4QX7B

Crystal structure of histone demethylase kdm2a-h3k36me2 with alpha-kg
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
68
structure length
68
Chain Sequence
QVHLTHFELEGLRCLVDKLESLPLHKKCVPTGIEDEDALIADVKILLEELASSDPKLALTGVPIVQWP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Lysine-specific demethylase 2A
publication title A molecular threading mechanism underlies Jumonji lysine demethylase KDM2A regulation of methylated H3K36.
pubmed doi rcsb
source organism Mus musculus
molecule tags Oxidoreductase/structural protein
total genus 19
structure length 68
sequence length 68
chains with identical sequence D
ec nomenclature ec 1.14.11.27: [Histone H3]-dimetyl-L-lysine-36 demethylase.
pdb deposition date 2014-07-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.2210 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4qx7B00
4QWNB 4QXHB 4QXCB 4QX8B 4QXBB 4TN7B 4QX7B
chains in the Genus database with same CATH superfamily
4AKGA 3UUNA 4MFRA 4A56A 4CXWA 4PFOA 3J9X1 2ZMAA 5IUXA 1HCIA 4JEHB 4L0RA 2BG9B 2BDEA 5AQSB 3J7Yq 1QSDA 2LM9A 2KLQA 4DV0T 2BS2A 1XDPA 3AE3A 3ETUA 2CBIA 3OTOT 2VL0A 4ADZA 1DU2A 5LB7B 5FY1A 4MHCA 3C4XA 2XQ4A 3FBLA 2QRXA 1SHZC 3O4XE 3OBVE 3ZMTB 3PDYA 3MXZA 4UVAB 2NTXA 1XWMA 5FL1A 2MYSA 3AECA 1D1AA 4OFZA 3ZMZB 2E9XA 4EYUA 1IBKT 2UUBT 2IDOB 3H3MA 2LT3A 4ZOLE 4LF8T 3Q5DA 1X9BA 1MMGA 3RLFF 4YSZA 2Q9QD 3R84B 2LHNA 4PK5A 2YDRA 5LP6E 4IE7A 5LG4A 3RI5A 4TV8E 3I9YA 3HL6A 2WDQA 2BBHA 1U5PA 2WS3A 5FVKA 4CI2B 3ZC1A 3VR9A 3ZCJA 4HTEA 2V7MA 4YJ3E 5AQRB 2ZM8A 3VRAA 2LSYA 3ZLIA 3AEBA 4AIUA 2IHR1 1LVKA 3JAEA 1YD8G 4XBFB 4O4LE 3CQCB 1IBMT 1T72A 3P4WA 1UX5A 2JQQA 5L3EB 4Z8XA 4G63A 4AXPA 4TV9E 2ODUA 4YFSA 5LBMA 5FY0A 4ILBA 4ILUA 4DNDA 4HE8A 3EDVA 3Q5XA 4O4JE 2N9DA 3KV9A 1HG2A 2LHRA 4CXXA 3JC6D 4GYRA 2W00A 2DLRA 3CX7B 4EZ4A 4IDPA 5HXRA 2KZ7B 3IEEA 3HKEE 2RPAA 4O2AE 3FB2A 1L0VA 5ETWA 5HEJA 1HS7A 1NAFA 2E2AA 2XSAA 5H6QB 3JAFA 2WMNA 4JI8T 3KINB 4AQGA 1WFDA 4HEAA 2XPKA 3LJCA 5FNVE 3N9NA 1XNQT 3N9LA 4IL4A 2CCQA 2WMOA 3LG7A 4B3MT 3E0ZA 4U7IA 4QKNA 2X66A 1M62A 4JBWF 4PAGA 4YTMA 4OYJA 5AQPB 4CZZB 2LRKA 5EK4A 4ZI7E 2ZM6T 2LEHA 2E5LT 4HFDA 4YLHA 2WM9A 2PJQA 4ILCA 1YQ4A 2AXDS 3RKGA 2JQ9A 2L9QA 4QH5A 3AB3B 4TN7B 4AKLA 4YJ2E 4IDQA 3Q5WA 3H37A 4H9SE 2BVLA 4DBRA 4J2CA 3ZYMA 4DV6T 3C50A 4B3ST 4P0AA 2XQ7A 4LFAT 3AE7A 4B3TT 5H6RB 2V26A 4GIWA 1VCTA 3N9QA 3O1IA 1IJ6A 4WW0A 2FUPA 3HR0A 3UUXB 2A9UA 4CXYA 4DUYT 2D0TA 2A72A 2CXLA 4BJMA 2VKJA 4HFHA 3I0OA 1NEKA 3WI3A 3VKGA 3RKOA 3K3QC 2DWGA 2PBIA 3AVRA 4XZCA 5KXJA 2UXNB 3B57A 4I50E 3KVAA 2J4GA 3LK2B 4OHFA 2JPFA 5LHGB 1HNXT 5AQHB 3T8OA 1G73A 1SA0E 3CVRA 2V7IA 2V6YB 3ESLA 2W4XA 2V7LA 2F4VT 4O4IE 3P7IA 4UV8B 5FY7A 1SE7A 2LRLA 5L3FB 4QH4A 4EYYR 1VCSA 4IE4A 4DVDA 5KDMC 3KVBA 1HG5A 3PUWF 2XQ8A 3AEFA 4ZEYA 4GK5E 2D0UA 1W0BA 2XQ3A 4WBNE 3R6NA 2A3DA 3P50A 4ZHQE 5HAXA 2DL1A 2XQAA 2YDSA 3ZEFB 4ISSA 2LOPA 3LK42 2CE7A 5ABEA 3UU3A 3NVOA 4KMCA 4HN9A 2YN6A 5ABFA 4IIJE 3PTRB 2KXPB 3MZKB 5LG3A 4TWHA 1UX4A 4HFEA 4HWFA 3RIAA 2WDRA 2ZM0A 1KEYA 3ZYLA 2XAHB 1ZP0A 4IDZA 3JCFA 1ZV4X 5JR9A 2W61A 3RC3A 3FZLB 5L3GB 4GKKT 2RA1A 2XQ9A 4ILAA 3UULA 3AE9A 3CMLA 3LDQB 3X1DA 2V1DB 4IE5A 2CHNA 2X0YA 2XAGB 2YEVC 3C51A 1KK7A 2KWHA 2BZBA 4A5XA 1CUNA 4NUUA 5JQGE 5FXZA 3ZT7A 5JH7E 2BBJA 3K3NA 4K0UA 5J2TE 3EDUA 3RGLA 3OYZA 3VR8A 3IF8B 3AE5A 3N9PA 3V5SA 3PV0F 4CI3B 3C98B 5J0ZA 4FI5A 5L3CB 3QB5K 3KBTA 2Y48B 5LOVE 3QB5A 2UXDT 1HTJF 2WY2A 3ZKRA 4KHPT 2HPJA 2E9XC 2Q9QB 4IE6A 3ZMUB 4ANJA 3QK6A 3PUQA 3HKBE 4JI5T 4HWHA 3LBXA 4CQIA 5ABGA 1MNEA 3MJXA 2LSGA 2KMFA 3RPUA 3ZT6A 4NXNT 1UUSA 1MMNA 4WBOA 5LJNA 3DP7A 2PG8A 3Q5EA 4MBQA 4LMJA 4LFCT 1E7PA 4JV5T 1W0AA 5AQFB 3TLVA 3KFWX 4LF6T 3QUJA 3TLWA 2HH7A 1WYCA 3JC6C 2UXXB 2FJBA 4Q25A 2RP4A 3LFMA 2XUEA 3CQXC 2WU5A 3CKDA 2NW8A 3KV4A 1MMAA 1OEDE 5FYMA 2AE9A 4P1NA 2CLYC 3Q2MA 5C8YE 4HFBA 2L8KA 2JMHA 1XMQT 2QYWA 3RRCA 4H63V 4EEDA 3F2EA 1MIVA 1T8BA 2W63A 2VURA 3I1AA 1KNRA 4F8HA 4DR6T 3U78A 1FJGT 1N32T 5GONE 4IT4A 2LOSA 2KT9A 2YINA 4HKAA 3SFEA 4DV2T 3ONXA 3BQKA 5DQVA 5LJMA 5JREA 2HN1A 1IZNB 4BAYB 2CBJA 2CLYB 4WYVA 3VU7H 2D2SA 4DR7T 3GA8A 3RC8A 3P4SA 4CI1B 3FHNA 3UTKA 3AEAA 2X9YA 1KNZA 3MKDA 5HWYA 2BG9E 5JDFA 1Y01A 5F8PA 2H7VC 4X5TA 1D0ZA 2WB5A 2HPLA 3MA9A 5C3JA 3ANWB 4O4HE 2MPKA 2YKSA 3NWIA 3A8YC 2JMKA 4MALA 2C5JA 5BMVE 2V7KA 2XM1A 3UFEA 1AJ3A 4X64T 3L8RA 2W2UA 4LMLA 2XASB 4HFVA 2L3LA 2W66A 1M7KA 4I55E 5TAOA 1N36T 4EIWA 2W0GA 2WDVA 3AXJA 4JEUB 5F3JA 2CWYA 5LYJE 3PUSA 4E7ZA 2K9AA 5FMNA 2E9XD 5KX5E 4ZS3A 3OVUA 4AKHA 2DI4A 4KI0F 2D5UA 5AQTB 4U33A 1D0XA 1JNZA 4DV4T 3C64A 1IJ5A 4X20E 1X79A 3L39A 1N34T 1I6ZA 5HWXA 2XJ7A 3ZT5A 4N78D 3B5MA 1JNRA 1KF6A 3PUAA 4LF5T 2HN2A 4NIQA 2MBGA 5F5WA 5LCYA 5L4HA 4JI2T 1KNPA 1UCUA 5EZYE 2XY8B 1LRZA 2ODVA 5EK3A 2NP9A 1Z0PA 3ONLC 1MIWA 4QX7B 3AVSA 2X9XA 2LKHA 5JDHA 5LMUT 4K0KT 4WNKA 1FIOA 3KBUA 3HA4A 4M1PA 3UU4A 2PFVA 2W62A 3AE2A 2X68A 2ZM2A 4XAXB 3PUGA 5LHIB 3N5LA 3PE0A 3AE1A 2CPTA 3KDSE 3T1HT 4IDNA 3PU3A 3NRXA 4HWIB 4EXTA 3Q9DA 4DBQA 4B6XA 2LJLA 2BS3A 2C5IT 3RYCE 3FBZA 4JUYA 3E08A 4CN4A 2CXFA 3CPZA 5BR8T 4MLKA 2MTQA 2XAQB 2YDQA 4UF0B 5JTGA 3O1HA 3VRBA 4BJNA 4LFBT 5FXXA 2X9WA 3ZMVB 2VL8A 4IGUA 2JQKA 2ACZA 3AAIA 3NRYA 2CA5A 4KX6A 3UT5E 5JDMA 4DR2T 3GMIA 1S35A 3BK9A 2YK0A 3M65A 3EVYA 5HCJA 4YY3T 4YXDA 3K8PC 2LSJA 5J1GA 3H3AA 1I94T 4QH1A 1BR1A 2DCFA 3PUYF 4P09A 2OA5A 1O3XA 2V6XA 2QVAA 2V8SV 3SWHA 1SUMB 1VOMA 1EZ3A 2WBLA 2XQYA 3WAKA 4X62T 2VQFT 1WLXA 2CHOA 4PK6A 3VKHA 5JR9C 1BR4A 1HF8A 1D0YA 2JIWA 4E7SA 2K24A 2VB6A 2H89A 3P8CD 5DQWA 4KP3C 1J5WA 3HI2A 3DTOA 2P9BA 5HEOA 2BKOA 5FVLA 1YXRA 5HCMA 5J2UE 1HNZT 1QUUA 3QC9A 3FXDB 1YQ3A 2XQ6A 4WZXA 2N2NA 5JDLA 4UR9A 2XSBA 5ABFB 1GQEA 4JI1T 4H9QC 3NZQA 2B1EA 2Z6EA 4AI6A 3P4RA 4A97A 3CK6A 2VASA 4COFA 3RQUA 3ZSTA 5JR9B 1ZEEA 5JRCB 1HX8A 3RIUA 5IWAT 1FMWA 5L3BB 2CM0A 2DNXA 4TZ4C 3PURA 1WYBA 3RYFE 3RQWA 1B7TA 3ETVA 4UIGA 3TLTA 1LVFA 3UU5A 3LSVA 4PW8A 2IUBA 2X9HA 2IIUA 4DO0A 3HKDE 2I6HA 2JRKA 5FL0A 4DV7T 1XDOA 5L3DB 1N33T 5DABA 1D1BA 4YSXA 3IA3A 2QA7A 4ZI3C 2G0UA 2FBWA 4B3RT 2NWBA 2WAUA 4YTNA 4H9OC 4AQYT 3ZSSA 2BKPA 2NTYA 5HYAA 5HXCA 4U2ZA 1OEDC 3RYIE 1Z8UA 4ZI2C 1YKEB 1IBLT 2JJ9A 3OKQA 3LBXB 5HXSA 3CWZB 4YTPA 5ADXL 4C90A 1W9RA 4OK0A 4TWDA 3EABA 5LBQB 2OLTA 4PJJA 5HXHA 2JQHA 2NOXA 3RH3A 3LK3B 4DMWA 4AKRB 4ZXLA 2R6GF 4L5GA 2WWUA 4DIDB 2VKHA 2XHEB 4X1IE 2VQET 5LNKA 5IHYA 4TUYE 4ISTA 2K3WA 3TLUA 2W67A 1YKHB 3AE4A 3AA0B 2EHOA 3AA7B 3GN5A 4EEBA 4X65T 3B13A 2NR4A 3AAEB 5CJ5A 2I59A 2K48A 4IE0A 1WR0A 2NW7A 4X1KE 5CA0E 2M6IA 5AQQB 4C91A 3EUHA 5HEGA 4P0BA 4F6RC 1J1JA 5C2TA 2CRBA 2VK9A 3NKZA 2WP9A 4EAHA 1WR6A 5L2LA 3ZYKA 3MACA 3RHWA 4UV9B 4DUZT 1UGOA 3G06A 4NXMT 2LSIA 3IBPA 3N2KE 4V1Av 2E9XB 3ABVA 1BR0A 3ZN0B 2UU9T 3RYHE 3WAJA 1OEDA 1OWAA 2V7JA 3ZMSB 5LGNB 3AEDA 2A2FX 3QNUA 4JI3T 3PJAA 2WQYA 4DV1T 2EHOD 3C4WA 4H63H 3ZN1B 3FZMB 4AQFA 2Q9QA 1FMVA 2VVSA 3P4QA 4GYSA 5DJQC 4X66T 4TX5A 2YU1A 5IYZE 3ZPOA 4QHOA 3TLSA 2LKGA 4ZI3D 2XZEA 3L09A 3PUXF 3SRZA 1WRDA 1YW0A 2LM2A 3AXJB 3F31A 3F57A 2LSKA 2CMRA 3O9XA 1T98A 3N2GE 2ES0A 4ZI2D 2FJAA 2BG9A 2LLYA 2WZIA 2UXBT 3ZJ1A 4JI7T 5CGMA 3CIRA 5AQIB 4LF7T 4EGWA 3ZCIA 3K1SA 3EAMA 3PU8A 4HWDA 3S4UA 3V5UA 1XNRT 3AAAB 5LHHB 2UUAT 1E1HB 1HR0T 2BS4A 4A98A 4X1YE 4QXCB 2ZLYA 4U3CA 1MNDA 4U74A 5HEUA 4UELA 4EOZB 3PUVF 4YHHT 1LKXA 4Z90A 3FXEB 5AQMB 2IMLA 1T7SA 3BQIA 4JI6T 3TKLB 3L3PA 2KSRA 3AA6B 5LA6E 3AE6A 4OX9T 1MIYA 1U4QA 3PJAJ 3VHLA 2E5VA 3NBXX 1HX1B 3UQ4A 3OPCA 3O1JA 1NWMX 4YHJA 4BA9A 4G2AA 3ANWA 4GK0E 4H9RC 2H3RA 3BQLA 2X67A 3A7MA 3W15B 4IHJE 2X0LB 2WCAA 4UXNB 1IAPA 2UUCT 5LMNT 4JYAT 2WZHA 3RX6A 5AQLB 4ERRA 4EZHA 5CB4E 1UK5A 2IC9A 2M67A 1QLBA 3N9MA 5AQGB 5JDQA 5AQOB 2XAFB 4IREA 1E2AA 5AQKB 2K5BB 2FJEA 4JI0T 2BVMA 1ZOYA 2ACXA 2DWKA 4NPPA 5JDGA 2X51A 2C0SA 3MK7C 3AE8A 1D1CA 5JDNA 2LE8A 4PFPA 2IAKA 5CFBA 3AEEA 2D9DA 3N9OA 4IL9A 4KUMB 4DMVA 3RIUC 2CWOA 3CQGB 4QX8B 2VKDA 3RIFA 5EK2A 1XMOT 2H88A 3EI0A 4ZZCA 4DV5T 4TWFA 4PJLA 2XTLA 3HKCE 3D0TA 2XAJB 2YOEA 5AQVB 3GWHA 3A5XA 4H9PC 2V5DA 4U7YA 4QXBB 5M4YA 4U2YA 1KFYA 2C5KT 2I0MA 3I0QA 1ZKEA 3P4PA 4I4TE 1HFAA 1Y64B 5AQNB 5HEHA 2MAWA 4GKJT 4ASKA 2KNDA 4PNIA 2NW9A 4EB6E 1HNWT 3FZFB 3FZHB 2WWVA 4JI4T 1FEWA 5ABHA 3QOFA 1OXZA 4JLEA 4UF0A 5JVDE 1H7CA 3CX6B 2CXDA 4O2BE 2Y6XA 4TNWA 5L4EA 5KMGP 3UU6A 4TNVA 1WCRA 4ZZBA 4CN1A 2VVNA 3ZJ2A 1V9DA 4EV6A 3IHRA 4YSYA 2B76A 3PUZF 5CA1E 3UQ7A 3M3ZB 5HXEA 4UVBB 4QXHB 2DHRA 4DR5T 2FJDA 3ONJA 2EHOC 3SS1A 5E0OA 2PTFA 2UXCT 2XQ5A 2WSSV 2X0HA 5FXWA 5AFUL 3RRWA 3E22E 1CHUA 3UU8A 1UURA 3FZKB 2J47A 4PK4A 5AQUB 4KBMB 2IC6A 2YU2A 3NZPA 2IW5B 1MMDA 3K3OA 3KV5A 3AA1B 3I9WA 2GK9A 1G8XA 4DV3T 4YT0A 2V6YA 3OYXA 2J62A 2HHHT 4HGAA 3DJBA 3UUMA 2N1GA 5FXVA 1US7B 2EHOB 2V5CA 4DR4T 3GN5B 4O8SA 5LXTE 2KINB 1XZYA 3RF1A 2BKNA 2Y8DA 2H7OA 4NUVA 3UUBA 1BR2A 5L47A 4GOUA 3OJAA 5JRCA 3SFDA 4HFIA 5FP3A 4AQFC 4UEMA 2Q9QC 3UFGA 2MOZA 2J1DG 2E8IA 3ZC0A 3N2OA 1S94A 4FJOA 2M6BA 3EHZA 2XM2A 4CN6A 4H9NC 1OEDB 4PJMA 2WU2A 1W09A 3JADA 4Z91A 4UVCB 4U31A 5AQJB 4HFCA 1J5ET 4LF9T 4L9IA 2VKOA 4AISA 4I0UA 2VWAA 4AKIA 2QGSA 5A1LA 2BG9C 3SOLA 2KWIB 1VRBA 4DR1T 3C4ZA 1R8IA 3KV6A 1NENA 4DR3T 3CX8B 4I43B 5FKYA 4PJNA 1ZHCA 5LGUB 2OV9A 3AEGA 4ZS2A 4HWCA 4QWNB 5LGTB 4KHZF 3T1YT 4OYKA 4U72A 4LMKA 4LF4T 4IDOA 3U3IA 2SPCA 2CEAA
chains in the Genus database with same CATH topology
4AKGA 3ZEFB 3UUNA 4MFRA 4A56A 3AAIA 3BQIA 4ISSA 2LOPA 3LK42 3NRYA 2CA5A 4CXWA 3UT5E 4PFOA 3TKLB 2CE7A 3J9X1 2ZMAA 5JDMA 1HCIA 3GMIA 1S35A 3L3PA 4JEHB 4L0RA 3AA6B 4KMCA 5LA6E 3BK9A 4HN9A 2BDEA 2YK0A 3J7Yq 3M65A 3EVYA 1QSDA 2LM9A 4IIJE 3K8PC 2KLQA 3PTRB 2KXPB 3MZKB 1MIYA 1U4QA 2LSJA 5J1GA 3H3AA 3VHLA 1BR1A 2DCFA 4P09A 1UX4A 2OA5A 3ETUA 2ZM0A 3ZYLA 2XAHB 1O3XA 4IDZA 3NBXX 1ZV4X 3O1JA 5JR9A 2W61A 1NWMX 3SWHA 3RC3A 4YHJA 4BA9A 1VOMA 4G2AA 5L3GB 3ANWA 4GK0E 4H9RC 1EZ3A 2WBLA 4ADZA 2RA1A 5FY1A 2XQYA 3WAKA 3UULA 2H3RA 3CMLA 1WLXA 3BQLA 2X67A 2V1DB 3W15B 4PK6A 4IHJE 4IE5A 4MHCA 3C4XA 2XAGB 3FBLA 3VKHA 5JR9C 2YEVC 1BR4A 1HF8A 1SHZC 3O4XE 2X0LB 1KK7A 3C51A 2KWHA 2BZBA 1D0YA 3OBVE 3ZMTB 1CUNA 4NUUA 4E7SA 4UXNB 1IAPA 2K24A 2VB6A 3P8CD 3PDYA 5DQWA 3MXZA 4KP3C 4UVAB 5JQGE 2NTXA 5FXZA 5JH7E 3HI2A 2MYSA 3DTOA 3K3NA 4K0UA 2P9BA 3RX6A 5J2TE 1D1AA 4ERRA 3EDUA 4OFZA 4EZHA 3ZMZB 5J2UE 5CB4E 2E9XA 3OYZA 4EYUA 2IC9A 3IF8B 3N9PA 3V5SA 1QUUA 3QC9A 2M67A 3FXDB 4CI3B 2LT3A 3N9MA 3C98B 5JDQA 2N2NA 4ZOLE 2XAFB 5JDLA 4FI5A 5L3CB 3KBTA 2Y48B 5LOVE 2K5BB 4H9QC 1HTJF 2BVMA 3NZQA 1MMGA 2ACXA 2DWKA 2B1EA 2Z6EA 4AI6A 5JDGA 2HPJA 2E9XC 2Q9QD 2X51A 2Q9QB 3R84B 2C0SA 2VASA 4IE6A 3ZMUB 3MK7C 4ANJA 3QK6A 5JR9B 2LHNA 1ZEEA 3PUQA 3HKBE 5JRCB 1HX8A 4PK5A 1D1CA 5JDNA 3LBXA 4CQIA 5LP6E 4IE7A 5LG4A 1FMWA 1MNEA 2LE8A 5L3BB 2CM0A 2DNXA 4PFPA 4TV8E 4TZ4C 2IAKA 3MJXA 2LSGA 1WYBA 3PURA 3I9YA 2KMFA 3RPUA 3HL6A 3RYFE 1MMNA 4WBOA 1B7TA 3N9OA 5LJNA 1U5PA 3DP7A 3ETVA 4UIGA 4KUMB 4DMVA 1LVFA 2PG8A 4CI2B 3ZC1A 4MBQA 4PW8A 2CWOA 3CQGB 2X9HA 3ZCJA 4DO0A 3HKDE 4QX8B 4HTEA 2VKDA 2JRKA 2V7MA 3KFWX 4YJ3E 3QUJA 2ZM8A 5EK2A 2LSYA 2HH7A 1WYCA 3ZLIA 5L3DB 3JC6C 2UXXB 1LVKA 5DABA 4PJLA 2XTLA 1D1BA 2RP4A 1YD8G 3LFMA 3CQXC 2QA7A 2XUEA 3HKCE 4XBFB 3CKDA 2NW8A 3KV4A 3D0TA 4ZI3C 2G0UA 1MMAA 2XAJB 3GWHA 5FYMA 2CLYC 2NWBA 3Q2MA 2WAUA 4O4LE 3A5XA 5C8YE 4H9PC 2L8KA 4H9OC 2JMHA 3CQCB 1UX5A 2JQQA 4QXBB 5M4YA 5L3EB 2C5KT 4Z8XA 4G63A 2NTYA 3RRCA 4H63V 3F2EA 5HYAA 1MIVA 2W63A 3I0QA 3I1AA 4AXPA 5HXCA 1ZKEA 4TV9E 2ODUA 4YFSA 5LBMA 3RYIE 4I4TE 3U78A 1Y64B 1HFAA 5FY0A 1YKEB 4ILUA 4ZI2C 4DNDA 2JJ9A 3OKQA 4HE8A 3EDVA 3Q5XA 4O4JE 5GONE 2N9DA 3LBXB 2LOSA 5HXSA 3CWZB 5ADXL 4C90A 4ASKA 3KV9A 1HG2A 2LHRA 2KT9A 4CXXA 4OK0A 2KNDA 3JC6D 2YINA 4GYRA 4HKAA 5LBQB 4PJJA 2W00A 2DLRA 3CX7B 4PNIA 3ONXA 2NW9A 4EB6E 4EZ4A 3BQKA 5DQVA 5HXRA 2KZ7B 5LJMA 5JREA 5HXHA 3IEEA 2NOXA 3RH3A 1IZNB 3LK3B 4BAYB 3HKEE 4DMWA 1FEWA 4AKRB 2CLYB 4O2AE 4L5GA 3FB2A 1OXZA 4JLEA 4UF0A 2WWUA 5JVDE 1H7CA 5ETWA 3CX6B 3VU7H 2D2SA 1HS7A 1NAFA 2VKHA 3GA8A 3RC8A 2CXDA 2XHEB 4O2BE 2Y6XA 4X1IE 5H6QB 4CI1B 3FHNA 5LNKA 5KMGP 2WMNA 3UTKA 2X9YA 5IHYA 3KINB 4TUYE 4AQGA 4ISTA 1KNZA 4HEAA 3LJCA 5FNVE 3MKDA 5HWYA 5JDFA 1YKHB 3ZJ2A 3N9NA 1V9DA 3AA0B 3IHRA 5F8PA 2EHOA 2H7VC 3AA7B 3GN5A 2CCQA 3N9LA 2WMOA 3B13A 1D0ZA 2HPLA 3LG7A 3MA9A 3E0ZA 4QKNA 5CA1E 3AAEB 3ANWB 5HXEA 2X66A 4UVBB 4O4HE 2JMKA 4MALA 2I59A 4PAGA 2C5JA 2K48A 5BMVE 4IE0A 4OYJA 4QXHB 2NW7A 2DHRA 4X1KE 5CA0E 4C91A 3EUHA 2EHOC 4CZZB 3SS1A 5E0OA 2V7KA 4P0BA 3UFEA 5EK4A 1AJ3A 4F6RC 4ZI7E 2LEHA 2WSSV 2VK9A 5FXWA 5AFUL 3RRWA 3E22E 2XASB 4HFVA 2L3LA 4EAHA 4YLHA 1WR6A 5L2LA 4I55E 5TAOA 2WM9A 3ZYKA 3MACA 4EIWA 2PJQA 4UV9B 2W0GA 4JEUB 2L9QA 4PK4A 5F3JA 2CWYA 5LYJE 3PUSA 4E7ZA 2LSIA 3AB3B 2K9AA 3IBPA 5FMNA 2E9XD 3N2KE 4V1Av 5KX5E 4ZS3A 2E9XB 4TN7B 4KBMB 4AKLA 2IC6A 2YU2A 3NZPA 2IW5B 4YJ2E 1BR0A 1MMDA 3ZN0B 3Q5WA 3RYHE 3H37A 3K3OA 3WAJA 1OWAA 3KV5A 2V7JA 3AA1B 4H9SE 2BVLA 3I9WA 3ZMSB 4DBRA 5LGNB 2GK9A 4J2CA 1G8XA 3ZYMA 2A2FX 3C50A 4AKHA 3OYXA 2DI4A 4P0AA 2D5UA 4HGAA 3DJBA 3UUMA 1D0XA 2N1GA 2EHOD 5FXVA 3C64A 1US7B 2EHOB 3C4WA 3GN5B 4H63H 5H6RB 4O8SA 2V26A 3ZN1B 1IJ5A 5LXTE 2KINB 4GIWA 4X20E 1X79A 3N9QA 4AQFA 3O1IA 1IJ6A 4WW0A 5HWXA 2Q9QA 3HR0A 2Y8DA 2H7OA 1FMVA 3UUXB 4NUVA 4CXYA 1BR2A 4GOUA 4GYSA 3OJAA 4N78D 2D0TA 2A72A 5JRCA 2CXLA 5DJQC 4BJMA 2VKJA 4TX5A 2YU1A 5IYZE 3ZPOA 3I0OA 4QHOA 3PUAA 3WI3A 3VKGA 5FP3A 4ZI3D 4AQFC 3L09A 2MBGA 3RKOA 3K3QC 2DWGA 2PBIA 4UEMA 5LCYA 3AVRA 2Q9QC 1WRDA 3SRZA 2MOZA 2J1DG 1YW0A 1UCUA 4XZCA 2E8IA 5EZYE 2UXNB 3ZC0A 3B57A 1LRZA 4I50E 3N2OA 3KVAA 2ODVA 3F31A 1S94A 3F57A 5EK3A 2NP9A 3LK2B 4FJOA 4OHFA 2LSKA 1Z0PA 2JPFA 2CMRA 1MIWA 4QX7B 5LHGB 3O9XA 3AVSA 2X9XA 1T98A 3N2GE 4H9NC 5JDHA 2ES0A 4PJMA 4ZI2D 3T8OA 4WNKA 1G73A 1SA0E 1FIOA 3KBUA 3HA4A 4M1PA 3CVRA 4UVCB 2V7IA 2PFVA 3ZJ1A 2W62A 2X68A 2ZM2A 3ESLA 2V7LA 4L9IA 4XAXB 4O4IE 2VKOA 3ZCIA 3P7IA 4UV8B 3PUGA 5LHIB 3N5LA 5FY7A 3PU8A 2VWAA 3S4UA 3V5UA 4AKIA 2QGSA 5L3FB 3AAAB 5A1LA 3PE0A 3KDSE 3SOLA 2KWIB 5LHHB 4EYYR 1VRBA 1E1HB 3C4ZA 3PU3A 4IE4A 4DVDA 3KVBA 3NRXA 5KDMC 4EXTA 1HG5A 3Q9DA 4DBQA 4B6XA 2LJLA 4X1YE 4QXCB 3KV6A 2C5IT 3CX8B 2ZLYA 4I43B 4GK5E 4PJNA 1ZHCA 5LGUB 1MNDA 3RYCE 4U74A 3FBZA 4JUYA 3E08A 4UELA 4EOZB 2CXFA 2D0UA 3CPZA 4ZS2A 4QWNB 5LGTB 4WBNE 3R6NA 4MLKA 2A3DA 2MTQA 2XAQB 4OYKA 4U72A 4UF0B 3O1HA 1LKXA 4BJNA 3FXEB 3U3IA 5FXXA 2X9WA 3ZMVB 2SPCA 2VL8A 4ZHQE 5HAXA 2CEAA 4IGUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QWN B;  4QXH B;  4QXC B;  4QX8 B;  4QXB B;  4TN7 B;  4QX7 B; 
#chains in the Genus database with same CATH topology
 4AKG A;  3UUN A;  4MFR A;  4A56 A;  4CXW A;  4PFO A;  3J9X 1;  2ZMA A;  5IUX A;  1HCI A;  4JEH B;  4L0R A;  2BG9 B;  2BDE A;  5AQS B;  3J7Y q;  1QSD A;  2LM9 A;  2KLQ A;  4DV0 T;  2BS2 A;  1XDP A;  3AE3 A;  3ETU A;  2CBI A;  3OTO T;  2VL0 A;  4ADZ A;  1DU2 A;  5LB7 B;  5FY1 A;  4MHC A;  3C4X A;  2XQ4 A;  3FBL A;  2QRX A;  1SHZ C;  3O4X E;  3OBV E;  3ZMT B;  3PDY A;  3MXZ A;  4UVA B;  2NTX A;  1XWM A;  5FL1 A;  2MYS A;  3AEC A;  1D1A A;  4OFZ A;  3ZMZ B;  2E9X A;  4EYU A;  1IBK T;  2UUB T;  2IDO B;  3H3M A;  2LT3 A;  4ZOL E;  4LF8 T;  3Q5D A;  1X9B A;  1MMG A;  3RLF F;  4YSZ A;  2Q9Q D;  3R84 B;  2LHN A;  4PK5 A;  2YDR A;  5LP6 E;  4IE7 A;  5LG4 A;  3RI5 A;  4TV8 E;  3I9Y A;  3HL6 A;  2WDQ A;  2BBH A;  1U5P A;  2WS3 A;  5FVK A;  4CI2 B;  3ZC1 A;  3VR9 A;  3ZCJ A;  4HTE A;  2V7M A;  4YJ3 E;  5AQR B;  2ZM8 A;  3VRA A;  2LSY A;  3ZLI A;  3AEB A;  4AIU A;  2IHR 1;  1LVK A;  3JAE A;  1YD8 G;  4XBF B;  4O4L E;  3CQC B;  1IBM T;  1T72 A;  3P4W A;  1UX5 A;  2JQQ A;  5L3E B;  4Z8X A;  4G63 A;  4AXP A;  4TV9 E;  2ODU A;  4YFS A;  5LBM A;  5FY0 A;  4ILB A;  4ILU A;  4DND A;  4HE8 A;  3EDV A;  3Q5X A;  4O4J E;  2N9D A;  3KV9 A;  1HG2 A;  2LHR A;  4CXX A;  3JC6 D;  4GYR A;  2W00 A;  2DLR A;  3CX7 B;  4EZ4 A;  4IDP A;  5HXR A;  2KZ7 B;  3IEE A;  3HKE E;  2RPA A;  4O2A E;  3FB2 A;  1L0V A;  5ETW A;  5HEJ A;  1HS7 A;  1NAF A;  2E2A A;  2XSA A;  5H6Q B;  3JAF A;  2WMN A;  4JI8 T;  3KIN B;  4AQG A;  1WFD A;  4HEA A;  2XPK A;  3LJC A;  5FNV E;  3N9N A;  1XNQ T;  3N9L A;  4IL4 A;  2CCQ A;  2WMO A;  3LG7 A;  4B3M T;  3E0Z A;  4U7I A;  4QKN A;  2X66 A;  1M62 A;  4JBW F;  4PAG A;  4YTM A;  4OYJ A;  5AQP B;  4CZZ B;  2LRK A;  5EK4 A;  4ZI7 E;  2ZM6 T;  2LEH A;  2E5L T;  4HFD A;  4YLH A;  2WM9 A;  2PJQ A;  4ILC A;  1YQ4 A;  2AXD S;  3RKG A;  2JQ9 A;  2L9Q A;  4QH5 A;  3AB3 B;  4TN7 B;  4AKL A;  4YJ2 E;  4IDQ A;  3Q5W A;  3H37 A;  4H9S E;  2BVL A;  4DBR A;  4J2C A;  3ZYM A;  4DV6 T;  3C50 A;  4B3S T;  4P0A A;  2XQ7 A;  4LFA T;  3AE7 A;  4B3T T;  5H6R B;  2V26 A;  4GIW A;  1VCT A;  3N9Q A;  3O1I A;  1IJ6 A;  4WW0 A;  2FUP A;  3HR0 A;  3UUX B;  2A9U A;  4CXY A;  4DUY T;  2D0T A;  2A72 A;  2CXL A;  4BJM A;  2VKJ A;  4HFH A;  3I0O A;  1NEK A;  3WI3 A;  3VKG A;  3RKO A;  3K3Q C;  2DWG A;  2PBI A;  3AVR A;  4XZC A;  5KXJ A;  2UXN B;  3B57 A;  4I50 E;  3KVA A;  2J4G A;  3LK2 B;  4OHF A;  2JPF A;  5LHG B;  1HNX T;  5AQH B;  3T8O A;  1G73 A;  1SA0 E;  3CVR A;  2V7I A;  2V6Y B;  3ESL A;  2W4X A;  2V7L A;  2F4V T;  4O4I E;  3P7I A;  4UV8 B;  5FY7 A;  1SE7 A;  2LRL A;  5L3F B;  4QH4 A;  4EYY R;  1VCS A;  4IE4 A;  4DVD A;  5KDM C;  3KVB A;  1HG5 A;  3PUW F;  2XQ8 A;  3AEF A;  4ZEY A;  4GK5 E;  2D0U A;  1W0B A;  2XQ3 A;  4WBN E;  3R6N A;  2A3D A;  3P50 A;  4ZHQ E;  5HAX A;  2DL1 A;  2XQA A;  2YDS A;  3ZEF B;  4ISS A;  2LOP A;  3LK4 2;  2CE7 A;  5ABE A;  3UU3 A;  3NVO A;  4KMC A;  4HN9 A;  2YN6 A;  5ABF A;  4IIJ E;  3PTR B;  2KXP B;  3MZK B;  5LG3 A;  4TWH A;  1UX4 A;  4HFE A;  4HWF A;  3RIA A;  2WDR A;  2ZM0 A;  1KEY A;  3ZYL A;  2XAH B;  1ZP0 A;  4IDZ A;  3JCF A;  1ZV4 X;  5JR9 A;  2W61 A;  3RC3 A;  3FZL B;  5L3G B;  4GKK T;  2RA1 A;  2XQ9 A;  4ILA A;  3UUL A;  3AE9 A;  3CML A;  3LDQ B;  3X1D A;  2V1D B;  4IE5 A;  2CHN A;  2X0Y A;  2XAG B;  2YEV C;  3C51 A;  1KK7 A;  2KWH A;  2BZB A;  4A5X A;  1CUN A;  4NUU A;  5JQG E;  5FXZ A;  3ZT7 A;  5JH7 E;  2BBJ A;  3K3N A;  4K0U A;  5J2T E;  3EDU A;  3RGL A;  3OYZ A;  3VR8 A;  3IF8 B;  3AE5 A;  3N9P A;  3V5S A;  3PV0 F;  4CI3 B;  3C98 B;  5J0Z A;  4FI5 A;  5L3C B;  3QB5 K;  3KBT A;  2Y48 B;  5LOV E;  3QB5 A;  2UXD T;  1HTJ F;  2WY2 A;  3ZKR A;  4KHP T;  2HPJ A;  2E9X C;  2Q9Q B;  4IE6 A;  3ZMU B;  4ANJ A;  3QK6 A;  3PUQ A;  3HKB E;  4JI5 T;  4HWH A;  3LBX A;  4CQI A;  5ABG A;  1MNE A;  3MJX A;  2LSG A;  2KMF A;  3RPU A;  3ZT6 A;  4NXN T;  1UUS A;  1MMN A;  4WBO A;  5LJN A;  3DP7 A;  2PG8 A;  3Q5E A;  4MBQ A;  4LMJ A;  4LFC T;  1E7P A;  4JV5 T;  1W0A A;  5AQF B;  3TLV A;  3KFW X;  4LF6 T;  3QUJ A;  3TLW A;  2HH7 A;  1WYC A;  3JC6 C;  2UXX B;  2FJB A;  4Q25 A;  2RP4 A;  3LFM A;  2XUE A;  3CQX C;  2WU5 A;  3CKD A;  2NW8 A;  3KV4 A;  1MMA A;  1OED E;  5FYM A;  2AE9 A;  4P1N A;  2CLY C;  3Q2M A;  5C8Y E;  4HFB A;  2L8K A;  2JMH A;  1XMQ T;  2QYW A;  3RRC A;  4H63 V;  4EED A;  3F2E A;  1MIV A;  1T8B A;  2W63 A;  2VUR A;  3I1A A;  1KNR A;  4F8H A;  4DR6 T;  3U78 A;  1FJG T;  1N32 T;  5GON E;  4IT4 A;  2LOS A;  2KT9 A;  2YIN A;  4HKA A;  3SFE A;  4DV2 T;  3ONX A;  3BQK A;  5DQV A;  5LJM A;  5JRE A;  2HN1 A;  1IZN B;  4BAY B;  2CBJ A;  2CLY B;  4WYV A;  3VU7 H;  2D2S A;  4DR7 T;  3GA8 A;  3RC8 A;  3P4S A;  4CI1 B;  3FHN A;  3UTK A;  3AEA A;  2X9Y A;  1KNZ A;  3MKD A;  5HWY A;  2BG9 E;  5JDF A;  1Y01 A;  5F8P A;  2H7V C;  4X5T A;  1D0Z A;  2WB5 A;  2HPL A;  3MA9 A;  5C3J A;  3ANW B;  4O4H E;  2MPK A;  2YKS A;  3NWI A;  3A8Y C;  2JMK A;  4MAL A;  2C5J A;  5BMV E;  2V7K A;  2XM1 A;  3UFE A;  1AJ3 A;  4X64 T;  3L8R A;  2W2U A;  4LML A;  2XAS B;  4HFV A;  2L3L A;  2W66 A;  1M7K A;  4I55 E;  5TAO A;  1N36 T;  4EIW A;  2W0G A;  2WDV A;  3AXJ A;  4JEU B;  5F3J A;  2CWY A;  5LYJ E;  3PUS A;  4E7Z A;  2K9A A;  5FMN A;  2E9X D;  5KX5 E;  4ZS3 A;  3OVU A;  4AKH A;  2DI4 A;  4KI0 F;  2D5U A;  5AQT B;  4U33 A;  1D0X A;  1JNZ A;  4DV4 T;  3C64 A;  1IJ5 A;  4X20 E;  1X79 A;  3L39 A;  1N34 T;  1I6Z A;  5HWX A;  2XJ7 A;  3ZT5 A;  4N78 D;  3B5M A;  1JNR A;  1KF6 A;  3PUA A;  4LF5 T;  2HN2 A;  4NIQ A;  2MBG A;  5F5W A;  5LCY A;  5L4H A;  4JI2 T;  1KNP A;  1UCU A;  5EZY E;  2XY8 B;  1LRZ A;  2ODV A;  5EK3 A;  2NP9 A;  1Z0P A;  3ONL C;  1MIW A;  4QX7 B;  3AVS A;  2X9X A;  2LKH A;  5JDH A;  5LMU T;  4K0K T;  4WNK A;  1FIO A;  3KBU A;  3HA4 A;  4M1P A;  3UU4 A;  2PFV A;  2W62 A;  3AE2 A;  2X68 A;  2ZM2 A;  4XAX B;  3PUG A;  5LHI B;  3N5L A;  3PE0 A;  3AE1 A;  2CPT A;  3KDS E;  3T1H T;  4IDN A;  3PU3 A;  3NRX A;  4HWI B;  4EXT A;  3Q9D A;  4DBQ A;  4B6X A;  2LJL A;  2BS3 A;  2C5I T;  3RYC E;  3FBZ A;  4JUY A;  3E08 A;  4CN4 A;  2CXF A;  3CPZ A;  5BR8 T;  4MLK A;  2MTQ A;  2XAQ B;  2YDQ A;  4UF0 B;  5JTG A;  3O1H A;  3VRB A;  4BJN A;  4LFB T;  5FXX A;  2X9W A;  3ZMV B;  2VL8 A;  4IGU A;  2JQK A;  2ACZ A;  3AAI A;  3NRY A;  2CA5 A;  4KX6 A;  3UT5 E;  5JDM A;  4DR2 T;  3GMI A;  1S35 A;  3BK9 A;  2YK0 A;  3M65 A;  3EVY A;  5HCJ A;  4YY3 T;  4YXD A;  3K8P C;  2LSJ A;  5J1G A;  3H3A A;  1I94 T;  4QH1 A;  1BR1 A;  2DCF A;  3PUY F;  4P09 A;  2OA5 A;  1O3X A;  2V6X A;  2QVA A;  2V8S V;  3SWH A;  1SUM B;  1VOM A;  1EZ3 A;  2WBL A;  2XQY A;  3WAK A;  4X62 T;  2VQF T;  1WLX A;  2CHO A;  4PK6 A;  3VKH A;  5JR9 C;  1BR4 A;  1HF8 A;  1D0Y A;  2JIW A;  4E7S A;  2K24 A;  2VB6 A;  2H89 A;  3P8C D;  5DQW A;  4KP3 C;  1J5W A;  3HI2 A;  3DTO A;  2P9B A;  5HEO A;  2BKO A;  5FVL A;  1YXR A;  5HCM A;  5J2U E;  1HNZ T;  1QUU A;  3QC9 A;  3FXD B;  1YQ3 A;  2XQ6 A;  4WZX A;  2N2N A;  5JDL A;  4UR9 A;  2XSB A;  5ABF B;  1GQE A;  4JI1 T;  4H9Q C;  3NZQ A;  2B1E A;  2Z6E A;  4AI6 A;  3P4R A;  4A97 A;  3CK6 A;  2VAS A;  4COF A;  3RQU A;  3ZST A;  5JR9 B;  1ZEE A;  5JRC B;  1HX8 A;  3RIU A;  5IWA T;  1FMW A;  5L3B B;  2CM0 A;  2DNX A;  4TZ4 C;  3PUR A;  1WYB A;  3RYF E;  3RQW A;  1B7T A;  3ETV A;  4UIG A;  3TLT A;  1LVF A;  3UU5 A;  3LSV A;  4PW8 A;  2IUB A;  2X9H A;  2IIU A;  4DO0 A;  3HKD E;  2I6H A;  2JRK A;  5FL0 A;  4DV7 T;  1XDO A;  5L3D B;  1N33 T;  5DAB A;  1D1B A;  4YSX A;  3IA3 A;  2QA7 A;  4ZI3 C;  2G0U A;  2FBW A;  4B3R T;  2NWB A;  2WAU A;  4YTN A;  4H9O C;  4AQY T;  3ZSS A;  2BKP A;  2NTY A;  5HYA A;  5HXC A;  4U2Z A;  1OED C;  3RYI E;  1Z8U A;  4ZI2 C;  1YKE B;  1IBL T;  2JJ9 A;  3OKQ A;  3LBX B;  5HXS A;  3CWZ B;  4YTP A;  5ADX L;  4C90 A;  1W9R A;  4OK0 A;  4TWD A;  3EAB A;  5LBQ B;  2OLT A;  4PJJ A;  5HXH A;  2JQH A;  2NOX A;  3RH3 A;  3LK3 B;  4DMW A;  4AKR B;  4ZXL A;  2R6G F;  4L5G A;  2WWU A;  4DID B;  2VKH A;  2XHE B;  4X1I E;  2VQE T;  5LNK A;  5IHY A;  4TUY E;  4IST A;  2K3W A;  3TLU A;  2W67 A;  1YKH B;  3AE4 A;  3AA0 B;  2EHO A;  3AA7 B;  3GN5 A;  4EEB A;  4X65 T;  3B13 A;  2NR4 A;  3AAE B;  5CJ5 A;  2I59 A;  2K48 A;  4IE0 A;  1WR0 A;  2NW7 A;  4X1K E;  5CA0 E;  2M6I A;  5AQQ B;  4C91 A;  3EUH A;  5HEG A;  4P0B A;  4F6R C;  1J1J A;  5C2T A;  2CRB A;  2VK9 A;  3NKZ A;  2WP9 A;  4EAH A;  1WR6 A;  5L2L A;  3ZYK A;  3MAC A;  3RHW A;  4UV9 B;  4DUZ T;  1UGO A;  3G06 A;  4NXM T;  2LSI A;  3IBP A;  3N2K E;  4V1A v;  2E9X B;  3ABV A;  1BR0 A;  3ZN0 B;  2UU9 T;  3RYH E;  3WAJ A;  1OED A;  1OWA A;  2V7J A;  3ZMS B;  5LGN B;  3AED A;  2A2F X;  3QNU A;  4JI3 T;  3PJA A;  2WQY A;  4DV1 T;  2EHO D;  3C4W A;  4H63 H;  3ZN1 B;  3FZM B;  4AQF A;  2Q9Q A;  1FMV A;  2VVS A;  3P4Q A;  4GYS A;  5DJQ C;  4X66 T;  4TX5 A;  2YU1 A;  5IYZ E;  3ZPO A;  4QHO A;  3TLS A;  2LKG A;  4ZI3 D;  2XZE A;  3L09 A;  3PUX F;  3SRZ A;  1WRD A;  1YW0 A;  2LM2 A;  3AXJ B;  3F31 A;  3F57 A;  2LSK A;  2CMR A;  3O9X A;  1T98 A;  3N2G E;  2ES0 A;  4ZI2 D;  2FJA A;  2BG9 A;  2LLY A;  2WZI A;  2UXB T;  3ZJ1 A;  4JI7 T;  5CGM A;  3CIR A;  5AQI B;  4LF7 T;  4EGW A;  3ZCI A;  3K1S A;  3EAM A;  3PU8 A;  4HWD A;  3S4U A;  3V5U A;  1XNR T;  3AAA B;  5LHH B;  2UUA T;  1E1H B;  1HR0 T;  2BS4 A;  4A98 A;  4X1Y E;  4QXC B;  2ZLY A;  4U3C A;  1MND A;  4U74 A;  5HEU A;  4UEL A;  4EOZ B;  3PUV F;  4YHH T;  1LKX A;  4Z90 A;  3FXE B;  5AQM B;  2IML A;  1T7S A;  3BQI A;  4JI6 T;  3TKL B;  3L3P A;  2KSR A;  3AA6 B;  5LA6 E;  3AE6 A;  4OX9 T;  1MIY A;  1U4Q A;  3PJA J;  3VHL A;  2E5V A;  3NBX X;  1HX1 B;  3UQ4 A;  3OPC A;  3O1J A;  1NWM X;  4YHJ A;  4BA9 A;  4G2A A;  3ANW A;  4GK0 E;  4H9R C;  2H3R A;  3BQL A;  2X67 A;  3A7M A;  3W15 B;  4IHJ E;  2X0L B;  2WCA A;  4UXN B;  1IAP A;  2UUC T;  5LMN T;  4JYA T;  2WZH A;  3RX6 A;  5AQL B;  4ERR A;  4EZH A;  5CB4 E;  1UK5 A;  2IC9 A;  2M67 A;  1QLB A;  3N9M A;  5AQG B;  5JDQ A;  5AQO B;  2XAF B;  4IRE A;  1E2A A;  5AQK B;  2K5B B;  2FJE A;  4JI0 T;  2BVM A;  1ZOY A;  2ACX A;  2DWK A;  4NPP A;  5JDG A;  2X51 A;  2C0S A;  3MK7 C;  3AE8 A;  1D1C A;  5JDN A;  2LE8 A;  4PFP A;  2IAK A;  5CFB A;  3AEE A;  2D9D A;  3N9O A;  4IL9 A;  4KUM B;  4DMV A;  3RIU C;  2CWO A;  3CQG B;  4QX8 B;  2VKD A;  3RIF A;  5EK2 A;  1XMO T;  2H88 A;  3EI0 A;  4ZZC A;  4DV5 T;  4TWF A;  4PJL A;  2XTL A;  3HKC E;  3D0T A;  2XAJ B;  2YOE A;  5AQV B;  3GWH A;  3A5X A;  4H9P C;  2V5D A;  4U7Y A;  4QXB B;  5M4Y A;  4U2Y A;  1KFY A;  2C5K T;  2I0M A;  3I0Q A;  1ZKE A;  3P4P A;  4I4T E;  1HFA A;  1Y64 B;  5AQN B;  5HEH A;  2MAW A;  4GKJ T;  4ASK A;  2KND A;  4PNI A;  2NW9 A;  4EB6 E;  1HNW T;  3FZF B;  3FZH B;  2WWV A;  4JI4 T;  1FEW A;  5ABH A;  3QOF A;  1OXZ A;  4JLE A;  4UF0 A;  5JVD E;  1H7C A;  3CX6 B;  2CXD A;  4O2B E;  2Y6X A;  4TNW A;  5L4E A;  5KMG P;  3UU6 A;  4TNV A;  1WCR A;  4ZZB A;  4CN1 A;  2VVN A;  3ZJ2 A;  1V9D A;  4EV6 A;  3IHR A;  4YSY A;  2B76 A;  3PUZ F;  5CA1 E;  3UQ7 A;  3M3Z B;  5HXE A;  4UVB B;  4QXH B;  2DHR A;  4DR5 T;  2FJD A;  3ONJ A;  2EHO C;  3SS1 A;  5E0O A;  2PTF A;  2UXC T;  2XQ5 A;  2WSS V;  2X0H A;  5FXW A;  5AFU L;  3RRW A;  3E22 E;  1CHU A;  3UU8 A;  1UUR A;  3FZK B;  2J47 A;  4PK4 A;  5AQU B;  4KBM B;  2IC6 A;  2YU2 A;  3NZP A;  2IW5 B;  1MMD A;  3K3O A;  3KV5 A;  3AA1 B;  3I9W A;  2GK9 A;  1G8X A;  4DV3 T;  4YT0 A;  2V6Y A;  3OYX A;  2J62 A;  2HHH T;  4HGA A;  3DJB A;  3UUM A;  2N1G A;  5FXV A;  1US7 B;  2EHO B;  2V5C A;  4DR4 T;  3GN5 B;  4O8S A;  5LXT E;  2KIN B;  1XZY A;  3RF1 A;  2BKN A;  2Y8D A;  2H7O A;  4NUV A;  3UUB A;  1BR2 A;  5L47 A;  4GOU A;  3OJA A;  5JRC A;  3SFD A;  4HFI A;  5FP3 A;  4AQF C;  4UEM A;  2Q9Q C;  3UFG A;  2MOZ A;  2J1D G;  2E8I A;  3ZC0 A;  3N2O A;  1S94 A;  4FJO A;  2M6B A;  3EHZ A;  2XM2 A;  4CN6 A;  4H9N C;  1OED B;  4PJM A;  2WU2 A;  1W09 A;  3JAD A;  4Z91 A;  4UVC B;  4U31 A;  5AQJ B;  4HFC A;  1J5E T;  4LF9 T;  4L9I A;  2VKO A;  4AIS A;  4I0U A;  2VWA A;  4AKI A;  2QGS A;  5A1L A;  2BG9 C;  3SOL A;  2KWI B;  1VRB A;  4DR1 T;  3C4Z A;  1R8I A;  3KV6 A;  1NEN A;  4DR3 T;  3CX8 B;  4I43 B;  5FKY A;  4PJN A;  1ZHC A;  5LGU B;  2OV9 A;  3AEG A;  4ZS2 A;  4HWC A;  4QWN B;  5LGT B;  4KHZ F;  3T1Y T;  4OYK A;  4U72 A;  4LMK A;  4LF4 T;  4IDO A;  3U3I A;  2SPC A;  2CEA A; 
#chains in the Genus database with same CATH homology
 4AKG A;  3ZEF B;  3UUN A;  4MFR A;  4A56 A;  3AAI A;  3BQI A;  4ISS A;  2LOP A;  3LK4 2;  3NRY A;  2CA5 A;  4CXW A;  3UT5 E;  4PFO A;  3TKL B;  2CE7 A;  3J9X 1;  2ZMA A;  5JDM A;  1HCI A;  3GMI A;  1S35 A;  3L3P A;  4JEH B;  4L0R A;  3AA6 B;  4KMC A;  5LA6 E;  3BK9 A;  4HN9 A;  2BDE A;  2YK0 A;  3J7Y q;  3M65 A;  3EVY A;  1QSD A;  2LM9 A;  4IIJ E;  3K8P C;  2KLQ A;  3PTR B;  2KXP B;  3MZK B;  1MIY A;  1U4Q A;  2LSJ A;  5J1G A;  3H3A A;  3VHL A;  1BR1 A;  2DCF A;  4P09 A;  1UX4 A;  2OA5 A;  3ETU A;  2ZM0 A;  3ZYL A;  2XAH B;  1O3X A;  4IDZ A;  3NBX X;  1ZV4 X;  3O1J A;  5JR9 A;  2W61 A;  1NWM X;  3SWH A;  3RC3 A;  4YHJ A;  4BA9 A;  1VOM A;  4G2A A;  5L3G B;  3ANW A;  4GK0 E;  4H9R C;  1EZ3 A;  2WBL A;  4ADZ A;  2RA1 A;  5FY1 A;  2XQY A;  3WAK A;  3UUL A;  2H3R A;  3CML A;  1WLX A;  3BQL A;  2X67 A;  2V1D B;  3W15 B;  4PK6 A;  4IHJ E;  4IE5 A;  4MHC A;  3C4X A;  2XAG B;  3FBL A;  3VKH A;  5JR9 C;  2YEV C;  1BR4 A;  1HF8 A;  1SHZ C;  3O4X E;  2X0L B;  1KK7 A;  3C51 A;  2KWH A;  2BZB A;  1D0Y A;  3OBV E;  3ZMT B;  1CUN A;  4NUU A;  4E7S A;  4UXN B;  1IAP A;  2K24 A;  2VB6 A;  3P8C D;  3PDY A;  5DQW A;  3MXZ A;  4KP3 C;  4UVA B;  5JQG E;  2NTX A;  5FXZ A;  5JH7 E;  3HI2 A;  2MYS A;  3DTO A;  3K3N A;  4K0U A;  2P9B A;  3RX6 A;  5J2T E;  1D1A A;  4ERR A;  3EDU A;  4OFZ A;  4EZH A;  3ZMZ B;  5J2U E;  5CB4 E;  2E9X A;  3OYZ A;  4EYU A;  2IC9 A;  3IF8 B;  3N9P A;  3V5S A;  1QUU A;  3QC9 A;  2M67 A;  3FXD B;  4CI3 B;  2LT3 A;  3N9M A;  3C98 B;  5JDQ A;  2N2N A;  4ZOL E;  2XAF B;  5JDL A;  4FI5 A;  5L3C B;  3KBT A;  2Y48 B;  5LOV E;  2K5B B;  4H9Q C;  1HTJ F;  2BVM A;  3NZQ A;  1MMG A;  2ACX A;  2DWK A;  2B1E A;  2Z6E A;  4AI6 A;  5JDG A;  2HPJ A;  2E9X C;  2Q9Q D;  2X51 A;  2Q9Q B;  3R84 B;  2C0S A;  2VAS A;  4IE6 A;  3ZMU B;  3MK7 C;  4ANJ A;  3QK6 A;  5JR9 B;  2LHN A;  1ZEE A;  3PUQ A;  3HKB E;  5JRC B;  1HX8 A;  4PK5 A;  1D1C A;  5JDN A;  3LBX A;  4CQI A;  5LP6 E;  4IE7 A;  5LG4 A;  1FMW A;  1MNE A;  2LE8 A;  5L3B B;  2CM0 A;  2DNX A;  4PFP A;  4TV8 E;  4TZ4 C;  2IAK A;  3MJX A;  2LSG A;  1WYB A;  3PUR A;  3I9Y A;  2KMF A;  3RPU A;  3HL6 A;  3RYF E;  1MMN A;  4WBO A;  1B7T A;  3N9O A;  5LJN A;  1U5P A;  3DP7 A;  3ETV A;  4UIG A;  4KUM B;  4DMV A;  1LVF A;  2PG8 A;  4CI2 B;  3ZC1 A;  4MBQ A;  4PW8 A;  2CWO A;  3CQG B;  2X9H A;  3ZCJ A;  4DO0 A;  3HKD E;  4QX8 B;  4HTE A;  2VKD A;  2JRK A;  2V7M A;  3KFW X;  4YJ3 E;  3QUJ A;  2ZM8 A;  5EK2 A;  2LSY A;  2HH7 A;  1WYC A;  3ZLI A;  5L3D B;  3JC6 C;  2UXX B;  1LVK A;  5DAB A;  4PJL A;  2XTL A;  1D1B A;  2RP4 A;  1YD8 G;  3LFM A;  3CQX C;  2QA7 A;  2XUE A;  3HKC E;  4XBF B;  3CKD A;  2NW8 A;  3KV4 A;  3D0T A;  4ZI3 C;  2G0U A;  1MMA A;  2XAJ B;  3GWH A;  5FYM A;  2CLY C;  2NWB A;  3Q2M A;  2WAU A;  4O4L E;  3A5X A;  5C8Y E;  4H9P C;  2L8K A;  4H9O C;  2JMH A;  3CQC B;  1UX5 A;  2JQQ A;  4QXB B;  5M4Y A;  5L3E B;  2C5K T;  4Z8X A;  4G63 A;  2NTY A;  3RRC A;  4H63 V;  3F2E A;  5HYA A;  1MIV A;  2W63 A;  3I0Q A;  3I1A A;  4AXP A;  5HXC A;  1ZKE A;  4TV9 E;  2ODU A;  4YFS A;  5LBM A;  3RYI E;  4I4T E;  3U78 A;  1Y64 B;  1HFA A;  5FY0 A;  1YKE B;  4ILU A;  4ZI2 C;  4DND A;  2JJ9 A;  3OKQ A;  4HE8 A;  3EDV A;  3Q5X A;  4O4J E;  5GON E;  2N9D A;  3LBX B;  2LOS A;  5HXS A;  3CWZ B;  5ADX L;  4C90 A;  4ASK A;  3KV9 A;  1HG2 A;  2LHR A;  2KT9 A;  4CXX A;  4OK0 A;  2KND A;  3JC6 D;  2YIN A;  4GYR A;  4HKA A;  5LBQ B;  4PJJ A;  2W00 A;  2DLR A;  3CX7 B;  4PNI A;  3ONX A;  2NW9 A;  4EB6 E;  4EZ4 A;  3BQK A;  5DQV A;  5HXR A;  2KZ7 B;  5LJM A;  5JRE A;  5HXH A;  3IEE A;  2NOX A;  3RH3 A;  1IZN B;  3LK3 B;  4BAY B;  3HKE E;  4DMW A;  1FEW A;  4AKR B;  2CLY B;  4O2A E;  4L5G A;  3FB2 A;  1OXZ A;  4JLE A;  4UF0 A;  2WWU A;  5JVD E;  1H7C A;  5ETW A;  3CX6 B;  3VU7 H;  2D2S A;  1HS7 A;  1NAF A;  2VKH A;  3GA8 A;  3RC8 A;  2CXD A;  2XHE B;  4O2B E;  2Y6X A;  4X1I E;  5H6Q B;  4CI1 B;  3FHN A;  5LNK A;  5KMG P;  2WMN A;  3UTK A;  2X9Y A;  5IHY A;  3KIN B;  4TUY E;  4AQG A;  4IST A;  1KNZ A;  4HEA A;  3LJC A;  5FNV E;  3MKD A;  5HWY A;  5JDF A;  1YKH B;  3ZJ2 A;  3N9N A;  1V9D A;  3AA0 B;  3IHR A;  5F8P A;  2EHO A;  2H7V C;  3AA7 B;  3GN5 A;  2CCQ A;  3N9L A;  2WMO A;  3B13 A;  1D0Z A;  2HPL A;  3LG7 A;  3MA9 A;  3E0Z A;  4QKN A;  5CA1 E;  3AAE B;  3ANW B;  5HXE A;  2X66 A;  4UVB B;  4O4H E;  2JMK A;  4MAL A;  2I59 A;  4PAG A;  2C5J A;  2K48 A;  5BMV E;  4IE0 A;  4OYJ A;  4QXH B;  2NW7 A;  2DHR A;  4X1K E;  5CA0 E;  4C91 A;  3EUH A;  2EHO C;  4CZZ B;  3SS1 A;  5E0O A;  2V7K A;  4P0B A;  3UFE A;  5EK4 A;  1AJ3 A;  4F6R C;  4ZI7 E;  2LEH A;  2WSS V;  2VK9 A;  5FXW A;  5AFU L;  3RRW A;  3E22 E;  2XAS B;  4HFV A;  2L3L A;  4EAH A;  4YLH A;  1WR6 A;  5L2L A;  4I55 E;  5TAO A;  2WM9 A;  3ZYK A;  3MAC A;  4EIW A;  2PJQ A;  4UV9 B;  2W0G A;  4JEU B;  2L9Q A;  4PK4 A;  5F3J A;  2CWY A;  5LYJ E;  3PUS A;  4E7Z A;  2LSI A;  3AB3 B;  2K9A A;  3IBP A;  5FMN A;  2E9X D;  3N2K E;  4V1A v;  5KX5 E;  4ZS3 A;  2E9X B;  4TN7 B;  4KBM B;  4AKL A;  2IC6 A;  2YU2 A;  3NZP A;  2IW5 B;  4YJ2 E;  1BR0 A;  1MMD A;  3ZN0 B;  3Q5W A;  3RYH E;  3H37 A;  3K3O A;  3WAJ A;  1OWA A;  3KV5 A;  2V7J A;  3AA1 B;  4H9S E;  2BVL A;  3I9W A;  3ZMS B;  4DBR A;  5LGN B;  2GK9 A;  4J2C A;  1G8X A;  3ZYM A;  2A2F X;  3C50 A;  4AKH A;  3OYX A;  2DI4 A;  4P0A A;  2D5U A;  4HGA A;  3DJB A;  3UUM A;  1D0X A;  2N1G A;  2EHO D;  5FXV A;  3C64 A;  1US7 B;  2EHO B;  3C4W A;  3GN5 B;  4H63 H;  5H6R B;  4O8S A;  2V26 A;  3ZN1 B;  1IJ5 A;  5LXT E;  2KIN B;  4GIW A;  4X20 E;  1X79 A;  3N9Q A;  4AQF A;  3O1I A;  1IJ6 A;  4WW0 A;  5HWX A;  2Q9Q A;  3HR0 A;  2Y8D A;  2H7O A;  1FMV A;  3UUX B;  4NUV A;  4CXY A;  1BR2 A;  4GOU A;  4GYS A;  3OJA A;  4N78 D;  2D0T A;  2A72 A;  5JRC A;  2CXL A;  5DJQ C;  4BJM A;  2VKJ A;  4TX5 A;  2YU1 A;  5IYZ E;  3ZPO A;  3I0O A;  4QHO A;  3PUA A;  3WI3 A;  3VKG A;  5FP3 A;  4ZI3 D;  4AQF C;  3L09 A;  2MBG A;  3RKO A;  3K3Q C;  2DWG A;  2PBI A;  4UEM A;  5LCY A;  3AVR A;  2Q9Q C;  1WRD A;  3SRZ A;  2MOZ A;  2J1D G;  1YW0 A;  1UCU A;  4XZC A;  2E8I A;  5EZY E;  2UXN B;  3ZC0 A;  3B57 A;  1LRZ A;  4I50 E;  3N2O A;  3KVA A;  2ODV A;  3F31 A;  1S94 A;  3F57 A;  5EK3 A;  2NP9 A;  3LK2 B;  4FJO A;  4OHF A;  2LSK A;  1Z0P A;  2JPF A;  2CMR A;  1MIW A;  4QX7 B;  5LHG B;  3O9X A;  3AVS A;  2X9X A;  1T98 A;  3N2G E;  4H9N C;  5JDH A;  2ES0 A;  4PJM A;  4ZI2 D;  3T8O A;  4WNK A;  1G73 A;  1SA0 E;  1FIO A;  3KBU A;  3HA4 A;  4M1P A;  3CVR A;  4UVC B;  2V7I A;  2PFV A;  3ZJ1 A;  2W62 A;  2X68 A;  2ZM2 A;  3ESL A;  2V7L A;  4L9I A;  4XAX B;  4O4I E;  2VKO A;  3ZCI A;  3P7I A;  4UV8 B;  3PUG A;  5LHI B;  3N5L A;  5FY7 A;  3PU8 A;  2VWA A;  3S4U A;  3V5U A;  4AKI A;  2QGS A;  5L3F B;  3AAA B;  5A1L A;  3PE0 A;  3KDS E;  3SOL A;  2KWI B;  5LHH B;  4EYY R;  1VRB A;  1E1H B;  3C4Z A;  3PU3 A;  4IE4 A;  4DVD A;  3KVB A;  3NRX A;  5KDM C;  4EXT A;  1HG5 A;  3Q9D A;  4DBQ A;  4B6X A;  2LJL A;  4X1Y E;  4QXC B;  3KV6 A;  2C5I T;  3CX8 B;  2ZLY A;  4I43 B;  4GK5 E;  4PJN A;  1ZHC A;  5LGU B;  1MND A;  3RYC E;  4U74 A;  3FBZ A;  4JUY A;  3E08 A;  4UEL A;  4EOZ B;  2CXF A;  2D0U A;  3CPZ A;  4ZS2 A;  4QWN B;  5LGT B;  4WBN E;  3R6N A;  4MLK A;  2A3D A;  2MTQ A;  2XAQ B;  4OYK A;  4U72 A;  4UF0 B;  3O1H A;  1LKX A;  4BJN A;  3FXE B;  3U3I A;  5FXX A;  2X9W A;  3ZMV B;  2SPC A;  2VL8 A;  4ZHQ E;  5HAX A;  2CEA A;  4IGU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...