3L8RA

The crystal structure of ptca from s. mutans
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
102
structure length
102
Chain Sequence
MNTEELQVAAFEIILNSGNARSIVHEAFDAMREKNYILAEQKLQEANDELLKAHQAQTDLLQEYASGTEIKIEIIMVHAQDHLMTTMTLREVAIEMLELYKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of PtcA from Streptococcus mutans
rcsb
source organism Streptococcus mutans
molecule tags Transferase
molecule keywords Putative PTS system, cellobiose-specific IIA component
total genus 45
structure length 102
sequence length 102
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 2.7.1.69: Transferred entry: 2.7.1.191, 2.7.1.192, 2.7.1.193, 2.7.1.194, 2.7.1.195,
pdb deposition date 2010-01-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02255 PTS_IIA PTS system, Lactose/Cellobiose specific IIA subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.80 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Phosphotransferase system, lactose/cellobiose-type IIA subunit 3l8rA00
1E2AA 2E2AA 3L8RA
chains in the Genus database with same CATH superfamily
1R8IA 2ACXA 2YK0A 1MMNA 3Q9DA 4H9OC 3RIFA 3SFEA 1ZOYA 2I0MA 2V6YA 4CI1B 1BR0A 4LFAT 2UU9T 2CCQA 4A98A 4YY3T 2BS4A 4HTEA 1WCRA 4DV6T 4TWFA 3ZYMA 3MKDA 4ISTA 1HR0T 1I6ZA 5FXWA 4DBQA 3FZMB 1X79A 5AQQB 5JDQA 5LGNB 2XM2A 1D1BA 4UEMA 3IEEA 5EZYE 3O1IA 3PDYA 5FXZA 5LBMA 2JMHA 4A5XA 4PK6A 3AE5A 3GA8A 1YQ3A 5CA1E 2VWAA 2WCAA 2YEVC 2XQ9A 5LA6E 3ZC0A 2LE8A 3UU4A 2LKGA 2VL0A 3VRAA 2Y6XA 4X64T 1J5ET 4ZOLE 1YKEB 1UURA 3O4XE 1YXRA 2P9BA 2W62A 3ZYLA 3PUQA 3UFGA 2E9XD 1J1JA 2ACZA 2X9YA 4HWIB 4U3CA 4YHHT 3AE4A 4DR4T 4I0UA 4ZI3C 4UF0B 5L3DB 2XQ5A 2JPFA 4NUUA 5C3JA 5KDMC 4IREA 3AE7A 1XWMA 5TAOA 1M62A 1N34T 1EZ3A 1OEDE 2Q9QC 3PJAA 4F6RC 3FXDB 3GWHA 4J2CA 2NR4A 2E8IA 4C91A 3C4XA 4JV5T 5JRCB 2WZHA 2KINB 3LJCA 3R84B 1XNRT 2BG9E 4NUVA 4DR6T 2FJDA 4IDZA 1D0ZA 2W61A 4JBWF 2WDVA 4DO0A 4DNDA 4A56A 4GKKT 2X0HA 4IE4A 2V5CA 1Z0PA 3UQ4A 1XMOT 3FB2A 2K3WA 3JC6C 4QH1A 2BKPA 4AKIA 1FJGT 2A2FX 2RPAA 3I0QA 3KV5A 3KVBA 3L09A 3ONJA 4IIJE 3BQKA 4DMWA 1Y64B 3CMLA 2HHHT 2D0UA 5M4YA 1HS7A 1MIWA 3AEEA 5H6QB 2YU2A 3PUSA 3VHLA 3LSVA 1KFYA 1LVKA 3IHRA 2V7IA 3KV6A 3LK42 2WB5A 1UUSA 2VQET 5BR8T 2W0GA 5HEHA 3CKDA 2WWVA 2NOXA 2IHR1 1D0XA 1ZEEA 4TN7B 2WDRA 3RRWA 2YKSA 3AXJB 3UUXB 2QYWA 2Q9QA 2W00A 3HKCE 2NTYA 4IDOA 3I1AA 4PJNA 4U33A 3RQWA 2K24A 2VASA 4WW0A 4XAXB 5L47A 4DV0T 3N9PA 5ABHA 2D9DA 2J62A 3G06A 3IF8B 1UX4A 4PK4A 3P4WA 3PUGA 2DWGA 1MIYA 5HCMA 3ZPOA 5LGTB 2CXDA 3OVUA 1OXZA 2CM0A 2KMFA 1VCTA 2JQ9A 1V9DA 2V7KA 3ANWB 2MBGA 5AQIB 3PUXF 3C64A 2LRLA 2MPKA 2KT9A 4UR9A 4DV7T 2OV9A 1XNQT 2HH7A 1SHZC 3ANWA 1YW0A 4HWHA 4I43B 1OEDA 5ADXL 2UXXB 1JNZA 2IUBA 5LNKA 5IWAT 3AE2A 4HFEA 2XPKA 4OYJA 3N9QA 1YD8G 2V7MA 1HX8A 2VL8A 3P50A 4IHJE 4B6XA 4DR7T 4B3TT 4C90A 2XQ8A 2BG9C 2HN2A 2L9QA 3AA1B 3M3ZB 4LF8T 3QNUA 4IE0A 4LF5T 2FUPA 2XSBA 3NZPA 3DP7A 4E7SA 1GQEA 1XMQT 3GN5B 1T72A 2E2AA 4HFIA 5AQUB 3R6NA 4UXNB 2DWKA 3FHNA 1BR1A 2WP9A 2D0TA 2CWOA 5AQPB 2UUCT 4I55E 2EHOC 4HN9A 2J47A 5LBQB 5JR9B 4HWCA 3ONXA 5FY0A 4X1IE 4LF7T 5EK2A 1HX1B 2WU5A 1HTJF 2BS2A 3EI0A 3TLWA 4CQIA 2SPCA 5JDGA 2NTXA 4ZS3A 3ZSSA 1SA0E 1YKHB 3ZKRA 3RGLA 4X65T 2M6IA 1N36T 3C4WA 3MA9A 5J2UE 2VKDA 4U31A 3N9MA 5LHIB 3RIUA 3RYCE 5HXHA 2LSYA 3PUZF 2IIUA 2IDOB 2WU2A 3CWZB 2BZBA 4GIWA 4HWDA 4HFBA 5JR9A 4YSZA 5DQVA 2VKOA 4QXBB 2C5JA 3Q5EA 2YN6A 5FL0A 4CXXA 3AAEB 4YT0A 5JDLA 1H7CA 4YTPA 2VQFT 4AKGA 2WS3A 1W0BA 2YINA 4ILAA 3ZT7A 2CE7A 1UCUA 2CLYB 1T8BA 2FJEA 2M6BA 1NENA 3CX7B 1HG5A 3N2GE 3Q5WA 3EDUA 4I4TE 3EUHA 3RI5A 2CMRA 3RC3A 3RIUC 3RYIE 3ZMTB 4DV4T 2X68A 3AE8A 2XSAA 4EXTA 4O4LE 1W0AA 2VK9A 4YSXA 3ZT5A 3UT5E 2IC9A 3NVOA 2JMKA 4TX5A 2YDSA 5LXTE 3FZHB 3N9OA 1LVFA 4B3RT 2HPLA 5LMNT 2FBWA 4ZI7E 1QLBA 3CX6B 2Y48B 3KV4A 3N2KE 2W67A 2WY2A 4YLHA 4V1Av 3WI3A 5AQGB 4JI4T 1YQ4A 2B76A 1ZV4X 5AQVB 5LOVE 3A7MA 1NEKA 4FI5A 2N9DA 4IE7A 2IW5B 3U3IA 4XBFB 2N1GA 4AXPA 4ZZCA 2CXLA 5JR9C 1US7B 2MOZA 2BVLA 3RF1A 2OA5A 3OYXA 3ZJ1A 4BA9A 4EOZB 3A5XA 2J4GA 2XQ6A 4U7IA 5JDFA 5J2TE 2HN1A 4P1NA 4M1PA 5H6RB 2Y8DA 1ZHCA 1HG2A 2E9XA 4P0AA 3AE3A 3NWIA 3N5LA 3QUJA 2CEAA 3U78A 4ZZBA 5LG3A 3T1HT 4B3MT 2XAQB 2DCFA 2JJ9A 1ZP0A 2XASB 1UX5A 4L0RA 3UUNA 4ILBA 2Q9QB 1D1AA 4LFBT 2V6YB 2YDQA 4TZ4C 2KSRA 3ZT6A 5JDNA 3O1HA 2JQHA 3UUBA 4EEDA 3NBXX 3K3QC 5AQKB 2AXDS 2C5IT 3EHZA 5HEOA 5CB4E 3LBXB 3TLUA 3FBLA 3I0OA 3NRXA 4A97A 3AAIA 1MIVA 3P4QA 4L5GA 4ZXLA 3EDVA 4P0BA 2RA1A 5AQFB 4KHPT 3FZLB 3ZC1A 4P09A 5LGUB 4EIWA 4HEAA 5AQNB 2MAWA 3CVRA 3GN5A 3KDSE 3OJAA 3TKLB 4JI3T 2E5LT 4AI6A 5BMVE 3UQ7A 4H9NC 2EHOD 3AA6B 5KXJA 5EK3A 4NXMT 3AAAB 4MHCA 4ZHQE 3HL6A 3LK3B 2BG9A 5ABFB 3HR0A 4HWFA 4YTNA 4DV5T 4AISA 4JUYA 2XQ4A 2BDEA 2CRBA 4U72A 2NW7A 5JQGE 5FNVE 2XZEA 3Q5DA 3F31A 3BK9A 3LDQB 1KK7A 3MZKB 3PURA 4HFVA 4O2BE 4QX7B 5IUXA 2JRKA 3PUYF 1KF6A 4O4JE 5IYZE 2XY8B 3RC8A 2W4XA 2ODUA 3AA0B 2KNDA 3QK6A 2W63A 1IJ6A 4IL4A 4JI5T 5C8YE 4PJMA 2F4VT 4HFHA 4JI0T 3RKOA 1LKXA 3E22E 2PBIA 3PTRB 3K8PC 4O4IE 4FJOA 1VRBA 2BBJA 2LSIA 4KHZF 4X1YE 1CHUA 3MXZA 5DJQC 2LLYA 5CA0E 1DU2A 2HPJA 4IGUA 3AA7B 4OX9T 4X62T 1IBMT 4UVCB 4PK5A 2QA7A 3ABVA 2ZM0A 3SWHA 3P4RA 3RPUA 3T1YT 2CPTA 3S4UA 4QH5A 4AQFA 4HFDA 4PJJA 3ZN1B 5CGMA 2DL1A 4U74A 3AEFA 2R6GF 3I9YA 2J1DG 1IBLT 3PU3A 4JEUB 2Q9QD 2C0SA 2WWUA 3JCFA 4LMKA 3QB5A 4X20E 2XTLA 2XAGB 2VVSA 4JEHB 4UV9B 2V1DB 5AQHB 5IHYA 3ZEFB 5HXEA 5F3JA 2XQ3A 3RH3A 4IE6A 3ETVA 3AEDA 3RIAA 3LBXA 5E0OA 2H88A 3P8CD 5AQJB 2KWIB 3B5MA 2LM9A 2OLTA 4UV8B 3ESLA 4XZCA 4QKNA 5FXVA 5LCYA 3UUMA 2I6HA 2PFVA 3D0TA 4I50E 3M65A 4H9SE 2VKHA 2LJLA 3V5SA 1HNWT 2XAJB 1B7TA 4JI1T 1Y01A 4JYAT 3H3MA 5JREA 3HKDE 3OKQA 3EVYA 2UXBT 5L3CB 4AQFC 5L2LA 2DI4A 1HFAA 4L9IA 1WR0A 4UF0A 4PJLA 3FZKB 3ZMSB 2DLRA 5JDMA 3UU8A 4DR3T 3AEGA 2LSKA 5GONE 1QUUA 2C5KT 4DR5T 2E9XB 2V6XA 3QC9A 3RYHE 4NPPA 4DUYT 4TNVA 5AQSB 3CX8B 2IMLA 2WMOA 1M7KA 2LOSA 1JNRA 3P4PA 5AQTB 5LG4A 5FKYA 3HI2A 1WRDA 3UULA 2X9XA 4ZI3D 3AEAA 3AEBA 3P7IA 4QXHB 3RHWA 3E0ZA 3W15B 2BVMA 5HXCA 4JI6T 2QRXA 4EEBA 1XDOA 2PG8A 2Z6EA 2BKOA 3UU6A 5CJ5A 1MNEA 4MBQA 5CFBA 5LP6E 4WBNE 3J9X1 2V7JA 2ZM8A 3C50A 3KBUA 4K0KT 3DJBA 5AQOB 2LSGA 3ZJ2A 2H3RA 1AJ3A 1CUNA 3TLTA 5LHGB 1D0YA 3F57A 1MNDA 1MMGA 4AKHA 1FIOA 4DBRA 5F8PA 5AQLB 2NWBA 2X66A 4G63A 4HGAA 1E2AA 1QSDA 3SS1A 5LJMA 3C4ZA 4X5TA 2KLQA 1FMVA 5A1LA 5LJNA 3L8RA 2ZM2A 4IL9A 2N2NA 5ABGA 3PJAJ 4GK5E 1W9RA 1KEYA 3ZN0B 3BQLA 3EABA 3VR8A 4CXWA 4JLEA 2VVNA 4IDPA 2V7LA 2ZMAA 1HCIA 2UXNB 3NKZA 4OYKA 3N9NA 3RRCA 3HKEE 4EAHA 5LHHB 2W66A 5HEGA 1IAPA 2LHRA 4DR2T 4IE5A 3IA3A 5AQMB 3OYZA 3ETUA 4KUMB 5FVLA 3VU7H 1G73A 4KBMB 2DNXA 2XUEA 2IC6A 1O3XA 3AE6A 5JRCA 2AE9A 2X67A 4Z90A 4TWHA 4NXNT 4ZI2C 1WFDA 2UUBT 3N2OA 4TNWA 5JVDE 3C98B 3X1DA 4EYUA 4DMVA 4ISSA 4LF4T 2K9AA 4IDQA 4TUYE 5FVKA 4JI2T 2JIWA 4YFSA 3UU3A 4ERRA 2KWHA 5HAXA 3OTOT 3SOLA 2CHOA 2X9HA 4UVAB 4WZXA 2XM1A 4CN1A 2WM9A 5AQRB 4QWNB 2LKHA 2UXDT 4DIDB 2LEHA 3LFMA 3KV9A 3DTOA 2MYSA 3CK6A 3MACA 3JC6D 2WQYA 4PFOA 4DV3T 4TWDA 3KINB 4NIQA 3C51A 5FY1A 4MFRA 5ABEA 4DV1T 1UGOA 2LRKA 3OPCA 2MTQA 2VKJA 2ES0A 3KVAA 3CIRA 1Z8UA 5J1GA 3JADA 1FMWA 3K1SA 4G2AA 3RLFF 4CN4A 5L3FB 5FL1A 5JH7E 2LM2A 4AQGA 4YJ2E 4PNIA 4U2ZA 1U4QA 4IDNA 2A72A 4MLKA 3UTKA 3CQGB 2RP4A 3Q2MA 3ZCIA 2BBHA 4PFPA 5HEJA 4X66T 3L3PA 5FY7A 1I94T 5HYAA 4LF6T 1N33T 3FXEB 2EHOA 2YU1A 3A8YC 1VCSA 3WAKA 5AFUL 2X9WA 3LG7A 4DR1T 2CBIA 4ZI2D 3I9WA 4YHJA 4ANJA 2V26A 3O1JA 4UIGA 3OBVE 3RQUA 1S35A 4EGWA 4AKLA 2X0LB 4PW8A 4X1KE 3QB5K 5DABA 4BAYB 5L4EA 2QVAA 2IAKA 2XQ7A 3KBTA 1SE7A 4KP3C 2K48A 1WR6A 1L0VA 2X51A 3ZMUB 4ZS2A 1IBKT 4JI7T 1HNXT 5DQWA 5HEUA 1IJ5A 1E7PA 2FJBA 4H9RC 1G8XA 3QOFA 3B13A 4UVBB 2WZIA 1WYBA 2CWYA 4HFCA 4OHFA 5L4HA 5L3BB 4LFCT 2BKNA 2DHRA 2B1EA 2NP9A 2H89A 3JAEA 4GK0E 2CXFA 2H7VC 1OEDB 4H9PC 4GKJT 2V5DA 2YDRA 4LMLA 4DV2T 5FP3A 3O9XA 2CLYC 2G0UA 5F5WA 1XZYA 3PU8A 3VR9A 3CQXC 3AVRA 2H7OA 4U7YA 2D5UA 3T8OA 4CI2B 1T7SA 2XAHB 3ZCJA 2L8KA 3WAJA 2V8SV 2JQQA 3BQIA 1KNRA 2X0YA 5HXRA 2VB6A 3ZSTA 4EB6E 3PV0F 1VOMA 2FJAA 2NW9A 3VKGA 4EZ4A 4F8HA 4TV8E 1HNZT 3HKBE 4MALA 4DUZT 3ONLC 4H63H 4JI8T 2W2UA 2WDQA 4AKRB 1W09A 2M67A 3E08A 3TLVA 2KXPB 5HWYA 3H37A 3AXJA 3PE0A 3ZLIA 2A9UA 4LF9T 2CBJA 2K5BB 5FYMA 1KNZA 2XHEB 2WAUA 4WNKA 5C2TA 3L39A 1WYCA 5ETWA 4EYYR 4KMCA 5HWXA 2LT3A 1HF8A 2LSJA 4BJNA 3AECA 3MK7C 3CPZA 3ZMZB 4CXYA 1MMDA 1NWMX 3F2EA 3PUAA 2CA5A 4KI0F 1WLXA 4N78D 3KFWX 2BG9B 5ABFA 4WBOA 4GYSA 3PUWF 2LOPA 4U2YA 4OFZA 4ASKA 5JTGA 1UK5A 2E9XC 2JQKA 2BS3A 3EAMA 3GMIA 3HA4A 4UELA 4CZZB 1BR4A 4ZEYA 3Q5XA 4IT4A 4OK0A 4CN6A 5L3EB 4LMJA 1OEDC 2D2SA 2I59A 3TLSA 4O4HE 5LB7B 2GK9A 1U5PA 2NW8A 3P4SA 4ILUA 4TV9E 3VRBA 4COFA 1XDPA 4EZHA 5LMUT 1LRZA 1OWAA 2EHOB 5HXSA 2WBLA 2KZ7B 2XQAA 3RKGA 5J0ZA 3ZMVB 4QH4A 1J5WA 4YJ3E 3JAFA 4GOUA 2L3LA 3AB3B 3AVSA 4AQYT 4E7ZA 5KMGP 2XAFB 1T98A 1IZNB 4GYRA 4HKAA 4O8SA 3N9LA 4ILCA 2WSSV 3CQCB 4H9QC 1D1CA 1MMAA 2XQYA 1NAFA 3RX6A 4CI3B 1BR2A 3UU5A 1N32T 4QX8B 2CHNA 1SUMB 4QHOA 4WYVA 3K3NA 4QXCB 2LHNA 2E5VA 5FMNA 2ODVA 4BJMA 4EV6A 5JDHA 2PTFA 2VURA 3RYFE 4Z8XA 3MJXA 3SRZA 3J7Yq 4H63V 5HCJA 1S94A 3FZFB 5EK4A 3SFDA 4ADZA 3VKHA 4Z91A 1FEWA 3PUVF 4Q25A 3ZYKA 2ZLYA 1X9BA 3B57A 4PAGA 4YTMA 5FXXA 3UFEA 3K3OA 4KX6A 2UUAT 1E1HB 2WMNA 2YOEA 4B3ST 3FBZA 1ZKEA 1KNPA 3IBPA 4HE8A 4DVDA 4YXDA 3LK2B 3AE1A 3NZQA 3H3AA 3V5UA 3NRYA 4AIUA 2UXCT 5KX5E 2XJ7A 4O2AE 5LYJE 4K0UA 5L3GB 4YSYA 2QGSA 2ZM6T 2A3DA 3AE9A 2PJQA
chains in the Genus database with same CATH topology
1E2AA 2E2AA 3L8RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E2A A;  2E2A A;  3L8R A; 
#chains in the Genus database with same CATH topology
 1R8I A;  2ACX A;  2YK0 A;  1MMN A;  3Q9D A;  4H9O C;  3RIF A;  3SFE A;  1ZOY A;  2I0M A;  2V6Y A;  4CI1 B;  1BR0 A;  4LFA T;  2UU9 T;  2CCQ A;  4A98 A;  4YY3 T;  2BS4 A;  4HTE A;  1WCR A;  4DV6 T;  4TWF A;  3ZYM A;  3MKD A;  4IST A;  1HR0 T;  1I6Z A;  5FXW A;  4DBQ A;  3FZM B;  1X79 A;  5AQQ B;  5JDQ A;  5LGN B;  2XM2 A;  1D1B A;  4UEM A;  3IEE A;  5EZY E;  3O1I A;  3PDY A;  5FXZ A;  5LBM A;  2JMH A;  4A5X A;  4PK6 A;  3AE5 A;  3GA8 A;  1YQ3 A;  5CA1 E;  2VWA A;  2WCA A;  2YEV C;  2XQ9 A;  5LA6 E;  3ZC0 A;  2LE8 A;  3UU4 A;  2LKG A;  2VL0 A;  3VRA A;  2Y6X A;  4X64 T;  1J5E T;  4ZOL E;  1YKE B;  1UUR A;  3O4X E;  1YXR A;  2P9B A;  2W62 A;  3ZYL A;  3PUQ A;  3UFG A;  2E9X D;  1J1J A;  2ACZ A;  2X9Y A;  4HWI B;  4U3C A;  4YHH T;  3AE4 A;  4DR4 T;  4I0U A;  4ZI3 C;  4UF0 B;  5L3D B;  2XQ5 A;  2JPF A;  4NUU A;  5C3J A;  5KDM C;  4IRE A;  3AE7 A;  1XWM A;  5TAO A;  1M62 A;  1N34 T;  1EZ3 A;  1OED E;  2Q9Q C;  3PJA A;  4F6R C;  3FXD B;  3GWH A;  4J2C A;  2NR4 A;  2E8I A;  4C91 A;  3C4X A;  4JV5 T;  5JRC B;  2WZH A;  2KIN B;  3LJC A;  3R84 B;  1XNR T;  2BG9 E;  4NUV A;  4DR6 T;  2FJD A;  4IDZ A;  1D0Z A;  2W61 A;  4JBW F;  2WDV A;  4DO0 A;  4DND A;  4A56 A;  4GKK T;  2X0H A;  4IE4 A;  2V5C A;  1Z0P A;  3UQ4 A;  1XMO T;  3FB2 A;  2K3W A;  3JC6 C;  4QH1 A;  2BKP A;  4AKI A;  1FJG T;  2A2F X;  2RPA A;  3I0Q A;  3KV5 A;  3KVB A;  3L09 A;  3ONJ A;  4IIJ E;  3BQK A;  4DMW A;  1Y64 B;  3CML A;  2HHH T;  2D0U A;  5M4Y A;  1HS7 A;  1MIW A;  3AEE A;  5H6Q B;  2YU2 A;  3PUS A;  3VHL A;  3LSV A;  1KFY A;  1LVK A;  3IHR A;  2V7I A;  3KV6 A;  3LK4 2;  2WB5 A;  1UUS A;  2VQE T;  5BR8 T;  2W0G A;  5HEH A;  3CKD A;  2WWV A;  2NOX A;  2IHR 1;  1D0X A;  1ZEE A;  4TN7 B;  2WDR A;  3RRW A;  2YKS A;  3AXJ B;  3UUX B;  2QYW A;  2Q9Q A;  2W00 A;  3HKC E;  2NTY A;  4IDO A;  3I1A A;  4PJN A;  4U33 A;  3RQW A;  2K24 A;  2VAS A;  4WW0 A;  4XAX B;  5L47 A;  4DV0 T;  3N9P A;  5ABH A;  2D9D A;  2J62 A;  3G06 A;  3IF8 B;  1UX4 A;  4PK4 A;  3P4W A;  3PUG A;  2DWG A;  1MIY A;  5HCM A;  3ZPO A;  5LGT B;  2CXD A;  3OVU A;  1OXZ A;  2CM0 A;  2KMF A;  1VCT A;  2JQ9 A;  1V9D A;  2V7K A;  3ANW B;  2MBG A;  5AQI B;  3PUX F;  3C64 A;  2LRL A;  2MPK A;  2KT9 A;  4UR9 A;  4DV7 T;  2OV9 A;  1XNQ T;  2HH7 A;  1SHZ C;  3ANW A;  1YW0 A;  4HWH A;  4I43 B;  1OED A;  5ADX L;  2UXX B;  1JNZ A;  2IUB A;  5LNK A;  5IWA T;  3AE2 A;  4HFE A;  2XPK A;  4OYJ A;  3N9Q A;  1YD8 G;  2V7M A;  1HX8 A;  2VL8 A;  3P50 A;  4IHJ E;  4B6X A;  4DR7 T;  4B3T T;  4C90 A;  2XQ8 A;  2BG9 C;  2HN2 A;  2L9Q A;  3AA1 B;  3M3Z B;  4LF8 T;  3QNU A;  4IE0 A;  4LF5 T;  2FUP A;  2XSB A;  3NZP A;  3DP7 A;  4E7S A;  1GQE A;  1XMQ T;  3GN5 B;  1T72 A;  2E2A A;  4HFI A;  5AQU B;  3R6N A;  4UXN B;  2DWK A;  3FHN A;  1BR1 A;  2WP9 A;  2D0T A;  2CWO A;  5AQP B;  2UUC T;  4I55 E;  2EHO C;  4HN9 A;  2J47 A;  5LBQ B;  5JR9 B;  4HWC A;  3ONX A;  5FY0 A;  4X1I E;  4LF7 T;  5EK2 A;  1HX1 B;  2WU5 A;  1HTJ F;  2BS2 A;  3EI0 A;  3TLW A;  4CQI A;  2SPC A;  5JDG A;  2NTX A;  4ZS3 A;  3ZSS A;  1SA0 E;  1YKH B;  3ZKR A;  3RGL A;  4X65 T;  2M6I A;  1N36 T;  3C4W A;  3MA9 A;  5J2U E;  2VKD A;  4U31 A;  3N9M A;  5LHI B;  3RIU A;  3RYC E;  5HXH A;  2LSY A;  3PUZ F;  2IIU A;  2IDO B;  2WU2 A;  3CWZ B;  2BZB A;  4GIW A;  4HWD A;  4HFB A;  5JR9 A;  4YSZ A;  5DQV A;  2VKO A;  4QXB B;  2C5J A;  3Q5E A;  2YN6 A;  5FL0 A;  4CXX A;  3AAE B;  4YT0 A;  5JDL A;  1H7C A;  4YTP A;  2VQF T;  4AKG A;  2WS3 A;  1W0B A;  2YIN A;  4ILA A;  3ZT7 A;  2CE7 A;  1UCU A;  2CLY B;  1T8B A;  2FJE A;  2M6B A;  1NEN A;  3CX7 B;  1HG5 A;  3N2G E;  3Q5W A;  3EDU A;  4I4T E;  3EUH A;  3RI5 A;  2CMR A;  3RC3 A;  3RIU C;  3RYI E;  3ZMT B;  4DV4 T;  2X68 A;  3AE8 A;  2XSA A;  4EXT A;  4O4L E;  1W0A A;  2VK9 A;  4YSX A;  3ZT5 A;  3UT5 E;  2IC9 A;  3NVO A;  2JMK A;  4TX5 A;  2YDS A;  5LXT E;  3FZH B;  3N9O A;  1LVF A;  4B3R T;  2HPL A;  5LMN T;  2FBW A;  4ZI7 E;  1QLB A;  3CX6 B;  2Y48 B;  3KV4 A;  3N2K E;  2W67 A;  2WY2 A;  4YLH A;  4V1A v;  3WI3 A;  5AQG B;  4JI4 T;  1YQ4 A;  2B76 A;  1ZV4 X;  5AQV B;  5LOV E;  3A7M A;  1NEK A;  4FI5 A;  2N9D A;  4IE7 A;  2IW5 B;  3U3I A;  4XBF B;  2N1G A;  4AXP A;  4ZZC A;  2CXL A;  5JR9 C;  1US7 B;  2MOZ A;  2BVL A;  3RF1 A;  2OA5 A;  3OYX A;  3ZJ1 A;  4BA9 A;  4EOZ B;  3A5X A;  2J4G A;  2XQ6 A;  4U7I A;  5JDF A;  5J2T E;  2HN1 A;  4P1N A;  4M1P A;  5H6R B;  2Y8D A;  1ZHC A;  1HG2 A;  2E9X A;  4P0A A;  3AE3 A;  3NWI A;  3N5L A;  3QUJ A;  2CEA A;  3U78 A;  4ZZB A;  5LG3 A;  3T1H T;  4B3M T;  2XAQ B;  2DCF A;  2JJ9 A;  1ZP0 A;  2XAS B;  1UX5 A;  4L0R A;  3UUN A;  4ILB A;  2Q9Q B;  1D1A A;  4LFB T;  2V6Y B;  2YDQ A;  4TZ4 C;  2KSR A;  3ZT6 A;  5JDN A;  3O1H A;  2JQH A;  3UUB A;  4EED A;  3NBX X;  3K3Q C;  5AQK B;  2AXD S;  2C5I T;  3EHZ A;  5HEO A;  5CB4 E;  3LBX B;  3TLU A;  3FBL A;  3I0O A;  3NRX A;  4A97 A;  3AAI A;  1MIV A;  3P4Q A;  4L5G A;  4ZXL A;  3EDV A;  4P0B A;  2RA1 A;  5AQF B;  4KHP T;  3FZL B;  3ZC1 A;  4P09 A;  5LGU B;  4EIW A;  4HEA A;  5AQN B;  2MAW A;  3CVR A;  3GN5 A;  3KDS E;  3OJA A;  3TKL B;  4JI3 T;  2E5L T;  4AI6 A;  5BMV E;  3UQ7 A;  4H9N C;  2EHO D;  3AA6 B;  5KXJ A;  5EK3 A;  4NXM T;  3AAA B;  4MHC A;  4ZHQ E;  3HL6 A;  3LK3 B;  2BG9 A;  5ABF B;  3HR0 A;  4HWF A;  4YTN A;  4DV5 T;  4AIS A;  4JUY A;  2XQ4 A;  2BDE A;  2CRB A;  4U72 A;  2NW7 A;  5JQG E;  5FNV E;  2XZE A;  3Q5D A;  3F31 A;  3BK9 A;  3LDQ B;  1KK7 A;  3MZK B;  3PUR A;  4HFV A;  4O2B E;  4QX7 B;  5IUX A;  2JRK A;  3PUY F;  1KF6 A;  4O4J E;  5IYZ E;  2XY8 B;  3RC8 A;  2W4X A;  2ODU A;  3AA0 B;  2KND A;  3QK6 A;  2W63 A;  1IJ6 A;  4IL4 A;  4JI5 T;  5C8Y E;  4PJM A;  2F4V T;  4HFH A;  4JI0 T;  3RKO A;  1LKX A;  3E22 E;  2PBI A;  3PTR B;  3K8P C;  4O4I E;  4FJO A;  1VRB A;  2BBJ A;  2LSI A;  4KHZ F;  4X1Y E;  1CHU A;  3MXZ A;  5DJQ C;  2LLY A;  5CA0 E;  1DU2 A;  2HPJ A;  4IGU A;  3AA7 B;  4OX9 T;  4X62 T;  1IBM T;  4UVC B;  4PK5 A;  2QA7 A;  3ABV A;  2ZM0 A;  3SWH A;  3P4R A;  3RPU A;  3T1Y T;  2CPT A;  3S4U A;  4QH5 A;  4AQF A;  4HFD A;  4PJJ A;  3ZN1 B;  5CGM A;  2DL1 A;  4U74 A;  3AEF A;  2R6G F;  3I9Y A;  2J1D G;  1IBL T;  3PU3 A;  4JEU B;  2Q9Q D;  2C0S A;  2WWU A;  3JCF A;  4LMK A;  3QB5 A;  4X20 E;  2XTL A;  2XAG B;  2VVS A;  4JEH B;  4UV9 B;  2V1D B;  5AQH B;  5IHY A;  3ZEF B;  5HXE A;  5F3J A;  2XQ3 A;  3RH3 A;  4IE6 A;  3ETV A;  3AED A;  3RIA A;  3LBX A;  5E0O A;  2H88 A;  3P8C D;  5AQJ B;  2KWI B;  3B5M A;  2LM9 A;  2OLT A;  4UV8 B;  3ESL A;  4XZC A;  4QKN A;  5FXV A;  5LCY A;  3UUM A;  2I6H A;  2PFV A;  3D0T A;  4I50 E;  3M65 A;  4H9S E;  2VKH A;  2LJL A;  3V5S A;  1HNW T;  2XAJ B;  1B7T A;  4JI1 T;  1Y01 A;  4JYA T;  3H3M A;  5JRE A;  3HKD E;  3OKQ A;  3EVY A;  2UXB T;  5L3C B;  4AQF C;  5L2L A;  2DI4 A;  1HFA A;  4L9I A;  1WR0 A;  4UF0 A;  4PJL A;  3FZK B;  3ZMS B;  2DLR A;  5JDM A;  3UU8 A;  4DR3 T;  3AEG A;  2LSK A;  5GON E;  1QUU A;  2C5K T;  4DR5 T;  2E9X B;  2V6X A;  3QC9 A;  3RYH E;  4NPP A;  4DUY T;  4TNV A;  5AQS B;  3CX8 B;  2IML A;  2WMO A;  1M7K A;  2LOS A;  1JNR A;  3P4P A;  5AQT B;  5LG4 A;  5FKY A;  3HI2 A;  1WRD A;  3UUL A;  2X9X A;  4ZI3 D;  3AEA A;  3AEB A;  3P7I A;  4QXH B;  3RHW A;  3E0Z A;  3W15 B;  2BVM A;  5HXC A;  4JI6 T;  2QRX A;  4EEB A;  1XDO A;  2PG8 A;  2Z6E A;  2BKO A;  3UU6 A;  5CJ5 A;  1MNE A;  4MBQ A;  5CFB A;  5LP6 E;  4WBN E;  3J9X 1;  2V7J A;  2ZM8 A;  3C50 A;  3KBU A;  4K0K T;  3DJB A;  5AQO B;  2LSG A;  3ZJ2 A;  2H3R A;  1AJ3 A;  1CUN A;  3TLT A;  5LHG B;  1D0Y A;  3F57 A;  1MND A;  1MMG A;  4AKH A;  1FIO A;  4DBR A;  5F8P A;  5AQL B;  2NWB A;  2X66 A;  4G63 A;  4HGA A;  1E2A A;  1QSD A;  3SS1 A;  5LJM A;  3C4Z A;  4X5T A;  2KLQ A;  1FMV A;  5A1L A;  5LJN A;  3L8R A;  2ZM2 A;  4IL9 A;  2N2N A;  5ABG A;  3PJA J;  4GK5 E;  1W9R A;  1KEY A;  3ZN0 B;  3BQL A;  3EAB A;  3VR8 A;  4CXW A;  4JLE A;  2VVN A;  4IDP A;  2V7L A;  2ZMA A;  1HCI A;  2UXN B;  3NKZ A;  4OYK A;  3N9N A;  3RRC A;  3HKE E;  4EAH A;  5LHH B;  2W66 A;  5HEG A;  1IAP A;  2LHR A;  4DR2 T;  4IE5 A;  3IA3 A;  5AQM B;  3OYZ A;  3ETU A;  4KUM B;  5FVL A;  3VU7 H;  1G73 A;  4KBM B;  2DNX A;  2XUE A;  2IC6 A;  1O3X A;  3AE6 A;  5JRC A;  2AE9 A;  2X67 A;  4Z90 A;  4TWH A;  4NXN T;  4ZI2 C;  1WFD A;  2UUB T;  3N2O A;  4TNW A;  5JVD E;  3C98 B;  3X1D A;  4EYU A;  4DMV A;  4ISS A;  4LF4 T;  2K9A A;  4IDQ A;  4TUY E;  5FVK A;  4JI2 T;  2JIW A;  4YFS A;  3UU3 A;  4ERR A;  2KWH A;  5HAX A;  3OTO T;  3SOL A;  2CHO A;  2X9H A;  4UVA B;  4WZX A;  2XM1 A;  4CN1 A;  2WM9 A;  5AQR B;  4QWN B;  2LKH A;  2UXD T;  4DID B;  2LEH A;  3LFM A;  3KV9 A;  3DTO A;  2MYS A;  3CK6 A;  3MAC A;  3JC6 D;  2WQY A;  4PFO A;  4DV3 T;  4TWD A;  3KIN B;  4NIQ A;  3C51 A;  5FY1 A;  4MFR A;  5ABE A;  4DV1 T;  1UGO A;  2LRK A;  3OPC A;  2MTQ A;  2VKJ A;  2ES0 A;  3KVA A;  3CIR A;  1Z8U A;  5J1G A;  3JAD A;  1FMW A;  3K1S A;  4G2A A;  3RLF F;  4CN4 A;  5L3F B;  5FL1 A;  5JH7 E;  2LM2 A;  4AQG A;  4YJ2 E;  4PNI A;  4U2Z A;  1U4Q A;  4IDN A;  2A72 A;  4MLK A;  3UTK A;  3CQG B;  2RP4 A;  3Q2M A;  3ZCI A;  2BBH A;  4PFP A;  5HEJ A;  4X66 T;  3L3P A;  5FY7 A;  1I94 T;  5HYA A;  4LF6 T;  1N33 T;  3FXE B;  2EHO A;  2YU1 A;  3A8Y C;  1VCS A;  3WAK A;  5AFU L;  2X9W A;  3LG7 A;  4DR1 T;  2CBI A;  4ZI2 D;  3I9W A;  4YHJ A;  4ANJ A;  2V26 A;  3O1J A;  4UIG A;  3OBV E;  3RQU A;  1S35 A;  4EGW A;  4AKL A;  2X0L B;  4PW8 A;  4X1K E;  3QB5 K;  5DAB A;  4BAY B;  5L4E A;  2QVA A;  2IAK A;  2XQ7 A;  3KBT A;  1SE7 A;  4KP3 C;  2K48 A;  1WR6 A;  1L0V A;  2X51 A;  3ZMU B;  4ZS2 A;  1IBK T;  4JI7 T;  1HNX T;  5DQW A;  5HEU A;  1IJ5 A;  1E7P A;  2FJB A;  4H9R C;  1G8X A;  3QOF A;  3B13 A;  4UVB B;  2WZI A;  1WYB A;  2CWY A;  4HFC A;  4OHF A;  5L4H A;  5L3B B;  4LFC T;  2BKN A;  2DHR A;  2B1E A;  2NP9 A;  2H89 A;  3JAE A;  4GK0 E;  2CXF A;  2H7V C;  1OED B;  4H9P C;  4GKJ T;  2V5D A;  2YDR A;  4LML A;  4DV2 T;  5FP3 A;  3O9X A;  2CLY C;  2G0U A;  5F5W A;  1XZY A;  3PU8 A;  3VR9 A;  3CQX C;  3AVR A;  2H7O A;  4U7Y A;  2D5U A;  3T8O A;  4CI2 B;  1T7S A;  2XAH B;  3ZCJ A;  2L8K A;  3WAJ A;  2V8S V;  2JQQ A;  3BQI A;  1KNR A;  2X0Y A;  5HXR A;  2VB6 A;  3ZST A;  4EB6 E;  3PV0 F;  1VOM A;  2FJA A;  2NW9 A;  3VKG A;  4EZ4 A;  4F8H A;  4TV8 E;  1HNZ T;  3HKB E;  4MAL A;  4DUZ T;  3ONL C;  4H63 H;  4JI8 T;  2W2U A;  2WDQ A;  4AKR B;  1W09 A;  2M67 A;  3E08 A;  3TLV A;  2KXP B;  5HWY A;  3H37 A;  3AXJ A;  3PE0 A;  3ZLI A;  2A9U A;  4LF9 T;  2CBJ A;  2K5B B;  5FYM A;  1KNZ A;  2XHE B;  2WAU A;  4WNK A;  5C2T A;  3L39 A;  1WYC A;  5ETW A;  4EYY R;  4KMC A;  5HWX A;  2LT3 A;  1HF8 A;  2LSJ A;  4BJN A;  3AEC A;  3MK7 C;  3CPZ A;  3ZMZ B;  4CXY A;  1MMD A;  1NWM X;  3F2E A;  3PUA A;  2CA5 A;  4KI0 F;  1WLX A;  4N78 D;  3KFW X;  2BG9 B;  5ABF A;  4WBO A;  4GYS A;  3PUW F;  2LOP A;  4U2Y A;  4OFZ A;  4ASK A;  5JTG A;  1UK5 A;  2E9X C;  2JQK A;  2BS3 A;  3EAM A;  3GMI A;  3HA4 A;  4UEL A;  4CZZ B;  1BR4 A;  4ZEY A;  3Q5X A;  4IT4 A;  4OK0 A;  4CN6 A;  5L3E B;  4LMJ A;  1OED C;  2D2S A;  2I59 A;  3TLS A;  4O4H E;  5LB7 B;  2GK9 A;  1U5P A;  2NW8 A;  3P4S A;  4ILU A;  4TV9 E;  3VRB A;  4COF A;  1XDP A;  4EZH A;  5LMU T;  1LRZ A;  1OWA A;  2EHO B;  5HXS A;  2WBL A;  2KZ7 B;  2XQA A;  3RKG A;  5J0Z A;  3ZMV B;  4QH4 A;  1J5W A;  4YJ3 E;  3JAF A;  4GOU A;  2L3L A;  3AB3 B;  3AVS A;  4AQY T;  4E7Z A;  5KMG P;  2XAF B;  1T98 A;  1IZN B;  4GYR A;  4HKA A;  4O8S A;  3N9L A;  4ILC A;  2WSS V;  3CQC B;  4H9Q C;  1D1C A;  1MMA A;  2XQY A;  1NAF A;  3RX6 A;  4CI3 B;  1BR2 A;  3UU5 A;  1N32 T;  4QX8 B;  2CHN A;  1SUM B;  4QHO A;  4WYV A;  3K3N A;  4QXC B;  2LHN A;  2E5V A;  5FMN A;  2ODV A;  4BJM A;  4EV6 A;  5JDH A;  2PTF A;  2VUR A;  3RYF E;  4Z8X A;  3MJX A;  3SRZ A;  3J7Y q;  4H63 V;  5HCJ A;  1S94 A;  3FZF B;  5EK4 A;  3SFD A;  4ADZ A;  3VKH A;  4Z91 A;  1FEW A;  3PUV F;  4Q25 A;  3ZYK A;  2ZLY A;  1X9B A;  3B57 A;  4PAG A;  4YTM A;  5FXX A;  3UFE A;  3K3O A;  4KX6 A;  2UUA T;  1E1H B;  2WMN A;  2YOE A;  4B3S T;  3FBZ A;  1ZKE A;  1KNP A;  3IBP A;  4HE8 A;  4DVD A;  4YXD A;  3LK2 B;  3AE1 A;  3NZQ A;  3H3A A;  3V5U A;  3NRY A;  4AIU A;  2UXC T;  5KX5 E;  2XJ7 A;  4O2A E;  5LYJ E;  4K0U A;  5L3G B;  4YSY A;  2QGS A;  2ZM6 T;  2A3D A;  3AE9 A;  2PJQ A; 
#chains in the Genus database with same CATH homology
 1E2A A;  2E2A A;  3L8R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...