA 5JDHA 3PUQA 4CQIA 2B1EA 2NTXA 2BVMA 4QX8B 5LBQB 4I43B 4EZ4A 5JDQA 4ILUA 2PBIA 4E7ZA 4UV8B 3GN5B 4EIWA 3SRZA 1D1AA 3I0QA 2D2SA 2LSJA 2WWUA 4CXYA 2JQQA 2E9XC 2LEHA 3SWHA 3LBXA 2LSIA 2PG8A 4HN9A 3PU8A 4JEUB 4QXCB 5J1GA 2CMRA 4TV9E 1MNDA 3F2EA 1WRDA 3BQLA 4QXHB 3LFMA 4ZI3D 2QA7A 4CXWA 2LOSA 3AA6B 3ZMVB 2DCFA 3K3NA 1LRZA 3UUMA 5LGNB 5JRCB 2XQYA 2I59A 2KLQA 2CM0A 2LM9A 3ZPOA 5LP6E 2Y8DA 5L2LA 4AKHA 3UULA 4JUYA 3RH3A 3WI3A 2Q9QD 2X51A 4P09A 1BR4A 2WM9A 4TV8E 2Y6XA 2VASA 3LJCA 2QGSA 5JR9A 5EK3A 2OA5A 4DBQA 2LHRA 4UF0B 5FXVA 5JQGE 4O2BE 4TZ4C 3MZKB 2NOXA 4OFZA 2EHOB 4KUMB 2WAUA 5DQVA 4EXTA 3O9XA 4NUVA 3KBTA 3CQGB 4CXXA 5JDFA 4GIWA 2JJ9A 4MHCA 4OK0A 3VKGA 4U72A 2ZM0A 3IEEA 3HKCE 2CWYA 5M4YA 3ZLIA 4ERRA 3IBPA 3KVBA 1IAPA 3IHRA 4UVBB 2KZ7B 2V1DB 3OJAA 3FB2A 4H63H 1HG5A 5LGUB 3C4XA 1OXZA 5FY7A 1YKEB 1OWAA 5FYMA 5HWYA 5LA6E 4EOZB 4G2AA 2BVLA 4ISSA 2YK0A 3BQIA 3KV6A 3PTRB 5LHIB 4QXBB 3MACA 5L3BB 3H3AA 2UXNB 1WLXA 3CPZA 5FXWA 3ONXA 2C5IT 4IDZA 2KWHA 4L9IA 4J2CA 1B7TA 3HKEE 4G63A 2YEVC 4QHOA 5LOVE 3GN5A 2K5BB 3C51A 1AJ3A 4KBMB 2X9WA 4AI6A 2MYSA 4I4TE 3GA8A 3RPUA 4C91A 5HWXA 3HKBE 3I9WA 5L3DB 1O3XA 4WBOA 3ZYKA 2V7LA 5HXSA 4P0AA 2IW5B 5H6RB 3MA9A 2ZMAA 3ZYMA 3ZJ1A 3ESLA 3AAEB 3KV4A 3RRCA 4EYYR 5L3GB 5LXTE 1YW0A 3JC6C 2H7OA 4IE6A 5JRCA 3ZN1B 3ZMUB 2SPCA 3CKDA 2RP4A 3RYCE 2M67A 3DTOA 5LG4A 4H63V 5DJQC 2E9XB 1MIWA 4O8SA 3C4ZA 1BR2A 2D0TA 2CEAA 3HI2A 4Z8XA 5LCYA 1D1CA 2NP9A 3KDSE 4AXPA 2L9QA 3LG7A 1UCUA 4XZCA 5KX5E 4F6RC 2JMHA 4YJ2E 3CWZB 4UF0A 1ZHCA 3EUHA 3KINB 3N2GE 2P9BA 2DHRA 4AQFC 4YJ3E 5HXRA 4ZI2D 5HXEA 4IE0A 2EHOA 2CXDA 4WNKA 4KMCA 4UXNB 3RYIE 4WW0A 3OYXA 2CCQA 1LKXA 4PK4A 4X1IE 5GONE 3RC3A 2CE7A 4PNIA 2NW7A 2VKJA 2X9XA 3PUSA 1MNEA 4ADZA 3C50A 3AAIA 2X68A 4ZI3C 2WMOA 4QKNA 3N9LA 3E0ZA 2CLYC 5HXCA 1KK7A 3CVRA 5TAOA 3UT5E 3RRWA 2LHNA 2HPJA 3N2KE 2HPLA 4IHJE 3UUNA 3FXEB 1IJ6A 1BR1A 4IE5A 1BR0A 4UVAB 4O4JE 3KBUA 3FHNA 3NBXX 1HFAA 4EAHA 2UXXB 2ODUA 4AKGA 1CUNA 1G73A 2XHEB 3QK6A 2N2NA 5LYJE 1VRBA 1UX4A 3O1IA 2C0SA 3L09A 4PJMA 2W61A 3TKLB 5CB4E 3T8OA 2K48A 3V5SA 3CX6B 3EVYA 3RKOA 4I55E 2V7MA 4H9NC 3UUXB 5L3EB 5LNKA 2DI4A 4DVDA 5LBMA 2KNDA 2IAKA 3MK7C 4QX7B 3IF8B 5EK4A 3I9YA 3VU7H 3PE0A 4GYSA 5JH7E 2D5UA 4ZI7E 1HX8A 1WYBA 4AKIA 4FI5A 3NZQA 1SA0E 2KMFA 3O4XE 2LSKA 4JEHB 4UIGA 5KDMC 2HH7A 3V5UA 2KWIB 5JDMA 3ETVA 3RYHE 3K3OA 1LVKA 2XAFB 4L0RA 1D0XA 2E9XA 2PJQA 2VL8A 3HL6A 2IC6A 3N5LA 2V26A 3ZMZB 3VHLA 3SOLA 3N9PA 3ZEFB 2W62A 5CA1E 1UX5A 1EZ3A 2GK9A 4FJOA 3WAJA 3C64A 3B13A 4N78D 2X9HA 3FBZA 1SHZC 3NZPA 2H3RA 1YD8G 2NW9A 3NRYA 2LT3A 3OBVE 5HAXA 4E7SA 1US7B 4A56A 5JVDE 2ACXA 1U4QA 3F57A 2N9DA 4PAGA 2EHOD 5FY1A 1ZV4X 3N9NA 4IIJE 3Q9DA 4GOUA 4ZHQE 2MBGA 3MXZA 1G8XA 3I0OA 5FXXA 1T98A 4I50E 4YHJA 4O4HE 5ADXL 2XASB 2LOPA 5JDGA 2CWOA 2X67A 3CX7B 4UV9B 3PUGA 2YU2A 2Z6EA 4M1PA 3R6NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YK0 A;  3BQI A;  2WAU A;  3RRC A;  4YFS A;  3BQK A;  4NUV A;  5F3J A;  3BQL A;  3CPZ A;  3C64 A;  4NUU A;  2Y8D A;  3CML A; 
#chains in the Genus database with same CATH topology
 2WSS V;  2VVS A;  2UUB T;  1HNX T;  1D0Z A;  2V7J A;  3EHZ A;  2XTL A;  4U2Y A;  2W00 A;  1MMA A;  3PJA A;  3KFW X;  4YHH T;  3HR0 A;  4HKA A;  1NWM X;  4U74 A;  4EV6 A;  4U33 A;  3OKQ A;  2VKH A;  4PFO A;  3S4U A;  3TLU A;  3RX6 A;  4PJL A;  4UEL A;  4LF5 T;  1T72 A;  4DND A;  2ZM8 A;  4H9S E;  4BAY B;  4MFR A;  1W0B A;  2XUE A;  2IML A;  2Q9Q C;  3FBL A;  1MMG A;  3K3Q C;  4U3C A;  2M6B A;  5CA0 E;  3RIU A;  4YSZ A;  4ZZB A;  2A72 A;  2V7I A;  2MTQ A;  3L3P A;  5DAB A;  3GMI A;  3MKD A;  5ABF B;  1XDP A;  5KMG P;  2J1D G;  1T7S A;  4X20 E;  3HKD E;  4HWF A;  3AED A;  5AQR B;  2XQ7 A;  3AA1 B;  1YKH B;  5H6Q B;  1HNW T;  1HS7 A;  2W66 A;  3QC9 A;  3FXD B;  5AQT B;  5L3F B;  4B3T T;  4DBR A;  1H7C A;  5KXJ A;  2ES0 A;  2IHR 1;  3W15 B;  4O4L E;  5LJN A;  4ASK A;  1V9D A;  4X1Y E;  3UTK A;  2H88 A;  3ZMS B;  3RC8 A;  4DV1 T;  2VWA A;  1U5P A;  1Y64 B;  3WAK A;  2JRK A;  2BS2 A;  3P4P A;  5FMN A;  2H7V C;  2I0M A;  4H9R C;  3I1A A;  3Q5D A;  3UQ7 A;  3E08 A;  4H9O C;  4IL4 A;  1WR0 A;  3CX8 B;  3O1H A;  3AEG A;  3A5X A;  5JTG A;  3K8P C;  3VR8 A;  3AA0 B;  4GK5 E;  2WU2 A;  2K3W A;  3GWH A;  3ANW A;  1FMV A;  5F8P A;  4YFS A;  4H9Q C;  3PUR A;  2NW8 A;  1UUR A;  4CN4 A;  4ZZC A;  1I6Z A;  3Q2M A;  5FVL A;  3H37 A;  3K1S A;  3U78 A;  5J2U E;  4A5X A;  2MOZ A;  3JC6 D;  5AQQ B;  2Q9Q B;  3BQK A;  4QH1 A;  3A8Y C;  2WCA A;  1FMW A;  5CJ5 A;  1MMN A;  3DP7 A;  2RA1 A;  1YXR A;  5JDH A;  2NTX A;  5FL1 A;  4I43 B;  5JDQ A;  4ILU A;  2PBI A;  4E7Z A;  3GN5 B;  4EIW A;  3AEB A;  2WQY A;  2PTF A;  4CXY A;  3G06 A;  2JQQ A;  2E9X C;  3SWH A;  2LSI A;  4QXC B;  2UUA T;  2CMR A;  4CXW A;  2WDR A;  2DCF A;  1LRZ A;  3UUM A;  2XQY A;  5L2L A;  4AKH A;  3UUL A;  4JUY A;  2Y6X A;  3LJC A;  5JR9 A;  2OA5 A;  4UF0 B;  3MZK B;  2NOX A;  2YDS A;  4KUM B;  4NUV A;  3CQG B;  4CXX A;  1SUM B;  5JDF A;  2JJ9 A;  2CWY A;  4ERR A;  3IBP A;  3RHW A;  3KVB A;  1GQE A;  4UVB B;  3UU3 A;  3OJA A;  1HG5 A;  2E2A A;  1OWA A;  3VR9 A;  4JI0 T;  2V6Y A;  4G2A A;  2YK0 A;  4QXB B;  5L3B B;  1WLX A;  3CPZ A;  5FXW A;  3ONX A;  4L9I A;  4QHO A;  2K5B B;  3C51 A;  1AJ3 A;  4AI6 A;  3PUZ F;  5HWX A;  3I9W A;  1O3X A;  3AE3 A;  2V7L A;  5H6R B;  4JI7 T;  3UUB A;  3ZYM A;  3JAF A;  4ZXL A;  3KV4 A;  4EYY R;  5LXT E;  1YW0 A;  4IE6 A;  3ZMU B;  2SPC A;  3DTO A;  5HEJ A;  2E9X B;  5LCY A;  1BR2 A;  3HI2 A;  3KDS E;  4AXP A;  3LG7 A;  2HN1 A;  5AQS B;  4YJ2 E;  1X9B A;  2DHR A;  3AE5 A;  4AQF C;  2EHO A;  2V5D A;  4WNK A;  4KMC A;  4UXN B;  3EAM A;  3OYX A;  1LKX A;  2VKJ A;  1QLB A;  4ADZ A;  1XMO T;  3AAI A;  4QKN A;  3P4W A;  1KK7 A;  3UT5 E;  3RRW A;  2HPJ A;  4IHJ E;  1BR1 A;  4IE5 A;  4AKG A;  1G73 A;  2XHE B;  2HN2 A;  5AQV B;  5LYJ E;  3QNU A;  1VRB A;  4HFE A;  3CIR A;  1KNR A;  4PJM A;  3CX6 B;  3EVY A;  4JI1 T;  5LNK A;  2DI4 A;  2ZM6 T;  3IF8 B;  3L8R A;  2UXB T;  3PE0 A;  5JH7 E;  1WYB A;  4DR4 T;  3NZQ A;  3UQ4 A;  2LSK A;  4JEH B;  5KDM C;  3V5U A;  2KWI B;  3PV0 F;  3UU6 A;  3RYH E;  5L4H A;  2PJQ A;  2VL8 A;  4U7Y A;  3ZMZ B;  3VHL A;  1UX5 A;  2MAW A;  4LMJ A;  3NZP A;  1YD8 G;  3NRY A;  2LT3 A;  2IIU A;  1ZP0 A;  2EHO D;  5FY1 A;  3Q9D A;  4ZHQ E;  3MXZ A;  5ADX L;  2X67 A;  1OED A;  2J62 A;  1S94 A;  5FL0 A;  3ZC0 A;  2LKG A;  3PU3 A;  2BZB A;  2IDO B;  2WS3 A;  1HX1 B;  4AIS A;  1WR6 A;  3X1D A;  4MAL A;  4UVC B;  2D0U A;  2W0G A;  2VUR A;  3C98 B;  4KHP T;  4IGU A;  2X9Y A;  4CI2 B;  5L4E A;  5LGT B;  4HE8 A;  1R8I A;  5FNV E;  3AE1 A;  2V7K A;  2F4V T;  5J2T E;  4IST A;  2QRX A;  3E22 E;  3LSV A;  3EDV A;  4K0U A;  4QWN B;  4DR1 T;  2BG9 E;  3N2O A;  2XQ4 A;  2WWV A;  1IJ5 A;  4JI5 T;  3Q5X A;  3ZC1 A;  1HR0 T;  2BKP A;  3AAA B;  4IRE A;  3P8C D;  1HTJ F;  3ZYL A;  5JRE A;  2QVA A;  3RI5 A;  1D1B A;  1WCR A;  4WBN E;  4TX5 A;  4IE7 A;  4ZS3 A;  4P0B A;  2UXD T;  2XAQ B;  5EZY E;  3KV9 A;  4CN6 A;  5LHG B;  4JYA T;  3T1H T;  1E7P A;  3OTO T;  4YSX A;  1CHU A;  3C4W A;  3QUJ A;  3F31 A;  3ZKR A;  4WYV A;  4QH4 A;  2Q9Q A;  4AQY T;  4EYU A;  3BK9 A;  3CML A;  2LJL A;  3J9X 1;  1FEW A;  4EZH A;  4AKL A;  4BJN A;  4BJM A;  1Z0P A;  5C8Y E;  3Q5W A;  4U2Z A;  4IDO A;  5HXH A;  5LMU T;  4HEA A;  2YU1 A;  2KIN B;  4YTN A;  2C5K T;  2KXP B;  1NEK A;  3NVO A;  3ZN0 B;  2WB5 A;  3AVS A;  4C90 A;  4LFB T;  4CI1 B;  1N36 T;  1MIY A;  4JI8 T;  5AQI B;  4LMK A;  2XQ5 A;  1HCI A;  3FZL B;  1KNZ A;  3SFD A;  4NXN T;  2VKO A;  1N33 T;  3I0Q A;  2D2S A;  2WWU A;  1UK5 A;  3LBX A;  1XMQ T;  4HN9 A;  4JEU B;  5J1G A;  1MND A;  2JQ9 A;  2YDR A;  2QYW A;  4ZI3 D;  2LOS A;  3AA6 B;  3A7M A;  2LKH A;  3K3N A;  1VCT A;  2I59 A;  2CM0 A;  2LM9 A;  2XQ3 A;  2XPK A;  2Q9Q D;  2NR4 A;  2QGS A;  4DBQ A;  5FXV A;  5JQG E;  1W0A A;  3O9X A;  3KBT A;  4CN1 A;  4MHC A;  4OK0 A;  4U72 A;  2ZM0 A;  3TLV A;  3ZLI A;  1IAP A;  4DV2 T;  3AEC A;  1HNZ T;  1XZY A;  2V1D B;  3FB2 A;  4H63 H;  2BKO A;  1YKE B;  3AXJ B;  3UFG A;  5LA6 E;  2FBW A;  2BVL A;  1VCS A;  3BQI A;  5LHI B;  3ZT7 A;  4NIQ A;  3CK6 A;  2ACZ A;  1KEY A;  2C5I T;  4DR2 T;  2YKS A;  1M62 A;  2YOE A;  4KBM B;  3IA3 A;  2MYS A;  3HKB E;  5L3D B;  4WBO A;  3ZYK A;  5HXS A;  1SE7 A;  5HEG A;  3RIU C;  5CGM A;  3AAE B;  3JC6 C;  2XZE A;  5JRC A;  1FJG T;  5F5W A;  4EEB A;  1MIW A;  2CEA A;  2L9Q A;  1UCU A;  4F6R C;  2JMH A;  1ZHC A;  3EUH A;  3KIN B;  4YJ3 E;  2CXD A;  3QB5 A;  3RGL A;  2VQE T;  4TWD A;  2CCQ A;  4PK4 A;  5GON E;  2W67 A;  3JAD A;  4JI2 T;  2X68 A;  3N9L A;  1IBL T;  2JQK A;  5HXC A;  5TAO A;  5BR8 T;  3UUN A;  3FXE B;  4HFI A;  2WDV A;  3KBU A;  3PUX F;  3FHN A;  3NBX X;  2UXX B;  2ODU A;  1CUN A;  4DUY T;  3QK6 A;  3OVU A;  2DL1 A;  2E5V A;  2X0Y A;  3O1I A;  2W61 A;  3TKL B;  3T8O A;  3V5S A;  3RKO A;  3UUX B;  4DVD A;  4QX7 B;  3I9Y A;  3VU7 H;  3B5M A;  2CHN A;  4IT4 A;  4ZI7 E;  1HX8 A;  2JIW A;  2KMF A;  2HH7 A;  1J5W A;  3K3O A;  4KI0 F;  1LVK A;  3N5L A;  2W62 A;  3JAE A;  4LF4 T;  1E2A A;  3TLT A;  2XQA A;  1EZ3 A;  4FJO A;  3WAJ A;  3C64 A;  4IDN A;  4TNW A;  3B13 A;  2H3R A;  2NW9 A;  3OBV E;  1US7 B;  2ACX A;  1U4Q A;  2N9D A;  1ZV4 X;  2W4X A;  2WDQ A;  1G8X A;  4O4H E;  2XAS B;  4IDQ A;  2LOP A;  5JDG A;  2D9D A;  4X66 T;  4UV9 B;  2BG9 A;  4M1P A;  3R6N A;  2B76 A;  2LSG A;  2ZM2 A;  4LML A;  4B3M T;  4KP3 C;  2BS3 A;  1UUS A;  2CXF A;  3PUA A;  5JR9 C;  1T8B A;  2DLR A;  4CZZ B;  3UU4 A;  4U7I A;  4Q25 A;  4PJJ A;  5AQU B;  2K24 A;  2VB6 A;  3ZT6 A;  3ZCJ A;  3ZCI A;  2CBI A;  2XSA A;  4HFB A;  4HTE A;  5EK2 A;  1HG2 A;  1I94 T;  1NAF A;  4V1A v;  3KV5 A;  4P1N A;  5J0Z A;  4K0K T;  3ANW B;  2YN6 A;  4AKR B;  2OV9 A;  4O2A E;  3P7I A;  4DR6 T;  5L47 A;  2LSY A;  3ZMT B;  1YQ4 A;  3N9M A;  1N32 T;  2Y48 B;  5ABE A;  1J5E T;  4GYR A;  3HA4 A;  5LJM A;  4JBW F;  3ETU A;  2YIN A;  3P4S A;  4UEM A;  5E0O A;  4KHZ F;  2DWK A;  4PW8 A;  4IL9 A;  2L3L A;  5LHH B;  1L0V A;  3AE9 A;  2EHO C;  1VOM A;  4YTP A;  2J47 A;  1E1H B;  4U31 A;  2V8S V;  1ZEE A;  3VRB A;  3ONL C;  4OHF A;  5ABG A;  5FY0 A;  4CI3 B;  2BKN A;  4PK5 A;  5FKY A;  5JR9 B;  5FVK A;  1WYC A;  5FXZ A;  4TUY E;  2WY2 A;  4NUU A;  2JMK A;  3NRX A;  5BMV E;  4X64 T;  4OYK A;  2W2U A;  1D0Y A;  4IE4 A;  2G0U A;  3CQX C;  3D0T A;  4ZI2 C;  4B3R T;  3N9Q A;  5ABF A;  3R84 B;  4X1K E;  4TWH A;  1MIV A;  3DJB A;  4TN7 B;  4LFC T;  1S35 A;  2BDE A;  4BA9 A;  4XAX B;  2V6Y B;  1Y01 A;  2N1G A;  4ANJ A;  4EED A;  2E8I A;  2M6I A;  3AE6 A;  5HYA A;  4CQI A;  2B1E A;  4QX8 B;  5C2T A;  5AQM B;  4EZ4 A;  4UV8 B;  3RQW A;  3SRZ A;  1D1A A;  2LSJ A;  2LEH A;  5AQO B;  1UGO A;  2PG8 A;  3JCF A;  3EAB A;  4JI6 T;  3F2E A;  3BQL A;  4QXH B;  3LFM A;  2QA7 A;  4DV6 T;  3UU5 A;  2KLQ A;  5LP6 E;  2Y8D A;  1W9R A;  2A9U A;  2X51 A;  4P09 A;  1BR4 A;  4HWH A;  2WM9 A;  4TV8 E;  5EK3 A;  4DV3 T;  1OED C;  4TZ4 C;  2H89 A;  2XQ8 A;  4LF7 T;  2EHO B;  5DQV A;  2WAU A;  4GIW A;  5HCJ A;  3HKC E;  5HEH A;  5M4Y A;  2WU5 A;  4TWF A;  3IHR A;  4A97 A;  2KZ7 B;  5LGU B;  1OXZ A;  1ZOY A;  2XM1 A;  5FYM A;  4EOZ B;  4ISS A;  3KV6 A;  4IDZ A;  2KWH A;  4J2C A;  1B7T A;  3AE7 A;  2YEV C;  3GN5 A;  4I4T E;  1YQ3 A;  3GA8 A;  4P0A A;  3ZT5 A;  2IW5 B;  3MA9 A;  2HHH T;  2ZMA A;  4DUZ T;  3ESL A;  3RRC A;  5L3G B;  4LFA T;  4X65 T;  3ZN1 B;  3CKD A;  2RP4 A;  2M67 A;  4DR7 T;  3NKZ A;  4O8S A;  3C4Z A;  4Z8X A;  4A98 A;  5AQH B;  2NP9 A;  2OLT A;  3FZH B;  4UF0 A;  3N2G E;  5HXE A;  5HXR A;  4IE0 A;  3RYI E;  4WW0 A;  5CFB A;  2AXD S;  3RC3 A;  3VRA A;  2CE7 A;  4PNI A;  2NW7 A;  1MNE A;  4ZI3 C;  2WMO A;  3ZSS A;  2I6H A;  3E0Z A;  2CLY C;  3ABV A;  1OED B;  2LHN A;  2MPK A;  2HPL A;  2LM2 A;  4UVA B;  3H3M A;  5IUX A;  3L39 A;  4YSY A;  2N2N A;  1OED E;  3RLF F;  2K48 A;  4I55 E;  2V7M A;  4H9N C;  4JI4 T;  2KND A;  3MK7 C;  4HFC A;  1SA0 E;  3O4X E;  4NPP A;  4L0R A;  2XAF B;  2E9X A;  3M3Z B;  3HL6 A;  2IC6 A;  3N9P A;  3ZEF B;  2YDQ A;  3TLW A;  2GK9 A;  4N78 D;  2UU9 T;  2UXC T;  1KNP A;  5HAX A;  4E7S A;  4DR3 T;  1XNR T;  5JVD E;  3RIA A;  3AE8 A;  4Z90 A;  3N9N A;  2V5C A;  5FXX A;  1T98 A;  4I50 E;  4YHJ A;  3T1Y T;  4GKK T;  5IWA T;  3UU8 A;  2CBJ A;  2CWO A;  3CX7 B;  2Z6E A;  4L5G A;  2KT9 A;  5ABH A;  1MMD A;  3UFE A;  2XAH B;  2LE8 A;  5AQG B;  3J7Y q;  4YTM A;  2A2F X;  2DWG A;  1FIO A;  4ZOL E;  1XWM A;  4AQG A;  2CLY B;  3OPC A;  2VVN A;  2W63 A;  3M65 A;  3LK4 2;  3LDQ B;  4DMW A;  1HF8 A;  2FJD A;  2JPF A;  2VKD A;  1IZN B;  3N9O A;  4DMV A;  2X66 A;  3PDY A;  2ZLY A;  3SFE A;  1N34 T;  2NTY A;  2XQ6 A;  4JLE A;  5JDL A;  2XAJ B;  5IYZ E;  5JDN A;  4HFH A;  5A1L A;  4DV0 T;  5LMN T;  2E9X D;  2ODV A;  3AVR A;  4HGA A;  4XBF B;  3LK3 B;  4WZX A;  3OYZ A;  3AE2 A;  3NWI A;  4AIU A;  3FZF B;  4Z91 A;  4LF9 T;  1J1J A;  3EI0 A;  1KFY A;  4ILA A;  5DQW A;  2XAG B;  2L8K A;  3PJA J;  3O1J A;  4PFP A;  3B57 A;  3AE4 A;  2LLY A;  4DID B;  4AQF A;  1LVF A;  3ZJ2 A;  2WP9 A;  3SS1 A;  2JQH A;  1JNZ A;  4PK6 A;  5LG3 A;  1QUU A;  3LBX B;  4GK0 E;  2WBL A;  2KSR A;  2UUC T;  5ETW A;  2CXL A;  4EB6 E;  5LB7 B;  2IC9 A;  3CQC B;  2E5L T;  4MBQ A;  2WMN A;  1ZKE A;  2BS4 A;  3AEE A;  2DNX A;  2XY8 B;  4O4I E;  3LK2 B;  3ZST A;  4ZS2 A;  4PJN A;  2NWB A;  1X79 A;  5AQF B;  3EDU A;  3VKH A;  4B6X A;  3RYF E;  2XSB A;  2R6G F;  2K9A A;  5IHY A;  2FJB A;  4UR9 A;  3AA7 B;  4ILB A;  1QSD A;  1WFD A;  2WZH A;  5L3C B;  4MLK A;  5F3J A;  2VK9 A;  4HWI B;  4YLH A;  4H9P C;  2CA5 A;  3AB3 B;  2FJE A;  4COF A;  4DO0 A;  2IUB A;  2A3D A;  3Q5E A;  2X0L B;  3KVA A;  4OYJ A;  2XM2 A;  2LRL A;  3QOF A;  4HFV A;  2PFV A;  5FP3 A;  5HCM A;  2CRB A;  4LF6 T;  2C5J A;  5AFU L;  3U3I A;  3FZK B;  3MJX A;  3PUQ A;  2BVM A;  5LBQ B;  4ZEY A;  3ONJ A;  1M7K A;  2RPA A;  3PU8 A;  4TV9 E;  4IDP A;  5AQL B;  1WRD A;  1IBK T;  2CHO A;  4DV4 T;  2CPT A;  4HWD A;  3ZMV B;  5LGN B;  5JRC B;  3ZPO A;  3RH3 A;  3WI3 A;  1NEN A;  2VAS A;  3TLS A;  3RKG A;  2LHR A;  2BG9 C;  4GKJ T;  4O2B E;  2WZI A;  4EXT A;  4OFZ A;  4DV5 T;  3VKG A;  4ILC A;  3QB5 K;  1XDO A;  3RQU A;  3IEE A;  2FUP A;  3FZM B;  2X0H A;  4HFD A;  2VL0 A;  4EGW A;  4DR5 T;  4F8H A;  3C4X A;  5FY7 A;  2BBJ A;  5AQP B;  5HWY A;  3PTR B;  3MAC A;  3H3A A;  2UXN B;  3HKE E;  4G63 A;  5LOV E;  5AQK B;  4LF8 T;  2X9W A;  4JV5 T;  4NXM T;  3RPU A;  4C91 A;  1W09 A;  2FJA A;  3ZJ1 A;  3AEA A;  2V6X A;  2AE9 A;  2LRK A;  2H7O A;  1Z8U A;  3RYC E;  5LG4 A;  4H63 V;  5DJQ C;  1DU2 A;  2D0T A;  1D1C A;  4JI3 T;  4XZC A;  5KX5 E;  4X62 T;  3CWZ B;  2P9B A;  4ZI2 D;  5HEU A;  4X1I E;  5C3J A;  2XQ9 A;  2X9X A;  3PUS A;  3C50 A;  3CVR A;  3P50 A;  2BG9 B;  3N2K E;  1IJ6 A;  3AXJ A;  1BR0 A;  3AEF A;  4O4J E;  4YY3 T;  1KF6 A;  1HFA A;  4EAH A;  3P4Q A;  4QH5 A;  1UX4 A;  3P4R A;  4I0U A;  2C0S A;  3L09 A;  4HWC A;  5CB4 E;  5AQJ B;  4B3S T;  5L3E B;  5LBM A;  2IAK A;  5EK4 A;  4GYS A;  3RF1 A;  4TNV A;  2D5U A;  4YXD A;  2J4G A;  4AKI A;  4FI5 A;  1IBM T;  4YT0 A;  4UIG A;  5JDM A;  2VQF T;  3ETV A;  3PUY F;  4DV7 T;  1JNR A;  2BBH A;  1D0X A;  2V26 A;  3SOL A;  5CA1 E;  1XNQ T;  4KX6 A;  2X9H A;  3RIF A;  3FBZ A;  1SHZ C;  4X5T A;  4A56 A;  3F57 A;  4PAG A;  4IIJ E;  4GOU A;  2MBG A;  3I0O A;  3PUV F;  2XJ7 A;  5AQN B;  5HEO A;  3PUW F;  3PUG A;  2YU2 A;  4OX9 T; 
#chains in the Genus database with same CATH homology
 2WSS V;  1S94 A;  4L5G A;  2KT9 A;  1MMD A;  3UFE A;  2LSG A;  2ZM2 A;  2XAH B;  2LE8 A;  3ZC0 A;  3PU3 A;  2BZB A;  3J7Y q;  4KP3 C;  2A2F X;  1WR6 A;  2DWG A;  4MAL A;  1D0Z A;  4UVC B;  1FIO A;  2V7J A;  2CXF A;  2D0U A;  3PUA A;  2XTL A;  4ZOL E;  4AQG A;  5JR9 C;  2DLR A;  2W00 A;  4CZZ B;  1MMA A;  2CLY B;  2W0G A;  3C98 B;  2W63 A;  4PJJ A;  3KFW X;  3M65 A;  3LK4 2;  2K24 A;  3HR0 A;  4IGU A;  2VB6 A;  2X9Y A;  4HKA A;  4DMW A;  1NWM X;  1HF8 A;  3ZCJ A;  4CI2 B;  4U74 A;  3ZCI A;  5LGT B;  2JPF A;  2VKD A;  1IZN B;  4HE8 A;  3OKQ A;  2VKH A;  4PFO A;  3S4U A;  3N9O A;  3RX6 A;  4PJL A;  4DMV A;  4UEL A;  5FNV E;  4DND A;  2ZM8 A;  2X66 A;  2V7K A;  4H9S E;  4HTE A;  4MFR A;  4BAY B;  3PDY A;  5EK2 A;  1HG2 A;  2ZLY A;  1NAF A;  4V1A v;  3KV5 A;  5J2T E;  4IST A;  2NTY A;  4JLE A;  2XUE A;  3ANW B;  5JDL A;  3E22 E;  2Q9Q C;  2XAJ B;  3FBL A;  1MMG A;  5IYZ E;  3EDV A;  3K3Q C;  4K0U A;  5JDN A;  5CA0 E;  5A1L A;  4QWN B;  2E9X D;  2ODV A;  3AVR A;  2A72 A;  2V7I A;  2MTQ A;  3L3P A;  4HGA A;  5DAB A;  3LK3 B;  4AKR B;  4XBF B;  3N2O A;  3GMI A;  3OYZ A;  3MKD A;  1IJ5 A;  2J1D G;  4O2A E;  5KMG P;  4X20 E;  3P7I A;  3Q5X A;  3ZC1 A;  3AAA B;  2LSY A;  3HKD E;  3P8C D;  3ZMT B;  5DQW A;  1HTJ F;  2XAG B;  3AA1 B;  1YKH B;  2L8K A;  5H6Q B;  3ZYL A;  3N9M A;  1HS7 A;  5JRE A;  2Y48 B;  3O1J A;  4PFP A;  3B57 A;  3QC9 A;  3FXD B;  1D1B A;  5L3F B;  4AQF A;  4WBN E;  4TX5 A;  4DBR A;  1H7C A;  4GYR A;  1LVF A;  3HA4 A;  4IE7 A;  4P0B A;  4ZS3 A;  3ZJ2 A;  2XAQ B;  3SS1 A;  5EZY E;  2ES0 A;  5LJM A;  3W15 B;  3KV9 A;  4O4L E;  5LJN A;  4PK6 A;  3ETU A;  4ASK A;  1V9D A;  1QUU A;  3LBX B;  2YIN A;  4UEM A;  4X1Y E;  4GK0 E;  3UTK A;  3ZMS B;  5E0O A;  5LHG B;  3RC8 A;  2VWA A;  2WBL A;  1U5P A;  1Y64 B;  2DWK A;  5ETW A;  4PW8 A;  2CXL A;  2JRK A;  3WAK A;  4EB6 E;  2L3L A;  2IC9 A;  3CQC B;  5FMN A;  3C4W A;  3QUJ A;  5LHH B;  2H7V C;  4MBQ A;  3F31 A;  2WMN A;  4H9R C;  1ZKE A;  2EHO C;  1VOM A;  3I1A A;  2DNX A;  2Q9Q A;  3E08 A;  1E1H B;  4H9O C;  4O4I E;  4EYU A;  3BK9 A;  3CML A;  3CX8 B;  3LK2 B;  1ZEE A;  2LJL A;  3J9X 1;  3O1H A;  1FEW A;  4EZH A;  4ZS2 A;  4AKL A;  3A5X A;  4BJN A;  4BJM A;  1Z0P A;  4OHF A;  4PJN A;  2NWB A;  5C8Y E;  1X79 A;  5FY0 A;  4CI3 B;  3EDU A;  4PK5 A;  3VKH A;  4B6X A;  5JR9 B;  3K8P C;  3Q5W A;  3RYF E;  3AA0 B;  1WYC A;  5FXZ A;  2K9A A;  4GK5 E;  5HXH A;  3GWH A;  5IHY A;  4TUY E;  3ANW A;  4NUU A;  3AA7 B;  2JMK A;  1FMV A;  4HEA A;  3NRX A;  5F8P A;  2YU1 A;  2KIN B;  4YFS A;  1QSD A;  5BMV E;  4H9Q C;  4OYK A;  3PUR A;  2NW8 A;  2C5K T;  2KXP B;  5L3C B;  1D0Y A;  4IE4 A;  4MLK A;  2G0U A;  3ZN0 B;  5F3J A;  2VK9 A;  3AVS A;  3CQX C;  3D0T A;  3Q2M A;  4YLH A;  4ZI2 C;  3H37 A;  4H9P C;  2CA5 A;  4C90 A;  3AB3 B;  4CI1 B;  4DO0 A;  3N9Q A;  2A3D A;  2X0L B;  3KVA A;  4OYJ A;  3U78 A;  5J2U E;  3R84 B;  4X1K E;  4HFV A;  2PFV A;  5FP3 A;  2MOZ A;  1MIV A;  2C5J A;  3DJB A;  3JC6 D;  1MIY A;  4TN7 B;  5AFU L;  1S35 A;  2BDE A;  2Q9Q B;  3U3I A;  4BA9 A;  3BQK A;  4XAX B;  1HCI A;  1KNZ A;  2N1G A;  1FMW A;  4ANJ A;  2E8I A;  1MMN A;  3DP7 A;  5HYA A;  2RA1 A;  3MJX A;  2VKO A;  5JDH A;  3PUQ A;  4CQI A;  2B1E A;  2NTX A;  2BVM A;  4QX8 B;  5LBQ B;  4I43 B;  4EZ4 A;  5JDQ A;  4ILU A;  2PBI A;  4E7Z A;  4UV8 B;  3GN5 B;  4EIW A;  3SRZ A;  1D1A A;  3I0Q A;  2D2S A;  2LSJ A;  2WWU A;  4CXY A;  2JQQ A;  2E9X C;  2LEH A;  3SWH A;  3LBX A;  2LSI A;  2PG8 A;  4HN9 A;  3PU8 A;  4JEU B;  4QXC B;  5J1G A;  2CMR A;  4TV9 E;  1MND A;  3F2E A;  1WRD A;  3BQL A;  4QXH B;  3LFM A;  4ZI3 D;  2QA7 A;  4CXW A;  2LOS A;  3AA6 B;  3ZMV B;  2DCF A;  3K3N A;  1LRZ A;  3UUM A;  5LGN B;  5JRC B;  2XQY A;  2I59 A;  2KLQ A;  2CM0 A;  2LM9 A;  3ZPO A;  5LP6 E;  2Y8D A;  5L2L A;  4AKH A;  3UUL A;  4JUY A;  3RH3 A;  3WI3 A;  2Q9Q D;  2X51 A;  4P09 A;  1BR4 A;  2WM9 A;  4TV8 E;  2Y6X A;  2VAS A;  3LJC A;  2QGS A;  5JR9 A;  5EK3 A;  2OA5 A;  4DBQ A;  2LHR A;  4UF0 B;  5FXV A;  5JQG E;  4O2B E;  4TZ4 C;  3MZK B;  2NOX A;  4OFZ A;  2EHO B;  4KUM B;  2WAU A;  5DQV A;  4EXT A;  3O9X A;  4NUV A;  3KBT A;  3CQG B;  4CXX A;  5JDF A;  4GIW A;  2JJ9 A;  4MHC A;  4OK0 A;  3VKG A;  4U72 A;  2ZM0 A;  3IEE A;  3HKC E;  2CWY A;  5M4Y A;  3ZLI A;  4ERR A;  3IBP A;  3KVB A;  1IAP A;  3IHR A;  4UVB B;  2KZ7 B;  2V1D B;  3OJA A;  3FB2 A;  4H63 H;  1HG5 A;  5LGU B;  3C4X A;  1OXZ A;  5FY7 A;  1YKE B;  1OWA A;  5FYM A;  5HWY A;  5LA6 E;  4EOZ B;  4G2A A;  2BVL A;  4ISS A;  2YK0 A;  3BQI A;  3KV6 A;  3PTR B;  5LHI B;  4QXB B;  3MAC A;  5L3B B;  3H3A A;  2UXN B;  1WLX A;  3CPZ A;  5FXW A;  3ONX A;  2C5I T;  4IDZ A;  2KWH A;  4L9I A;  4J2C A;  1B7T A;  3HKE E;  4G63 A;  2YEV C;  4QHO A;  5LOV E;  3GN5 A;  2K5B B;  3C51 A;  1AJ3 A;  4KBM B;  2X9W A;  4AI6 A;  2MYS A;  4I4T E;  3GA8 A;  3RPU A;  4C91 A;  5HWX A;  3HKB E;  3I9W A;  5L3D B;  1O3X A;  4WBO A;  3ZYK A;  2V7L A;  5HXS A;  4P0A A;  2IW5 B;  5H6R B;  3MA9 A;  2ZMA A;  3ZYM A;  3ZJ1 A;  3ESL A;  3AAE B;  3KV4 A;  3RRC A;  4EYY R;  5L3G B;  5LXT E;  1YW0 A;  3JC6 C;  2H7O A;  4IE6 A;  5JRC A;  3ZN1 B;  3ZMU B;  2SPC A;  3CKD A;  2RP4 A;  3RYC E;  2M67 A;  3DTO A;  5LG4 A;  4H63 V;  5DJQ C;  2E9X B;  1MIW A;  4O8S A;  3C4Z A;  1BR2 A;  2D0T A;  2CEA A;  3HI2 A;  4Z8X A;  5LCY A;  1D1C A;  2NP9 A;  3KDS E;  4AXP A;  2L9Q A;  3LG7 A;  1UCU A;  4XZC A;  5KX5 E;  4F6R C;  2JMH A;  4YJ2 E;  3CWZ B;  4UF0 A;  1ZHC A;  3EUH A;  3KIN B;  3N2G E;  2P9B A;  2DHR A;  4AQF C;  4YJ3 E;  5HXR A;  4ZI2 D;  5HXE A;  4IE0 A;  2EHO A;  2CXD A;  4WNK A;  4KMC A;  4UXN B;  3RYI E;  4WW0 A;  3OYX A;  2CCQ A;  1LKX A;  4PK4 A;  4X1I E;  5GON E;  3RC3 A;  2CE7 A;  4PNI A;  2NW7 A;  2VKJ A;  2X9X A;  3PUS A;  1MNE A;  4ADZ A;  3C50 A;  3AAI A;  2X68 A;  4ZI3 C;  2WMO A;  4QKN A;  3N9L A;  3E0Z A;  2CLY C;  5HXC A;  1KK7 A;  3CVR A;  5TAO A;  3UT5 E;  3RRW A;  2LHN A;  2HPJ A;  3N2K E;  2HPL A;  4IHJ E;  3UUN A;  3FXE B;  1IJ6 A;  1BR1 A;  4IE5 A;  1BR0 A;  4UVA B;  4O4J E;  3KBU A;  3FHN A;  3NBX X;  1HFA A;  4EAH A;  2UXX B;  2ODU A;  4AKG A;  1CUN A;  1G73 A;  2XHE B;  3QK6 A;  2N2N A;  5LYJ E;  1VRB A;  1UX4 A;  3O1I A;  2C0S A;  3L09 A;  4PJM A;  2W61 A;  3TKL B;  5CB4 E;  3T8O A;  2K48 A;  3V5S A;  3CX6 B;  3EVY A;  3RKO A;  4I55 E;  2V7M A;  4H9N C;  3UUX B;  5L3E B;  5LNK A;  2DI4 A;  4DVD A;  5LBM A;  2KND A;  2IAK A;  3MK7 C;  4QX7 B;  3IF8 B;  5EK4 A;  3I9Y A;  3VU7 H;  3PE0 A;  4GYS A;  5JH7 E;  2D5U A;  4ZI7 E;  1HX8 A;  1WYB A;  4AKI A;  4FI5 A;  3NZQ A;  1SA0 E;  2KMF A;  3O4X E;  2LSK A;  4JEH B;  4UIG A;  5KDM C;  2HH7 A;  3V5U A;  2KWI B;  5JDM A;  3ETV A;  3RYH E;  3K3O A;  1LVK A;  2XAF B;  4L0R A;  1D0X A;  2E9X A;  2PJQ A;  2VL8 A;  3HL6 A;  2IC6 A;  3N5L A;  2V26 A;  3ZMZ B;  3VHL A;  3SOL A;  3N9P A;  3ZEF B;  2W62 A;  5CA1 E;  1UX5 A;  1EZ3 A;  2GK9 A;  4FJO A;  3WAJ A;  3C64 A;  3B13 A;  4N78 D;  2X9H A;  3FBZ A;  1SHZ C;  3NZP A;  2H3R A;  1YD8 G;  2NW9 A;  3NRY A;  2LT3 A;  3OBV E;  5HAX A;  4E7S A;  1US7 B;  4A56 A;  5JVD E;  2ACX A;  1U4Q A;  3F57 A;  2N9D A;  4PAG A;  2EHO D;  5FY1 A;  1ZV4 X;  3N9N A;  4IIJ E;  3Q9D A;  4GOU A;  4ZHQ E;  2MBG A;  3MXZ A;  1G8X A;  3I0O A;  5FXX A;  1T98 A;  4I50 E;  4YHJ A;  4O4H E;  5ADX L;  2XAS B;  2LOP A;  5JDG A;  2CWO A;  2X67 A;  3CX7 B;  4UV9 B;  3PUG A;  2YU2 A;  2Z6E A;  4M1P A;  3R6N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...