3PJAJ

Crystal structure of human c3po complex
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
243
structure length
219
Chain Sequence
b'SSPVMLAFKSFQQELDARHDKYERLVKLSRDITVESKRTIFLLHRITSAPDMEDILTESEIKLDGVRQKIFQVAQELSGEDMHQFHRAITTGLQEYVEAVSFQHFIKTRSLISMDEINKQLIFTLRVTPVDYLLGVADLTGELMRMCINSVGNGDIDTPFEVSQFLRQVYDGFSFIGNTGPYEVSKKLYTLKQSLAKVENACYALKVRGSEIPKHMLAD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Translin
molecule tags Hydrolase
source organism Homo sapiens
publication title Structure of C3PO and mechanism of human RISC activation.
pubmed doi rcsb
total genus 94
structure length 219
sequence length 243
chains with identical sequence K, L
ec nomenclature
pdb deposition date 2010-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01997 Translin Translin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.190 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Translin; domain 1 3pjaJ01
1.20.58.200 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Translin; domain 2 3pjaJ02
2QVAA 1KEYA 4WYVA 3AXJA 1J1JA 2QRXA 3PJAJ 3PJAA 3AXJB 3RIUC 3RIUA 3QB5K 3QB5A
chains in the Genus database with same CATH superfamily
2W61A 4UV8B 2VB6A 4ZZCA 4F6RC 4H9OC 4EB6E 2XQAA 3G06A 2JIWA 4MBQA 4KHPT 3FZMB 1W0BA 4KHZF 3N9MA 1AJ3A 5AQKB 4CI1B 4HWCA 1B7TA 3Q5EA 4IDPA 4AQYT 2YINA 4IL4A 2QRXA 4ZHQE 4TNVA 4Z90A 1UGOA 5FY7A 2KZ7B 2DWGA 3LJCA 2UXNB 4IDZA 5GONE 3SFDA 5BMVE 1CHUA 2BVLA 2I59A 3Q2MA 5JDMA 5LMUT 2XAHB 3GMIA 2CA5A 4H9SE 3ZT6A 2OV9A 5IYZE 4QHOA 4WBOA 3AE1A 2WBLA 5JVDE 2YEVC 4KI0F 5EZYE 2I6HA 2EHOD 3T1HT 4B6XA 4ILAA 5LJMA 3PJAJ 3AEEA 3LG7A 2V8SV 3K8PC 1HNZT 5HWXA 4FJOA 4JUYA 2CRBA 4UVCB 2V7LA 3E22E 1UURA 4ZEYA 4TV9E 4DR3T 2WAUA 3PUAA 4CI3B 1WCRA 4QH5A 4DV0T 4DV2T 5JH7E 4O4LE 3ZPOA 1FMVA 4QH4A 4X64T 5FP3A 5AQFB 3AB3B 2C5KT 2K24A 3ZMVB 3VHLA 2QGSA 4HFVA 2WM9A 5LYJE 4YTNA 3E08A 3PV0F 1YQ4A 3GN5B 4JI1T 1X9BA 3ONJA 4UVAB 4PNIA 3CX6B 2JQKA 4IDNA 4P0BA 4UV9B 5FXWA 3T8OA 5JDLA 5AQHB 2WDRA 3HKBE 2WQYA 3QB5K 4GKKT 1M62A 5AQGB 4IGUA 2E9XD 5FY0A 5JTGA 1I94T 4YJ3E 2X9YA 5HEGA 1HNXT 3KBUA 4B3ST 3FBLA 4DBQA 1H7CA 2KNDA 3JCFA 3P50A 4QXHB 3EVYA 3L09A 3ZSTA 1WRDA 2NW9A 3OPCA 1QSDA 4LMLA 5H6RB 3PJAA 4O8SA 4DNDA 4YT0A 2DLRA 3C51A 3JAEA 2LM9A 4EZHA 4GK5E 1XNQT 4Z8XA 4U3CA 2LHRA 3KVAA 3K3OA 4DUZT 3H37A 3PUYF 3MACA 4X66T 4IIJE 3L8RA 1IJ6A 3JAFA 2D0TA 2X68A 4JEHB 2XM1A 4B3RT 2JJ9A 3BQKA 3E0ZA 2AXDS 2P9BA 3RC3A 1O3XA 5IWAT 4AKGA 4EEDA 3JADA 3P4WA 4I43B 4E7ZA 3K3NA 2ZM8A 4PJJA 4B3MT 3AE7A 3RKGA 1KK7A 2FJAA 2X51A 2FJEA 3A8YC 1OEDC 4K0UA 3ZCIA 3DJBA 2YU2A 3SRZA 2G0UA 3AEFA 2SPCA 2LSGA 2JQHA 2V5DA 2JQQA 3C98B 4PW8A 3UUNA 3VR9A 2XJ7A 5FY1A 2V1DB 2W62A 4ZI2D 3RYCE 5L47A 2VURA 2FUPA 3WI3A 3AA7B 4I50E 5ABGA 3EABA 2V6YB 2CBIA 5LG4A 5LHIB 3ZN1B 3UULA 2YDQA 3O1IA 1HTJF 2LSYA 3NZQA 4UIGA 1L0VA 5A1LA 3AEAA 4UEMA 5H6QB 2LLYA 4H9RC 4U74A 3ANWB 4LFAT 3QC9A 2BG9A 3RI5A 3UU4A 3N9OA 4BAYB 4ASKA 1FIOA 3PUGA 4HFEA 5FXZA 4YXDA 4EAHA 4WYVA 3UQ7A 4GYSA 2LSKA 1S35A 4DO0A 2ZM2A 5HCMA 3P4PA 3ZMUB 3ZMTB 1E2AA 2UUBT 4HWFA 2JRKA 1XWMA 2X9WA 3VKHA 1YXRA 4N78D 3AXJA 4V1Av 4P1NA 3RKOA 4ILCA 2L9QA 3MKDA 2ODUA 1BR1A 2XQ6A 3ONLC 5HEOA 2A3DA 3RPUA 3CQCB 4OFZA 2XAGB 4CQIA 4G2AA 2XQ7A 1OEDB 5LOVE 2WWVA 1D1BA 3FZHB 3VRBA 1ZEEA 1Y01A 4WNKA 4TN7B 3RIAA 3PUXF 3JC6C 3KDSE 4DIDB 2HHHT 3KBTA 4E7SA 1J5WA 5LA6E 1MMGA 4L5GA 4MHCA 3CQXC 4DV4T 4DUYT 2BKNA 2LOPA 5L4EA 3UFEA 1G73A 1HR0T 1UX5A 2K48A 2UXCT 3NRXA 2XAQB 4EV6A 3RLFF 3BQLA 2EHOC 2BKPA 3AVSA 5FVKA 5BR8T 4O2AE 1HG5A 2GK9A 4Z91A 2A72A 3UUBA 3N2OA 4CN6A 3S4UA 1VOMA 2J62A 3RIFA 3NRYA 4EGWA 3O9XA 3M3ZB 3AAEB 4UVBB 5AQMB 3KVBA 2YU1A 3LFMA 3ESLA 4WZXA 5JDGA 2HN1A 1KNPA 4IDQA 3ZMSB 3FZLB 2R6GF 2XQYA 2CBJA 4DV5T 2VQET 1MMAA 2LT3A 2VK9A 3CMLA 2M6IA 1IBKT 2BG9B 4DV7T 4LF7T 2BBJA 3P4SA 4LF9T 2X67A 3IHRA 4TZ4C 2IHR1 4GOUA 4AKLA 5ABFB 4LF5T 5DQWA 1KEYA 4U31A 2XM2A 4L9IA 3RC8A 3AEDA 4X5TA 3C64A 4X62T 3SS1A 3NKZA 3HKCE 5JR9A 3I0QA 4WBNE 4PJMA 5L4HA 3PU3A 2RPAA 3Q9DA 3LBXB 4IL9A 3KV4A 3N2KE 3KFWX 1NWMX 2H89A 3H3MA 1S94A 3L3PA 2PJQA 4G63A 4IE7A 4NPPA 4AQGA 2XHEB 2CEAA 3HL6A 4IREA 1FEWA 2XPKA 5AQNB 3TLTA 3V5SA 2JPFA 5L3DB 1SHZC 3WAKA 5JR9B 3OJAA 4UELA 4YHJA 2LSJA 3ZYLA 4KBMB 1US7B 4JI8T 2JQ9A 2NW7A 5HCJA 1HG2A 2ZMAA 4PFOA 2WDQA 3I9YA 5HXHA 1HNWT 2CM0A 1N36T 5AQRB 3ZC1A 4NXMT 3UTKA 2BS4A 3LK2B 2C5IT 2WMNA 1BR4A 2D9DA 5LJNA 2C5JA 3I9WA 2DI4A 2J1DG 2RP4A 3I0OA 3DP7A 2OA5A 1MMNA 1U5PA 4HFCA 4ZOLE 2E8IA 3IF8B 2HH7A 3RRWA 2WY2A 3ZMZB 5L3CB 3RIUC 1MIWA 3IEEA 3ETVA 2ODVA 5HEJA 5HXEA 1Z8UA 2J4GA 3UQ4A 2UXXB 2CXLA 1D1CA 2HPLA 5L3EB 3CIRA 1D0ZA 1D1AA 3IA3A 4GIWA 3CK6A 2VKJA 4X20E 2NWBA 3R84B 5KDMC 2BBHA 4AQFA 3AAIA 1V9DA 5TAOA 4ZS3A 3O1HA 5AQUB 2W0GA 1W09A 3GN5A 4PJNA 3OTOT 1FJGT 1LVFA 2QA7A 5KMGP 3EHZA 3JC6D 3AA0B 3FXEB 4I0UA 5CJ5A 3AA1B 2B1EA 3I1AA 2K9AA 4ISTA 3SFEA 3VRAA 3OVUA 3MA9A 4NUVA 4EZ4A 4ZI3C 4DR2T 3M65A 1N33T 4ZS2A 3ZT7A 4AKRB 2KSRA 3FBZA 3ZC0A 4HE8A 1YD8G 2NW8A 5LXTE 4H9NC 1UX4A 1NAFA 4XAXB 2BG9C 3RF1A 3FZKB 3ANWA 3HA4A 4H9PC 4HN9A 5JREA 2KXPB 2VKHA 3EI0A 4EOZB 3U3IA 4ANJA 1IJ5A 2MYSA 2F4VT 3LBXA 3N9PA 1GQEA 5ABEA 3K1SA 5EK3A 1SUMB 4O4IE 2WMOA 1T7SA 4IT4A 5LBQB 1YKEB 2YDRA 2B76A 2E9XA 3IBPA 4YFSA 4DMWA 5CFBA 4I4TE 2KWIB 4TWDA 5J2UE 1E7PA 1SA0E 2N9DA 3UU6A 3B13A 3PUSA 4IE6A 4A98A 4PK4A 4H63V 5LGUB 4EXTA 1HF8A 3KV9A 4KX6A 2IC6A 5HEHA 2WZIA 3GA8A 3OBVE 3VKGA 3O1JA 2H7VC 4A56A 4YLHA 2V7KA 2E9XB 4DR4T 2Y6XA 5CGMA 3WAJA 2Q9QD 3KV6A 5HWYA 4LFBT 3C4WA 3PUZF 1HS7A 1R8IA 1YQ3A 2BS2A 5DQVA 5LMNT 2H7OA 3EDUA 2Q9QA 4F8HA 5F8PA 4XZCA 2W4XA 1KNZA 2K5BB 3PTRB 2X9XA 5EK2A 3CX7B 4PJLA 3LK42 3NBXX 3PUWF 4AXPA 1WYCA 2PTFA 2EHOA 3OKQA 1YW0A 3RQWA 3VU7H 5AQLB 5AQOB 5LNKA 1OEDE 3ZCJA 3NWIA 3ZYMA 2X0YA 3C50A 3RRCA 3LDQB 3U78A 2WP9A 3A7MA 3AE9A 4HFDA 2WCAA 4P09A 1G8XA 2LHNA 3J9X1 2CHNA 3ZJ1A 3PUQA 2N2NA 5L3GB 4OK0A 1D0YA 4JI2T 2E5LT 3RH3A 1EZ3A 3MK7C 4TWHA 3SWHA 3AXJB 5JR9C 3D0TA 5FXVA 3FB2A 1WFDA 4DR5T 3ETUA 3PU8A 2KMFA 3BQIA 3UU3A 2X0LB 4HKAA 3AE3A 1MIYA 3AVRA 2UUAT 3QNUA 1UCUA 2JMKA 5JDQA 4IDOA 5C3JA 4ZI2C 3QK6A 1ZP0A 3T1YT 5C8YE 3ZLIA 4ILBA 2IIUA 3MXZA 4QKNA 5FMNA 2VASA 4C91A 5JDNA 2LRKA 2Z6EA 2V5CA 2XASB 3P4RA 2BVMA 2NTXA 1J5ET 3AE8A 4X1YE 2DL1A 2LKGA 2KLQA 3L39A 3Q5XA 2WSSV 4AI6A 2LSIA 5HAXA 5LGTB 1WR6A 4JI5T 1Y64B 2QVAA 3LSVA 4CN1A 4EEBA 1J1JA 4DR7T 3CX8B 1T8BA 2VVSA 2YKSA 2ACZA 4O4JE 5EK4A 5AQSB 5JDHA 4DVDA 5KX5E 3P4QA 4GK0E 4O4HE 1HCIA 3VR8A 3AEBA 5AQJB 2DNXA 3FHNA 3NVOA 3HI2A 2CLYC 4UR9A 5CB4E 2WU5A 5E0OA 2CCQA 3ZEFB 5ADXL 4JBWF 2W67A 5JQGE 3DTOA 3F31A 3FXDB 3MJXA 5L2LA 4PK6A 4LFCT 1NENA 4BA9A 4QXCB 3R6NA 4TNWA 2MTQA 2LJLA 4NUUA 3FZFB 4ISSA 1XZYA 3RIUA 4AIUA 3ONXA 2DHRA 2BKOA 2NP9A 2VL0A 2Y48B 4H9QC 3N9LA 1N32T 3UUXB 5LG3A 3ZJ2A 2Y8DA 4JV5T 4J2CA 2VVNA 2CXDA 1CUNA 2V6YA 3O4XE 3P7IA 4HWDA 4YSXA 3Q5WA 5L3FB 2JMHA 5ETWA 5F5WA 2X66A 5AQIB 4QX7B 4ADZA 3OYXA 4AQFC 4ZI7E 3HR0A 1VCSA 2X0HA 4HTEA 2V7IA 2XQ4A 3N2GE 3RGLA 4CZZB 2WS3A 4ZZBA 1XDPA 4YJ2E 3SOLA 4UF0B 5JRCA 4MLKA 3PURA 5LCYA 4BJNA 2M67A 1IBMT 2WB5A 4X1IE 3AECA 2VQFT 4X1KE 4ZXLA 2LM2A 2H88A 3ZKRA 2FBWA 4QWNB 3ZYKA 4KUMB 2CXFA 3RQUA 1UK5A 4HFHA 4A5XA 4YSZA 4Q25A 2L3LA 3UU5A 3X1DA 4DBRA 3TLVA 2E9XC 4JEUB 3RYIE 4A97A 3CVRA 5CA1E 3C4ZA 4LF6T 3QOFA 3HKEE 4HWIB 4PK5A 4OYKA 4B3TT 3PE0A 4JLEA 2NTYA 1XMOT 4JYAT 1MIVA 4DR6T 4HGAA 4QX8B 1JNZA 4HWHA 4BJMA 4COFA 4CXYA 4WW0A 5FYMA 4GKJT 4CN4A 4HFBA 2HPJA 5LB7B 2XQ9A 2WDVA 1NEKA 4TUYE 4XBFB 3LK3B 1XMQT 2BDEA 2D2SA 2J47A 3N9QA 1KFYA 1LKXA 1ZKEA 2MAWA 1LRZA 2Q9QC 3RYFE 4IE4A 5HYAA 5KXJA 2UXBT 3PDYA 3ZSSA 3OYZA 1HFAA 2NR4A 4AISA 3KV5A 3CKDA 4QXBB 1E1HB 2M6BA 2YK0A 3ABVA 5IHYA 3HKDE 3EAMA 4FI5A 5FVLA 1VRBA 2L8KA 1WYBA 3UUMA 2Q9QB 4AKIA 4DR1T 4U72A 2XZEA 2PBIA 1BR2A 2LKHA 2W63A 2ZLYA 4DV6T 2XAJB 3C4XA 4JI6T 2DWKA 3UU8A 4AKHA 4HFIA 4OX9T 3KINB 2HN2A 1W9RA 2W00A 3GWHA 2V7JA 3K3QC 3H3AA 3PUVF 4IHJE 2XAFB 2C0SA 1BR0A 2MOZA 2DCFA 1XDOA 4NXNT 1UUSA 4YTMA 2MPKA 3RHWA 2UU9T 3QB5A 5FKYA 5J2TE 2XSAA 2UUCT 5FL1A 5J1GA 2EHOB 5AQPB 4UXNB 4LF8T 2UXDT 1ZOYA 4EIWA 5J0ZA 2CMRA 2K3WA 1ZHCA 2BS3A 2V6XA 2V26A 2A9UA 3AE2A 4PFPA 4UF0A 5ABFA 4ERRA 5HXCA 2KINB 2AE9A 2E5VA 4KMCA 5F3JA 4TX5A 3J7Yq 2XQ3A 3BK9A 1JNRA 4M1PA 1D0XA 2XTLA 2MBGA 2ZM6T 4U2YA 3B5MA 2KWHA 5CA0E 5LHHB 2LRLA 1KNRA 2CLYB 4I55E 1KF6A 2BG9E 1IZNB 2VKOA 4PAGA 4CXWA 4P0AA 3CQGB 2CHOA 2RA1A 3B57A 4YY3T 3AA6B 2H3RA 2X9HA 3V5UA 2YN6A 1ZV4X 4LMJA 1I6ZA 4OHFA 2N1GA 1IAPA 2KT9A 5AQQB 4CXXA 2W66A 2LE8A 3N5LA 1WLXA 4ZI3D 5HXSA 1MNDA 4H63H 1QLBA 4IE5A 4JI3T 5M4YA 2ES0A 1MNEA 2XQ5A 3UFGA 3AE4A 4EYYR 1QUUA 2LEHA 1T72A 3EDVA 5C2TA 3NZPA 1OWAA 4QH1A 3TLSA 1XNRT 1OEDA 3AEGA 1M7KA 5FXXA 4CI2B 3P8CD 4YHHT 2WU2A 2W2UA 1YKHB 2YDSA 4DV3T 2CPTA 5LHGB 2PFVA 3N9NA 3Q5DA 4NIQA 1W0AA 4EYUA 1DU2A 2IDOB 2VL8A 4LMKA 3TKLB 4TWFA 4GYRA 5ABHA 2QYWA 3A5XA 1X79A 3MZKB 4IE0A 2WZHA 4TV8E 5AFUL 1U4QA 2NOXA 5HEUA 4JI7T 4KP3C 4HEAA 2OLTA 2PG8A 4K0KT 1HX8A 5LBMA 1IBLT 1FMWA 4O2BE 3EUHA 2XSBA 4ILUA 3RX6A 2FJDA 4U33A 1OXZA 1VCTA 3AE6A 2FJBA 2WWUA 2ACXA 2I0MA 3AE5A 5DJQC 2A2FX 2BZBA 5FNVE 3RYHE 2LOSA 3TLWA 2CWOA 2D5UA 2E2AA 2CE7A 2D0UA 3AAAB 4DMVA 4YSYA 2IUBA 2VKDA 1N34T 2IAKA 5L3BB 3F57A 4LF4T 4U2ZA 3F2EA 4OYJA 3ZT5A 3UT5E 5HXRA 1WR0A 2IMLA 2XUEA 3W15B 5AQTB 3ZN0B 4JI4T 4U7IA 2ZM0A 4L0RA 4C90A 2V7MA 2CWYA 2XY8B 4MFRA 5IUXA 2IW5B 5FL0A 4MALA 4X65T 5LP6E 3QUJA 5LGNB 4U7YA 4DV1T 2YOEA 1Z0PA 3CPZA 5JDFA 4YTPA 2XQ8A 2IC9A 5AQVB 4JI0T 1SE7A 5JRCB 1T98A 3TLUA 3CWZB 1MMDA 1LVKA 5DABA 1HX1B 2VWAA
chains in the Genus database with same CATH topology
2QVAA 1KEYA 4WYVA 3AXJA 1J1JA 2QRXA 3PJAJ 3PJAA 3AXJB 3RIUC 3RIUA 3QB5K 3QB5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QVA A;  1KEY A;  4WYV A;  3AXJ A;  1J1J A;  2QRX A;  3PJA J;  3PJA A;  3AXJ B;  3RIU C;  3RIU A;  3QB5 K;  3QB5 A; 
#chains in the Genus database with same CATH topology
 2W61 A;  4UV8 B;  2VB6 A;  4ZZC A;  4F6R C;  4H9O C;  4EB6 E;  2XQA A;  3G06 A;  2JIW A;  4MBQ A;  4KHP T;  3FZM B;  1W0B A;  4KHZ F;  3N9M A;  1AJ3 A;  5AQK B;  4CI1 B;  4HWC A;  1B7T A;  3Q5E A;  4IDP A;  4AQY T;  2YIN A;  4IL4 A;  2QRX A;  4ZHQ E;  4TNV A;  4Z90 A;  1UGO A;  5FY7 A;  2KZ7 B;  2DWG A;  3LJC A;  2UXN B;  4IDZ A;  5GON E;  3SFD A;  5BMV E;  1CHU A;  2BVL A;  2I59 A;  3Q2M A;  5JDM A;  5LMU T;  2XAH B;  3GMI A;  2CA5 A;  4H9S E;  3ZT6 A;  2OV9 A;  5IYZ E;  4QHO A;  4WBO A;  3AE1 A;  2WBL A;  5JVD E;  2YEV C;  4KI0 F;  5EZY E;  2I6H A;  2EHO D;  3T1H T;  4B6X A;  4ILA A;  5LJM A;  3PJA J;  3AEE A;  3LG7 A;  2V8S V;  3K8P C;  1HNZ T;  5HWX A;  4FJO A;  4JUY A;  2CRB A;  4UVC B;  2V7L A;  3E22 E;  1UUR A;  4ZEY A;  4TV9 E;  4DR3 T;  2WAU A;  3PUA A;  4CI3 B;  1WCR A;  4QH5 A;  4DV0 T;  4DV2 T;  5JH7 E;  4O4L E;  3ZPO A;  1FMV A;  4QH4 A;  4X64 T;  5FP3 A;  5AQF B;  3AB3 B;  2C5K T;  2K24 A;  3ZMV B;  3VHL A;  2QGS A;  4HFV A;  2WM9 A;  5LYJ E;  4YTN A;  3E08 A;  3PV0 F;  1YQ4 A;  3GN5 B;  4JI1 T;  1X9B A;  3ONJ A;  4UVA B;  4PNI A;  3CX6 B;  2JQK A;  4IDN A;  4P0B A;  4UV9 B;  5FXW A;  3T8O A;  5JDL A;  5AQH B;  2WDR A;  3HKB E;  2WQY A;  3QB5 K;  4GKK T;  1M62 A;  5AQG B;  4IGU A;  2E9X D;  5FY0 A;  5JTG A;  1I94 T;  4YJ3 E;  2X9Y A;  5HEG A;  1HNX T;  3KBU A;  4B3S T;  3FBL A;  4DBQ A;  1H7C A;  2KND A;  3JCF A;  3P50 A;  4QXH B;  3EVY A;  3L09 A;  3ZST A;  1WRD A;  2NW9 A;  3OPC A;  1QSD A;  4LML A;  5H6R B;  3PJA A;  4O8S A;  4DND A;  4YT0 A;  2DLR A;  3C51 A;  3JAE A;  2LM9 A;  4EZH A;  4GK5 E;  1XNQ T;  4Z8X A;  4U3C A;  2LHR A;  3KVA A;  3K3O A;  4DUZ T;  3H37 A;  3PUY F;  3MAC A;  4X66 T;  4IIJ E;  3L8R A;  1IJ6 A;  3JAF A;  2D0T A;  2X68 A;  4JEH B;  2XM1 A;  4B3R T;  2JJ9 A;  3BQK A;  3E0Z A;  2AXD S;  2P9B A;  3RC3 A;  1O3X A;  5IWA T;  4AKG A;  4EED A;  3JAD A;  3P4W A;  4I43 B;  4E7Z A;  3K3N A;  2ZM8 A;  4PJJ A;  4B3M T;  3AE7 A;  3RKG A;  1KK7 A;  2FJA A;  2X51 A;  2FJE A;  3A8Y C;  1OED C;  4K0U A;  3ZCI A;  3DJB A;  2YU2 A;  3SRZ A;  2G0U A;  3AEF A;  2SPC A;  2LSG A;  2JQH A;  2V5D A;  2JQQ A;  3C98 B;  4PW8 A;  3UUN A;  3VR9 A;  2XJ7 A;  5FY1 A;  2V1D B;  2W62 A;  4ZI2 D;  3RYC E;  5L47 A;  2VUR A;  2FUP A;  3WI3 A;  3AA7 B;  4I50 E;  5ABG A;  3EAB A;  2V6Y B;  2CBI A;  5LG4 A;  5LHI B;  3ZN1 B;  3UUL A;  2YDQ A;  3O1I A;  1HTJ F;  2LSY A;  3NZQ A;  4UIG A;  1L0V A;  5A1L A;  3AEA A;  4UEM A;  5H6Q B;  2LLY A;  4H9R C;  4U74 A;  3ANW B;  4LFA T;  3QC9 A;  2BG9 A;  3RI5 A;  3UU4 A;  3N9O A;  4BAY B;  4ASK A;  1FIO A;  3PUG A;  4HFE A;  5FXZ A;  4YXD A;  4EAH A;  4WYV A;  3UQ7 A;  4GYS A;  2LSK A;  1S35 A;  4DO0 A;  2ZM2 A;  5HCM A;  3P4P A;  3ZMU B;  3ZMT B;  1E2A A;  2UUB T;  4HWF A;  2JRK A;  1XWM A;  2X9W A;  3VKH A;  1YXR A;  4N78 D;  3AXJ A;  4V1A v;  4P1N A;  3RKO A;  4ILC A;  2L9Q A;  3MKD A;  2ODU A;  1BR1 A;  2XQ6 A;  3ONL C;  5HEO A;  2A3D A;  3RPU A;  3CQC B;  4OFZ A;  2XAG B;  4CQI A;  4G2A A;  2XQ7 A;  1OED B;  5LOV E;  2WWV A;  1D1B A;  3FZH B;  3VRB A;  1ZEE A;  1Y01 A;  4WNK A;  4TN7 B;  3RIA A;  3PUX F;  3JC6 C;  3KDS E;  4DID B;  2HHH T;  3KBT A;  4E7S A;  1J5W A;  5LA6 E;  1MMG A;  4L5G A;  4MHC A;  3CQX C;  4DV4 T;  4DUY T;  2BKN A;  2LOP A;  5L4E A;  3UFE A;  1G73 A;  1HR0 T;  1UX5 A;  2K48 A;  2UXC T;  3NRX A;  2XAQ B;  4EV6 A;  3RLF F;  3BQL A;  2EHO C;  2BKP A;  3AVS A;  5FVK A;  5BR8 T;  4O2A E;  1HG5 A;  2GK9 A;  4Z91 A;  2A72 A;  3UUB A;  3N2O A;  4CN6 A;  3S4U A;  1VOM A;  2J62 A;  3RIF A;  3NRY A;  4EGW A;  3O9X A;  3M3Z B;  3AAE B;  4UVB B;  5AQM B;  3KVB A;  2YU1 A;  3LFM A;  3ESL A;  4WZX A;  5JDG A;  2HN1 A;  1KNP A;  4IDQ A;  3ZMS B;  3FZL B;  2R6G F;  2XQY A;  2CBJ A;  4DV5 T;  2VQE T;  1MMA A;  2LT3 A;  2VK9 A;  3CML A;  2M6I A;  1IBK T;  2BG9 B;  4DV7 T;  4LF7 T;  2BBJ A;  3P4S A;  4LF9 T;  2X67 A;  3IHR A;  4TZ4 C;  2IHR 1;  4GOU A;  4AKL A;  5ABF B;  4LF5 T;  5DQW A;  1KEY A;  4U31 A;  2XM2 A;  4L9I A;  3RC8 A;  3AED A;  4X5T A;  3C64 A;  4X62 T;  3SS1 A;  3NKZ A;  3HKC E;  5JR9 A;  3I0Q A;  4WBN E;  4PJM A;  5L4H A;  3PU3 A;  2RPA A;  3Q9D A;  3LBX B;  4IL9 A;  3KV4 A;  3N2K E;  3KFW X;  1NWM X;  2H89 A;  3H3M A;  1S94 A;  3L3P A;  2PJQ A;  4G63 A;  4IE7 A;  4NPP A;  4AQG A;  2XHE B;  2CEA A;  3HL6 A;  4IRE A;  1FEW A;  2XPK A;  5AQN B;  3TLT A;  3V5S A;  2JPF A;  5L3D B;  1SHZ C;  3WAK A;  5JR9 B;  3OJA A;  4UEL A;  4YHJ A;  2LSJ A;  3ZYL A;  4KBM B;  1US7 B;  4JI8 T;  2JQ9 A;  2NW7 A;  5HCJ A;  1HG2 A;  2ZMA A;  4PFO A;  2WDQ A;  3I9Y A;  5HXH A;  1HNW T;  2CM0 A;  1N36 T;  5AQR B;  3ZC1 A;  4NXM T;  3UTK A;  2BS4 A;  3LK2 B;  2C5I T;  2WMN A;  1BR4 A;  2D9D A;  5LJN A;  2C5J A;  3I9W A;  2DI4 A;  2J1D G;  2RP4 A;  3I0O A;  3DP7 A;  2OA5 A;  1MMN A;  1U5P A;  4HFC A;  4ZOL E;  2E8I A;  3IF8 B;  2HH7 A;  3RRW A;  2WY2 A;  3ZMZ B;  5L3C B;  3RIU C;  1MIW A;  3IEE A;  3ETV A;  2ODV A;  5HEJ A;  5HXE A;  1Z8U A;  2J4G A;  3UQ4 A;  2UXX B;  2CXL A;  1D1C A;  2HPL A;  5L3E B;  3CIR A;  1D0Z A;  1D1A A;  3IA3 A;  4GIW A;  3CK6 A;  2VKJ A;  4X20 E;  2NWB A;  3R84 B;  5KDM C;  2BBH A;  4AQF A;  3AAI A;  1V9D A;  5TAO A;  4ZS3 A;  3O1H A;  5AQU B;  2W0G A;  1W09 A;  3GN5 A;  4PJN A;  3OTO T;  1FJG T;  1LVF A;  2QA7 A;  5KMG P;  3EHZ A;  3JC6 D;  3AA0 B;  3FXE B;  4I0U A;  5CJ5 A;  3AA1 B;  2B1E A;  3I1A A;  2K9A A;  4IST A;  3SFE A;  3VRA A;  3OVU A;  3MA9 A;  4NUV A;  4EZ4 A;  4ZI3 C;  4DR2 T;  3M65 A;  1N33 T;  4ZS2 A;  3ZT7 A;  4AKR B;  2KSR A;  3FBZ A;  3ZC0 A;  4HE8 A;  1YD8 G;  2NW8 A;  5LXT E;  4H9N C;  1UX4 A;  1NAF A;  4XAX B;  2BG9 C;  3RF1 A;  3FZK B;  3ANW A;  3HA4 A;  4H9P C;  4HN9 A;  5JRE A;  2KXP B;  2VKH A;  3EI0 A;  4EOZ B;  3U3I A;  4ANJ A;  1IJ5 A;  2MYS A;  2F4V T;  3LBX A;  3N9P A;  1GQE A;  5ABE A;  3K1S A;  5EK3 A;  1SUM B;  4O4I E;  2WMO A;  1T7S A;  4IT4 A;  5LBQ B;  1YKE B;  2YDR A;  2B76 A;  2E9X A;  3IBP A;  4YFS A;  4DMW A;  5CFB A;  4I4T E;  2KWI B;  4TWD A;  5J2U E;  1E7P A;  1SA0 E;  2N9D A;  3UU6 A;  3B13 A;  3PUS A;  4IE6 A;  4A98 A;  4PK4 A;  4H63 V;  5LGU B;  4EXT A;  1HF8 A;  3KV9 A;  4KX6 A;  2IC6 A;  5HEH A;  2WZI A;  3GA8 A;  3OBV E;  3VKG A;  3O1J A;  2H7V C;  4A56 A;  4YLH A;  2V7K A;  2E9X B;  4DR4 T;  2Y6X A;  5CGM A;  3WAJ A;  2Q9Q D;  3KV6 A;  5HWY A;  4LFB T;  3C4W A;  3PUZ F;  1HS7 A;  1R8I A;  1YQ3 A;  2BS2 A;  5DQV A;  5LMN T;  2H7O A;  3EDU A;  2Q9Q A;  4F8H A;  5F8P A;  4XZC A;  2W4X A;  1KNZ A;  2K5B B;  3PTR B;  2X9X A;  5EK2 A;  3CX7 B;  4PJL A;  3LK4 2;  3NBX X;  3PUW F;  4AXP A;  1WYC A;  2PTF A;  2EHO A;  3OKQ A;  1YW0 A;  3RQW A;  3VU7 H;  5AQL B;  5AQO B;  5LNK A;  1OED E;  3ZCJ A;  3NWI A;  3ZYM A;  2X0Y A;  3C50 A;  3RRC A;  3LDQ B;  3U78 A;  2WP9 A;  3A7M A;  3AE9 A;  4HFD A;  2WCA A;  4P09 A;  1G8X A;  2LHN A;  3J9X 1;  2CHN A;  3ZJ1 A;  3PUQ A;  2N2N A;  5L3G B;  4OK0 A;  1D0Y A;  4JI2 T;  2E5L T;  3RH3 A;  1EZ3 A;  3MK7 C;  4TWH A;  3SWH A;  3AXJ B;  5JR9 C;  3D0T A;  5FXV A;  3FB2 A;  1WFD A;  4DR5 T;  3ETU A;  3PU8 A;  2KMF A;  3BQI A;  3UU3 A;  2X0L B;  4HKA A;  3AE3 A;  1MIY A;  3AVR A;  2UUA T;  3QNU A;  1UCU A;  2JMK A;  5JDQ A;  4IDO A;  5C3J A;  4ZI2 C;  3QK6 A;  1ZP0 A;  3T1Y T;  5C8Y E;  3ZLI A;  4ILB A;  2IIU A;  3MXZ A;  4QKN A;  5FMN A;  2VAS A;  4C91 A;  5JDN A;  2LRK A;  2Z6E A;  2V5C A;  2XAS B;  3P4R A;  2BVM A;  2NTX A;  1J5E T;  3AE8 A;  4X1Y E;  2DL1 A;  2LKG A;  2KLQ A;  3L39 A;  3Q5X A;  2WSS V;  4AI6 A;  2LSI A;  5HAX A;  5LGT B;  1WR6 A;  4JI5 T;  1Y64 B;  2QVA A;  3LSV A;  4CN1 A;  4EEB A;  1J1J A;  4DR7 T;  3CX8 B;  1T8B A;  2VVS A;  2YKS A;  2ACZ A;  4O4J E;  5EK4 A;  5AQS B;  5JDH A;  4DVD A;  5KX5 E;  3P4Q A;  4GK0 E;  4O4H E;  1HCI A;  3VR8 A;  3AEB A;  5AQJ B;  2DNX A;  3FHN A;  3NVO A;  3HI2 A;  2CLY C;  4UR9 A;  5CB4 E;  2WU5 A;  5E0O A;  2CCQ A;  3ZEF B;  5ADX L;  4JBW F;  2W67 A;  5JQG E;  3DTO A;  3F31 A;  3FXD B;  3MJX A;  5L2L A;  4PK6 A;  4LFC T;  1NEN A;  4BA9 A;  4QXC B;  3R6N A;  4TNW A;  2MTQ A;  2LJL A;  4NUU A;  3FZF B;  4ISS A;  1XZY A;  3RIU A;  4AIU A;  3ONX A;  2DHR A;  2BKO A;  2NP9 A;  2VL0 A;  2Y48 B;  4H9Q C;  3N9L A;  1N32 T;  3UUX B;  5LG3 A;  3ZJ2 A;  2Y8D A;  4JV5 T;  4J2C A;  2VVN A;  2CXD A;  1CUN A;  2V6Y A;  3O4X E;  3P7I A;  4HWD A;  4YSX A;  3Q5W A;  5L3F B;  2JMH A;  5ETW A;  5F5W A;  2X66 A;  5AQI B;  4QX7 B;  4ADZ A;  3OYX A;  4AQF C;  4ZI7 E;  3HR0 A;  1VCS A;  2X0H A;  4HTE A;  2V7I A;  2XQ4 A;  3N2G E;  3RGL A;  4CZZ B;  2WS3 A;  4ZZB A;  1XDP A;  4YJ2 E;  3SOL A;  4UF0 B;  5JRC A;  4MLK A;  3PUR A;  5LCY A;  4BJN A;  2M67 A;  1IBM T;  2WB5 A;  4X1I E;  3AEC A;  2VQF T;  4X1K E;  4ZXL A;  2LM2 A;  2H88 A;  3ZKR A;  2FBW A;  4QWN B;  3ZYK A;  4KUM B;  2CXF A;  3RQU A;  1UK5 A;  4HFH A;  4A5X A;  4YSZ A;  4Q25 A;  2L3L A;  3UU5 A;  3X1D A;  4DBR A;  3TLV A;  2E9X C;  4JEU B;  3RYI E;  4A97 A;  3CVR A;  5CA1 E;  3C4Z A;  4LF6 T;  3QOF A;  3HKE E;  4HWI B;  4PK5 A;  4OYK A;  4B3T T;  3PE0 A;  4JLE A;  2NTY A;  1XMO T;  4JYA T;  1MIV A;  4DR6 T;  4HGA A;  4QX8 B;  1JNZ A;  4HWH A;  4BJM A;  4COF A;  4CXY A;  4WW0 A;  5FYM A;  4GKJ T;  4CN4 A;  4HFB A;  2HPJ A;  5LB7 B;  2XQ9 A;  2WDV A;  1NEK A;  4TUY E;  4XBF B;  3LK3 B;  1XMQ T;  2BDE A;  2D2S A;  2J47 A;  3N9Q A;  1KFY A;  1LKX A;  1ZKE A;  2MAW A;  1LRZ A;  2Q9Q C;  3RYF E;  4IE4 A;  5HYA A;  5KXJ A;  2UXB T;  3PDY A;  3ZSS A;  3OYZ A;  1HFA A;  2NR4 A;  4AIS A;  3KV5 A;  3CKD A;  4QXB B;  1E1H B;  2M6B A;  2YK0 A;  3ABV A;  5IHY A;  3HKD E;  3EAM A;  4FI5 A;  5FVL A;  1VRB A;  2L8K A;  1WYB A;  3UUM A;  2Q9Q B;  4AKI A;  4DR1 T;  4U72 A;  2XZE A;  2PBI A;  1BR2 A;  2LKH A;  2W63 A;  2ZLY A;  4DV6 T;  2XAJ B;  3C4X A;  4JI6 T;  2DWK A;  3UU8 A;  4AKH A;  4HFI A;  4OX9 T;  3KIN B;  2HN2 A;  1W9R A;  2W00 A;  3GWH A;  2V7J A;  3K3Q C;  3H3A A;  3PUV F;  4IHJ E;  2XAF B;  2C0S A;  1BR0 A;  2MOZ A;  2DCF A;  1XDO A;  4NXN T;  1UUS A;  4YTM A;  2MPK A;  3RHW A;  2UU9 T;  3QB5 A;  5FKY A;  5J2T E;  2XSA A;  2UUC T;  5FL1 A;  5J1G A;  2EHO B;  5AQP B;  4UXN B;  4LF8 T;  2UXD T;  1ZOY A;  4EIW A;  5J0Z A;  2CMR A;  2K3W A;  1ZHC A;  2BS3 A;  2V6X A;  2V26 A;  2A9U A;  3AE2 A;  4PFP A;  4UF0 A;  5ABF A;  4ERR A;  5HXC A;  2KIN B;  2AE9 A;  2E5V A;  4KMC A;  5F3J A;  4TX5 A;  3J7Y q;  2XQ3 A;  3BK9 A;  1JNR A;  4M1P A;  1D0X A;  2XTL A;  2MBG A;  2ZM6 T;  4U2Y A;  3B5M A;  2KWH A;  5CA0 E;  5LHH B;  2LRL A;  1KNR A;  2CLY B;  4I55 E;  1KF6 A;  2BG9 E;  1IZN B;  2VKO A;  4PAG A;  4CXW A;  4P0A A;  3CQG B;  2CHO A;  2RA1 A;  3B57 A;  4YY3 T;  3AA6 B;  2H3R A;  2X9H A;  3V5U A;  2YN6 A;  1ZV4 X;  4LMJ A;  1I6Z A;  4OHF A;  2N1G A;  1IAP A;  2KT9 A;  5AQQ B;  4CXX A;  2W66 A;  2LE8 A;  3N5L A;  1WLX A;  4ZI3 D;  5HXS A;  1MND A;  4H63 H;  1QLB A;  4IE5 A;  4JI3 T;  5M4Y A;  2ES0 A;  1MNE A;  2XQ5 A;  3UFG A;  3AE4 A;  4EYY R;  1QUU A;  2LEH A;  1T72 A;  3EDV A;  5C2T A;  3NZP A;  1OWA A;  4QH1 A;  3TLS A;  1XNR T;  1OED A;  3AEG A;  1M7K A;  5FXX A;  4CI2 B;  3P8C D;  4YHH T;  2WU2 A;  2W2U A;  1YKH B;  2YDS A;  4DV3 T;  2CPT A;  5LHG B;  2PFV A;  3N9N A;  3Q5D A;  4NIQ A;  1W0A A;  4EYU A;  1DU2 A;  2IDO B;  2VL8 A;  4LMK A;  3TKL B;  4TWF A;  4GYR A;  5ABH A;  2QYW A;  3A5X A;  1X79 A;  3MZK B;  4IE0 A;  2WZH A;  4TV8 E;  5AFU L;  1U4Q A;  2NOX A;  5HEU A;  4JI7 T;  4KP3 C;  4HEA A;  2OLT A;  2PG8 A;  4K0K T;  1HX8 A;  5LBM A;  1IBL T;  1FMW A;  4O2B E;  3EUH A;  2XSB A;  4ILU A;  3RX6 A;  2FJD A;  4U33 A;  1OXZ A;  1VCT A;  3AE6 A;  2FJB A;  2WWU A;  2ACX A;  2I0M A;  3AE5 A;  5DJQ C;  2A2F X;  2BZB A;  5FNV E;  3RYH E;  2LOS A;  3TLW A;  2CWO A;  2D5U A;  2E2A A;  2CE7 A;  2D0U A;  3AAA B;  4DMV A;  4YSY A;  2IUB A;  2VKD A;  1N34 T;  2IAK A;  5L3B B;  3F57 A;  4LF4 T;  4U2Z A;  3F2E A;  4OYJ A;  3ZT5 A;  3UT5 E;  5HXR A;  1WR0 A;  2IML A;  2XUE A;  3W15 B;  5AQT B;  3ZN0 B;  4JI4 T;  4U7I A;  2ZM0 A;  4L0R A;  4C90 A;  2V7M A;  2CWY A;  2XY8 B;  4MFR A;  5IUX A;  2IW5 B;  5FL0 A;  4MAL A;  4X65 T;  5LP6 E;  3QUJ A;  5LGN B;  4U7Y A;  4DV1 T;  2YOE A;  1Z0P A;  3CPZ A;  5JDF A;  4YTP A;  2XQ8 A;  2IC9 A;  5AQV B;  4JI0 T;  1SE7 A;  5JRC B;  1T98 A;  3TLU A;  3CWZ B;  1MMD A;  1LVK A;  5DAB A;  1HX1 B;  2VWA A; 
#chains in the Genus database with same CATH homology
 2QVA A;  1KEY A;  4WYV A;  3AXJ A;  1J1J A;  2QRX A;  3PJA J;  3PJA A;  3AXJ B;  3RIU C;  3RIU A;  3QB5 K;  3QB5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...