3PJAJ

Crystal structure of human c3po complex
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
243
structure length
219
Chain Sequence
SSPVMLAFKSFQQELDARHDKYERLVKLSRDITVESKRTIFLLHRITSAPDMEDILTESEIKLDGVRQKIFQVAQELSGEDMHQFHRAITTGLQEYVEAVSFQHFIKTRSLISMDEINKQLIFTLRVTPVDYLLGVADLTGELMRMCINSVGNGDIDTPFEVSQFLRQVYDGFSFIGNTGPYEVSKKLYTLKQSLAKVENACYALKVRGSEIPKHMLAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Translin
publication title Structure of C3PO and mechanism of human RISC activation.
pubmed doi rcsb
source organism Homo sapiens
total genus 94
structure length 219
sequence length 243
chains with identical sequence K, L
ec nomenclature
pdb deposition date 2010-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01997 Translin Translin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.190 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Translin; domain 1 3pjaJ01
1.20.58.200 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Translin; domain 2 3pjaJ02
4WYVA 3AXJB 2QVAA 3PJAJ 3RIUA 3QB5A 3RIUC 3PJAA 1J1JA 3QB5K 1KEYA 3AXJA 2QRXA
chains in the Genus database with same CATH superfamily
2X0HA 1T72A 2VL8A 2Z6EA 4F6RC 1LVFA 2Y6XA 4IE7A 3GA8A 2DCFA 3J7Yq 2PFVA 4CXXA 4AISA 4DBQA 4TWDA 2C5KT 5JR9C 2N9DA 4WBOA 4HN9A 2CXFA 1XNQT 3UU6A 5HXEA 4IE6A 2WDQA 1NAFA 5JRCB 2H88A 2BG9B 3DTOA 4FI5A 5HEOA 3O1JA 2CBIA 4UR9A 3I1AA 5CGMA 2BKNA 2H7VC 1HCIA 4UXNB 4CQIA 4ZI3D 3E0ZA 2WU5A 2NW8A 2LHRA 1KNZA 5JR9A 2X9XA 1LKXA 3ZSTA 5AQIB 2XQ7A 3EDUA 1H7CA 4X66T 4H9NC 4WNKA 1WRDA 1JNRA 4JEHB 5L2LA 3AE1A 4QH4A 1Y64B 2LM9A 4H9PC 1OEDC 5ADXL 4MLKA 4X64T 4EIWA 4B6XA 1Z8UA 5KX5E 1W09A 3C51A 2WAUA 3I9WA 3IA3A 1IAPA 1IBKT 1KNPA 3PUXF 4HWCA 4DV7T 1D1CA 3C4ZA 2WWUA 5J2TE 4N78D 3K3QC 2L9QA 4ILAA 3ZMZB 1KEYA 3CVRA 3IEEA 2CLYB 4C91A 4QWNB 5FL0A 4ZI7E 4AKRB 4I55E 4HWFA 4A98A 3UULA 1S35A 5C2TA 3C64A 1OWAA 5L3BB 3E08A 4AI6A 4KP3C 1XMQT 4AIUA 2KLQA 4DVDA 4JI2T 4COFA 2LOSA 4ZOLE 2D9DA 4UELA 3ZKRA 2D5UA 4I4TE 4LF7T 2JPFA 3ZSSA 1WR0A 2W62A 3HKDE 4ILCA 3PUWF 4JI3T 4K0UA 2J1DG 1MIYA 4EYUA 3B57A 2LT3A 2VURA 4TN7B 4CN6A 4WBNE 3OYZA 2J62A 2YOEA 3RYIE 5DABA 1HFAA 2CRBA 1LRZA 2VASA 4AQYT 4X5TA 5EZYE 2F4VT 1I94T 3VU7H 3AAIA 4TV8E 1BR4A 3ZN0B 3P4QA 4UEMA 4M1PA 2MTQA 5L3FB 2V7LA 2EHOA 4K0KT 4GKKT 3X1DA 5LBQB 3UUNA 2UU9T 5AQLB 4DR2T 5LBMA 3ZYLA 3Q5WA 1HNWT 4HEAA 2FJEA 2B1EA 1N34T 3JC6D 1MMDA 3GN5B 3ZN1B 1V9DA 2JRKA 3B5MA 3CQGB 3CX6B 3C50A 2NTXA 1T7SA 4WZXA 5BMVE 5LGNB 1SUMB 4G63A 1KFYA 3FHNA 4HFVA 5FXZA 4P09A 3KFWX 3UU3A 2FBWA 1HS7A 2X67A 3CWZB 2H3RA 3BQKA 4ZXLA 4YT0A 4IREA 2YN6A 3ETUA 2DI4A 5IYZE 5J2UE 3RGLA 4QH5A 1SHZC 4OX9T 3PE0A 2OV9A 4BJNA 2KT9A 4TX5A 4IDZA 1BR0A 4PFPA 5J0ZA 3BQLA 3M65A 4ZEYA 2LKHA 4IDPA 3O4XE 2W0GA 2UXCT 4JYAT 2VL0A 1IJ6A 2Y8DA 1ZHCA 4H63V 1D0YA 2V7IA 2WCAA 2IIUA 3N9QA 1D0ZA 3U78A 5AQKB 4GK5E 4KI0F 3N2KE 4O8SA 2X66A 1MIWA 3AAAB 1N32T 4IDQA 3RIAA 4PK5A 2XAGB 3MJXA 4QHOA 3LG7A 2MAWA 3A5XA 2KXPB 2LSKA 4CI2B 3FZHB 5J1GA 4YTNA 3AB3B 1ZV4X 2PTFA 3RC3A 2NP9A 3PUZF 5JTGA 4AQGA 2V7MA 3ZT6A 2KMFA 3ZMSB 2E9XB 2B76A 5IWAT 4QXCB 2CBJA 2IUBA 3OYXA 2NWBA 4O2AE 2UUAT 3JC6C 1E1HB 2BDEA 5M4YA 4DNDA 2PJQA 4Z90A 2KSRA 3WAJA 3K3OA 1WYBA 4GYRA 3ANWB 2I0MA 4O4JE 2N1GA 3KDSE 5DQWA 3D0TA 3OVUA 5LYJE 4XBFB 4ZI2D 3AEDA 2VWAA 4JI4T 2DHRA 5LG3A 4QKNA 4MHCA 2JIWA 5H6QB 2CHNA 5L4HA 3U3IA 4NIQA 4YTPA 3UTKA 1XZYA 1G73A 2XAQB 3OJAA 5IHYA 4OHFA 3P4RA 2BVLA 1NWMX 4U3CA 3QOFA 4BA9A 4DR5T 3FBLA 2XSBA 3PUAA 1ZEEA 3LBXA 4OK0A 4DUZT 3TLSA 4O4IE 3F57A 3PURA 2NR4A 5DQVA 3ZC0A 2KWHA 3BK9A 3HKBE 3FZLB 4UVAB 2IDOB 2W63A 2K9AA 4UF0A 4EXTA 4DV1T 1HX8A 5TAOA 4JUYA 2X0LB 1M7KA 5AQOB 4ERRA 5ABHA 2UUBT 5HXCA 2HPJA 3DJBA 4IDOA 2WDRA 2LRLA 2OLTA 3ZMUB 2SPCA 3H37A 3P50A 4KUMB 3AA0B 1N36T 2V7JA 2XHEB 2XQ3A 4DR1T 3C98B 3GWHA 5JDHA 4JI1T 5FMNA 4AKLA 2PG8A 4JI7T 1E7PA 1FEWA 3RYHE 2XQ5A 4YJ2E 2WZIA 3AXJB 4KMCA 1OEDB 5AQSB 4AXPA 5JDLA 3P4PA 3HL6A 2JQKA 3EVYA 4GYSA 4HFEA 5HEUA 4L5GA 2ZMAA 4HWHA 2A9UA 2LKGA 5FVLA 4DV6T 1FIOA 2UXBT 3AE5A 4PJLA 3T1HT 2EHOD 4ZI2C 1YKEB 2G0UA 4YLHA 2D2SA 1UX4A 1MIVA 4E7SA 3R6NA 2UUCT 4HE8A 2WWVA 3NKZA 4X65T 2RP4A 3KVBA 3RHWA 4CXWA 4OYJA 2Q9QB 2GK9A 1QLBA 3PU8A 3JADA 1ZKEA 5JDFA 3HR0A 4U74A 3SWHA 5F5WA 2K48A 4PJJA 3VR9A 5JQGE 2YDSA 2KINB 3UU4A 3NVOA 3IHRA 4UVCB 4TUYE 4CN4A 2C0SA 4KX6A 3O1IA 3FZMB 4IHJE 4ZZBA 4LF6T 2HPLA 1KK7A 3ZMTB 1VOMA 5LP6E 3RIFA 3EDVA 3HKEE 2XPKA 3KV4A 2WB5A 2HN2A 4WW0A 4KHPT 2IW5B 2XQ6A 1J5ET 5AQUB 3ZT7A 2QRXA 4A56A 4LF4T 4DV4T 3N2GE 2JQ9A 5HXRA 2H7OA 5AFUL 2L8KA 2BS3A 2WU2A 3VRBA 4HWDA 2DL1A 3AEBA 3RLFF 5DJQC 4JV5T 5AQFB 2X0YA 1EZ3A 4HFDA 2LSJA 1U5PA 4QXHB 3B13A 2V1DB 4H9OC 3N5LA 3LFMA 1HR0T 5ABFB 5LGTB 5AQGB 4ANJA 1SE7A 4WYVA 2BG9C 4HFHA 4X1YE 1T98A 5CA1E 4NXNT 3NZQA 3JCFA 5HCJA 4CI3B 2EHOC 2JMHA 3TLUA 2XSAA 4H9RC 3MA9A 2NOXA 3N9PA 3KV6A 1JNZA 3MACA 2H89A 4AKGA 5L4EA 4IL9A 2WQYA 4H9SE 4U33A 2ZM6T 2VKHA 5AQVB 2N2NA 1UX5A 2UXDT 4U7YA 5LXTE 5FNVE 4EEDA 2XQ4A 3PTRB 5JRCA 2FJDA 4MBQA 2BG9A 4QXBB 3AE4A 4DV2T 1ZOYA 3CPZA 2R6GF 1MMGA 4IIJE 3BQIA 4B3MT 5HEGA 3CK6A 4ADZA 3FBZA 5FKYA 4YSYA 2V6YB 4PJNA 3FB2A 5L3CB 2WP9A 4GOUA 2J47A 3PDYA 5EK4A 2CLYC 3ZPOA 1US7B 4HTEA 5ETWA 5CB4E 2XM2A 3SFDA 3RQUA 3SS1A 3CQCB 2WMNA 3RI5A 1U4QA 3MZKB 4KHZF 4DR7T 2FJAA 5LOVE 2WSSV 2VVNA 3A8YC 3Q2MA 2LSGA 3NRXA 2KZ7B 1QSDA 4LF9T 4JBWF 3IF8B 5CA0E 3UFGA 4NUVA 4A5XA 3N9NA 4U7IA 5KMGP 3HA4A 5AQRB 4U2ZA 4NXMT 4U72A 4XAXB 1WR6A 4YTMA 3PUSA 2YU1A 2W66A 3KV5A 2JQQA 3KINB 1YQ4A 1MNDA 2XAJB 3O1HA 3Q5EA 3J9X1 3OPCA 4EAHA 3ZMVB 3MK7C 3UUXB 3AA1B 4LFBT 3ONXA 2XQAA 3PV0F 4ZS3A 4AKHA 2ZM2A 4PK6A 3VR8A 3AVSA 3V5SA 4CXYA 3L39A 4QH1A 2VB6A 5LHGB 2LSIA 1YW0A 2CXDA 4JLEA 2NW9A 1I6ZA 2BKOA 3AE2A 2ZM0A 5C3JA 3AVRA 2OA5A 4JEUB 1NENA 2E9XD 2HH7A 2VKOA 3AE8A 3EHZA 3F2EA 5HXSA 2YK0A 2BG9E 4LMKA 3N9LA 3H3AA 2CMRA 4DV5T 3SFEA 4ILBA 3UFEA 4P0AA 4CI1B 2VQFT 4NUUA 1HNZT 5FP3A 1Y01A 1S94A 1MMNA 4IT4A 3CMLA 2BS4A 3ETVA 2YINA 1CUNA 2C5IT 4V1Av 3K1SA 2FJBA 3HI2A 4YJ3E 4L0RA 4QX8B 2NTYA 4GK0E 3FZFB 2LOPA 3O9XA 2X68A 3GN5A 3RQWA 3RKGA 3Q5DA 2DNXA 3KBTA 1L0VA 3ESLA 3AA6B 2I6HA 2A2FX 2MOZA 3CIRA 3P4WA 4KBMB 4YHJA 2X51A 1HX1B 5AQHB 3N2OA 3RYCE 4PK4A 2CCQA 2K3WA 5H6RB 3UU8A 2LRKA 4ISTA 3K8PC 1Z0PA 1YD8G 5L3EB 1IJ5A 2A3DA 2XAHB 3AEGA 3F31A 3S4UA 4DBRA 1UUSA 2ZM8A 4PFOA 3HKCE 3PUGA 4JI0T 2W00A 4J2CA 5LMNT 4HGAA 3RKOA 3WI3A 3R84B 3QK6A 4C90A 1X79A 3NBXX 2WDVA 2BBJA 3KV9A 5LMUT 5JR9B 1MNEA 4AQFC 2P9BA 4Q25A 3T8OA 5KXJA 2AXDS 5CJ5A 4U2YA 3AA7B 2E9XC 4B3RT 2M6IA 2KWIB 1YQ3A 1X9BA 4ZHQE 5FY7A 4F8HA 1UURA 2MYSA 5JVDE 4EOZB 1M62A 3CKDA 2LM2A 2BS2A 4HFCA 5HEJA 4AQFA 1BR2A 4EEBA 3OBVE 5GONE 3UQ4A 1R8IA 4EZ4A 1AJ3A 2YEVC 3EUHA 4O2BE 2E9XA 4E7ZA 3ZYKA 3EABA 3RIUC 3PUVF 4JI8T 2A72A 2X9HA 2W67A 2MBGA 2HN1A 4ZZCA 3P8CD 3OKQA 2W2UA 5AQPB 3UT5E 5LJMA 2ODUA 4ISSA 3NWIA 5HWXA 3EAMA 2Q9QD 3PJAJ 1W0BA 3NZPA 3ANWA 2BZBA 2J4GA 4EYYR 3M3ZB 2BBHA 5AQJB 2QGSA 2IAKA 1UCUA 4GIWA 1T8BA 2M67A 3RIUA 2V8SV 3L8RA 1MMAA 3TKLB 3P4SA 1VRBA 5L3DB 3H3MA 2YDRA 2LE8A 3OTOT 2K24A 3QB5K 3A7MA 2MPKA 4I0UA 4QX7B 4P1NA 4HWIB 2XQYA 3Q5XA 3PU3A 3MKDA 1WYCA 1HG2A 1G8XA 3AEEA 5LCYA 2EHOB 1HF8A 4G2AA 1XDOA 3ABVA 5F3JA 4YSXA 3VKHA 1D0XA 2M6BA 1UGOA 4MALA 3RF1A 2YKSA 5FXWA 3ZT5A 1XMOT 1WFDA 3MXZA 2XJ7A 5L3GB 3C4WA 1FJGT 4UV8B 2PBIA 5AQTB 3W15B 4X62T 4YHHT 1J1JA 1FMVA 5FY0A 4TNWA 4U31A 1QUUA 3AAEB 2XAFB 1WCRA 3RH3A 3AXJA 1KNRA 3UQ7A 3EI0A 1OEDA 3SRZA 2RA1A 4CN1A 4LF8T 5IUXA 4AKIA 2W61A 2UXXB 2YDQA 4I43B 3JAEA 2Q9QC 2ACZA 4DMWA 3N9MA 3Q9DA 5LNKA 4TNVA 3T1YT 2HHHT 3AE6A 5FL1A 4Z8XA 4HFIA 2QA7A 4O4HE 3TLTA 4TWHA 3TLVA 2YU2A 2QYWA 5FXVA 1LVKA 3AE3A 3GMIA 4X1KE 2D0UA 2XQ9A 3ONLC 3ZLIA 2Q9QA 2KNDA 2VVSA 3LDQB 4EB6E 5LB7B 1E2AA 1CHUA 1D1BA 2BVMA 5HYAA 3ZCJA 2VKDA 2XUEA 4HKAA 3PUYF 4MFRA 1W9RA 4ILUA 5LA6E 4LMLA 4DV0T 4BJMA 3VHLA 2DLRA 2XQ8A 1WLXA 3V5UA 1VCTA 1FMWA 2CEAA 2VQET 4ZI3C 2XY8B 4X20E 3L09A 5JDGA 5JDNA 3VKGA 4BAYB 3FXEB 1J5WA 3KVAA 1XWMA 4HFBA 5ABGA 4L9IA 4UV9B 2VK9A 2I59A 1OXZA 1YKHB 2CXLA 1XNRT 5A1LA 2CHOA 1ZP0A 5LHIB 2LLYA 4EZHA 4TWFA 1GQEA 2V5CA 2NW7A 2Y48B 3IBPA 4YFSA 4PW8A 1O3XA 4GKJT 1IZNB 3UU5A 5ABEA 4DV3T 3RPUA 1HTJF 2WM9A 2D0TA 1UK5A 2ZLYA 3AE7A 1VCSA 3RC8A 2E5VA 1HG5A 1OEDE 2AE9A 4IE0A 3CX8B 3LK2B 2IC6A 2DWKA 1D1AA 2DWGA 4DIDB 3I9YA 3ZYMA 5LG4A 4YY3T 1B7TA 3VRAA 5ABFA 2V5DA 3UUMA 1N33T 3RX6A 2L3LA 5JH7E 3PUQA 4XZCA 5HEHA 3LK3B 5AQNB 1IBLT 4A97A 3LBXB 2CA5A 4YSZA 2ES0A 5KDMC 2CM0A 4P0BA 4X1IE 3P7IA 4EV6A 2ODVA 4LFAT 4UF0B 2LJLA 2E5LT 3RYFE 3FXDB 2LHNA 2JJ9A 3WAKA 2WMOA 2CWYA 1YXRA 2LSYA 4DUYT 4ZS2A 2XASB 3PJAA 5FXXA 2IC9A 5C8YE 4DMVA 4PJMA 3C4XA 2V6YA 2XM1A 3ZC1A 1IBMT 5EK3A 2IMLA 3FZKB 3ONJA 2V7KA 4PNIA 5JDQA 2RPAA 3AEAA 3L3PA 5HXHA 2XTLA 3I0QA 2JQHA 4IGUA 3NRYA 4B3ST 4IDNA 2V6XA 5FYMA 3RRCA 3ZJ1A 5LHHB 2FUPA 3DP7A 2WBLA 2QVAA 2C5JA 1W0AA 1BR1A 3ZCIA 3LJCA 4FJOA 2X9WA 5HWYA 5EK2A 3LK42 3LSVA 2W4XA 4EGWA 4YXDA 3AECA 4UVBB 2X9YA 2CE7A 5AQQB 4DR6T 3E22E 3JAFA 3QNUA 4B3TT 2WY2A 5FVKA 4CZZB 3K3NA 4OFZA 1DU2A 4H9QC 3CX7B 3CQXC 2E8IA 3KBUA 2CPTA 4O4LE 5LJNA 2CWOA 5CFBA 3ZJ2A 4LFCT 3RRWA 3ZEFB 3G06A 5L47A 4DR3T 4I50E 2E2AA 5E0OA 4IE4A 4IL4A 4Z91A 4OYKA 4LF5T 4DO0A 4JI5T 3UUBA 5HCMA 4TZ4C 5BR8T 1SA0E 4NPPA 5LGUB 1NEKA 2WS3A 1HNXT 4JI6T 3N9OA 2XZEA 2V26A 4H63H 2ACXA 5HAXA 1KF6A 2LEHA 2VKJA 3QC9A 2JMKA 3QB5A 5AQMB 3TLWA 5F8PA 3AEFA 4DR4T 4LMJA 3SOLA 4UIGA 5JDMA 3I0OA 4PAGA 3AE9A 5FY1A 2BKPA 2UXNB 3QUJA 1XDPA 2WZHA 2IHR1 5JREA 4IE5A 4ASKA 2K5BB 4TV9E
chains in the Genus database with same CATH topology
4WYVA 3AXJB 2QVAA 3PJAJ 3RIUA 3QB5A 3RIUC 3PJAA 1J1JA 3QB5K 1KEYA 3AXJA 2QRXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WYV A;  3AXJ B;  2QVA A;  3PJA J;  3RIU A;  3QB5 A;  3RIU C;  3PJA A;  1J1J A;  3QB5 K;  1KEY A;  3AXJ A;  2QRX A; 
#chains in the Genus database with same CATH topology
 2X0H A;  1T72 A;  2VL8 A;  2Z6E A;  4F6R C;  1LVF A;  2Y6X A;  4IE7 A;  3GA8 A;  2DCF A;  3J7Y q;  2PFV A;  4CXX A;  4AIS A;  4DBQ A;  4TWD A;  2C5K T;  5JR9 C;  2N9D A;  4WBO A;  4HN9 A;  2CXF A;  1XNQ T;  3UU6 A;  5HXE A;  4IE6 A;  2WDQ A;  1NAF A;  5JRC B;  2H88 A;  2BG9 B;  3DTO A;  4FI5 A;  5HEO A;  3O1J A;  2CBI A;  4UR9 A;  3I1A A;  5CGM A;  2BKN A;  2H7V C;  1HCI A;  4UXN B;  4CQI A;  4ZI3 D;  3E0Z A;  2WU5 A;  2NW8 A;  2LHR A;  1KNZ A;  5JR9 A;  2X9X A;  1LKX A;  3ZST A;  5AQI B;  2XQ7 A;  3EDU A;  1H7C A;  4X66 T;  4H9N C;  4WNK A;  1WRD A;  1JNR A;  4JEH B;  5L2L A;  3AE1 A;  4QH4 A;  1Y64 B;  2LM9 A;  4H9P C;  1OED C;  5ADX L;  4MLK A;  4X64 T;  4EIW A;  4B6X A;  1Z8U A;  5KX5 E;  1W09 A;  3C51 A;  2WAU A;  3I9W A;  3IA3 A;  1IAP A;  1IBK T;  1KNP A;  3PUX F;  4HWC A;  4DV7 T;  1D1C A;  3C4Z A;  2WWU A;  5J2T E;  4N78 D;  3K3Q C;  2L9Q A;  4ILA A;  3ZMZ B;  1KEY A;  3CVR A;  3IEE A;  2CLY B;  4C91 A;  4QWN B;  5FL0 A;  4ZI7 E;  4AKR B;  4I55 E;  4HWF A;  4A98 A;  3UUL A;  1S35 A;  5C2T A;  3C64 A;  1OWA A;  5L3B B;  3E08 A;  4AI6 A;  4KP3 C;  1XMQ T;  4AIU A;  2KLQ A;  4DVD A;  4JI2 T;  4COF A;  2LOS A;  4ZOL E;  2D9D A;  4UEL A;  3ZKR A;  2D5U A;  4I4T E;  4LF7 T;  2JPF A;  3ZSS A;  1WR0 A;  2W62 A;  3HKD E;  4ILC A;  3PUW F;  4JI3 T;  4K0U A;  2J1D G;  1MIY A;  4EYU A;  3B57 A;  2LT3 A;  2VUR A;  4TN7 B;  4CN6 A;  4WBN E;  3OYZ A;  2J62 A;  2YOE A;  3RYI E;  5DAB A;  1HFA A;  2CRB A;  1LRZ A;  2VAS A;  4AQY T;  4X5T A;  5EZY E;  2F4V T;  1I94 T;  3VU7 H;  3AAI A;  4TV8 E;  1BR4 A;  3ZN0 B;  3P4Q A;  4UEM A;  4M1P A;  2MTQ A;  5L3F B;  2V7L A;  2EHO A;  4K0K T;  4GKK T;  3X1D A;  5LBQ B;  3UUN A;  2UU9 T;  5AQL B;  4DR2 T;  5LBM A;  3ZYL A;  3Q5W A;  1HNW T;  4HEA A;  2FJE A;  2B1E A;  1N34 T;  3JC6 D;  1MMD A;  3GN5 B;  3ZN1 B;  1V9D A;  2JRK A;  3B5M A;  3CQG B;  3CX6 B;  3C50 A;  2NTX A;  1T7S A;  4WZX A;  5BMV E;  5LGN B;  1SUM B;  4G63 A;  1KFY A;  3FHN A;  4HFV A;  5FXZ A;  4P09 A;  3KFW X;  3UU3 A;  2FBW A;  1HS7 A;  2X67 A;  3CWZ B;  2H3R A;  3BQK A;  4ZXL A;  4YT0 A;  4IRE A;  2YN6 A;  3ETU A;  2DI4 A;  5IYZ E;  5J2U E;  3RGL A;  4QH5 A;  1SHZ C;  4OX9 T;  3PE0 A;  2OV9 A;  4BJN A;  2KT9 A;  4TX5 A;  4IDZ A;  1BR0 A;  4PFP A;  5J0Z A;  3BQL A;  3M65 A;  4ZEY A;  2LKH A;  4IDP A;  3O4X E;  2W0G A;  2UXC T;  4JYA T;  2VL0 A;  1IJ6 A;  2Y8D A;  1ZHC A;  4H63 V;  1D0Y A;  2V7I A;  2WCA A;  2IIU A;  3N9Q A;  1D0Z A;  3U78 A;  5AQK B;  4GK5 E;  4KI0 F;  3N2K E;  4O8S A;  2X66 A;  1MIW A;  3AAA B;  1N32 T;  4IDQ A;  3RIA A;  4PK5 A;  2XAG B;  3MJX A;  4QHO A;  3LG7 A;  2MAW A;  3A5X A;  2KXP B;  2LSK A;  4CI2 B;  3FZH B;  5J1G A;  4YTN A;  3AB3 B;  1ZV4 X;  2PTF A;  3RC3 A;  2NP9 A;  3PUZ F;  5JTG A;  4AQG A;  2V7M A;  3ZT6 A;  2KMF A;  3ZMS B;  2E9X B;  2B76 A;  5IWA T;  4QXC B;  2CBJ A;  2IUB A;  3OYX A;  2NWB A;  4O2A E;  2UUA T;  3JC6 C;  1E1H B;  2BDE A;  5M4Y A;  4DND A;  2PJQ A;  4Z90 A;  2KSR A;  3WAJ A;  3K3O A;  1WYB A;  4GYR A;  3ANW B;  2I0M A;  4O4J E;  2N1G A;  3KDS E;  5DQW A;  3D0T A;  3OVU A;  5LYJ E;  4XBF B;  4ZI2 D;  3AED A;  2VWA A;  4JI4 T;  2DHR A;  5LG3 A;  4QKN A;  4MHC A;  2JIW A;  5H6Q B;  2CHN A;  5L4H A;  3U3I A;  4NIQ A;  4YTP A;  3UTK A;  1XZY A;  1G73 A;  2XAQ B;  3OJA A;  5IHY A;  4OHF A;  3P4R A;  2BVL A;  1NWM X;  4U3C A;  3QOF A;  4BA9 A;  4DR5 T;  3FBL A;  2XSB A;  3PUA A;  1ZEE A;  3LBX A;  4OK0 A;  4DUZ T;  3TLS A;  4O4I E;  3F57 A;  3PUR A;  2NR4 A;  5DQV A;  3ZC0 A;  2KWH A;  3BK9 A;  3HKB E;  3FZL B;  4UVA B;  2IDO B;  2W63 A;  2K9A A;  4UF0 A;  4EXT A;  4DV1 T;  1HX8 A;  5TAO A;  4JUY A;  2X0L B;  1M7K A;  5AQO B;  4ERR A;  5ABH A;  2UUB T;  5HXC A;  2HPJ A;  3DJB A;  4IDO A;  2WDR A;  2LRL A;  2OLT A;  3ZMU B;  2SPC A;  3H37 A;  3P50 A;  4KUM B;  3AA0 B;  1N36 T;  2V7J A;  2XHE B;  2XQ3 A;  4DR1 T;  3C98 B;  3GWH A;  5JDH A;  4JI1 T;  5FMN A;  4AKL A;  2PG8 A;  4JI7 T;  1E7P A;  1FEW A;  3RYH E;  2XQ5 A;  4YJ2 E;  2WZI A;  3AXJ B;  4KMC A;  1OED B;  5AQS B;  4AXP A;  5JDL A;  3P4P A;  3HL6 A;  2JQK A;  3EVY A;  4GYS A;  4HFE A;  5HEU A;  4L5G A;  2ZMA A;  4HWH A;  2A9U A;  2LKG A;  5FVL A;  4DV6 T;  1FIO A;  2UXB T;  3AE5 A;  4PJL A;  3T1H T;  2EHO D;  4ZI2 C;  1YKE B;  2G0U A;  4YLH A;  2D2S A;  1UX4 A;  1MIV A;  4E7S A;  3R6N A;  2UUC T;  4HE8 A;  2WWV A;  3NKZ A;  4X65 T;  2RP4 A;  3KVB A;  3RHW A;  4CXW A;  4OYJ A;  2Q9Q B;  2GK9 A;  1QLB A;  3PU8 A;  3JAD A;  1ZKE A;  5JDF A;  3HR0 A;  4U74 A;  3SWH A;  5F5W A;  2K48 A;  4PJJ A;  3VR9 A;  5JQG E;  2YDS A;  2KIN B;  3UU4 A;  3NVO A;  3IHR A;  4UVC B;  4TUY E;  4CN4 A;  2C0S A;  4KX6 A;  3O1I A;  3FZM B;  4IHJ E;  4ZZB A;  4LF6 T;  2HPL A;  1KK7 A;  3ZMT B;  1VOM A;  5LP6 E;  3RIF A;  3EDV A;  3HKE E;  2XPK A;  3KV4 A;  2WB5 A;  2HN2 A;  4WW0 A;  4KHP T;  2IW5 B;  2XQ6 A;  1J5E T;  5AQU B;  3ZT7 A;  2QRX A;  4A56 A;  4LF4 T;  4DV4 T;  3N2G E;  2JQ9 A;  5HXR A;  2H7O A;  5AFU L;  2L8K A;  2BS3 A;  2WU2 A;  3VRB A;  4HWD A;  2DL1 A;  3AEB A;  3RLF F;  5DJQ C;  4JV5 T;  5AQF B;  2X0Y A;  1EZ3 A;  4HFD A;  2LSJ A;  1U5P A;  4QXH B;  3B13 A;  2V1D B;  4H9O C;  3N5L A;  3LFM A;  1HR0 T;  5ABF B;  5LGT B;  5AQG B;  4ANJ A;  1SE7 A;  4WYV A;  2BG9 C;  4HFH A;  4X1Y E;  1T98 A;  5CA1 E;  4NXN T;  3NZQ A;  3JCF A;  5HCJ A;  4CI3 B;  2EHO C;  2JMH A;  3TLU A;  2XSA A;  4H9R C;  3MA9 A;  2NOX A;  3N9P A;  3KV6 A;  1JNZ A;  3MAC A;  2H89 A;  4AKG A;  5L4E A;  4IL9 A;  2WQY A;  4H9S E;  4U33 A;  2ZM6 T;  2VKH A;  5AQV B;  2N2N A;  1UX5 A;  2UXD T;  4U7Y A;  5LXT E;  5FNV E;  4EED A;  2XQ4 A;  3PTR B;  5JRC A;  2FJD A;  4MBQ A;  2BG9 A;  4QXB B;  3AE4 A;  4DV2 T;  1ZOY A;  3CPZ A;  2R6G F;  1MMG A;  4IIJ E;  3BQI A;  4B3M T;  5HEG A;  3CK6 A;  4ADZ A;  3FBZ A;  5FKY A;  4YSY A;  2V6Y B;  4PJN A;  3FB2 A;  5L3C B;  2WP9 A;  4GOU A;  2J47 A;  3PDY A;  5EK4 A;  2CLY C;  3ZPO A;  1US7 B;  4HTE A;  5ETW A;  5CB4 E;  2XM2 A;  3SFD A;  3RQU A;  3SS1 A;  3CQC B;  2WMN A;  3RI5 A;  1U4Q A;  3MZK B;  4KHZ F;  4DR7 T;  2FJA A;  5LOV E;  2WSS V;  2VVN A;  3A8Y C;  3Q2M A;  2LSG A;  3NRX A;  2KZ7 B;  1QSD A;  4LF9 T;  4JBW F;  3IF8 B;  5CA0 E;  3UFG A;  4NUV A;  4A5X A;  3N9N A;  4U7I A;  5KMG P;  3HA4 A;  5AQR B;  4U2Z A;  4NXM T;  4U72 A;  4XAX B;  1WR6 A;  4YTM A;  3PUS A;  2YU1 A;  2W66 A;  3KV5 A;  2JQQ A;  3KIN B;  1YQ4 A;  1MND A;  2XAJ B;  3O1H A;  3Q5E A;  3J9X 1;  3OPC A;  4EAH A;  3ZMV B;  3MK7 C;  3UUX B;  3AA1 B;  4LFB T;  3ONX A;  2XQA A;  3PV0 F;  4ZS3 A;  4AKH A;  2ZM2 A;  4PK6 A;  3VR8 A;  3AVS A;  3V5S A;  4CXY A;  3L39 A;  4QH1 A;  2VB6 A;  5LHG B;  2LSI A;  1YW0 A;  2CXD A;  4JLE A;  2NW9 A;  1I6Z A;  2BKO A;  3AE2 A;  2ZM0 A;  5C3J A;  3AVR A;  2OA5 A;  4JEU B;  1NEN A;  2E9X D;  2HH7 A;  2VKO A;  3AE8 A;  3EHZ A;  3F2E A;  5HXS A;  2YK0 A;  2BG9 E;  4LMK A;  3N9L A;  3H3A A;  2CMR A;  4DV5 T;  3SFE A;  4ILB A;  3UFE A;  4P0A A;  4CI1 B;  2VQF T;  4NUU A;  1HNZ T;  5FP3 A;  1Y01 A;  1S94 A;  1MMN A;  4IT4 A;  3CML A;  2BS4 A;  3ETV A;  2YIN A;  1CUN A;  2C5I T;  4V1A v;  3K1S A;  2FJB A;  3HI2 A;  4YJ3 E;  4L0R A;  4QX8 B;  2NTY A;  4GK0 E;  3FZF B;  2LOP A;  3O9X A;  2X68 A;  3GN5 A;  3RQW A;  3RKG A;  3Q5D A;  2DNX A;  3KBT A;  1L0V A;  3ESL A;  3AA6 B;  2I6H A;  2A2F X;  2MOZ A;  3CIR A;  3P4W A;  4KBM B;  4YHJ A;  2X51 A;  1HX1 B;  5AQH B;  3N2O A;  3RYC E;  4PK4 A;  2CCQ A;  2K3W A;  5H6R B;  3UU8 A;  2LRK A;  4IST A;  3K8P C;  1Z0P A;  1YD8 G;  5L3E B;  1IJ5 A;  2A3D A;  2XAH B;  3AEG A;  3F31 A;  3S4U A;  4DBR A;  1UUS A;  2ZM8 A;  4PFO A;  3HKC E;  3PUG A;  4JI0 T;  2W00 A;  4J2C A;  5LMN T;  4HGA A;  3RKO A;  3WI3 A;  3R84 B;  3QK6 A;  4C90 A;  1X79 A;  3NBX X;  2WDV A;  2BBJ A;  3KV9 A;  5LMU T;  5JR9 B;  1MNE A;  4AQF C;  2P9B A;  4Q25 A;  3T8O A;  5KXJ A;  2AXD S;  5CJ5 A;  4U2Y A;  3AA7 B;  2E9X C;  4B3R T;  2M6I A;  2KWI B;  1YQ3 A;  1X9B A;  4ZHQ E;  5FY7 A;  4F8H A;  1UUR A;  2MYS A;  5JVD E;  4EOZ B;  1M62 A;  3CKD A;  2LM2 A;  2BS2 A;  4HFC A;  5HEJ A;  4AQF A;  1BR2 A;  4EEB A;  3OBV E;  5GON E;  3UQ4 A;  1R8I A;  4EZ4 A;  1AJ3 A;  2YEV C;  3EUH A;  4O2B E;  2E9X A;  4E7Z A;  3ZYK A;  3EAB A;  3RIU C;  3PUV F;  4JI8 T;  2A72 A;  2X9H A;  2W67 A;  2MBG A;  2HN1 A;  4ZZC A;  3P8C D;  3OKQ A;  2W2U A;  5AQP B;  3UT5 E;  5LJM A;  2ODU A;  4ISS A;  3NWI A;  5HWX A;  3EAM A;  2Q9Q D;  3PJA J;  1W0B A;  3NZP A;  3ANW A;  2BZB A;  2J4G A;  4EYY R;  3M3Z B;  2BBH A;  5AQJ B;  2QGS A;  2IAK A;  1UCU A;  4GIW A;  1T8B A;  2M67 A;  3RIU A;  2V8S V;  3L8R A;  1MMA A;  3TKL B;  3P4S A;  1VRB A;  5L3D B;  3H3M A;  2YDR A;  2LE8 A;  3OTO T;  2K24 A;  3QB5 K;  3A7M A;  2MPK A;  4I0U A;  4QX7 B;  4P1N A;  4HWI B;  2XQY A;  3Q5X A;  3PU3 A;  3MKD A;  1WYC A;  1HG2 A;  1G8X A;  3AEE A;  5LCY A;  2EHO B;  1HF8 A;  4G2A A;  1XDO A;  3ABV A;  5F3J A;  4YSX A;  3VKH A;  1D0X A;  2M6B A;  1UGO A;  4MAL A;  3RF1 A;  2YKS A;  5FXW A;  3ZT5 A;  1XMO T;  1WFD A;  3MXZ A;  2XJ7 A;  5L3G B;  3C4W A;  1FJG T;  4UV8 B;  2PBI A;  5AQT B;  3W15 B;  4X62 T;  4YHH T;  1J1J A;  1FMV A;  5FY0 A;  4TNW A;  4U31 A;  1QUU A;  3AAE B;  2XAF B;  1WCR A;  3RH3 A;  3AXJ A;  1KNR A;  3UQ7 A;  3EI0 A;  1OED A;  3SRZ A;  2RA1 A;  4CN1 A;  4LF8 T;  5IUX A;  4AKI A;  2W61 A;  2UXX B;  2YDQ A;  4I43 B;  3JAE A;  2Q9Q C;  2ACZ A;  4DMW A;  3N9M A;  3Q9D A;  5LNK A;  4TNV A;  3T1Y T;  2HHH T;  3AE6 A;  5FL1 A;  4Z8X A;  4HFI A;  2QA7 A;  4O4H E;  3TLT A;  4TWH A;  3TLV A;  2YU2 A;  2QYW A;  5FXV A;  1LVK A;  3AE3 A;  3GMI A;  4X1K E;  2D0U A;  2XQ9 A;  3ONL C;  3ZLI A;  2Q9Q A;  2KND A;  2VVS A;  3LDQ B;  4EB6 E;  5LB7 B;  1E2A A;  1CHU A;  1D1B A;  2BVM A;  5HYA A;  3ZCJ A;  2VKD A;  2XUE A;  4HKA A;  3PUY F;  4MFR A;  1W9R A;  4ILU A;  5LA6 E;  4LML A;  4DV0 T;  4BJM A;  3VHL A;  2DLR A;  2XQ8 A;  1WLX A;  3V5U A;  1VCT A;  1FMW A;  2CEA A;  2VQE T;  4ZI3 C;  2XY8 B;  4X20 E;  3L09 A;  5JDG A;  5JDN A;  3VKG A;  4BAY B;  3FXE B;  1J5W A;  3KVA A;  1XWM A;  4HFB A;  5ABG A;  4L9I A;  4UV9 B;  2VK9 A;  2I59 A;  1OXZ A;  1YKH B;  2CXL A;  1XNR T;  5A1L A;  2CHO A;  1ZP0 A;  5LHI B;  2LLY A;  4EZH A;  4TWF A;  1GQE A;  2V5C A;  2NW7 A;  2Y48 B;  3IBP A;  4YFS A;  4PW8 A;  1O3X A;  4GKJ T;  1IZN B;  3UU5 A;  5ABE A;  4DV3 T;  3RPU A;  1HTJ F;  2WM9 A;  2D0T A;  1UK5 A;  2ZLY A;  3AE7 A;  1VCS A;  3RC8 A;  2E5V A;  1HG5 A;  1OED E;  2AE9 A;  4IE0 A;  3CX8 B;  3LK2 B;  2IC6 A;  2DWK A;  1D1A A;  2DWG A;  4DID B;  3I9Y A;  3ZYM A;  5LG4 A;  4YY3 T;  1B7T A;  3VRA A;  5ABF A;  2V5D A;  3UUM A;  1N33 T;  3RX6 A;  2L3L A;  5JH7 E;  3PUQ A;  4XZC A;  5HEH A;  3LK3 B;  5AQN B;  1IBL T;  4A97 A;  3LBX B;  2CA5 A;  4YSZ A;  2ES0 A;  5KDM C;  2CM0 A;  4P0B A;  4X1I E;  3P7I A;  4EV6 A;  2ODV A;  4LFA T;  4UF0 B;  2LJL A;  2E5L T;  3RYF E;  3FXD B;  2LHN A;  2JJ9 A;  3WAK A;  2WMO A;  2CWY A;  1YXR A;  2LSY A;  4DUY T;  4ZS2 A;  2XAS B;  3PJA A;  5FXX A;  2IC9 A;  5C8Y E;  4DMV A;  4PJM A;  3C4X A;  2V6Y A;  2XM1 A;  3ZC1 A;  1IBM T;  5EK3 A;  2IML A;  3FZK B;  3ONJ A;  2V7K A;  4PNI A;  5JDQ A;  2RPA A;  3AEA A;  3L3P A;  5HXH A;  2XTL A;  3I0Q A;  2JQH A;  4IGU A;  3NRY A;  4B3S T;  4IDN A;  2V6X A;  5FYM A;  3RRC A;  3ZJ1 A;  5LHH B;  2FUP A;  3DP7 A;  2WBL A;  2QVA A;  2C5J A;  1W0A A;  1BR1 A;  3ZCI A;  3LJC A;  4FJO A;  2X9W A;  5HWY A;  5EK2 A;  3LK4 2;  3LSV A;  2W4X A;  4EGW A;  4YXD A;  3AEC A;  4UVB B;  2X9Y A;  2CE7 A;  5AQQ B;  4DR6 T;  3E22 E;  3JAF A;  3QNU A;  4B3T T;  2WY2 A;  5FVK A;  4CZZ B;  3K3N A;  4OFZ A;  1DU2 A;  4H9Q C;  3CX7 B;  3CQX C;  2E8I A;  3KBU A;  2CPT A;  4O4L E;  5LJN A;  2CWO A;  5CFB A;  3ZJ2 A;  4LFC T;  3RRW A;  3ZEF B;  3G06 A;  5L47 A;  4DR3 T;  4I50 E;  2E2A A;  5E0O A;  4IE4 A;  4IL4 A;  4Z91 A;  4OYK A;  4LF5 T;  4DO0 A;  4JI5 T;  3UUB A;  5HCM A;  4TZ4 C;  5BR8 T;  1SA0 E;  4NPP A;  5LGU B;  1NEK A;  2WS3 A;  1HNX T;  4JI6 T;  3N9O A;  2XZE A;  2V26 A;  4H63 H;  2ACX A;  5HAX A;  1KF6 A;  2LEH A;  2VKJ A;  3QC9 A;  2JMK A;  3QB5 A;  5AQM B;  3TLW A;  5F8P A;  3AEF A;  4DR4 T;  4LMJ A;  3SOL A;  4UIG A;  5JDM A;  3I0O A;  4PAG A;  3AE9 A;  5FY1 A;  2BKP A;  2UXN B;  3QUJ A;  1XDP A;  2WZH A;  2IHR 1;  5JRE A;  4IE5 A;  4ASK A;  2K5B B;  4TV9 E; 
#chains in the Genus database with same CATH homology
 4WYV A;  3AXJ B;  2QVA A;  3PJA J;  3RIU A;  3QB5 A;  3RIU C;  3PJA A;  1J1J A;  3QB5 K;  1KEY A;  3AXJ A;  2QRX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...