3PJAJ

Crystal structure of human c3po complex
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
243
structure length
219
Chain Sequence
SSPVMLAFKSFQQELDARHDKYERLVKLSRDITVESKRTIFLLHRITSAPDMEDILTESEIKLDGVRQKIFQVAQELSGEDMHQFHRAITTGLQEYVEAVSFQHFIKTRSLISMDEINKQLIFTLRVTPVDYLLGVADLTGELMRMCINSVGNGDIDTPFEVSQFLRQVYDGFSFIGNTGPYEVSKKLYTLKQSLAKVENACYALKVRGSEIPKHMLAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Translin
publication title Structure of C3PO and mechanism of human RISC activation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 94
structure length 219
sequence length 243
chains with identical sequence K, L
ec nomenclature
pdb deposition date 2010-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01997 Translin Translin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.190 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Translin; domain 1 3pjaJ01
1.20.58.200 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Translin; domain 2 3pjaJ02
4WYVA 3QB5A 2QRXA 3PJAA 3QB5K 2QVAA 3AXJB 3PJAJ 1KEYA 3RIUC 3AXJA 1J1JA 3RIUA
chains in the Genus database with same CATH superfamily
2XTLA 4PJLA 2VL8A 4JI1T 3CPZA 5AQFB 2QVAA 4O4IE 3TLWA 4NUUA 5LHIB 3WI3A 3TLVA 4H9NC 1XMQT 4JUYA 5LBQB 2WBLA 5CB4E 5LCYA 5HEJA 4E7ZA 1MMDA 4HEAA 3PUWF 5DQVA 3P8CD 2CLYC 2J4GA 3EVYA 5LJMA 2V7MA 2XM2A 3A5XA 3MXZA 4WYVA 4UEMA 2IUBA 1T72A 4H63H 4U74A 4NIQA 5L2LA 3ANWB 3MK7C 2R6GF 2NTYA 2JPFA 4I50E 4YSXA 3R84B 1HG2A 2A2FX 4YXDA 4QX7B 3P50A 1LVFA 4OHFA 3VU7H 5AFUL 2JJ9A 4GK0E 1IZNB 3LK3B 3UU3A 4PJNA 1T7SA 1YKEB 2XASB 4DV7T 2IC6A 4GIWA 3RIFA 4YJ2E 4O2BE 1UUSA 3N9MA 3TKLB 1IBLT 3AECA 2DCFA 2WDVA 4MLKA 5L4EA 2JMHA 3H3MA 4TN7B 2GK9A 4YFSA 4LMLA 2CXFA 1W9RA 4JYAT 4UV8B 4E7SA 4HTEA 3QB5K 1FIOA 1D1AA 3NBXX 3PUGA 5AQQB 3PUQA 3PJAA 2ZMAA 3E08A 2KMFA 2C5IT 3JADA 4IHJE 3ANWA 2H3RA 1HCIA 3LG7A 2XQAA 1BR0A 5AQGB 5AQJB 4A56A 4KUMB 5CFBA 3GWHA 4LFAT 2Q9QB 4GYSA 5IYZE 5EZYE 5AQPB 2VQFT 2K3WA 3HL6A 5L4HA 4L0RA 5DABA 2BS4A 2E9XD 2H7OA 3F2EA 3OTOT 2XQ3A 3FBZA 4TV9E 4CZZB 4ASKA 4UVCB 4TWHA 2MPKA 5JDQA 2VASA 3ZLIA 5ABHA 3TLUA 4DNDA 2FJEA 3NWIA 5FYMA 5LXTE 5LHGB 2PJQA 2W63A 5L3BB 4AKLA 2UU9T 1HG5A 2PTFA 2QRXA 1HR0T 2IC9A 5FY7A 2E8IA 5ADXL 4YJ3E 4H9RC 2C5KT 4DUZT 3CQXC 1KEYA 4IGUA 5L3EB 3DP7A 2AXDS 4JI7T 4ILBA 4X62T 4UF0B 2XQ4A 2PBIA 3K3OA 2WDQA 3GN5B 4AI6A 2BG9A 5F8PA 4U2YA 4Z8XA 2Q9QA 3RYFE 2BG9E 2HHHT 3RPUA 1I94T 5IHYA 4L5GA 2Z6EA 2X0HA 5M4YA 3KVBA 2KXPB 1NAFA 2KT9A 5LGNB 1ZEEA 2W67A 4IDPA 4WNKA 4DR4T 4KP3C 4AQFA 4UV9B 2ACZA 3AEBA 3BQKA 4EEBA 4GOUA 4O4HE 4PK6A 2VVSA 3UULA 2YEVC 3Q5DA 2ZM6T 2L3LA 2ACXA 4KBMB 3UU8A 4UELA 4IIJE 2V8SV 3ZSTA 4FJOA 4QWNB 4ZOLE 4DR1T 2QGSA 4IDNA 4GKKT 2KWIB 4HE8A 2CHOA 1VCSA 1IJ5A 2XHEB 3I1AA 4LMJA 3KBTA 4P1NA 2ZM2A 2BBHA 2P9BA 3LJCA 1ZOYA 4AKGA 3EUHA 4CI3B 4TUYE 1UCUA 2WB5A 3GA8A 4X65T 3IA3A 3PUZF 1MIVA 4AKIA 2UXDT 3GN5A 1WR6A 1WRDA 2UXNB 5FKYA 4QH5A 4B3ST 3FZKB 2LE8A 2G0UA 2JIWA 2JQHA 2IW5B 3FBLA 3V5SA 3CK6A 4K0KT 3AA6B 2LJLA 2UUAT 3I0OA 3AE4A 3RLFF 4PJMA 5JDMA 3T1YT 2W2UA 2XAGB 5ETWA 3GMIA 2YU1A 3RYIE 1KK7A 3C98B 1U4QA 5DJQC 4YLHA 4OYKA 4JI5T 1E7PA 3ZMZB 3KV9A 3OYXA 3JCFA 2MYSA 3AE8A 3VKHA 1OEDB 1GQEA 5AQKB 1G73A 5HEHA 1LRZA 3HA4A 1Y01A 4I55E 2BG9C 5JDNA 3RIAA 3CQCB 3NRXA 4JI0T 5HEGA 2VVNA 2Y6XA 4P09A 3AE2A 1VOMA 4COFA 2X0YA 2BBJA 4OFZA 2V5CA 3ZCIA 3QB5A 2WMNA 4HFHA 4ZZBA 2CM0A 2WWVA 3A7MA 4IDZA 2H89A 2RP4A 2CHNA 3OKQA 4Z91A 3N5LA 4AQYT 1SUMB 1ZKEA 1XNRT 4DR6T 3UQ7A 2LT3A 2X9XA 3MZKB 4HWFA 4L9IA 2V6YB 3FZFB 1AJ3A 3O1JA 4QH1A 3IEEA 5EK2A 2WZIA 2E2AA 5EK4A 2YINA 2DNXA 2BVLA 4EZHA 3HKDE 2NW7A 5JDHA 4DR3T 5JDFA 4JEUB 1OXZA 2LSYA 5AQTB 4ZI2C 2NTXA 4F8HA 2MAWA 4UR9A 1VCTA 1OEDA 2QYWA 3OPCA 1J1JA 4YHHT 2ODVA 1OEDE 1D0XA 4BA9A 5L47A 2EHOB 3JC6C 1W09A 2LHRA 4TNWA 2CA5A 3O1HA 3Q2MA 2X68A 4NXNT 4QX8B 3SOLA 3B5MA 2FUPA 2D9DA 3UU4A 4X1YE 2KWHA 3RH3A 4JEHB 5LB7B 2CE7A 5HAXA 4UIGA 2V7IA 2W61A 4KI0F 3CWZB 2BKOA 4I43B 4HFDA 3L3PA 2VQET 5LHHB 3KV5A 5FXVA 1KFYA 2CWOA 4V1Av 1UGOA 3I9YA 3ZYLA 3AEFA 3RYCE 5ABEA 2V6YA 3HI2A 4GYRA 2YOEA 3O1IA 5CA0E 3RYHE 3ZMTB 4CXYA 2XQ7A 2H7VC 4HN9A 1IJ6A 3UU5A 2AE9A 3N2KE 2HPLA 4IREA 4JI4T 2DLRA 2X51A 2X67A 3MJXA 2JQQA 5J1GA 1NEKA 2LRLA 3UUMA 3ZMUB 2WCAA 4DBQA 2JQ9A 4AQGA 2YN6A 1HNZT 2W4XA 4O2AE 3UQ4A 3CKDA 4O4LE 1XDOA 3UFGA 1MNDA 2D2SA 4JI6T 2OA5A 4TWFA 3C4WA 5FL1A 2ZM0A 4KMCA 2CPTA 2YDQA 3X1DA 5JR9B 1UURA 1WCRA 3LK2B 3LBXB 4QHOA 4OX9T 3R6NA 2FJAA 3PUAA 2XAFB 1SHZC 2KZ7B 2RPAA 1G8XA 2VKHA 3T1HT 4B3TT 4YSYA 4PFPA 1XDPA 2XUEA 1BR2A 2WAUA 3AE9A 5JRCB 5AQHB 1YQ4A 2LM2A 2CCQA 2VKOA 1U5PA 2I0MA 3KVAA 3LK42 2F4VT 2JRKA 3ZC0A 3RF1A 5LP6E 3S4UA 1V9DA 3C4ZA 3I9WA 3C51A 4OK0A 4HWIB 5KX5E 3AEGA 4TX5A 3CX8B 5AQUB 2HN1A 3KFWX 4DIDB 4LFBT 1M7KA 4EYUA 4ZI2D 1YQ3A 3QNUA 2W0GA 2E5LT 5IUXA 4H9PC 3UUXB 3AVRA 4LF4T 3ETVA 5FMNA 1HTJF 3U3IA 3JC6D 1S35A 3KINB 4G2AA 3CVRA 2YDRA 2I59A 3ABVA 2XSAA 3C50A 4EEDA 3EHZA 4O8SA 4ISSA 5HXSA 3ONLC 2V5DA 5AQLB 4WW0A 4TV8E 1HFAA 1MMAA 5E0OA 5HEOA 1Y64B 4DR5T 4C90A 3O4XE 3AA7B 3NZQA 3RQWA 5JRCA 3UUNA 3DJBA 2X0LB 3CIRA 3OVUA 2DWKA 3IBPA 3N2OA 4IE7A 4BJMA 3RGLA 3FHNA 3B57A 5JVDE 2X9YA 3WAJA 4PW8A 2Y48B 4NUVA 3U78A 3F31A 3N9QA 2J62A 1WLXA 4HWDA 2IAKA 5FXWA 2HH7A 1IBKT 1N32T 2E9XB 4IE0A 4ZI7E 3UFEA 3RHWA 3AVSA 5AQRB 2LSKA 3FZLB 3TLTA 5C3JA 3MACA 4EB6E 3HKEE 2VURA 4N78D 3UTKA 1XNQT 3ZT5A 4EAHA 2WDRA 3P7IA 4HFBA 1N34T 5BMVE 3JAEA 3AB3B 4JV5T 4YSZA 3WAKA 2DWGA 3HKBE 3AE7A 2UXXB 5JH7E 3RRCA 2XQ6A 4PK4A 4LF8T 3Q5WA 5KXJA 3BQIA 4XBFB 1WFDA 3P4WA 2IMLA 2B76A 4EOZB 2E5VA 2WU5A 2CLYB 4PFOA 5CJ5A 4ILUA 4IL9A 3Q5EA 2K48A 4LF5T 4DR2T 4KHPT 2X66A 4H9OC 2A9UA 4XAXB 4UF0A 3EABA 5J0ZA 5L3DB 2BVMA 2WY2A 3AAEB 5LMUT 4B6XA 1D0ZA 1NWMX 5EK3A 3J7Yq 2E9XA 4K0UA 1US7B 5F5WA 3F57A 2KSRA 4QH4A 4U3CA 2VWAA 3RIUA 5JTGA 1R8IA 2V7JA 5ABFB 2BS3A 3KBUA 4CN4A 4DV0T 2LHNA 4U31A 5JDGA 2QA7A 1W0AA 4PJJA 4DMWA 3RC3A 3H3AA 1Z8UA 5HCMA 2RA1A 2WSSV 4U33A 3AEEA 5AQVB 4DR7T 2VK9A 1WYCA 5HCJA 1XZYA 2XQ8A 2LOSA 2LSIA 4NXMT 4AIUA 4X20E 2KINB 4WZXA 2N1GA 4ILCA 4KHZF 2Q9QC 4IL4A 5IWAT 4EIWA 3LDQB 5FVLA 3RX6A 5JQGE 3ZMSB 3ZT7A 3AA1B 2N9DA 3P4QA 3JAFA 1NENA 2BDEA 4HWHA 5LOVE 3FZHB 2I6HA 5C2TA 1SE7A 1EZ3A 1CHUA 4AQFC 3IF8B 3O9XA 3T8OA 1MIWA 3SRZA 2WP9A 4EXTA 3AXJB 2N2NA 1QSDA 4ZHQE 4H9QC 4JI2T 3E0ZA 1YD8G 2DI4A 5H6QB 2WZHA 2XQ9A 3K3NA 5FY1A 3PU8A 3EDUA 4QXBB 4U7IA 3QK6A 3I0QA 1HNWT 2L8KA 3OBVE 4HWCA 2MTQA 4X5TA 4PNIA 3D0TA 1YXRA 3AE5A 3P4PA 4JI8T 4TWDA 4QKNA 2K5BB 5J2TE 1MNEA 3RKOA 1QLBA 2D0UA 4ZS3A 2IDOB 1BR1A 3HR0A 3PE0A 4HKAA 2M67A 4ZXLA 1WYBA 4JBWF 1FEWA 3J9X1 3MKDA 4LF9T 3C64A 4IE5A 2WM9A 3C4XA 4EYYR 3CMLA 5FXXA 2FJDA 2J47A 4ZS2A 3AE1A 1M62A 3LSVA 3VRBA 2NW8A 2CBIA 4A5XA 1ZV4X 2ODUA 5KMGP 2BS2A 4DO0A 4EZ4A 3LFMA 4ZZCA 2CMRA 1H7CA 4H63V 2NP9A 1UK5A 4U72A 4CQIA 2V7LA 1J5WA 2KNDA 2V26A 5LYJE 4F6RC 3ZKRA 4HFEA 4JLEA 3MA9A 2WQYA 3PURA 3CX7B 3PJAJ 3DTOA 5CA1E 2YU2A 3VRAA 3KV6A 1JNZA 1QUUA 2M6IA 5HXCA 2FBWA 1Z0PA 2CRBA 1DU2A 4GK5E 4LFCT 4DV3T 4Z90A 2VB6A 4ZI3C 2EHOA 3RC8A 3SFEA 4YTPA 2NWBA 3VKGA 3ETUA 5H6RB 3PUXF 5L3FB 3L09A 4KX6A 3EAMA 3ZJ1A 5BR8T 2ES0A 2Q9QD 1KNRA 2YK0A 3SFDA 1ZHCA 1HNXT 5FL0A 4IT4A 5LG3A 2JMKA 3RI5A 2LLYA 1OWAA 3G06A 5AQMB 3ZSSA 4CN1A 3SWHA 2XSBA 4UVAB 2LM9A 3ZT6A 4MFRA 3AE3A 4XZCA 5DQWA 3E22E 2HPJA 4X64T 3ESLA 2X9WA 3AE6A 3N9NA 3L8RA 4BJNA 4I4TE 4FI5A 3CQGB 4UVBB 1OEDC 3ZCJA 2NW9A 2W00A 1IBMT 3PTRB 3VR8A 4TZ4C 1E1HB 2LOPA 1E2AA 3OYZA 2IIUA 4YHJA 4CN6A 2FJBA 5KDMC 4ISTA 2CXDA 2XY8B 1HS7A 4ANJA 4P0AA 2SPCA 2BG9B 1WR0A 3H37A 4DV4T 1MIYA 4YTNA 2NR4A 2XQYA 2BZBA 4CXXA 1JNRA 3KDSE 5LBMA 1L0VA 2WWUA 5A1LA 5JR9A 1N33T 3ZMVB 3LBXA 4G63A 5FVKA 1J5ET 4AXPA 3QOFA 3ONJA 5L3CB 2ZLYA 2UXCT 4EV6A 5AQIB 1SA0E 2XAJB 2YKSA 5LGTB 3FXDB 2Y8DA 4PAGA 4U7YA 4CI2B 1KNPA 2C0SA 4LMKA 1XMOT 2EHOC 1X9BA 4O4JE 3NRYA 2UXBT 1UX5A 3ONXA 4EGWA 5LG4A 5LGUB 1O3XA 3HKCE 2LSGA 4GKJT 4ZI3D 3B13A 5HXRA 4A98A 3ZYKA 4DMVA 4DVDA 2X9HA 5HEUA 5JREA 2XAHB 4ZEYA 2XM1A 2V6XA 2D5UA 3ZN1B 5LNKA 4BAYB 1LVKA 1T8BA 2BKNA 3BQLA 3ZN0B 2WMOA 2NOXA 2OV9A 4UXNB 2JQKA 4A97A 2D0TA 4TNVA 4ERRA 3NZPA 3V5UA 2DHRA 4WBNE 4C91A 4ILAA 4U2ZA 4HFIA 2XJ7A 1IAPA 1HX1B 1T98A 5AQOB 3ZYMA 3EI0A 5JDLA 4MBQA 3TLSA 5F3JA 2C5JA 4PK5A 3ZPOA 5HYAA 2V7KA 5HXEA 1LKXA 3FXEB 1YKHB 3K3QC 2WS3A 2VKDA 4I0UA 3K1SA 3PUVF 5AQSB 1FMWA 5J2UE 5L3GB 1CUNA 5JR9C 4H9SE 4LF6T 1FMVA 1XWMA 4B3RT 3A8YC 4CXWA 2H88A 3KV4A 3FZMB 2M6BA 5HWYA 1D1BA 3UT5E 4YY3T 3AAIA 3PUSA 2A3DA 2CBJA 5C8YE 2LKHA 4HGAA 3RRWA 3K8PC 5FY0A 3P4RA 5LMNT 2L9QA 2W62A 3P4SA 3VR9A 4IDQA 1MMGA 5LA6E 2HN2A 1I6ZA 2PG8A 3BK9A 3ZEFB 4X1IE 4LF7T 1D0YA 3M3ZB 3PDYA 4QXHB 2MOZA 4DBRA 1YW0A 1VRBA 3PUYF 2PFVA 3IHRA 3ZC1A 3Q9DA 4DV2T 2ZM8A 2CXLA 2EHOD 3N9PA 3ZJ2A 3UU6A 2CWYA 4IDOA 4MHCA 2CEAA 4B3MT 1KNZA 2W66A 4IE6A 3CX6B 4Q25A 3EDVA 4DUYT 1HX8A 5ABFA 2K9AA 4AKHA 2BKPA 4JI3T 2YDSA 3PV0F 3N2GE 2XPKA 5FP3A 2MBGA 2WU2A 2XZEA 4NPPA 1B7TA 5GONE 1MMNA 1N36T 4ADZA 4AKRB 5ABGA 2LKGA 4QXCB 3L39A 4HFCA 4AISA 5FNVE 4CI1B 4DV1T 2LEHA 3AEAA 2UUCT 1BR4A 1ZP0A 1S94A 1D1CA 3NVOA 1W0BA 2B1EA 4J2CA 4HFVA 3SS1A 2IHR1 3NKZA 4WBOA 5FXZA 5CGMA 5HWXA 4P0BA 3RKGA 2XAQB 1FJGT 2LRKA 2KLQA 3FB2A 2E9XC 4YTMA 2VKJA 3QC9A 2V1DB 3PU3A 2J1DG 2K24A 3M65A 3VHLA 3AEDA 2XQ5A 4M1PA 1UX4A 4YT0A 3AA0B 5HXHA 5AQNB 3OJAA 1KF6A 5TAOA 4IE4A 3RIUC 2LSJA 4MALA 2DL1A 3N9LA 3Q5XA 4X1KE 2VL0A 1HF8A 2UUBT 2A72A 3QUJA 5LJNA 4DV5T 4DV6T 1X79A 4X66T 3UUBA 3AAAB 2OLTA 3W15B 3N9OA 3AXJA 3RQUA 4OYJA
chains in the Genus database with same CATH topology
4WYVA 3QB5A 2QRXA 3PJAA 3QB5K 2QVAA 3AXJB 3PJAJ 1KEYA 3RIUC 3AXJA 1J1JA 3RIUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WYV A;  3QB5 A;  2QRX A;  3PJA A;  3QB5 K;  2QVA A;  3AXJ B;  3PJA J;  1KEY A;  3RIU C;  3AXJ A;  1J1J A;  3RIU A; 
#chains in the Genus database with same CATH topology
 2XTL A;  4PJL A;  2VL8 A;  4JI1 T;  3CPZ A;  5AQF B;  2QVA A;  4O4I E;  3TLW A;  4NUU A;  5LHI B;  3WI3 A;  3TLV A;  4H9N C;  1XMQ T;  4JUY A;  5LBQ B;  2WBL A;  5CB4 E;  5LCY A;  5HEJ A;  4E7Z A;  1MMD A;  4HEA A;  3PUW F;  5DQV A;  3P8C D;  2CLY C;  2J4G A;  3EVY A;  5LJM A;  2V7M A;  2XM2 A;  3A5X A;  3MXZ A;  4WYV A;  4UEM A;  2IUB A;  1T72 A;  4H63 H;  4U74 A;  4NIQ A;  5L2L A;  3ANW B;  3MK7 C;  2R6G F;  2NTY A;  2JPF A;  4I50 E;  4YSX A;  3R84 B;  1HG2 A;  2A2F X;  4YXD A;  4QX7 B;  3P50 A;  1LVF A;  4OHF A;  3VU7 H;  5AFU L;  2JJ9 A;  4GK0 E;  1IZN B;  3LK3 B;  3UU3 A;  4PJN A;  1T7S A;  1YKE B;  2XAS B;  4DV7 T;  2IC6 A;  4GIW A;  3RIF A;  4YJ2 E;  4O2B E;  1UUS A;  3N9M A;  3TKL B;  1IBL T;  3AEC A;  2DCF A;  2WDV A;  4MLK A;  5L4E A;  2JMH A;  3H3M A;  4TN7 B;  2GK9 A;  4YFS A;  4LML A;  2CXF A;  1W9R A;  4JYA T;  4UV8 B;  4E7S A;  4HTE A;  3QB5 K;  1FIO A;  1D1A A;  3NBX X;  3PUG A;  5AQQ B;  3PUQ A;  3PJA A;  2ZMA A;  3E08 A;  2KMF A;  2C5I T;  3JAD A;  4IHJ E;  3ANW A;  2H3R A;  1HCI A;  3LG7 A;  2XQA A;  1BR0 A;  5AQG B;  5AQJ B;  4A56 A;  4KUM B;  5CFB A;  3GWH A;  4LFA T;  2Q9Q B;  4GYS A;  5IYZ E;  5EZY E;  5AQP B;  2VQF T;  2K3W A;  3HL6 A;  5L4H A;  4L0R A;  5DAB A;  2BS4 A;  2E9X D;  2H7O A;  3F2E A;  3OTO T;  2XQ3 A;  3FBZ A;  4TV9 E;  4CZZ B;  4ASK A;  4UVC B;  4TWH A;  2MPK A;  5JDQ A;  2VAS A;  3ZLI A;  5ABH A;  3TLU A;  4DND A;  2FJE A;  3NWI A;  5FYM A;  5LXT E;  5LHG B;  2PJQ A;  2W63 A;  5L3B B;  4AKL A;  2UU9 T;  1HG5 A;  2PTF A;  2QRX A;  1HR0 T;  2IC9 A;  5FY7 A;  2E8I A;  5ADX L;  4YJ3 E;  4H9R C;  2C5K T;  4DUZ T;  3CQX C;  1KEY A;  4IGU A;  5L3E B;  3DP7 A;  2AXD S;  4JI7 T;  4ILB A;  4X62 T;  4UF0 B;  2XQ4 A;  2PBI A;  3K3O A;  2WDQ A;  3GN5 B;  4AI6 A;  2BG9 A;  5F8P A;  4U2Y A;  4Z8X A;  2Q9Q A;  3RYF E;  2BG9 E;  2HHH T;  3RPU A;  1I94 T;  5IHY A;  4L5G A;  2Z6E A;  2X0H A;  5M4Y A;  3KVB A;  2KXP B;  1NAF A;  2KT9 A;  5LGN B;  1ZEE A;  2W67 A;  4IDP A;  4WNK A;  4DR4 T;  4KP3 C;  4AQF A;  4UV9 B;  2ACZ A;  3AEB A;  3BQK A;  4EEB A;  4GOU A;  4O4H E;  4PK6 A;  2VVS A;  3UUL A;  2YEV C;  3Q5D A;  2ZM6 T;  2L3L A;  2ACX A;  4KBM B;  3UU8 A;  4UEL A;  4IIJ E;  2V8S V;  3ZST A;  4FJO A;  4QWN B;  4ZOL E;  4DR1 T;  2QGS A;  4IDN A;  4GKK T;  2KWI B;  4HE8 A;  2CHO A;  1VCS A;  1IJ5 A;  2XHE B;  3I1A A;  4LMJ A;  3KBT A;  4P1N A;  2ZM2 A;  2BBH A;  2P9B A;  3LJC A;  1ZOY A;  4AKG A;  3EUH A;  4CI3 B;  4TUY E;  1UCU A;  2WB5 A;  3GA8 A;  4X65 T;  3IA3 A;  3PUZ F;  1MIV A;  4AKI A;  2UXD T;  3GN5 A;  1WR6 A;  1WRD A;  2UXN B;  5FKY A;  4QH5 A;  4B3S T;  3FZK B;  2LE8 A;  2G0U A;  2JIW A;  2JQH A;  2IW5 B;  3FBL A;  3V5S A;  3CK6 A;  4K0K T;  3AA6 B;  2LJL A;  2UUA T;  3I0O A;  3AE4 A;  3RLF F;  4PJM A;  5JDM A;  3T1Y T;  2W2U A;  2XAG B;  5ETW A;  3GMI A;  2YU1 A;  3RYI E;  1KK7 A;  3C98 B;  1U4Q A;  5DJQ C;  4YLH A;  4OYK A;  4JI5 T;  1E7P A;  3ZMZ B;  3KV9 A;  3OYX A;  3JCF A;  2MYS A;  3AE8 A;  3VKH A;  1OED B;  1GQE A;  5AQK B;  1G73 A;  5HEH A;  1LRZ A;  3HA4 A;  1Y01 A;  4I55 E;  2BG9 C;  5JDN A;  3RIA A;  3CQC B;  3NRX A;  4JI0 T;  5HEG A;  2VVN A;  2Y6X A;  4P09 A;  3AE2 A;  1VOM A;  4COF A;  2X0Y A;  2BBJ A;  4OFZ A;  2V5C A;  3ZCI A;  3QB5 A;  2WMN A;  4HFH A;  4ZZB A;  2CM0 A;  2WWV A;  3A7M A;  4IDZ A;  2H89 A;  2RP4 A;  2CHN A;  3OKQ A;  4Z91 A;  3N5L A;  4AQY T;  1SUM B;  1ZKE A;  1XNR T;  4DR6 T;  3UQ7 A;  2LT3 A;  2X9X A;  3MZK B;  4HWF A;  4L9I A;  2V6Y B;  3FZF B;  1AJ3 A;  3O1J A;  4QH1 A;  3IEE A;  5EK2 A;  2WZI A;  2E2A A;  5EK4 A;  2YIN A;  2DNX A;  2BVL A;  4EZH A;  3HKD E;  2NW7 A;  5JDH A;  4DR3 T;  5JDF A;  4JEU B;  1OXZ A;  2LSY A;  5AQT B;  4ZI2 C;  2NTX A;  4F8H A;  2MAW A;  4UR9 A;  1VCT A;  1OED A;  2QYW A;  3OPC A;  1J1J A;  4YHH T;  2ODV A;  1OED E;  1D0X A;  4BA9 A;  5L47 A;  2EHO B;  3JC6 C;  1W09 A;  2LHR A;  4TNW A;  2CA5 A;  3O1H A;  3Q2M A;  2X68 A;  4NXN T;  4QX8 B;  3SOL A;  3B5M A;  2FUP A;  2D9D A;  3UU4 A;  4X1Y E;  2KWH A;  3RH3 A;  4JEH B;  5LB7 B;  2CE7 A;  5HAX A;  4UIG A;  2V7I A;  2W61 A;  4KI0 F;  3CWZ B;  2BKO A;  4I43 B;  4HFD A;  3L3P A;  2VQE T;  5LHH B;  3KV5 A;  5FXV A;  1KFY A;  2CWO A;  4V1A v;  1UGO A;  3I9Y A;  3ZYL A;  3AEF A;  3RYC E;  5ABE A;  2V6Y A;  3HI2 A;  4GYR A;  2YOE A;  3O1I A;  5CA0 E;  3RYH E;  3ZMT B;  4CXY A;  2XQ7 A;  2H7V C;  4HN9 A;  1IJ6 A;  3UU5 A;  2AE9 A;  3N2K E;  2HPL A;  4IRE A;  4JI4 T;  2DLR A;  2X51 A;  2X67 A;  3MJX A;  2JQQ A;  5J1G A;  1NEK A;  2LRL A;  3UUM A;  3ZMU B;  2WCA A;  4DBQ A;  2JQ9 A;  4AQG A;  2YN6 A;  1HNZ T;  2W4X A;  4O2A E;  3UQ4 A;  3CKD A;  4O4L E;  1XDO A;  3UFG A;  1MND A;  2D2S A;  4JI6 T;  2OA5 A;  4TWF A;  3C4W A;  5FL1 A;  2ZM0 A;  4KMC A;  2CPT A;  2YDQ A;  3X1D A;  5JR9 B;  1UUR A;  1WCR A;  3LK2 B;  3LBX B;  4QHO A;  4OX9 T;  3R6N A;  2FJA A;  3PUA A;  2XAF B;  1SHZ C;  2KZ7 B;  2RPA A;  1G8X A;  2VKH A;  3T1H T;  4B3T T;  4YSY A;  4PFP A;  1XDP A;  2XUE A;  1BR2 A;  2WAU A;  3AE9 A;  5JRC B;  5AQH B;  1YQ4 A;  2LM2 A;  2CCQ A;  2VKO A;  1U5P A;  2I0M A;  3KVA A;  3LK4 2;  2F4V T;  2JRK A;  3ZC0 A;  3RF1 A;  5LP6 E;  3S4U A;  1V9D A;  3C4Z A;  3I9W A;  3C51 A;  4OK0 A;  4HWI B;  5KX5 E;  3AEG A;  4TX5 A;  3CX8 B;  5AQU B;  2HN1 A;  3KFW X;  4DID B;  4LFB T;  1M7K A;  4EYU A;  4ZI2 D;  1YQ3 A;  3QNU A;  2W0G A;  2E5L T;  5IUX A;  4H9P C;  3UUX B;  3AVR A;  4LF4 T;  3ETV A;  5FMN A;  1HTJ F;  3U3I A;  3JC6 D;  1S35 A;  3KIN B;  4G2A A;  3CVR A;  2YDR A;  2I59 A;  3ABV A;  2XSA A;  3C50 A;  4EED A;  3EHZ A;  4O8S A;  4ISS A;  5HXS A;  3ONL C;  2V5D A;  5AQL B;  4WW0 A;  4TV8 E;  1HFA A;  1MMA A;  5E0O A;  5HEO A;  1Y64 B;  4DR5 T;  4C90 A;  3O4X E;  3AA7 B;  3NZQ A;  3RQW A;  5JRC A;  3UUN A;  3DJB A;  2X0L B;  3CIR A;  3OVU A;  2DWK A;  3IBP A;  3N2O A;  4IE7 A;  4BJM A;  3RGL A;  3FHN A;  3B57 A;  5JVD E;  2X9Y A;  3WAJ A;  4PW8 A;  2Y48 B;  4NUV A;  3U78 A;  3F31 A;  3N9Q A;  2J62 A;  1WLX A;  4HWD A;  2IAK A;  5FXW A;  2HH7 A;  1IBK T;  1N32 T;  2E9X B;  4IE0 A;  4ZI7 E;  3UFE A;  3RHW A;  3AVS A;  5AQR B;  2LSK A;  3FZL B;  3TLT A;  5C3J A;  3MAC A;  4EB6 E;  3HKE E;  2VUR A;  4N78 D;  3UTK A;  1XNQ T;  3ZT5 A;  4EAH A;  2WDR A;  3P7I A;  4HFB A;  1N34 T;  5BMV E;  3JAE A;  3AB3 B;  4JV5 T;  4YSZ A;  3WAK A;  2DWG A;  3HKB E;  3AE7 A;  2UXX B;  5JH7 E;  3RRC A;  2XQ6 A;  4PK4 A;  4LF8 T;  3Q5W A;  5KXJ A;  3BQI A;  4XBF B;  1WFD A;  3P4W A;  2IML A;  2B76 A;  4EOZ B;  2E5V A;  2WU5 A;  2CLY B;  4PFO A;  5CJ5 A;  4ILU A;  4IL9 A;  3Q5E A;  2K48 A;  4LF5 T;  4DR2 T;  4KHP T;  2X66 A;  4H9O C;  2A9U A;  4XAX B;  4UF0 A;  3EAB A;  5J0Z A;  5L3D B;  2BVM A;  2WY2 A;  3AAE B;  5LMU T;  4B6X A;  1D0Z A;  1NWM X;  5EK3 A;  3J7Y q;  2E9X A;  4K0U A;  1US7 B;  5F5W A;  3F57 A;  2KSR A;  4QH4 A;  4U3C A;  2VWA A;  3RIU A;  5JTG A;  1R8I A;  2V7J A;  5ABF B;  2BS3 A;  3KBU A;  4CN4 A;  4DV0 T;  2LHN A;  4U31 A;  5JDG A;  2QA7 A;  1W0A A;  4PJJ A;  4DMW A;  3RC3 A;  3H3A A;  1Z8U A;  5HCM A;  2RA1 A;  2WSS V;  4U33 A;  3AEE A;  5AQV B;  4DR7 T;  2VK9 A;  1WYC A;  5HCJ A;  1XZY A;  2XQ8 A;  2LOS A;  2LSI A;  4NXM T;  4AIU A;  4X20 E;  2KIN B;  4WZX A;  2N1G A;  4ILC A;  4KHZ F;  2Q9Q C;  4IL4 A;  5IWA T;  4EIW A;  3LDQ B;  5FVL A;  3RX6 A;  5JQG E;  3ZMS B;  3ZT7 A;  3AA1 B;  2N9D A;  3P4Q A;  3JAF A;  1NEN A;  2BDE A;  4HWH A;  5LOV E;  3FZH B;  2I6H A;  5C2T A;  1SE7 A;  1EZ3 A;  1CHU A;  4AQF C;  3IF8 B;  3O9X A;  3T8O A;  1MIW A;  3SRZ A;  2WP9 A;  4EXT A;  3AXJ B;  2N2N A;  1QSD A;  4ZHQ E;  4H9Q C;  4JI2 T;  3E0Z A;  1YD8 G;  2DI4 A;  5H6Q B;  2WZH A;  2XQ9 A;  3K3N A;  5FY1 A;  3PU8 A;  3EDU A;  4QXB B;  4U7I A;  3QK6 A;  3I0Q A;  1HNW T;  2L8K A;  3OBV E;  4HWC A;  2MTQ A;  4X5T A;  4PNI A;  3D0T A;  1YXR A;  3AE5 A;  3P4P A;  4JI8 T;  4TWD A;  4QKN A;  2K5B B;  5J2T E;  1MNE A;  3RKO A;  1QLB A;  2D0U A;  4ZS3 A;  2IDO B;  1BR1 A;  3HR0 A;  3PE0 A;  4HKA A;  2M67 A;  4ZXL A;  1WYB A;  4JBW F;  1FEW A;  3J9X 1;  3MKD A;  4LF9 T;  3C64 A;  4IE5 A;  2WM9 A;  3C4X A;  4EYY R;  3CML A;  5FXX A;  2FJD A;  2J47 A;  4ZS2 A;  3AE1 A;  1M62 A;  3LSV A;  3VRB A;  2NW8 A;  2CBI A;  4A5X A;  1ZV4 X;  2ODU A;  5KMG P;  2BS2 A;  4DO0 A;  4EZ4 A;  3LFM A;  4ZZC A;  2CMR A;  1H7C A;  4H63 V;  2NP9 A;  1UK5 A;  4U72 A;  4CQI A;  2V7L A;  1J5W A;  2KND A;  2V26 A;  5LYJ E;  4F6R C;  3ZKR A;  4HFE A;  4JLE A;  3MA9 A;  2WQY A;  3PUR A;  3CX7 B;  3PJA J;  3DTO A;  5CA1 E;  2YU2 A;  3VRA A;  3KV6 A;  1JNZ A;  1QUU A;  2M6I A;  5HXC A;  2FBW A;  1Z0P A;  2CRB A;  1DU2 A;  4GK5 E;  4LFC T;  4DV3 T;  4Z90 A;  2VB6 A;  4ZI3 C;  2EHO A;  3RC8 A;  3SFE A;  4YTP A;  2NWB A;  3VKG A;  3ETU A;  5H6R B;  3PUX F;  5L3F B;  3L09 A;  4KX6 A;  3EAM A;  3ZJ1 A;  5BR8 T;  2ES0 A;  2Q9Q D;  1KNR A;  2YK0 A;  3SFD A;  1ZHC A;  1HNX T;  5FL0 A;  4IT4 A;  5LG3 A;  2JMK A;  3RI5 A;  2LLY A;  1OWA A;  3G06 A;  5AQM B;  3ZSS A;  4CN1 A;  3SWH A;  2XSB A;  4UVA B;  2LM9 A;  3ZT6 A;  4MFR A;  3AE3 A;  4XZC A;  5DQW A;  3E22 E;  2HPJ A;  4X64 T;  3ESL A;  2X9W A;  3AE6 A;  3N9N A;  3L8R A;  4BJN A;  4I4T E;  4FI5 A;  3CQG B;  4UVB B;  1OED C;  3ZCJ A;  2NW9 A;  2W00 A;  1IBM T;  3PTR B;  3VR8 A;  4TZ4 C;  1E1H B;  2LOP A;  1E2A A;  3OYZ A;  2IIU A;  4YHJ A;  4CN6 A;  2FJB A;  5KDM C;  4IST A;  2CXD A;  2XY8 B;  1HS7 A;  4ANJ A;  4P0A A;  2SPC A;  2BG9 B;  1WR0 A;  3H37 A;  4DV4 T;  1MIY A;  4YTN A;  2NR4 A;  2XQY A;  2BZB A;  4CXX A;  1JNR A;  3KDS E;  5LBM A;  1L0V A;  2WWU A;  5A1L A;  5JR9 A;  1N33 T;  3ZMV B;  3LBX A;  4G63 A;  5FVK A;  1J5E T;  4AXP A;  3QOF A;  3ONJ A;  5L3C B;  2ZLY A;  2UXC T;  4EV6 A;  5AQI B;  1SA0 E;  2XAJ B;  2YKS A;  5LGT B;  3FXD B;  2Y8D A;  4PAG A;  4U7Y A;  4CI2 B;  1KNP A;  2C0S A;  4LMK A;  1XMO T;  2EHO C;  1X9B A;  4O4J E;  3NRY A;  2UXB T;  1UX5 A;  3ONX A;  4EGW A;  5LG4 A;  5LGU B;  1O3X A;  3HKC E;  2LSG A;  4GKJ T;  4ZI3 D;  3B13 A;  5HXR A;  4A98 A;  3ZYK A;  4DMV A;  4DVD A;  2X9H A;  5HEU A;  5JRE A;  2XAH B;  4ZEY A;  2XM1 A;  2V6X A;  2D5U A;  3ZN1 B;  5LNK A;  4BAY B;  1LVK A;  1T8B A;  2BKN A;  3BQL A;  3ZN0 B;  2WMO A;  2NOX A;  2OV9 A;  4UXN B;  2JQK A;  4A97 A;  2D0T A;  4TNV A;  4ERR A;  3NZP A;  3V5U A;  2DHR A;  4WBN E;  4C91 A;  4ILA A;  4U2Z A;  4HFI A;  2XJ7 A;  1IAP A;  1HX1 B;  1T98 A;  5AQO B;  3ZYM A;  3EI0 A;  5JDL A;  4MBQ A;  3TLS A;  5F3J A;  2C5J A;  4PK5 A;  3ZPO A;  5HYA A;  2V7K A;  5HXE A;  1LKX A;  3FXE B;  1YKH B;  3K3Q C;  2WS3 A;  2VKD A;  4I0U A;  3K1S A;  3PUV F;  5AQS B;  1FMW A;  5J2U E;  5L3G B;  1CUN A;  5JR9 C;  4H9S E;  4LF6 T;  1FMV A;  1XWM A;  4B3R T;  3A8Y C;  4CXW A;  2H88 A;  3KV4 A;  3FZM B;  2M6B A;  5HWY A;  1D1B A;  3UT5 E;  4YY3 T;  3AAI A;  3PUS A;  2A3D A;  2CBJ A;  5C8Y E;  2LKH A;  4HGA A;  3RRW A;  3K8P C;  5FY0 A;  3P4R A;  5LMN T;  2L9Q A;  2W62 A;  3P4S A;  3VR9 A;  4IDQ A;  1MMG A;  5LA6 E;  2HN2 A;  1I6Z A;  2PG8 A;  3BK9 A;  3ZEF B;  4X1I E;  4LF7 T;  1D0Y A;  3M3Z B;  3PDY A;  4QXH B;  2MOZ A;  4DBR A;  1YW0 A;  1VRB A;  3PUY F;  2PFV A;  3IHR A;  3ZC1 A;  3Q9D A;  4DV2 T;  2ZM8 A;  2CXL A;  2EHO D;  3N9P A;  3ZJ2 A;  3UU6 A;  2CWY A;  4IDO A;  4MHC A;  2CEA A;  4B3M T;  1KNZ A;  2W66 A;  4IE6 A;  3CX6 B;  4Q25 A;  3EDV A;  4DUY T;  1HX8 A;  5ABF A;  2K9A A;  4AKH A;  2BKP A;  4JI3 T;  2YDS A;  3PV0 F;  3N2G E;  2XPK A;  5FP3 A;  2MBG A;  2WU2 A;  2XZE A;  4NPP A;  1B7T A;  5GON E;  1MMN A;  1N36 T;  4ADZ A;  4AKR B;  5ABG A;  2LKG A;  4QXC B;  3L39 A;  4HFC A;  4AIS A;  5FNV E;  4CI1 B;  4DV1 T;  2LEH A;  3AEA A;  2UUC T;  1BR4 A;  1ZP0 A;  1S94 A;  1D1C A;  3NVO A;  1W0B A;  2B1E A;  4J2C A;  4HFV A;  3SS1 A;  2IHR 1;  3NKZ A;  4WBO A;  5FXZ A;  5CGM A;  5HWX A;  4P0B A;  3RKG A;  2XAQ B;  1FJG T;  2LRK A;  2KLQ A;  3FB2 A;  2E9X C;  4YTM A;  2VKJ A;  3QC9 A;  2V1D B;  3PU3 A;  2J1D G;  2K24 A;  3M65 A;  3VHL A;  3AED A;  2XQ5 A;  4M1P A;  1UX4 A;  4YT0 A;  3AA0 B;  5HXH A;  5AQN B;  3OJA A;  1KF6 A;  5TAO A;  4IE4 A;  3RIU C;  2LSJ A;  4MAL A;  2DL1 A;  3N9L A;  3Q5X A;  4X1K E;  2VL0 A;  1HF8 A;  2UUB T;  2A72 A;  3QUJ A;  5LJN A;  4DV5 T;  4DV6 T;  1X79 A;  4X66 T;  3UUB A;  3AAA B;  2OLT A;  3W15 B;  3N9O A;  3AXJ A;  3RQU A;  4OYJ A; 
#chains in the Genus database with same CATH homology
 4WYV A;  3QB5 A;  2QRX A;  3PJA A;  3QB5 K;  2QVA A;  3AXJ B;  3PJA J;  1KEY A;  3RIU C;  3AXJ A;  1J1J A;  3RIU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...