4QX7B

Crystal structure of histone demethylase kdm2a-h3k36me2 with alpha-kg
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
68
structure length
68
Chain Sequence
QVHLTHFELEGLRCLVDKLESLPLHKKCVPTGIEDEDALIADVKILLEELASSDPKLALTGVPIVQWP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Oxidoreductase/structural protein
molecule keywords Lysine-specific demethylase 2A
publication title A molecular threading mechanism underlies Jumonji lysine demethylase KDM2A regulation of methylated H3K36.
pubmed doi rcsb
source organism Mus musculus
total genus 19
structure length 68
sequence length 68
chains with identical sequence D
ec nomenclature ec 1.14.11.27: [Histone H3]-dimetyl-L-lysine-36 demethylase.
pdb deposition date 2014-07-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.2210 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4qx7B00
4QWNB 4QX7B 4QXHB 4TN7B 4QXBB 4QXCB 4QX8B
chains in the Genus database with same CATH superfamily
2R6GF 3LK42 3P4RA 4GKKT 5IWAT 2ACZA 5FKYA 2PFVA 3ZSTA 4H9OC 2MAWA 4PAGA 4U2YA 3LSVA 2E8IA 4LMJA 4TV9E 4JBWF 1XMOT 2LOPA 1JNZA 3ZJ2A 4UV9B 3RX6A 4K0KT 5KXJA 2VKDA 1IZNB 4QXCB 2V7JA 4P1NA 3AEFA 5JR9B 2VL0A 2XM2A 4ANJA 4I43B 3UU4A 5FP3A 1FJGT 3P8CD 2PJQA 3AVRA 3VRBA 2V26A 5CGMA 4E7SA 2WQYA 3P4WA 4X5TA 4JEUB 3KV5A 3RYFE 2QA7A 2WMNA 4JI3T 3HR0A 1N33T 2VB6A 3O1JA 4B3RT 2V5CA 4I50E 2BKPA 3N9LA 4JI1T 4HFCA 1W09A 1HCIA 2IDOB 3FBZA 1NWMX 2CMRA 3GN5A 5FYMA 3AEBA 4IT4A 2DLRA 3J7Yq 2V6YB 4QKNA 3OTOT 3RLFF 1OWAA 3Q5XA 2L3LA 4AQGA 2C0SA 2W67A 2QYWA 3CX8B 2JQHA 3QUJA 2J47A 3SWHA 4I55E 5LGUB 3PUZF 2UXXB 5L3GB 3QB5A 1Y64B 3Q9DA 4WYVA 4B3ST 1E1HB 3RYCE 1G8XA 4QXHB 2KNDA 2RA1A 4JUYA 5HEGA 2C5IT 4XZCA 2LHRA 3HKBE 5LJNA 2BKNA 1SA0E 2XAQB 3CWZB 5AQKB 1KK7A 1HX8A 5AQVB 3N5LA 2XQ8A 1T98A 5L4HA 1N32T 2ZLYA 5CB4E 4WBNE 1WRDA 1UURA 2XAFB 1T8BA 2LSGA 3UULA 2IUBA 3G06A 1M62A 4ZI2D 4NXMT 1MNDA 3L39A 2P9BA 4B3MT 4A56A 2E9XB 3AAEB 2W61A 4DV7T 2KXPB 4AKHA 5AQRB 4ZI3C 4KUMB 4U31A 4DV6T 4GK5E 4UVBB 2XQ9A 3M65A 3RIFA 1XNRT 5J0ZA 2LSJA 2KZ7B 3AEEA 4YJ2E 3QNUA 3B5MA 4IE5A 2Q9QD 2LSKA 4UR9A 1D0ZA 5FVLA 3MK7C 4AIUA 2E5VA 3CX7B 2J4GA 3RF1A 1XNQT 2WWVA 3FB2A 5J2UE 2E9XD 2N1GA 4AKRB 3RYHE 3RH3A 3RYIE 2EHOA 5LMUT 5LJMA 3AE2A 5F5WA 3CK6A 2XY8B 2WWUA 2X67A 2BDEA 2VURA 5JDFA 2W4XA 5LB7B 4AXPA 1MMAA 3RC3A 4ILCA 1W0BA 4DV2T 5DABA 4IGUA 3E08A 4UVCB 4UXNB 1BR0A 4MBQA 2KINB 4CZZB 4TX5A 2Y48B 4TUYE 5JRCA 4KHZF 4AQYT 2A3DA 2FJEA 2XQ3A 4LFCT 4OX9T 5AQIB 2Y8DA 3ZCJA 4CN6A 1V9DA 4CN1A 3AECA 3JCFA 5LG4A 4HFBA 4L5GA 3ZN0B 4ZHQE 3B57A 1D0YA 5LYJE 1HR0T 2VVSA 3ONLC 4AISA 2HN2A 2HHHT 3PJAA 3UQ7A 3JADA 4O8SA 2XQ6A 3GN5B 1US7B 3UU5A 2V6XA 4ZXLA 2CLYC 3AE4A 2M6BA 5HAXA 5HCJA 4HN9A 4Z90A 2CXFA 4IDNA 3N9MA 4GYRA 5LG3A 2B76A 2LKGA 4O4JE 3EVYA 2IW5B 1LVKA 5KMGP 4DR5T 2OA5A 3ZMZB 4UIGA 1L0VA 4QX8B 2H89A 3RQWA 1N36T 4PNIA 1J5WA 5EK2A 5AQQB 3ABVA 2UUCT 1Z0PA 2H3RA 2IHR1 4MHCA 3RIUC 5CA0E 4QWNB 2CCQA 3UUXB 2M6IA 3PUGA 3NZPA 5HWYA 5LA6E 1MMGA 3TKLB 3VRAA 2VWAA 5JDMA 3LJCA 4G2AA 1WR6A 3PUQA 4LF9T 2KSRA 4ISSA 2ZM6T 2YDQA 4X65T 3I9YA 3DTOA 3MKDA 4HEAA 1BR1A 2AE9A 2K48A 3NRYA 4DR2T 2L8KA 4ZS3A 5L3CB 1LRZA 5ABGA 2F4VT 2W63A 3RPUA 3IHRA 3QOFA 1LKXA 4U2ZA 4CXWA 3UU3A 3ZYKA 4DBQA 4FI5A 4LMKA 2PBIA 3PU3A 2BG9E 4IDOA 3AE9A 2WB5A 3OVUA 3AEAA 2D0UA 4EOZB 3GWHA 3ONXA 1XMQT 2XZEA 5HXEA 2EHOB 3S4UA 3F2EA 5ADXL 3AVSA 1WYCA 2LHNA 2LSIA 4HWFA 1WR0A 2BS3A 4MALA 4FJOA 3HKEE 4X64T 2KT9A 4YJ3E 3PUAA 1UX4A 2D9DA 3R84B 3RGLA 4J2CA 4ISTA 3CPZA 4DMVA 1HFAA 5JRCB 2NR4A 3K8PC 4A97A 2X9HA 2ODUA 4L9IA 4O2AE 3RKGA 5LHHB 5AQFB 1G73A 4NPPA 2JJ9A 4EB6E 4EYYR 3P50A 2IIUA 4AI6A 4PK6A 5F3JA 1WCRA 5AFUL 2LJLA 4PJJA 1S94A 3AA7B 2WMOA 3JAEA 1W0AA 2VKJA 5FMNA 2I6HA 2JMHA 2BS2A 4YTNA 3L8RA 2WCAA 4UF0A 2C5KT 3AA6B 2HH7A 3FXEB 2NW7A 5AQGB 4IE4A 4QH1A 5DQVA 4H9QC 3AE8A 4EEDA 4DR7T 5BR8T 2LRLA 3SFEA 3N9PA 2NTXA 3ZC1A 2MYSA 1O3XA 1SUMB 1ZHCA 3PE0A 3C64A 5ABFA 4B3TT 4DV5T 2FJAA 4DBRA 2NW9A 2A2FX 2H88A 2XAJB 3C4XA 1KFYA 5HEHA 2CBIA 5LHGB 1OEDA 3ANWA 2PTFA 2QGSA 2WAUA 3JC6D 1YKEB 4X66T 4YHHT 5J2TE 4HWDA 4NUVA 2YU2A 4H9NC 5FXWA 4JEHB 2KMFA 5BMVE 4UVAB 4O4LE 2XJ7A 4V1Av 4ASKA 3I9WA 4OHFA 2VASA 1YQ3A 3AEGA 3N2OA 4GYSA 2A72A 4QH5A 4M1PA 2D2SA 2WZHA 2OV9A 5FXVA 2BVMA 4CXYA 4PJMA 3C4ZA 4KP3C 3NVOA 2BS4A 4WNKA 5LMNT 2X0HA 2ZMAA 4Z91A 3EDVA 5L4EA 2AXDS 1S35A 3ZJ1A 2HN1A 4IE7A 1D0XA 2WU5A 4CI1B 2I59A 4ZI2C 5E0OA 5FVKA 4LF7T 5LP6E 4L0RA 5AQPB 4HFIA 2WZIA 5AQJB 1IJ6A 1HX1B 2M67A 2CXDA 4ILUA 3IF8B 3AAAB 4NUUA 5HXHA 1DU2A 3OKQA 1HTJF 5HCMA 4YSXA 2Q9QC 4ZI7E 2DNXA 4ADZA 3R6NA 1WYBA 2BBHA 2QVAA 3PU8A 3WAKA 3AA0B 5J1GA 3CVRA 2V7LA 4TNWA 3ZMSB 5FY1A 2XPKA 3FZFB 3ZSSA 3OPCA 4PFPA 2CXLA 2E9XC 4DR1T 5ABEA 1FEWA 2XASB 1XDPA 5LBQB 4YXDA 3VR8A 4DIDB 3SOLA 4PJNA 3Q5DA 2H7OA 4TV8E 1YD8G 1T7SA 2XSAA 3HKCE 4IL9A 2X0YA 1UK5A 3NZQA 2JQKA 4H63V 4E7ZA 4TNVA 4TN7B 3RIUA 4GIWA 2JQQA 3PJAJ 2K9AA 2LM2A 2XQ7A 4U7IA 4QH4A 4JYAT 3H3AA 2W62A 4NXNT 1OXZA 2KWIB 1W9RA 4DV3T 4HFDA 5F8PA 3RI5A 3QK6A 2XQ5A 4NIQA 5DJQC 2D5UA 1D1BA 3GA8A 5JH7E 3Q2MA 3A5XA 5CFBA 5HEJA 2IC9A 3AE3A 4UEMA 2V7IA 3ONJA 4G63A 1NAFA 4UF0B 4X1IE 4H63H 5LCYA 4PFOA 3P4QA 1SHZC 4X1KE 4PJLA 2LRKA 4KMCA 4HWHA 2WSSV 3PDYA 5EZYE 4IDZA 2FJBA 4YSZA 2CBJA 1T72A 4WW0A 4A98A 5ABFB 2FUPA 4EZHA 3PUXF 1I94T 5A1LA 4COFA 1I6ZA 1OEDB 4AKGA 3EUHA 3Q5EA 3ANWB 4LMLA 3AEDA 5IUXA 1KNZA 3K3NA 4U74A 2SPCA 2WDRA 2LEHA 3KFWX 3A7MA 1NEKA 2BVLA 4IE0A 2WM9A 2I0MA 1FMVA 2LM9A 2W0GA 3HKDE 2NOXA 5H6QB 1HNWT 2X51A 3EI0A 4JI0T 2YDSA 3MA9A 2IAKA 2H7VC 1MIYA 4MLKA 3C98B 5HXRA 3LFMA 4OK0A 1KNRA 5HEOA 2XQAA 2IMLA 4EGWA 3MJXA 2X66A 2X9WA 2V5DA 5LNKA 3AE7A 2YOEA 3B13A 1IJ5A 3KV6A 4EAHA 4IDPA 3V5SA 4JI6T 1M7KA 4H9SE 3TLSA 3CMLA 1BR4A 2DWGA 4I0UA 4GOUA 1HS7A 2X9XA 2CLYB 3OBVE 3BQLA 1D1CA 2C5JA 1HNXT 4X20E 3FZMB 4DUYT 3UTKA 5JDQA 4F6RC 2ODVA 2N9DA 4JI5T 4U33A 1JNRA 3ZMUB 2UXNB 4EYUA 2UXDT 5L3BB 5CJ5A 3FZHB 4TWFA 3RRCA 4ZOLE 1FIOA 4O4HE 3N9QA 4O4IE 1X79A 3VHLA 4AQFC 2ACXA 1R8IA 3AE6A 2RP4A 1XDOA 2XTLA 4ZZCA 4JI8T 1ZOYA 4U72A 2ZM8A 1HF8A 1EZ3A 3U78A 3BQIA 2ZM0A 2QRXA 5FXXA 4DR4T 3HL6A 3VU7H 3NKZA 3ZT5A 1SE7A 3M3ZB 1IBLT 4B6XA 2JIWA 3N2KE 3TLTA 4XAXB 1HNZT 2XSBA 3AAIA 3KBUA 2BG9C 2G0UA 2V1DB 4YTMA 2LE8A 3ZEFB 3IBPA 2UXBT 4IDQA 4GKJT 2CWOA 5JQGE 3N9OA 3O9XA 2B1EA 5L3FB 4ZEYA 2PG8A 2DCFA 2Q9QA 3FZLB 2CHNA 2A9UA 1ZEEA 2MBGA 3QC9A 3FHNA 2WDVA 3TLVA 2WU2A 1VCSA 4HGAA 3CQGB 3ZN1B 4ERRA 1IBMT 3LBXA 4JI7T 5JDHA 5AQTB 1J5ET 4KI0F 2E9XA 3OYZA 4BJNA 1KF6A 2KWHA 2X9YA 3JC6C 3AB3B 3VKGA 3RC8A 4QHOA 3SS1A 2EHOD 1XZYA 3N9NA 2V8SV 3PUVF 4H9PC 1H7CA 4CQIA 4P0AA 3ZT6A 4BAYB 3ZKRA 5KDMC 2Y6XA 2CPTA 5AQHB 1X9BA 4EV6A 3ZYLA 5JR9C 4OFZA 2E2AA 3RQUA 4K0UA 4O2BE 3H3MA 3ZMVB 2VK9A 3OJAA 5IHYA 2LT3A 1ZV4X 5AQLB 3UUBA 3U3IA 5JTGA 5JDNA 2CA5A 4QXBB 1IBKT 2HPJA 3I0QA 3C51A 1MMDA 5LHIB 2X68A 3BK9A 3MACA 1UGOA 3SRZA 3ESLA 5LOVE 4IE6A 3WAJA 1CUNA 3OYXA 2VQFT 2FBWA 3LG7A 1QUUA 3C4WA 4PK5A 3MZKB 1KEYA 2UXCT 4YTPA 5C2TA 3E0ZA 4IL4A 2ZM2A 5KX5E 3ZLIA 1FMWA 3LDQB 5HXCA 4EEBA 3WI3A 3EABA 3GMIA 3ZT7A 4OYKA 5H6RB 3E22E 2W66A 3T8OA 2YKSA 5AQUB 5FY0A 4DV4T 4AKLA 3LK3B 3CIRA 4DV1T 1HG5A 5LGNB 3VR9A 3KVAA 5FL0A 2CWYA 3CKDA 1NENA 5FY7A 3ZPOA 4HTEA 4TWDA 5C3JA 2E5LT 5EK3A 3F57A 3I1AA 4DR3T 1VCTA 5ETWA 3IEEA 4MFRA 4HFEA 1MNEA 1YW0A 4X1YE 1MIVA 1YXRA 1J1JA 3KVBA 2JMKA 4YY3T 2FJDA 5IYZE 4UV8B 1MMNA 3O1IA 4EIWA 4DVDA 3RHWA 5JDLA 2GK9A 2HPLA 5L3EB 4JV5T 2NP9A 2WP9A 2Q9QB 2K3WA 3HA4A 3CQCB 4I4TE 4WZXA 2CHOA 3RKOA 5M4YA 2NTYA 4KX6A 3ZC0A 2CE7A 3L09A 3TLUA 4ILAA 3D0TA 3LBXB 3AXJA 4DR6T 3PURA 3AE5A 2LSYA 2XHEB 1XWMA 4HWCA 5AQOB 2YDRA 2WDQA 3P7IA 4CI2B 2UUAT 5HEUA 4AQFA 4ILBA 1UUSA 1GQEA 3V5UA 2OLTA 3IA3A 3DP7A 2DI4A 3FZKB 5L3DB 3RIAA 2XQYA 2XAHB 4DMWA 2K24A 1N34T 3UU6A 2MPKA 5FL1A 1IAPA 3PTRB 3UUMA 3HI2A 1OEDC 3ZCIA 1KNPA 1LVFA 4QX7B 4AKIA 4LF4T 1OEDE 3UQ4A 2DWKA 4HKAA 2UU9T 2XUEA 3N2GE 1ZKEA 3CQXC 2BG9A 2XQ4A 1B7TA 2L9QA 5JVDE 3T1HT 3K3OA 1WFDA 4KBMB 4BJMA 3JAFA 4P09A 4YLHA 4DV0T 2V7MA 4ZI3D 2VL8A 4KHPT 5AQNB 2Z6EA 5L2LA 3X1DA 5GONE 5JDGA 2NWBA 3UT5E 3LK2B 2NW8A 4DNDA 1E2AA 3VKHA 5JREA 2JPFA 2X0LB 3ZMTB 5AQMB 2YK0A 4YHJA 4PW8A 4X62T 2LKHA 2WY2A 3FBLA 1VRBA 5FXZA 3O1HA 3K3QC 4TWHA 2VKOA 2ES0A 4A5XA 2BZBA 1BR2A 2CRBA 3PUSA 4HFHA 3A8YC 4UELA 5JR9A 4LF5T 5ABHA 2CM0A 5HWXA 2DHRA 2YN6A 1UCUA 3MXZA 2N2NA 4YFSA 3KDSE 2V7KA 2JQ9A 2RPAA 3ETUA 3NBXX 2D0TA 4DO0A 4N78D 3AE1A 2WS3A 4IHJE 4CN4A 4IIJE 4C90A 4HWIB 3F31A 4EZ4A 4HFVA 3NWIA 2BKOA 3EAMA 3UUNA 4BA9A 5HXSA 2W00A 3C50A 4OYJA 2MTQA 3KV9A 3KV4A 5C8YE 2VKHA 2XM1A 3PUYF 4ZS2A 3EHZA 2YINA 4PK4A 5LGTB 4LF6T 3ZYMA 4JI4T 2CEAA 2V6YA 3P4SA 1Y01A 3J9X1 3AXJB 4CI3B 3P4PA 2K5BB 2DL1A 2BBJA 3ETVA 2J62A 4F8HA 4EXTA 2JRKA 2YEVC 4XBFB 1D1AA 4ZZBA 4LFBT 3BQKA 4U7YA 2YU1A 4H9RC 4WBOA 1E7PA 3AA1B 1WLXA 2MOZA 1UX5A 3UU8A 2EHOC 3KBTA 4TZ4C 2LLYA 4Q25A 3DJBA 4YT0A 1YQ4A 4P0BA 4JLEA 4JI2T 3H37A 3UFGA 5AQSB 4DUZT 1Z8UA 1ZP0A 1U5PA 3O4XE 3KINB 2XAGB 3T1YT 3UFEA 2W2UA 3QB5K 5EK4A 2UUBT 1MIWA 5LXTE 4GK0E 2VVNA 5HYAA 2J1DG 4IREA 5CA1E 1QSDA 1YKHB 2BG9B 2WBLA 1HG2A 4C91A 3EDUA 3PV0F 3RRWA 4Z8XA 4LFAT 1VOMA 1CHUA 1QLBA 4CXXA 3TLWA 3I0OA 3W15B 5DQWA 3SFDA 5FNVE 4HE8A 3NRXA 5TAOA 4YSYA 3K1SA 3Q5WA 2VQET 2LOSA 4LF8T 1U4QA 3CX6B 4U3CA 2KLQA 5LBMA 5L47A 3PUWF 3L3PA 1AJ3A 3FXDB 2IC6A
chains in the Genus database with same CATH topology
2VWAA 5JDMA 4EZHA 5ETWA 3IEEA 3LK42 4MFRA 1MNEA 1YW0A 4X1YE 1MIVA 5A1LA 3LJCA 4G2AA 2PFVA 1WR6A 4H9OC 3PUQA 4AKGA 3EUHA 4ISSA 4PAGA 3ANWB 4WW0A 3KVBA 2JMKA 2E8IA 4TV9E 3I9YA 1KNZA 3K3NA 4U74A 5IYZE 2SPCA 3DTOA 4UV8B 1MMNA 3MKDA 3O1IA 4EIWA 2LEHA 2LOPA 3KFWX 4DVDA 3ZJ2A 4UV9B 3RX6A 5JDLA 2GK9A 2HPLA 5L3EB 4HEAA 1BR1A 2VKDA 2K48A 2BVLA 4IE0A 2WM9A 1IZNB 3NRYA 1FMVA 2LM9A 2NP9A 2L8KA 4QXCB 2V7JA 2W0GA 5JR9B 3HKDE 4ZS3A 5L3CB 2Q9QB 4ANJA 4I43B 3HA4A 2NOXA 1LRZA 3CQCB 4I4TE 5H6QB 2X51A 2W63A 3RPUA 3IHRA 5FP3A 3P8CD 3MA9A 2IAKA 1LKXA 2H7VC 2PJQA 3AVRA 1MIYA 2V26A 3RKOA 5M4YA 2NTYA 4CXWA 4E7SA 3ZC0A 2CE7A 4JEUB 4MLKA 3L09A 3C98B 3ZYKA 3D0TA 3LBXB 4DBQA 4FI5A 3KV5A 5HXRA 3LFMA 4OK0A 3RYFE 2PBIA 2QA7A 3PURA 2WMNA 2X66A 2LSYA 3MJXA 2X9WA 2XHEB 3PU3A 5LNKA 3B13A 3HR0A 1IJ5A 2D0UA 3GWHA 2VB6A 3KV6A 4EOZB 3ONXA 3O1JA 4EAHA 3V5SA 4H9SE 4I50E 5HXEA 2EHOB 3P7IA 3N9LA 3S4UA 3F2EA 4CI2B 3CMLA 1BR4A 5ADXL 3AVSA 1WYCA 4AQFA 2LHNA 2LSIA 1HCIA 2DWGA 3FBZA 1NWMX 4MALA 2CMRA 3GN5A 3V5UA 5FYMA 4FJOA 3HKEE 4GOUA 2KT9A 1HS7A 2X9XA 2CLYB 3OBVE 4YJ3E 3BQLA 2DLRA 3PUAA 1UX4A 3DP7A 2DI4A 1D1CA 2C5JA 3J7Yq 4X20E 3R84B 5L3DB 4J2CA 4QKNA 2XQYA 3UTKA 4ISTA 2XAHB 3CPZA 4DMWA 5JDQA 2K24A 4DMVA 1HFAA 1OWAA 3Q5XA 3K8PC 4F6RC 2L3LA 2X9HA 5JRCB 2ODUA 2ODVA 4L9IA 4O2AE 5LHHB 2N9DA 1G73A 4AQGA 1IAPA 2JJ9A 3PTRB 4EB6E 3UUMA 2C0SA 4EYYR 3ZMUB 4AI6A 4PK6A 3HI2A 5F3JA 3ZCIA 2UXNB 1LVFA 5AFUL 4QX7B 4AKIA 4EYUA 3CX8B 2LJLA 4PJJA 1S94A 3AA7B 5L3BB 2WMOA 2VKJA 2DWKA 3QUJA 4HKAA 5FMNA 3RRCA 3SWHA 4I55E 5LGUB 4ZOLE 1FIOA 2JMHA 2XUEA 1ZKEA 3N2GE 4O4HE 3CQXC 2UXXB 3N9QA 4O4IE 1B7TA 1X79A 2L9QA 4UF0A 5L3GB 2C5KT 3VHLA 5JVDE 3K3OA 4AQFC 3AA6B 4KBMB 2ACXA 1Y64B 3Q9DA 4BJMA 2RP4A 2HH7A 3FXEB 4P09A 2XTLA 2NW7A 1E1HB 3RYCE 1G8XA 4QXHB 4YLHA 4IE4A 2KNDA 2RA1A 4JUYA 2V7MA 4ZI3D 2VL8A 2C5IT 4XZCA 2LHRA 3HKBE 4U72A 5DQVA 5LJNA 2ZM8A 4H9QC 1HF8A 1SA0E 1EZ3A 2XAQB 3U78A 3CWZB 3BQIA 2ZM0A 5FXXA 3HL6A 3N9PA 2NTXA 2Z6EA 5L2LA 3VU7H 2MYSA 3ZC1A 1KK7A 1HX8A 1O3XA 1ZHCA 5GONE 5JDGA 2NWBA 3N5LA 3PE0A 3UT5E 3LK2B 1T98A 3C64A 4B6XA 2NW8A 2ZLYA 4DNDA 5CB4E 3VKHA 5JREA 2JPFA 3N2KE 2X0LB 3ZMTB 4WBNE 4XAXB 4DBRA 1WRDA 2NW9A 2XAFB 2A2FX 2LSGA 2YK0A 3UULA 2XAJB 3C4XA 3AAIA 4YHJA 3KBUA 4ZI2D 5LHGB 4PW8A 3ANWA 1MNDA 2G0UA 2QGSA 2V1DB 2P9BA 2WAUA 3JC6D 1YKEB 4A56A 2E9XB 3FBLA 1VRBA 5FXZA 2LE8A 5J2TE 3O1HA 4NUVA 3K3QC 2YU2A 3AAEB 4H9NC 2W61A 2VKOA 4JEHB 5FXWA 3ZEFB 2KXPB 3IBPA 4AKHA 2ES0A 4ZI3C 4KUMB 2KMFA 5BMVE 2CWOA 5JQGE 4UVAB 3N9OA 4GK5E 4O4LE 4UVBB 4V1Av 4ASKA 3I9WA 3M65A 3O9XA 2BZBA 4OHFA 2VASA 1BR2A 3N2OA 3PUSA 2B1EA 4GYSA 4UELA 2LSJA 2A72A 5L3FB 2KZ7B 4YJ2E 2PG8A 2DCFA 5JR9A 4M1PA 2D2SA 4IE5A 2Q9QA 2Q9QD 2CM0A 5HWXA 2DHRA 1ZEEA 2LSKA 5FXVA 2BVMA 2MBGA 4CXYA 1UCUA 3MXZA 4PJMA 3QC9A 2N2NA 3C4ZA 3FHNA 4YFSA 4KP3C 3KDSE 1D0ZA 4WNKA 3MK7C 4HGAA 2ZMAA 2V7KA 3CQGB 3EDVA 3ZN1B 4ERRA 3CX7B 3LBXA 5JDHA 3ETUA 3NBXX 1S35A 2D0TA 3ZJ1A 4IE7A 1D0XA 4DO0A 4N78D 3FB2A 5J2UE 4IHJE 4CI1B 4IIJE 2I59A 2E9XA 4C90A 2E9XD 3F31A 2N1GA 3OYZA 3RYHE 4AKRB 4ZI2C 4EZ4A 4BJNA 5E0OA 2KWHA 3RH3A 3RYIE 2X9YA 3JC6C 3AB3B 5LP6E 3VKGA 4HFVA 4L0RA 3RC8A 2EHOA 4QHOA 3SS1A 2EHOD 3N9NA 3UUNA 5LJMA 1IJ6A 4BA9A 2M67A 2CXDA 2W00A 5HXSA 4H9PC 3C50A 1H7CA 2WWUA 2X67A 4ILUA 4OYJA 3IF8B 3AAAB 2BDEA 4NUUA 2MTQA 3KV9A 5HXHA 4CQIA 3OKQA 4P0AA 3KV4A 5JDFA 5C8YE 1HTJF 4AXPA 2VKHA 4BAYB 5KDMC 1MMAA 2Y6XA 3RC3A 4ZS2A 5DABA 2YINA 4IGUA 3E08A 4PK4A 4UVCB 4UXNB 3ZYLA 5JR9C 1BR0A 2Q9QC 5LGTB 4MBQA 2DNXA 4OFZA 4ZI7E 2KINB 3ZYMA 4CZZB 4ADZA 2CEAA 4K0UA 1WYBA 3R6NA 4TX5A 3PU8A 4O2BE 3WAKA 2Y48B 4TUYE 5JRCA 3J9X1 3ZMVB 3AA0B 2VK9A 2A3DA 3OJAA 5J1GA 3CVRA 2V7LA 4CI3B 2K5BB 3ETVA 5IHYA 2LT3A 1ZV4X 3U3IA 2Y8DA 4EXTA 3ZMSB 2JRKA 2YEVC 3ZCJA 5FY1A 1V9DA 5JDNA 2CA5A 4PFPA 4XBFB 2CXLA 1D1AA 2E9XC 5LG4A 3BQKA 4L5GA 2YU1A 3ZN0B 4H9RC 4ZHQE 1FEWA 4WBOA 2XASB 4QXBB 3AA1B 1WLXA 3B57A 2HPJA 5LBQB 2MOZA 3I0QA 3C51A 1D0YA 1MMDA 1UX5A 2EHOC 5LYJE 5LHIB 3KBTA 4TZ4C 2X68A 3BK9A 3MACA 3SOLA 4PJNA 3DJBA 4O8SA 2H7OA 4TV8E 1YD8G 3GN5B 1US7B 3HKCE 3SRZA 4P0BA 4JLEA 3ESLA 3NZQA 4H63V 5LOVE 4IE6A 3H37A 3WAJA 1CUNA 2CLYC 3OYXA 4E7ZA 4TN7B 5HAXA 4GIWA 2JQQA 2K9AA 3LG7A 4HN9A 1QUUA 3C4WA 4PK5A 3MZKB 1U5PA 3O4XE 3H3AA 3KINB 2W62A 1OXZA 2CXFA 2KWIB 2XAGB 3N9MA 3E0ZA 4GYRA 3UFEA 5F8PA 3QK6A 5EK4A 5DJQC 4O4JE 2ZM2A 2D5UA 3ZLIA 5KX5E 1FMWA 5HXCA 1D1BA 3GA8A 3EVYA 5JH7E 1MIWA 3Q2MA 3A5XA 5LXTE 2IW5B 1LVKA 5KMGP 3WI3A 2OA5A 4GK0E 2IC9A 3ZMZB 5HYAA 2J1DG 4UEMA 2V7IA 3GMIA 1QSDA 1YKHB 2WBLA 4UIGA 5CA1E 1HG2A 4C91A 4G63A 4OYKA 3EDUA 5H6RB 1NAFA 3E22E 3RRWA 4UF0B 4Z8XA 4QX8B 3T8OA 1VOMA 4X1IE 4H63H 4CXXA 5FY0A 5LCYA 4PNIA 3I0OA 4AKLA 3W15B 3LK3B 5DQWA 4PFOA 5FNVE 4HE8A 5EK2A 3NRXA 5TAOA 1HG5A 1SHZC 5LGNB 1Z0PA 3KVAA 2H3RA 4X1KE 2CWYA 3CKDA 4MHCA 4PJLA 5CA0E 3Q5WA 4KMCA 5FY7A 4QWNB 3ZPOA 4HTEA 2LOSA 2WSSV 2CCQA 1U4QA 3CX6B 3PDYA 3UUXB 2KLQA 5EZYE 5LBMA 5EK3A 3L3PA 1AJ3A 4IDZA 3PUGA 3F57A 3NZPA 5HWYA 5LA6E 3FXDB 3I1AA 2IC6A 1MMGA 3TKLB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QWN B;  4QX7 B;  4QXH B;  4TN7 B;  4QXB B;  4QXC B;  4QX8 B; 
#chains in the Genus database with same CATH topology
 2R6G F;  3LK4 2;  3P4R A;  4GKK T;  5IWA T;  2ACZ A;  5FKY A;  2PFV A;  3ZST A;  4H9O C;  2MAW A;  4PAG A;  4U2Y A;  3LSV A;  2E8I A;  4LMJ A;  4TV9 E;  4JBW F;  1XMO T;  2LOP A;  1JNZ A;  3ZJ2 A;  4UV9 B;  3RX6 A;  4K0K T;  5KXJ A;  2VKD A;  1IZN B;  4QXC B;  2V7J A;  4P1N A;  3AEF A;  5JR9 B;  2VL0 A;  2XM2 A;  4ANJ A;  4I43 B;  3UU4 A;  5FP3 A;  1FJG T;  3P8C D;  2PJQ A;  3AVR A;  3VRB A;  2V26 A;  5CGM A;  4E7S A;  2WQY A;  3P4W A;  4X5T A;  4JEU B;  3KV5 A;  3RYF E;  2QA7 A;  2WMN A;  4JI3 T;  3HR0 A;  1N33 T;  2VB6 A;  3O1J A;  4B3R T;  2V5C A;  4I50 E;  2BKP A;  3N9L A;  4JI1 T;  4HFC A;  1W09 A;  1HCI A;  2IDO B;  3FBZ A;  1NWM X;  2CMR A;  3GN5 A;  5FYM A;  3AEB A;  4IT4 A;  2DLR A;  3J7Y q;  2V6Y B;  4QKN A;  3OTO T;  3RLF F;  1OWA A;  3Q5X A;  2L3L A;  4AQG A;  2C0S A;  2W67 A;  2QYW A;  3CX8 B;  2JQH A;  3QUJ A;  2J47 A;  3SWH A;  4I55 E;  5LGU B;  3PUZ F;  2UXX B;  5L3G B;  3QB5 A;  1Y64 B;  3Q9D A;  4WYV A;  4B3S T;  1E1H B;  3RYC E;  1G8X A;  4QXH B;  2KND A;  2RA1 A;  4JUY A;  5HEG A;  2C5I T;  4XZC A;  2LHR A;  3HKB E;  5LJN A;  2BKN A;  1SA0 E;  2XAQ B;  3CWZ B;  5AQK B;  1KK7 A;  1HX8 A;  5AQV B;  3N5L A;  2XQ8 A;  1T98 A;  5L4H A;  1N32 T;  2ZLY A;  5CB4 E;  4WBN E;  1WRD A;  1UUR A;  2XAF B;  1T8B A;  2LSG A;  3UUL A;  2IUB A;  3G06 A;  1M62 A;  4ZI2 D;  4NXM T;  1MND A;  3L39 A;  2P9B A;  4B3M T;  4A56 A;  2E9X B;  3AAE B;  2W61 A;  4DV7 T;  2KXP B;  4AKH A;  5AQR B;  4ZI3 C;  4KUM B;  4U31 A;  4DV6 T;  4GK5 E;  4UVB B;  2XQ9 A;  3M65 A;  3RIF A;  1XNR T;  5J0Z A;  2LSJ A;  2KZ7 B;  3AEE A;  4YJ2 E;  3QNU A;  3B5M A;  4IE5 A;  2Q9Q D;  2LSK A;  4UR9 A;  1D0Z A;  5FVL A;  3MK7 C;  4AIU A;  2E5V A;  3CX7 B;  2J4G A;  3RF1 A;  1XNQ T;  2WWV A;  3FB2 A;  5J2U E;  2E9X D;  2N1G A;  4AKR B;  3RYH E;  3RH3 A;  3RYI E;  2EHO A;  5LMU T;  5LJM A;  3AE2 A;  5F5W A;  3CK6 A;  2XY8 B;  2WWU A;  2X67 A;  2BDE A;  2VUR A;  5JDF A;  2W4X A;  5LB7 B;  4AXP A;  1MMA A;  3RC3 A;  4ILC A;  1W0B A;  4DV2 T;  5DAB A;  4IGU A;  3E08 A;  4UVC B;  4UXN B;  1BR0 A;  4MBQ A;  2KIN B;  4CZZ B;  4TX5 A;  2Y48 B;  4TUY E;  5JRC A;  4KHZ F;  4AQY T;  2A3D A;  2FJE A;  2XQ3 A;  4LFC T;  4OX9 T;  5AQI B;  2Y8D A;  3ZCJ A;  4CN6 A;  1V9D A;  4CN1 A;  3AEC A;  3JCF A;  5LG4 A;  4HFB A;  4L5G A;  3ZN0 B;  4ZHQ E;  3B57 A;  1D0Y A;  5LYJ E;  1HR0 T;  2VVS A;  3ONL C;  4AIS A;  2HN2 A;  2HHH T;  3PJA A;  3UQ7 A;  3JAD A;  4O8S A;  2XQ6 A;  3GN5 B;  1US7 B;  3UU5 A;  2V6X A;  4ZXL A;  2CLY C;  3AE4 A;  2M6B A;  5HAX A;  5HCJ A;  4HN9 A;  4Z90 A;  2CXF A;  4IDN A;  3N9M A;  4GYR A;  5LG3 A;  2B76 A;  2LKG A;  4O4J E;  3EVY A;  2IW5 B;  1LVK A;  5KMG P;  4DR5 T;  2OA5 A;  3ZMZ B;  4UIG A;  1L0V A;  4QX8 B;  2H89 A;  3RQW A;  1N36 T;  4PNI A;  1J5W A;  5EK2 A;  5AQQ B;  3ABV A;  2UUC T;  1Z0P A;  2H3R A;  2IHR 1;  4MHC A;  3RIU C;  5CA0 E;  4QWN B;  2CCQ A;  3UUX B;  2M6I A;  3PUG A;  3NZP A;  5HWY A;  5LA6 E;  1MMG A;  3TKL B;  3VRA A;  2VWA A;  5JDM A;  3LJC A;  4G2A A;  1WR6 A;  3PUQ A;  4LF9 T;  2KSR A;  4ISS A;  2ZM6 T;  2YDQ A;  4X65 T;  3I9Y A;  3DTO A;  3MKD A;  4HEA A;  1BR1 A;  2AE9 A;  2K48 A;  3NRY A;  4DR2 T;  2L8K A;  4ZS3 A;  5L3C B;  1LRZ A;  5ABG A;  2F4V T;  2W63 A;  3RPU A;  3IHR A;  3QOF A;  1LKX A;  4U2Z A;  4CXW A;  3UU3 A;  3ZYK A;  4DBQ A;  4FI5 A;  4LMK A;  2PBI A;  3PU3 A;  2BG9 E;  4IDO A;  3AE9 A;  2WB5 A;  3OVU A;  3AEA A;  2D0U A;  4EOZ B;  3GWH A;  3ONX A;  1XMQ T;  2XZE A;  5HXE A;  2EHO B;  3S4U A;  3F2E A;  5ADX L;  3AVS A;  1WYC A;  2LHN A;  2LSI A;  4HWF A;  1WR0 A;  2BS3 A;  4MAL A;  4FJO A;  3HKE E;  4X64 T;  2KT9 A;  4YJ3 E;  3PUA A;  1UX4 A;  2D9D A;  3R84 B;  3RGL A;  4J2C A;  4IST A;  3CPZ A;  4DMV A;  1HFA A;  5JRC B;  2NR4 A;  3K8P C;  4A97 A;  2X9H A;  2ODU A;  4L9I A;  4O2A E;  3RKG A;  5LHH B;  5AQF B;  1G73 A;  4NPP A;  2JJ9 A;  4EB6 E;  4EYY R;  3P50 A;  2IIU A;  4AI6 A;  4PK6 A;  5F3J A;  1WCR A;  5AFU L;  2LJL A;  4PJJ A;  1S94 A;  3AA7 B;  2WMO A;  3JAE A;  1W0A A;  2VKJ A;  5FMN A;  2I6H A;  2JMH A;  2BS2 A;  4YTN A;  3L8R A;  2WCA A;  4UF0 A;  2C5K T;  3AA6 B;  2HH7 A;  3FXE B;  2NW7 A;  5AQG B;  4IE4 A;  4QH1 A;  5DQV A;  4H9Q C;  3AE8 A;  4EED A;  4DR7 T;  5BR8 T;  2LRL A;  3SFE A;  3N9P A;  2NTX A;  3ZC1 A;  2MYS A;  1O3X A;  1SUM B;  1ZHC A;  3PE0 A;  3C64 A;  5ABF A;  4B3T T;  4DV5 T;  2FJA A;  4DBR A;  2NW9 A;  2A2F X;  2H88 A;  2XAJ B;  3C4X A;  1KFY A;  5HEH A;  2CBI A;  5LHG B;  1OED A;  3ANW A;  2PTF A;  2QGS A;  2WAU A;  3JC6 D;  1YKE B;  4X66 T;  4YHH T;  5J2T E;  4HWD A;  4NUV A;  2YU2 A;  4H9N C;  5FXW A;  4JEH B;  2KMF A;  5BMV E;  4UVA B;  4O4L E;  2XJ7 A;  4V1A v;  4ASK A;  3I9W A;  4OHF A;  2VAS A;  1YQ3 A;  3AEG A;  3N2O A;  4GYS A;  2A72 A;  4QH5 A;  4M1P A;  2D2S A;  2WZH A;  2OV9 A;  5FXV A;  2BVM A;  4CXY A;  4PJM A;  3C4Z A;  4KP3 C;  3NVO A;  2BS4 A;  4WNK A;  5LMN T;  2X0H A;  2ZMA A;  4Z91 A;  3EDV A;  5L4E A;  2AXD S;  1S35 A;  3ZJ1 A;  2HN1 A;  4IE7 A;  1D0X A;  2WU5 A;  4CI1 B;  2I59 A;  4ZI2 C;  5E0O A;  5FVK A;  4LF7 T;  5LP6 E;  4L0R A;  5AQP B;  4HFI A;  2WZI A;  5AQJ B;  1IJ6 A;  1HX1 B;  2M67 A;  2CXD A;  4ILU A;  3IF8 B;  3AAA B;  4NUU A;  5HXH A;  1DU2 A;  3OKQ A;  1HTJ F;  5HCM A;  4YSX A;  2Q9Q C;  4ZI7 E;  2DNX A;  4ADZ A;  3R6N A;  1WYB A;  2BBH A;  2QVA A;  3PU8 A;  3WAK A;  3AA0 B;  5J1G A;  3CVR A;  2V7L A;  4TNW A;  3ZMS B;  5FY1 A;  2XPK A;  3FZF B;  3ZSS A;  3OPC A;  4PFP A;  2CXL A;  2E9X C;  4DR1 T;  5ABE A;  1FEW A;  2XAS B;  1XDP A;  5LBQ B;  4YXD A;  3VR8 A;  4DID B;  3SOL A;  4PJN A;  3Q5D A;  2H7O A;  4TV8 E;  1YD8 G;  1T7S A;  2XSA A;  3HKC E;  4IL9 A;  2X0Y A;  1UK5 A;  3NZQ A;  2JQK A;  4H63 V;  4E7Z A;  4TNV A;  4TN7 B;  3RIU A;  4GIW A;  2JQQ A;  3PJA J;  2K9A A;  2LM2 A;  2XQ7 A;  4U7I A;  4QH4 A;  4JYA T;  3H3A A;  2W62 A;  4NXN T;  1OXZ A;  2KWI B;  1W9R A;  4DV3 T;  4HFD A;  5F8P A;  3RI5 A;  3QK6 A;  2XQ5 A;  4NIQ A;  5DJQ C;  2D5U A;  1D1B A;  3GA8 A;  5JH7 E;  3Q2M A;  3A5X A;  5CFB A;  5HEJ A;  2IC9 A;  3AE3 A;  4UEM A;  2V7I A;  3ONJ A;  4G63 A;  1NAF A;  4UF0 B;  4X1I E;  4H63 H;  5LCY A;  4PFO A;  3P4Q A;  1SHZ C;  4X1K E;  4PJL A;  2LRK A;  4KMC A;  4HWH A;  2WSS V;  3PDY A;  5EZY E;  4IDZ A;  2FJB A;  4YSZ A;  2CBJ A;  1T72 A;  4WW0 A;  4A98 A;  5ABF B;  2FUP A;  4EZH A;  3PUX F;  1I94 T;  5A1L A;  4COF A;  1I6Z A;  1OED B;  4AKG A;  3EUH A;  3Q5E A;  3ANW B;  4LML A;  3AED A;  5IUX A;  1KNZ A;  3K3N A;  4U74 A;  2SPC A;  2WDR A;  2LEH A;  3KFW X;  3A7M A;  1NEK A;  2BVL A;  4IE0 A;  2WM9 A;  2I0M A;  1FMV A;  2LM9 A;  2W0G A;  3HKD E;  2NOX A;  5H6Q B;  1HNW T;  2X51 A;  3EI0 A;  4JI0 T;  2YDS A;  3MA9 A;  2IAK A;  2H7V C;  1MIY A;  4MLK A;  3C98 B;  5HXR A;  3LFM A;  4OK0 A;  1KNR A;  5HEO A;  2XQA A;  2IML A;  4EGW A;  3MJX A;  2X66 A;  2X9W A;  2V5D A;  5LNK A;  3AE7 A;  2YOE A;  3B13 A;  1IJ5 A;  3KV6 A;  4EAH A;  4IDP A;  3V5S A;  4JI6 T;  1M7K A;  4H9S E;  3TLS A;  3CML A;  1BR4 A;  2DWG A;  4I0U A;  4GOU A;  1HS7 A;  2X9X A;  2CLY B;  3OBV E;  3BQL A;  1D1C A;  2C5J A;  1HNX T;  4X20 E;  3FZM B;  4DUY T;  3UTK A;  5JDQ A;  4F6R C;  2ODV A;  2N9D A;  4JI5 T;  4U33 A;  1JNR A;  3ZMU B;  2UXN B;  4EYU A;  2UXD T;  5L3B B;  5CJ5 A;  3FZH B;  4TWF A;  3RRC A;  4ZOL E;  1FIO A;  4O4H E;  3N9Q A;  4O4I E;  1X79 A;  3VHL A;  4AQF C;  2ACX A;  1R8I A;  3AE6 A;  2RP4 A;  1XDO A;  2XTL A;  4ZZC A;  4JI8 T;  1ZOY A;  4U72 A;  2ZM8 A;  1HF8 A;  1EZ3 A;  3U78 A;  3BQI A;  2ZM0 A;  2QRX A;  5FXX A;  4DR4 T;  3HL6 A;  3VU7 H;  3NKZ A;  3ZT5 A;  1SE7 A;  3M3Z B;  1IBL T;  4B6X A;  2JIW A;  3N2K E;  3TLT A;  4XAX B;  1HNZ T;  2XSB A;  3AAI A;  3KBU A;  2BG9 C;  2G0U A;  2V1D B;  4YTM A;  2LE8 A;  3ZEF B;  3IBP A;  2UXB T;  4IDQ A;  4GKJ T;  2CWO A;  5JQG E;  3N9O A;  3O9X A;  2B1E A;  5L3F B;  4ZEY A;  2PG8 A;  2DCF A;  2Q9Q A;  3FZL B;  2CHN A;  2A9U A;  1ZEE A;  2MBG A;  3QC9 A;  3FHN A;  2WDV A;  3TLV A;  2WU2 A;  1VCS A;  4HGA A;  3CQG B;  3ZN1 B;  4ERR A;  1IBM T;  3LBX A;  4JI7 T;  5JDH A;  5AQT B;  1J5E T;  4KI0 F;  2E9X A;  3OYZ A;  4BJN A;  1KF6 A;  2KWH A;  2X9Y A;  3JC6 C;  3AB3 B;  3VKG A;  3RC8 A;  4QHO A;  3SS1 A;  2EHO D;  1XZY A;  3N9N A;  2V8S V;  3PUV F;  4H9P C;  1H7C A;  4CQI A;  4P0A A;  3ZT6 A;  4BAY B;  3ZKR A;  5KDM C;  2Y6X A;  2CPT A;  5AQH B;  1X9B A;  4EV6 A;  3ZYL A;  5JR9 C;  4OFZ A;  2E2A A;  3RQU A;  4K0U A;  4O2B E;  3H3M A;  3ZMV B;  2VK9 A;  3OJA A;  5IHY A;  2LT3 A;  1ZV4 X;  5AQL B;  3UUB A;  3U3I A;  5JTG A;  5JDN A;  2CA5 A;  4QXB B;  1IBK T;  2HPJ A;  3I0Q A;  3C51 A;  1MMD A;  5LHI B;  2X68 A;  3BK9 A;  3MAC A;  1UGO A;  3SRZ A;  3ESL A;  5LOV E;  4IE6 A;  3WAJ A;  1CUN A;  3OYX A;  2VQF T;  2FBW A;  3LG7 A;  1QUU A;  3C4W A;  4PK5 A;  3MZK B;  1KEY A;  2UXC T;  4YTP A;  5C2T A;  3E0Z A;  4IL4 A;  2ZM2 A;  5KX5 E;  3ZLI A;  1FMW A;  3LDQ B;  5HXC A;  4EEB A;  3WI3 A;  3EAB A;  3GMI A;  3ZT7 A;  4OYK A;  5H6R B;  3E22 E;  2W66 A;  3T8O A;  2YKS A;  5AQU B;  5FY0 A;  4DV4 T;  4AKL A;  3LK3 B;  3CIR A;  4DV1 T;  1HG5 A;  5LGN B;  3VR9 A;  3KVA A;  5FL0 A;  2CWY A;  3CKD A;  1NEN A;  5FY7 A;  3ZPO A;  4HTE A;  4TWD A;  5C3J A;  2E5L T;  5EK3 A;  3F57 A;  3I1A A;  4DR3 T;  1VCT A;  5ETW A;  3IEE A;  4MFR A;  4HFE A;  1MNE A;  1YW0 A;  4X1Y E;  1MIV A;  1YXR A;  1J1J A;  3KVB A;  2JMK A;  4YY3 T;  2FJD A;  5IYZ E;  4UV8 B;  1MMN A;  3O1I A;  4EIW A;  4DVD A;  3RHW A;  5JDL A;  2GK9 A;  2HPL A;  5L3E B;  4JV5 T;  2NP9 A;  2WP9 A;  2Q9Q B;  2K3W A;  3HA4 A;  3CQC B;  4I4T E;  4WZX A;  2CHO A;  3RKO A;  5M4Y A;  2NTY A;  4KX6 A;  3ZC0 A;  2CE7 A;  3L09 A;  3TLU A;  4ILA A;  3D0T A;  3LBX B;  3AXJ A;  4DR6 T;  3PUR A;  3AE5 A;  2LSY A;  2XHE B;  1XWM A;  4HWC A;  5AQO B;  2YDR A;  2WDQ A;  3P7I A;  4CI2 B;  2UUA T;  5HEU A;  4AQF A;  4ILB A;  1UUS A;  1GQE A;  3V5U A;  2OLT A;  3IA3 A;  3DP7 A;  2DI4 A;  3FZK B;  5L3D B;  3RIA A;  2XQY A;  2XAH B;  4DMW A;  2K24 A;  1N34 T;  3UU6 A;  2MPK A;  5FL1 A;  1IAP A;  3PTR B;  3UUM A;  3HI2 A;  1OED C;  3ZCI A;  1KNP A;  1LVF A;  4QX7 B;  4AKI A;  4LF4 T;  1OED E;  3UQ4 A;  2DWK A;  4HKA A;  2UU9 T;  2XUE A;  3N2G E;  1ZKE A;  3CQX C;  2BG9 A;  2XQ4 A;  1B7T A;  2L9Q A;  5JVD E;  3T1H T;  3K3O A;  1WFD A;  4KBM B;  4BJM A;  3JAF A;  4P09 A;  4YLH A;  4DV0 T;  2V7M A;  4ZI3 D;  2VL8 A;  4KHP T;  5AQN B;  2Z6E A;  5L2L A;  3X1D A;  5GON E;  5JDG A;  2NWB A;  3UT5 E;  3LK2 B;  2NW8 A;  4DND A;  1E2A A;  3VKH A;  5JRE A;  2JPF A;  2X0L B;  3ZMT B;  5AQM B;  2YK0 A;  4YHJ A;  4PW8 A;  4X62 T;  2LKH A;  2WY2 A;  3FBL A;  1VRB A;  5FXZ A;  3O1H A;  3K3Q C;  4TWH A;  2VKO A;  2ES0 A;  4A5X A;  2BZB A;  1BR2 A;  2CRB A;  3PUS A;  4HFH A;  3A8Y C;  4UEL A;  5JR9 A;  4LF5 T;  5ABH A;  2CM0 A;  5HWX A;  2DHR A;  2YN6 A;  1UCU A;  3MXZ A;  2N2N A;  4YFS A;  3KDS E;  2V7K A;  2JQ9 A;  2RPA A;  3ETU A;  3NBX X;  2D0T A;  4DO0 A;  4N78 D;  3AE1 A;  2WS3 A;  4IHJ E;  4CN4 A;  4IIJ E;  4C90 A;  4HWI B;  3F31 A;  4EZ4 A;  4HFV A;  3NWI A;  2BKO A;  3EAM A;  3UUN A;  4BA9 A;  5HXS A;  2W00 A;  3C50 A;  4OYJ A;  2MTQ A;  3KV9 A;  3KV4 A;  5C8Y E;  2VKH A;  2XM1 A;  3PUY F;  4ZS2 A;  3EHZ A;  2YIN A;  4PK4 A;  5LGT B;  4LF6 T;  3ZYM A;  4JI4 T;  2CEA A;  2V6Y A;  3P4S A;  1Y01 A;  3J9X 1;  3AXJ B;  4CI3 B;  3P4P A;  2K5B B;  2DL1 A;  2BBJ A;  3ETV A;  2J62 A;  4F8H A;  4EXT A;  2JRK A;  2YEV C;  4XBF B;  1D1A A;  4ZZB A;  4LFB T;  3BQK A;  4U7Y A;  2YU1 A;  4H9R C;  4WBO A;  1E7P A;  3AA1 B;  1WLX A;  2MOZ A;  1UX5 A;  3UU8 A;  2EHO C;  3KBT A;  4TZ4 C;  2LLY A;  4Q25 A;  3DJB A;  4YT0 A;  1YQ4 A;  4P0B A;  4JLE A;  4JI2 T;  3H37 A;  3UFG A;  5AQS B;  4DUZ T;  1Z8U A;  1ZP0 A;  1U5P A;  3O4X E;  3KIN B;  2XAG B;  3T1Y T;  3UFE A;  2W2U A;  3QB5 K;  5EK4 A;  2UUB T;  1MIW A;  5LXT E;  4GK0 E;  2VVN A;  5HYA A;  2J1D G;  4IRE A;  5CA1 E;  1QSD A;  1YKH B;  2BG9 B;  2WBL A;  1HG2 A;  4C91 A;  3EDU A;  3PV0 F;  3RRW A;  4Z8X A;  4LFA T;  1VOM A;  1CHU A;  1QLB A;  4CXX A;  3TLW A;  3I0O A;  3W15 B;  5DQW A;  3SFD A;  5FNV E;  4HE8 A;  3NRX A;  5TAO A;  4YSY A;  3K1S A;  3Q5W A;  2VQE T;  2LOS A;  4LF8 T;  1U4Q A;  3CX6 B;  4U3C A;  2KLQ A;  5LBM A;  5L47 A;  3PUW F;  3L3P A;  1AJ3 A;  3FXD B;  2IC6 A; 
#chains in the Genus database with same CATH homology
 2VWA A;  5JDM A;  4EZH A;  5ETW A;  3IEE A;  3LK4 2;  4MFR A;  1MNE A;  1YW0 A;  4X1Y E;  1MIV A;  5A1L A;  3LJC A;  4G2A A;  2PFV A;  1WR6 A;  4H9O C;  3PUQ A;  4AKG A;  3EUH A;  4ISS A;  4PAG A;  3ANW B;  4WW0 A;  3KVB A;  2JMK A;  2E8I A;  4TV9 E;  3I9Y A;  1KNZ A;  3K3N A;  4U74 A;  5IYZ E;  2SPC A;  3DTO A;  4UV8 B;  1MMN A;  3MKD A;  3O1I A;  4EIW A;  2LEH A;  2LOP A;  3KFW X;  4DVD A;  3ZJ2 A;  4UV9 B;  3RX6 A;  5JDL A;  2GK9 A;  2HPL A;  5L3E B;  4HEA A;  1BR1 A;  2VKD A;  2K48 A;  2BVL A;  4IE0 A;  2WM9 A;  1IZN B;  3NRY A;  1FMV A;  2LM9 A;  2NP9 A;  2L8K A;  4QXC B;  2V7J A;  2W0G A;  5JR9 B;  3HKD E;  4ZS3 A;  5L3C B;  2Q9Q B;  4ANJ A;  4I43 B;  3HA4 A;  2NOX A;  1LRZ A;  3CQC B;  4I4T E;  5H6Q B;  2X51 A;  2W63 A;  3RPU A;  3IHR A;  5FP3 A;  3P8C D;  3MA9 A;  2IAK A;  1LKX A;  2H7V C;  2PJQ A;  3AVR A;  1MIY A;  2V26 A;  3RKO A;  5M4Y A;  2NTY A;  4CXW A;  4E7S A;  3ZC0 A;  2CE7 A;  4JEU B;  4MLK A;  3L09 A;  3C98 B;  3ZYK A;  3D0T A;  3LBX B;  4DBQ A;  4FI5 A;  3KV5 A;  5HXR A;  3LFM A;  4OK0 A;  3RYF E;  2PBI A;  2QA7 A;  3PUR A;  2WMN A;  2X66 A;  2LSY A;  3MJX A;  2X9W A;  2XHE B;  3PU3 A;  5LNK A;  3B13 A;  3HR0 A;  1IJ5 A;  2D0U A;  3GWH A;  2VB6 A;  3KV6 A;  4EOZ B;  3ONX A;  3O1J A;  4EAH A;  3V5S A;  4H9S E;  4I50 E;  5HXE A;  2EHO B;  3P7I A;  3N9L A;  3S4U A;  3F2E A;  4CI2 B;  3CML A;  1BR4 A;  5ADX L;  3AVS A;  1WYC A;  4AQF A;  2LHN A;  2LSI A;  1HCI A;  2DWG A;  3FBZ A;  1NWM X;  4MAL A;  2CMR A;  3GN5 A;  3V5U A;  5FYM A;  4FJO A;  3HKE E;  4GOU A;  2KT9 A;  1HS7 A;  2X9X A;  2CLY B;  3OBV E;  4YJ3 E;  3BQL A;  2DLR A;  3PUA A;  1UX4 A;  3DP7 A;  2DI4 A;  1D1C A;  2C5J A;  3J7Y q;  4X20 E;  3R84 B;  5L3D B;  4J2C A;  4QKN A;  2XQY A;  3UTK A;  4IST A;  2XAH B;  3CPZ A;  4DMW A;  5JDQ A;  2K24 A;  4DMV A;  1HFA A;  1OWA A;  3Q5X A;  3K8P C;  4F6R C;  2L3L A;  2X9H A;  5JRC B;  2ODU A;  2ODV A;  4L9I A;  4O2A E;  5LHH B;  2N9D A;  1G73 A;  4AQG A;  1IAP A;  2JJ9 A;  3PTR B;  4EB6 E;  3UUM A;  2C0S A;  4EYY R;  3ZMU B;  4AI6 A;  4PK6 A;  3HI2 A;  5F3J A;  3ZCI A;  2UXN B;  1LVF A;  5AFU L;  4QX7 B;  4AKI A;  4EYU A;  3CX8 B;  2LJL A;  4PJJ A;  1S94 A;  3AA7 B;  5L3B B;  2WMO A;  2VKJ A;  2DWK A;  3QUJ A;  4HKA A;  5FMN A;  3RRC A;  3SWH A;  4I55 E;  5LGU B;  4ZOL E;  1FIO A;  2JMH A;  2XUE A;  1ZKE A;  3N2G E;  4O4H E;  3CQX C;  2UXX B;  3N9Q A;  4O4I E;  1B7T A;  1X79 A;  2L9Q A;  4UF0 A;  5L3G B;  2C5K T;  3VHL A;  5JVD E;  3K3O A;  4AQF C;  3AA6 B;  4KBM B;  2ACX A;  1Y64 B;  3Q9D A;  4BJM A;  2RP4 A;  2HH7 A;  3FXE B;  4P09 A;  2XTL A;  2NW7 A;  1E1H B;  3RYC E;  1G8X A;  4QXH B;  4YLH A;  4IE4 A;  2KND A;  2RA1 A;  4JUY A;  2V7M A;  4ZI3 D;  2VL8 A;  2C5I T;  4XZC A;  2LHR A;  3HKB E;  4U72 A;  5DQV A;  5LJN A;  2ZM8 A;  4H9Q C;  1HF8 A;  1SA0 E;  1EZ3 A;  2XAQ B;  3U78 A;  3CWZ B;  3BQI A;  2ZM0 A;  5FXX A;  3HL6 A;  3N9P A;  2NTX A;  2Z6E A;  5L2L A;  3VU7 H;  2MYS A;  3ZC1 A;  1KK7 A;  1HX8 A;  1O3X A;  1ZHC A;  5GON E;  5JDG A;  2NWB A;  3N5L A;  3PE0 A;  3UT5 E;  3LK2 B;  1T98 A;  3C64 A;  4B6X A;  2NW8 A;  2ZLY A;  4DND A;  5CB4 E;  3VKH A;  5JRE A;  2JPF A;  3N2K E;  2X0L B;  3ZMT B;  4WBN E;  4XAX B;  4DBR A;  1WRD A;  2NW9 A;  2XAF B;  2A2F X;  2LSG A;  2YK0 A;  3UUL A;  2XAJ B;  3C4X A;  3AAI A;  4YHJ A;  3KBU A;  4ZI2 D;  5LHG B;  4PW8 A;  3ANW A;  1MND A;  2G0U A;  2QGS A;  2V1D B;  2P9B A;  2WAU A;  3JC6 D;  1YKE B;  4A56 A;  2E9X B;  3FBL A;  1VRB A;  5FXZ A;  2LE8 A;  5J2T E;  3O1H A;  4NUV A;  3K3Q C;  2YU2 A;  3AAE B;  4H9N C;  2W61 A;  2VKO A;  4JEH B;  5FXW A;  3ZEF B;  2KXP B;  3IBP A;  4AKH A;  2ES0 A;  4ZI3 C;  4KUM B;  2KMF A;  5BMV E;  2CWO A;  5JQG E;  4UVA B;  3N9O A;  4GK5 E;  4O4L E;  4UVB B;  4V1A v;  4ASK A;  3I9W A;  3M65 A;  3O9X A;  2BZB A;  4OHF A;  2VAS A;  1BR2 A;  3N2O A;  3PUS A;  2B1E A;  4GYS A;  4UEL A;  2LSJ A;  2A72 A;  5L3F B;  2KZ7 B;  4YJ2 E;  2PG8 A;  2DCF A;  5JR9 A;  4M1P A;  2D2S A;  4IE5 A;  2Q9Q A;  2Q9Q D;  2CM0 A;  5HWX A;  2DHR A;  1ZEE A;  2LSK A;  5FXV A;  2BVM A;  2MBG A;  4CXY A;  1UCU A;  3MXZ A;  4PJM A;  3QC9 A;  2N2N A;  3C4Z A;  3FHN A;  4YFS A;  4KP3 C;  3KDS E;  1D0Z A;  4WNK A;  3MK7 C;  4HGA A;  2ZMA A;  2V7K A;  3CQG B;  3EDV A;  3ZN1 B;  4ERR A;  3CX7 B;  3LBX A;  5JDH A;  3ETU A;  3NBX X;  1S35 A;  2D0T A;  3ZJ1 A;  4IE7 A;  1D0X A;  4DO0 A;  4N78 D;  3FB2 A;  5J2U E;  4IHJ E;  4CI1 B;  4IIJ E;  2I59 A;  2E9X A;  4C90 A;  2E9X D;  3F31 A;  2N1G A;  3OYZ A;  3RYH E;  4AKR B;  4ZI2 C;  4EZ4 A;  4BJN A;  5E0O A;  2KWH A;  3RH3 A;  3RYI E;  2X9Y A;  3JC6 C;  3AB3 B;  5LP6 E;  3VKG A;  4HFV A;  4L0R A;  3RC8 A;  2EHO A;  4QHO A;  3SS1 A;  2EHO D;  3N9N A;  3UUN A;  5LJM A;  1IJ6 A;  4BA9 A;  2M67 A;  2CXD A;  2W00 A;  5HXS A;  4H9P C;  3C50 A;  1H7C A;  2WWU A;  2X67 A;  4ILU A;  4OYJ A;  3IF8 B;  3AAA B;  2BDE A;  4NUU A;  2MTQ A;  3KV9 A;  5HXH A;  4CQI A;  3OKQ A;  4P0A A;  3KV4 A;  5JDF A;  5C8Y E;  1HTJ F;  4AXP A;  2VKH A;  4BAY B;  5KDM C;  1MMA A;  2Y6X A;  3RC3 A;  4ZS2 A;  5DAB A;  2YIN A;  4IGU A;  3E08 A;  4PK4 A;  4UVC B;  4UXN B;  3ZYL A;  5JR9 C;  1BR0 A;  2Q9Q C;  5LGT B;  4MBQ A;  2DNX A;  4OFZ A;  4ZI7 E;  2KIN B;  3ZYM A;  4CZZ B;  4ADZ A;  2CEA A;  4K0U A;  1WYB A;  3R6N A;  4TX5 A;  3PU8 A;  4O2B E;  3WAK A;  2Y48 B;  4TUY E;  5JRC A;  3J9X 1;  3ZMV B;  3AA0 B;  2VK9 A;  2A3D A;  3OJA A;  5J1G A;  3CVR A;  2V7L A;  4CI3 B;  2K5B B;  3ETV A;  5IHY A;  2LT3 A;  1ZV4 X;  3U3I A;  2Y8D A;  4EXT A;  3ZMS B;  2JRK A;  2YEV C;  3ZCJ A;  5FY1 A;  1V9D A;  5JDN A;  2CA5 A;  4PFP A;  4XBF B;  2CXL A;  1D1A A;  2E9X C;  5LG4 A;  3BQK A;  4L5G A;  2YU1 A;  3ZN0 B;  4H9R C;  4ZHQ E;  1FEW A;  4WBO A;  2XAS B;  4QXB B;  3AA1 B;  1WLX A;  3B57 A;  2HPJ A;  5LBQ B;  2MOZ A;  3I0Q A;  3C51 A;  1D0Y A;  1MMD A;  1UX5 A;  2EHO C;  5LYJ E;  5LHI B;  3KBT A;  4TZ4 C;  2X68 A;  3BK9 A;  3MAC A;  3SOL A;  4PJN A;  3DJB A;  4O8S A;  2H7O A;  4TV8 E;  1YD8 G;  3GN5 B;  1US7 B;  3HKC E;  3SRZ A;  4P0B A;  4JLE A;  3ESL A;  3NZQ A;  4H63 V;  5LOV E;  4IE6 A;  3H37 A;  3WAJ A;  1CUN A;  2CLY C;  3OYX A;  4E7Z A;  4TN7 B;  5HAX A;  4GIW A;  2JQQ A;  2K9A A;  3LG7 A;  4HN9 A;  1QUU A;  3C4W A;  4PK5 A;  3MZK B;  1U5P A;  3O4X E;  3H3A A;  3KIN B;  2W62 A;  1OXZ A;  2CXF A;  2KWI B;  2XAG B;  3N9M A;  3E0Z A;  4GYR A;  3UFE A;  5F8P A;  3QK6 A;  5EK4 A;  5DJQ C;  4O4J E;  2ZM2 A;  2D5U A;  3ZLI A;  5KX5 E;  1FMW A;  5HXC A;  1D1B A;  3GA8 A;  3EVY A;  5JH7 E;  1MIW A;  3Q2M A;  3A5X A;  5LXT E;  2IW5 B;  1LVK A;  5KMG P;  3WI3 A;  2OA5 A;  4GK0 E;  2IC9 A;  3ZMZ B;  5HYA A;  2J1D G;  4UEM A;  2V7I A;  3GMI A;  1QSD A;  1YKH B;  2WBL A;  4UIG A;  5CA1 E;  1HG2 A;  4C91 A;  4G63 A;  4OYK A;  3EDU A;  5H6R B;  1NAF A;  3E22 E;  3RRW A;  4UF0 B;  4Z8X A;  4QX8 B;  3T8O A;  1VOM A;  4X1I E;  4H63 H;  4CXX A;  5FY0 A;  5LCY A;  4PNI A;  3I0O A;  4AKL A;  3W15 B;  3LK3 B;  5DQW A;  4PFO A;  5FNV E;  4HE8 A;  5EK2 A;  3NRX A;  5TAO A;  1HG5 A;  1SHZ C;  5LGN B;  1Z0P A;  3KVA A;  2H3R A;  4X1K E;  2CWY A;  3CKD A;  4MHC A;  4PJL A;  5CA0 E;  3Q5W A;  4KMC A;  5FY7 A;  4QWN B;  3ZPO A;  4HTE A;  2LOS A;  2WSS V;  2CCQ A;  1U4Q A;  3CX6 B;  3PDY A;  3UUX B;  2KLQ A;  5EZY E;  5LBM A;  5EK3 A;  3L3P A;  1AJ3 A;  4IDZ A;  3PUG A;  3F57 A;  3NZP A;  5HWY A;  5LA6 E;  3FXD B;  3I1A A;  2IC6 A;  1MMG A;  3TKL B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...