3L8RA

The crystal structure of ptca from s. mutans
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
102
structure length
102
Chain Sequence
b'MNTEELQVAAFEIILNSGNARSIVHEAFDAMREKNYILAEQKLQEANDELLKAHQAQTDLLQEYASGTEIKIEIIMVHAQDHLMTTMTLREVAIEMLELYKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative PTS system, cellobiose-specific IIA component
publication title The crystal structure of PtcA from Streptococcus mutans
rcsb
source organism Streptococcus mutans
molecule tags Transferase
total genus 45
structure length 102
sequence length 102
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 2.7.1.69: Transferred entry: 2.7.1.191, 2.7.1.192, 2.7.1.193, 2.7.1.194, 2.7.1.195,
pdb deposition date 2010-01-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02255 PTS_IIA PTS system, Lactose/Cellobiose specific IIA subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.80 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Phosphotransferase system, lactose/cellobiose-type IIA subunit 3l8rA00
1E2AA 2E2AA 3L8RA
chains in the Genus database with same CATH superfamily
1T98A 3IEEA 4IE7A 5LG3A 2LSGA 3NZPA 3P8CD 4U2YA 3IF8B 3L09A 1OEDC 4U2ZA 3EHZA 4X5TA 3ZMZB 1L0VA 4H9OC 1OXZA 4IE4A 3MK7C 3RYFE 1ZKEA 3JAFA 2W61A 5JDLA 3RC3A 5CGMA 3L8RA 4I55E 3V5UA 1HTJF 4IE0A 4NIQA 3NWIA 2YU1A 1UCUA 3ZSSA 1UX4A 4DR7T 4JI3T 5F5WA 5JR9A 4B3TT 2IIUA 5AQOB 4X1KE 4TWDA 4CN4A 5LCYA 4NUUA 5A1LA 2KWHA 1D1BA 5AQGB 3I9WA 1KNPA 4CI1B 5HAXA 1MNDA 2LOPA 4AKHA 4ZZBA 4YSZA 4JI7T 5IUXA 3PUGA 3AA6B 1MIYA 4UXNB 4P0BA 2DWKA 2K48A 3A5XA 2DI4A 5KX5E 3I0OA 4LMKA 3T8OA 2XM2A 1WCRA 3KV5A 3N9MA 3D0TA 4P0AA 4LF4T 4LF8T 3X1DA 3BQKA 5C8YE 2PBIA 2XQ3A 3HL6A 2XQ4A 3OJAA 5HCJA 4JV5T 5ABGA 3AE6A 3CKDA 2WZHA 5FMNA 2F4VT 2IDOB 4AI6A 5J2TE 3PV0F 3TLTA 4EOZB 2V7KA 4E7SA 5L3EB 3ZMTB 3Q2MA 2QA7A 2WB5A 1MIWA 3P4PA 1Z8UA 3BQIA 3LSVA 3PUQA 1GQEA 3RIFA 5EZYE 3N9OA 3SS1A 3EABA 4H63V 2ZM6T 4P1NA 2XASB 4ZZCA 3AXJA 4EIWA 2NTXA 3LBXB 2BKNA 3Q9DA 2ES0A 5DQVA 4CI2B 3IHRA 1I94T 4BJMA 2J62A 2XAQB 1WR0A 1XMQT 4HFVA 2JRKA 2HN1A 4H9RC 3AB3B 4L5GA 4U74A 2WP9A 2J1DG 3ZN0B 2M67A 4YXDA 3MKDA 4X65T 3LDQB 5JREA 4MFRA 4WYVA 4X64T 4GKJT 4UVAB 4NXMT 2V7IA 2LHRA 4Z8XA 3ZMSB 3MACA 4CN1A 3FBLA 3AE2A 2H3RA 4AKLA 4HE8A 3AE8A 3UUBA 4LF6T 4O4IE 5LGNB 3RC8A 4CQIA 2AE9A 4CXXA 5KDMC 3PUVF 3PTRB 2YN6A 4U7YA 3ZMVB 3UTKA 5JDMA 1SA0E 3SRZA 3AEAA 3P7IA 1XZYA 3AA0B 2KZ7B 3RQWA 2LM2A 4UVCB 3OKQA 4QH5A 4TWFA 4CN6A 4DV2T 2BVLA 3CX7B 3C64A 3SFEA 2YDQA 4DBQA 1N33T 2M6IA 3EAMA 4N78D 3Q5EA 4KUMB 2C0SA 4DVDA 5FNVE 4DV4T 3V5SA 3F2EA 4GYSA 3KVAA 4EEBA 5ABFA 4LF9T 3CK6A 1WYBA 2W00A 3E0ZA 4K0UA 4KMCA 2PFVA 1MMDA 3UUXB 5BR8T 1R8IA 1XDOA 2UXCT 3QK6A 4MBQA 2UUAT 1UX5A 1VOMA 4PAGA 2VL8A 4KX6A 2L9QA 2SPCA 4X1IE 5J0ZA 1J5ET 3TLUA 1OEDA 3UULA 5LNKA 2BG9E 2VVNA 1XWMA 4C90A 1IBKT 4KP3C 2WDRA 4AQFC 5FXXA 3GN5B 2UUCT 4CI3B 2OLTA 2UUBT 4DV3T 2VVSA 3C4ZA 1BR1A 3AVSA 1T7SA 2CM0A 3PUYF 5C2TA 3P4QA 5L47A 4JI5T 4DR1T 3RIUC 4YFSA 4HFDA 3W15B 5HEGA 1MMAA 2CEAA 5FVLA 3GMIA 3FXEB 5LG4A 1E2AA 4GIWA 2D0UA 2UXNB 4A5XA 2WWVA 4PFPA 2Q9QB 3VKHA 2A3DA 2LE8A 5GONE 3LFMA 4ZI3C 1BR2A 4AKGA 2X67A 3OBVE 4E7ZA 4H63H 4GOUA 3AECA 1NEKA 2K9AA 5FKYA 5JTGA 1YD8G 4JBWF 5F3JA 3KINB 5LHGB 4JI4T 4UV9B 1OWAA 3A7MA 2Q9QC 3RI5A 2XY8B 3EUHA 2XM1A 2QVAA 5AQRB 2YK0A 3IBPA 1KFYA 4LFBT 4PK6A 3AA1B 3H3AA 5LB7B 2C5JA 4I43B 4IREA 3LJCA 1N34T 3HKEE 2I0MA 2IMLA 3O4XE 4TUYE 2W4XA 3UU5A 5CJ5A 4KHZF 3ZKRA 3GWHA 1SUMB 2W66A 1KNRA 4YJ3E 4WNKA 1WFDA 2WCAA 2LOSA 2JIWA 3JADA 5IWAT 2V7LA 2KNDA 3PURA 4G2AA 2EHOC 5LYJE 3O1IA 3ETUA 3PUSA 2CE7A 4ZHQE 2BS4A 5CA0E 4K0KT 4DV6T 5AQHB 1LVFA 5AQJB 2CWYA 4YHHT 3N9QA 3OYXA 2XSAA 3LBXA 2CRBA 3ZJ1A 2NOXA 4IDNA 3QB5A 4O4LE 1YQ3A 4DR2T 4AKRB 2FJEA 2VQFT 1AJ3A 2B1EA 1W09A 4AISA 1KNZA 4YY3T 2JJ9A 3RX6A 3UU3A 2HH7A 2V5CA 2CPTA 4GK0E 3RHWA 2ZM2A 2A72A 2X0YA 4ADZA 5L3GB 4UF0B 1Z0PA 3ESLA 1HNXT 2I6HA 1B7TA 4EXTA 4DIDB 2DHRA 5JDGA 5HXEA 2N2NA 1DU2A 3QOFA 3QUJA 3CPZA 2LKHA 5AQSB 1MIVA 3FZLB 1XDPA 2FJBA 4IE5A 3DTOA 3AA7B 1T8BA 2JMHA 3RYHE 2IUBA 2MOZA 4ERRA 1HS7A 2IHR1 5H6RB 3K3QC 4HTEA 2Y8DA 5LA6E 4EGWA 1HCIA 2VKOA 5KXJA 1V9DA 2DWGA 5LBQB 3DJBA 2XUEA 5HXRA 5AQIB 3OYZA 5F8PA 3EI0A 4EZ4A 3MZKB 2XQ7A 1MMGA 5L4EA 1QLBA 4HWIB 3CQGB 4TZ4C 2CHOA 2UU9T 3K3NA 4XBFB 3VU7H 3UQ7A 2WQYA 4V1Av 4CXWA 3N5LA 5L4HA 2NW7A 1YXRA 2QRXA 3KDSE 4TV9E 4AQFA 2HN2A 4HFEA 3AVRA 2UXXB 5AQTB 4L0RA 2CBJA 2CWOA 3ETVA 2XQAA 5LOVE 3MXZA 1NWMX 2BKOA 2BZBA 3FZMB 3RIUA 3UU6A 2FUPA 1KF6A 3GN5A 3KV9A 5C3JA 2D0TA 4IDZA 2RA1A 3CVRA 2NW8A 2XAFB 4YTPA 5AQUB 5L3CB 3UU8A 1D0YA 3G06A 3RKGA 2Y6XA 4YSYA 4UR9A 2YOEA 3AAIA 5LGTB 4HWCA 2CLYB 4MALA 4B3RT 5HXHA 1HNWT 2Q9QA 4PJJA 4GYRA 1XNQT 1HG5A 5L3BB 2W0GA 5HWYA 1LKXA 5LGUB 2LM9A 3ZYKA 4G63A 3P50A 2Z6EA 2BG9B 3KBTA 1FMVA 3PUXF 1WRDA 4IDQA 3FZKB 5BMVE 4DV0T 2CLYC 2VKDA 5HEJA 1JNZA 5JDHA 4NPPA 4EEDA 2WAUA 2H88A 3E22E 3QB5K 1YKEB 3SFDA 4AQGA 4A98A 4XZCA 2BG9C 2JQKA 2BVMA 1G73A 3HKCE 5HXSA 3SOLA 5JH7E 3RYIE 3HKBE 4H9NC 4DMWA 1G8XA 2VASA 4UELA 2J4GA 2B76A 4TNWA 1MMNA 4HWHA 4JI8T 2GK9A 3RIAA 4JI1T 4P09A 3F57A 3OPCA 4ZOLE 4XAXB 4IIJE 2X0LB 3C98B 2LKGA 5LBMA 2YINA 1S94A 3J7Yq 2ACZA 2X51A 3UQ4A 1W9RA 4LF5T 1FIOA 3LK3B 4DO0A 1M7KA 3P4RA 3ZCIA 2VWAA 2M6BA 4PK4A 1J1JA 4DUZT 2KLQA 4I50E 1XMOT 1YKHB 5AQVB 2NW9A 5FVKA 5LXTE 4LFCT 2K24A 2JPFA 4LMJA 4QH1A 5LMNT 4OYJA 3ANWB 2Q9QD 2ZLYA 2RP4A 5CFBA 1W0AA 1D0ZA 2XQ5A 3ZCJA 4ZS3A 4U31A 1FJGT 3WI3A 2V7MA 5JDQA 3LG7A 3PU3A 2XAJB 4LMLA 4DMVA 5J1GA 5FL1A 4A56A 2XSBA 3AEBA 3Q5DA 5FY1A 2E5VA 3FXDB 2E5LT 3R84B 2JQHA 4B3MT 3JC6D 3AAAB 3KV4A 4UF0A 2MBGA 4B6XA 5FXVA 2RPAA 4IHJE 3RPUA 2X0HA 5DJQC 2XQYA 4ILAA 3VHLA 3FHNA 3O1JA 2ZMAA 5FY7A 4TWHA 2YEVC 4ISSA 2MAWA 4IT4A 3ZYMA 4PJMA 2CBIA 2A2FX 2K3WA 4YTMA 2QGSA 3ZEFB 4YT0A 5L3DB 3K8PC 1XNRT 2WSSV 3BQLA 2JQ9A 4LF7T 1KEYA 2YKSA 4JLEA 3UFEA 2W63A 2E2AA 2MPKA 3VRAA 4EYYR 2L8KA 2X68A 1M62A 2WU5A 2JQQA 3UUMA 3QC9A 5L2LA 2PJQA 5LHIB 4Z91A 2WDVA 4DR4T 5JRCB 1I6ZA 5FXWA 3AEEA 5JDFA 3ZPOA 4OFZA 3QNUA 3AEFA 2OV9A 5E0OA 5HWXA 5FL0A 3EDUA 2AXDS 1D0XA 5DABA 1SHZC 3F31A 2EHOB 2CMRA 4LFAT 3T1YT 5IYZE 4AIUA 4KI0F 4YJ2E 4FJOA 3BK9A 4U7IA 4ZI2C 1H7CA 3AE1A 2OA5A 3ZC1A 1LVKA 2VK9A 1NAFA 4JUYA 3RGLA 3HKDE 5L3FB 4TNVA 2Y48B 1HX8A 4PJNA 1ZP0A 2KSRA 2W2UA 2VQET 1WR6A 2LT3A 2C5KT 2JMKA 3VR9A 3O1HA 2XJ7A 2QYWA 3N2OA 2W62A 3PE0A 2ACXA 2NP9A 2R6GF 2D2SA 4IDOA 4TV8E 2CXLA 3PUZF 4I0UA 2BG9A 4KBMB 2X9HA 3I9YA 4M1PA 5ABEA 1Y64B 2XAHB 3PUWF 5DQWA 4NXNT 1LRZA 3VR8A 2VKJA 3EVYA 5AQQB 4MLKA 5J2UE 3E08A 4OX9T 3WAJA 2MYSA 2V26A 4BJNA 3SWHA 4HFCA 4JEHB 2CA5A 3RKOA 4HN9A 4QXBB 2FBWA 3PUAA 2PG8A 3UUNA 3ZC0A 2FJDA 4ANJA 4HKAA 2V8SV 2WU2A 3R6NA 3RLFF 3CX8B 2BBJA 3O9XA 5LMUT 4NUVA 4CXYA 3VKGA 5LP6E 1FMWA 3KFWX 3MJXA 4JI2T 3ZLIA 2CXDA 3AE9A 4ZEYA 2LRKA 4QWNB 3KVBA 3B13A 5KMGP 1HX1B 3AE4A 3K3OA 3ANWA 4QXCB 5FP3A 4MHCA 4QXHB 2W67A 4AQYT 1IJ5A 3FZFB 5AQLB 1QSDA 3I1AA 2BS2A 5AQPB 3LK42 1O3XA 1D1AA 2NTYA 3NVOA 5EK2A 5LJMA 4OYKA 5AFUL 3M3ZB 3AEDA 3NZQA 4DBRA 1FEWA 1WYCA 4X1YE 2ZM0A 1WLXA 1US7B 3MA9A 4AKIA 4C91A 3PU8A 2N9DA 2E9XB 2DL1A 4BA9A 4PFOA 3C51A 5FXZA 4IL9A 4ASKA 2X66A 5LHHB 2UXBT 4B3ST 2BS3A 4IE6A 3U3IA 4DUYT 3CQXC 3N9LA 1W0BA 1IZNB 3NBXX 3NRYA 2WBLA 2V1DB 2LEHA 2E9XC 3UFGA 1ZHCA 4ILCA 4OK0A 5HEHA 2H7VC 3WAKA 3FBZA 3TKLB 1MNEA 2DNXA 2KXPB 3PJAA 4HFIA 2WDQA 3H37A 3RH3A 5EK4A 3B5MA 4UVBB 4HEAA 3ZSTA 2BBHA 1S35A 2H7OA 3PDYA 4QX8B 1OEDE 4O4HE 4QKNA 2V6YB 3LK2B 2G0UA 2CHNA 4ISTA 4DR6T 2NR4A 2ODUA 4QH4A 1SE7A 4HFBA 2LSIA 3I0QA 3Q5WA 3B57A 1ZV4X 4HWFA 2J47A 4WW0A 4DNDA 1J5WA 4COFA 4WBNE 4DV7T 2XAGB 3TLVA 3AE7A 3HA4A 2ODVA 5JRCA 4J2CA 1UUSA 4ILUA 1D1CA 5TAOA 2LSKA 3M65A 4GKKT 2WMOA 2HHHT 3CMLA 2P9BA 4F8HA 2BKPA 2XZEA 2KWIB 3GA8A 5FYMA 2IW5B 3ONXA 1N32T 2ZM8A 1UGOA 3AEGA 2EHOA 5HEOA 1HF8A 4TX5A 2HPJA 4H9SE 3ZMUB 4U3CA 3ONJA 4ZXLA 3JCFA 3N2GE 2WM9A 2BDEA 3ZYLA 3RF1A 1HNZT 4UIGA 4CZZB 2VB6A 4ZI3D 4UEMA 3TLSA 3JAEA 2V5DA 2XTLA 2LSJA 3CQCB 4O8SA 2XQ8A 4H9QC 5HCMA 1U4QA 3RRWA 1IBLT 4EAHA 4BAYB 3CIRA 4I4TE 3A8YC 4ZS2A 4JEUB 2IAKA 2WMNA 1IJ6A 4KHPT 3P4SA 4X20E 2CCQA 2DCFA 4O4JE 5AQMB 2K5BB 5JR9B 1U5PA 2YU2A 4DV5T 3OTOT 2XPKA 3CWZB 2KINB 2WWUA 3VRBA 3Q5XA 2H89A 4DR3T 4HGAA 3RQUA 4IGUA 2XHEB 5AQKB 1HR0T 1VRBA 2KT9A 4EB6E 5JR9C 3TLWA 4PW8A 5HEUA 1N36T 1UURA 3J9X1 4ZI2D 3ZN1B 4QX7B 3N9PA 1E1HB 1HG2A 2WS3A 2FJAA 3IA3A 4YTNA 1IBMT 4JI0T 4ILBA 1UK5A 3KV6A 2I59A 2EHOD 4TN7B 4PNIA 3U78A 1KK7A 1EZ3A 3NRXA 5CA1E 3HR0A 5IHYA 5JDNA 4WZXA 3OVUA 3ZT7A 1E7PA 3AAEB 2VL0A 3KBUA 4EV6A 4ZI7E 1BR0A 4OHFA 2LJLA 1NENA 2LLYA 5FY0A 5M4YA 2VKHA 3N9NA 1YQ4A 1ZOYA 3FB2A 2C5IT 3AXJB 4H9PC 2DLRA 2V6XA 3AE5A 4DV1T 3K1SA 4JI6T 4Q25A 3P4WA 4L9IA 2X9YA 3RRCA 1BR4A 3ZT5A 4O2BE 4IDPA 4DR5T 3C4XA 5CB4E 2LRLA 4A97A 4JYAT 4YSXA 2E9XA 3ABVA 5EK3A 1JNRA 3CX6B 4O2AE 4Z90A 3S4UA 1CHUA 3UT5E 2NWBA 2IC6A 4PK5A 4AXPA 4YLHA 3L39A 2L3LA 3C4WA 4QHOA 1CUNA 1YW0A 2HPLA 5AQNB 3DP7A 1X9BA 4FI5A 4GK5E 4WBOA 2LSYA 5JQGE 3NKZA 2WZIA 5ADXL 4UV8B 2PTFA 4HWDA 3JC6C 3EDVA 3PJAJ 3H3MA 2WY2A 1IAPA 1ZEEA 2D5UA 4IL4A 2A9UA 2D9DA 2XQ6A 2IC9A 2V7JA 3L3PA 2XQ9A 1Y01A 2V6YA 2VURA 5HYAA 2MTQA 3T1HT 2LHNA 3RYCE 5HXCA 2YDSA 3N2KE 4F6RC 3HI2A 2KMFA 4U33A 2X9XA 3FZHB 5ETWA 3AE3A 1VCTA 5ABFB 1T72A 5H6QB 1QUUA 5ABHA 4EZHA 4YHJA 5JVDE 2UXDT 4EYUA 1X79A 3UU4A 5LJNA 3ZT6A 1HFAA 4PJLA 2YDRA 4HFHA 4U72A 3ZJ2A 4X62T 2E9XD 1VCSA 1OEDB 3C50A 2E8IA 2N1GA 2CXFA 4X66T 2X9WA 5AQFB 3ONLC
chains in the Genus database with same CATH topology
1E2AA 2E2AA 3L8RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E2A A;  2E2A A;  3L8R A; 
#chains in the Genus database with same CATH topology
 1T98 A;  3IEE A;  4IE7 A;  5LG3 A;  2LSG A;  3NZP A;  3P8C D;  4U2Y A;  3IF8 B;  3L09 A;  1OED C;  4U2Z A;  3EHZ A;  4X5T A;  3ZMZ B;  1L0V A;  4H9O C;  1OXZ A;  4IE4 A;  3MK7 C;  3RYF E;  1ZKE A;  3JAF A;  2W61 A;  5JDL A;  3RC3 A;  5CGM A;  3L8R A;  4I55 E;  3V5U A;  1HTJ F;  4IE0 A;  4NIQ A;  3NWI A;  2YU1 A;  1UCU A;  3ZSS A;  1UX4 A;  4DR7 T;  4JI3 T;  5F5W A;  5JR9 A;  4B3T T;  2IIU A;  5AQO B;  4X1K E;  4TWD A;  4CN4 A;  5LCY A;  4NUU A;  5A1L A;  2KWH A;  1D1B A;  5AQG B;  3I9W A;  1KNP A;  4CI1 B;  5HAX A;  1MND A;  2LOP A;  4AKH A;  4ZZB A;  4YSZ A;  4JI7 T;  5IUX A;  3PUG A;  3AA6 B;  1MIY A;  4UXN B;  4P0B A;  2DWK A;  2K48 A;  3A5X A;  2DI4 A;  5KX5 E;  3I0O A;  4LMK A;  3T8O A;  2XM2 A;  1WCR A;  3KV5 A;  3N9M A;  3D0T A;  4P0A A;  4LF4 T;  4LF8 T;  3X1D A;  3BQK A;  5C8Y E;  2PBI A;  2XQ3 A;  3HL6 A;  2XQ4 A;  3OJA A;  5HCJ A;  4JV5 T;  5ABG A;  3AE6 A;  3CKD A;  2WZH A;  5FMN A;  2F4V T;  2IDO B;  4AI6 A;  5J2T E;  3PV0 F;  3TLT A;  4EOZ B;  2V7K A;  4E7S A;  5L3E B;  3ZMT B;  3Q2M A;  2QA7 A;  2WB5 A;  1MIW A;  3P4P A;  1Z8U A;  3BQI A;  3LSV A;  3PUQ A;  1GQE A;  3RIF A;  5EZY E;  3N9O A;  3SS1 A;  3EAB A;  4H63 V;  2ZM6 T;  4P1N A;  2XAS B;  4ZZC A;  3AXJ A;  4EIW A;  2NTX A;  3LBX B;  2BKN A;  3Q9D A;  2ES0 A;  5DQV A;  4CI2 B;  3IHR A;  1I94 T;  4BJM A;  2J62 A;  2XAQ B;  1WR0 A;  1XMQ T;  4HFV A;  2JRK A;  2HN1 A;  4H9R C;  3AB3 B;  4L5G A;  4U74 A;  2WP9 A;  2J1D G;  3ZN0 B;  2M67 A;  4YXD A;  3MKD A;  4X65 T;  3LDQ B;  5JRE A;  4MFR A;  4WYV A;  4X64 T;  4GKJ T;  4UVA B;  4NXM T;  2V7I A;  2LHR A;  4Z8X A;  3ZMS B;  3MAC A;  4CN1 A;  3FBL A;  3AE2 A;  2H3R A;  4AKL A;  4HE8 A;  3AE8 A;  3UUB A;  4LF6 T;  4O4I E;  5LGN B;  3RC8 A;  4CQI A;  2AE9 A;  4CXX A;  5KDM C;  3PUV F;  3PTR B;  2YN6 A;  4U7Y A;  3ZMV B;  3UTK A;  5JDM A;  1SA0 E;  3SRZ A;  3AEA A;  3P7I A;  1XZY A;  3AA0 B;  2KZ7 B;  3RQW A;  2LM2 A;  4UVC B;  3OKQ A;  4QH5 A;  4TWF A;  4CN6 A;  4DV2 T;  2BVL A;  3CX7 B;  3C64 A;  3SFE A;  2YDQ A;  4DBQ A;  1N33 T;  2M6I A;  3EAM A;  4N78 D;  3Q5E A;  4KUM B;  2C0S A;  4DVD A;  5FNV E;  4DV4 T;  3V5S A;  3F2E A;  4GYS A;  3KVA A;  4EEB A;  5ABF A;  4LF9 T;  3CK6 A;  1WYB A;  2W00 A;  3E0Z A;  4K0U A;  4KMC A;  2PFV A;  1MMD A;  3UUX B;  5BR8 T;  1R8I A;  1XDO A;  2UXC T;  3QK6 A;  4MBQ A;  2UUA T;  1UX5 A;  1VOM A;  4PAG A;  2VL8 A;  4KX6 A;  2L9Q A;  2SPC A;  4X1I E;  5J0Z A;  1J5E T;  3TLU A;  1OED A;  3UUL A;  5LNK A;  2BG9 E;  2VVN A;  1XWM A;  4C90 A;  1IBK T;  4KP3 C;  2WDR A;  4AQF C;  5FXX A;  3GN5 B;  2UUC T;  4CI3 B;  2OLT A;  2UUB T;  4DV3 T;  2VVS A;  3C4Z A;  1BR1 A;  3AVS A;  1T7S A;  2CM0 A;  3PUY F;  5C2T A;  3P4Q A;  5L47 A;  4JI5 T;  4DR1 T;  3RIU C;  4YFS A;  4HFD A;  3W15 B;  5HEG A;  1MMA A;  2CEA A;  5FVL A;  3GMI A;  3FXE B;  5LG4 A;  1E2A A;  4GIW A;  2D0U A;  2UXN B;  4A5X A;  2WWV A;  4PFP A;  2Q9Q B;  3VKH A;  2A3D A;  2LE8 A;  5GON E;  3LFM A;  4ZI3 C;  1BR2 A;  4AKG A;  2X67 A;  3OBV E;  4E7Z A;  4H63 H;  4GOU A;  3AEC A;  1NEK A;  2K9A A;  5FKY A;  5JTG A;  1YD8 G;  4JBW F;  5F3J A;  3KIN B;  5LHG B;  4JI4 T;  4UV9 B;  1OWA A;  3A7M A;  2Q9Q C;  3RI5 A;  2XY8 B;  3EUH A;  2XM1 A;  2QVA A;  5AQR B;  2YK0 A;  3IBP A;  1KFY A;  4LFB T;  4PK6 A;  3AA1 B;  3H3A A;  5LB7 B;  2C5J A;  4I43 B;  4IRE A;  3LJC A;  1N34 T;  3HKE E;  2I0M A;  2IML A;  3O4X E;  4TUY E;  2W4X A;  3UU5 A;  5CJ5 A;  4KHZ F;  3ZKR A;  3GWH A;  1SUM B;  2W66 A;  1KNR A;  4YJ3 E;  4WNK A;  1WFD A;  2WCA A;  2LOS A;  2JIW A;  3JAD A;  5IWA T;  2V7L A;  2KND A;  3PUR A;  4G2A A;  2EHO C;  5LYJ E;  3O1I A;  3ETU A;  3PUS A;  2CE7 A;  4ZHQ E;  2BS4 A;  5CA0 E;  4K0K T;  4DV6 T;  5AQH B;  1LVF A;  5AQJ B;  2CWY A;  4YHH T;  3N9Q A;  3OYX A;  2XSA A;  3LBX A;  2CRB A;  3ZJ1 A;  2NOX A;  4IDN A;  3QB5 A;  4O4L E;  1YQ3 A;  4DR2 T;  4AKR B;  2FJE A;  2VQF T;  1AJ3 A;  2B1E A;  1W09 A;  4AIS A;  1KNZ A;  4YY3 T;  2JJ9 A;  3RX6 A;  3UU3 A;  2HH7 A;  2V5C A;  2CPT A;  4GK0 E;  3RHW A;  2ZM2 A;  2A72 A;  2X0Y A;  4ADZ A;  5L3G B;  4UF0 B;  1Z0P A;  3ESL A;  1HNX T;  2I6H A;  1B7T A;  4EXT A;  4DID B;  2DHR A;  5JDG A;  5HXE A;  2N2N A;  1DU2 A;  3QOF A;  3QUJ A;  3CPZ A;  2LKH A;  5AQS B;  1MIV A;  3FZL B;  1XDP A;  2FJB A;  4IE5 A;  3DTO A;  3AA7 B;  1T8B A;  2JMH A;  3RYH E;  2IUB A;  2MOZ A;  4ERR A;  1HS7 A;  2IHR 1;  5H6R B;  3K3Q C;  4HTE A;  2Y8D A;  5LA6 E;  4EGW A;  1HCI A;  2VKO A;  5KXJ A;  1V9D A;  2DWG A;  5LBQ B;  3DJB A;  2XUE A;  5HXR A;  5AQI B;  3OYZ A;  5F8P A;  3EI0 A;  4EZ4 A;  3MZK B;  2XQ7 A;  1MMG A;  5L4E A;  1QLB A;  4HWI B;  3CQG B;  4TZ4 C;  2CHO A;  2UU9 T;  3K3N A;  4XBF B;  3VU7 H;  3UQ7 A;  2WQY A;  4V1A v;  4CXW A;  3N5L A;  5L4H A;  2NW7 A;  1YXR A;  2QRX A;  3KDS E;  4TV9 E;  4AQF A;  2HN2 A;  4HFE A;  3AVR A;  2UXX B;  5AQT B;  4L0R A;  2CBJ A;  2CWO A;  3ETV A;  2XQA A;  5LOV E;  3MXZ A;  1NWM X;  2BKO A;  2BZB A;  3FZM B;  3RIU A;  3UU6 A;  2FUP A;  1KF6 A;  3GN5 A;  3KV9 A;  5C3J A;  2D0T A;  4IDZ A;  2RA1 A;  3CVR A;  2NW8 A;  2XAF B;  4YTP A;  5AQU B;  5L3C B;  3UU8 A;  1D0Y A;  3G06 A;  3RKG A;  2Y6X A;  4YSY A;  4UR9 A;  2YOE A;  3AAI A;  5LGT B;  4HWC A;  2CLY B;  4MAL A;  4B3R T;  5HXH A;  1HNW T;  2Q9Q A;  4PJJ A;  4GYR A;  1XNQ T;  1HG5 A;  5L3B B;  2W0G A;  5HWY A;  1LKX A;  5LGU B;  2LM9 A;  3ZYK A;  4G63 A;  3P50 A;  2Z6E A;  2BG9 B;  3KBT A;  1FMV A;  3PUX F;  1WRD A;  4IDQ A;  3FZK B;  5BMV E;  4DV0 T;  2CLY C;  2VKD A;  5HEJ A;  1JNZ A;  5JDH A;  4NPP A;  4EED A;  2WAU A;  2H88 A;  3E22 E;  3QB5 K;  1YKE B;  3SFD A;  4AQG A;  4A98 A;  4XZC A;  2BG9 C;  2JQK A;  2BVM A;  1G73 A;  3HKC E;  5HXS A;  3SOL A;  5JH7 E;  3RYI E;  3HKB E;  4H9N C;  4DMW A;  1G8X A;  2VAS A;  4UEL A;  2J4G A;  2B76 A;  4TNW A;  1MMN A;  4HWH A;  4JI8 T;  2GK9 A;  3RIA A;  4JI1 T;  4P09 A;  3F57 A;  3OPC A;  4ZOL E;  4XAX B;  4IIJ E;  2X0L B;  3C98 B;  2LKG A;  5LBM A;  2YIN A;  1S94 A;  3J7Y q;  2ACZ A;  2X51 A;  3UQ4 A;  1W9R A;  4LF5 T;  1FIO A;  3LK3 B;  4DO0 A;  1M7K A;  3P4R A;  3ZCI A;  2VWA A;  2M6B A;  4PK4 A;  1J1J A;  4DUZ T;  2KLQ A;  4I50 E;  1XMO T;  1YKH B;  5AQV B;  2NW9 A;  5FVK A;  5LXT E;  4LFC T;  2K24 A;  2JPF A;  4LMJ A;  4QH1 A;  5LMN T;  4OYJ A;  3ANW B;  2Q9Q D;  2ZLY A;  2RP4 A;  5CFB A;  1W0A A;  1D0Z A;  2XQ5 A;  3ZCJ A;  4ZS3 A;  4U31 A;  1FJG T;  3WI3 A;  2V7M A;  5JDQ A;  3LG7 A;  3PU3 A;  2XAJ B;  4LML A;  4DMV A;  5J1G A;  5FL1 A;  4A56 A;  2XSB A;  3AEB A;  3Q5D A;  5FY1 A;  2E5V A;  3FXD B;  2E5L T;  3R84 B;  2JQH A;  4B3M T;  3JC6 D;  3AAA B;  3KV4 A;  4UF0 A;  2MBG A;  4B6X A;  5FXV A;  2RPA A;  4IHJ E;  3RPU A;  2X0H A;  5DJQ C;  2XQY A;  4ILA A;  3VHL A;  3FHN A;  3O1J A;  2ZMA A;  5FY7 A;  4TWH A;  2YEV C;  4ISS A;  2MAW A;  4IT4 A;  3ZYM A;  4PJM A;  2CBI A;  2A2F X;  2K3W A;  4YTM A;  2QGS A;  3ZEF B;  4YT0 A;  5L3D B;  3K8P C;  1XNR T;  2WSS V;  3BQL A;  2JQ9 A;  4LF7 T;  1KEY A;  2YKS A;  4JLE A;  3UFE A;  2W63 A;  2E2A A;  2MPK A;  3VRA A;  4EYY R;  2L8K A;  2X68 A;  1M62 A;  2WU5 A;  2JQQ A;  3UUM A;  3QC9 A;  5L2L A;  2PJQ A;  5LHI B;  4Z91 A;  2WDV A;  4DR4 T;  5JRC B;  1I6Z A;  5FXW A;  3AEE A;  5JDF A;  3ZPO A;  4OFZ A;  3QNU A;  3AEF A;  2OV9 A;  5E0O A;  5HWX A;  5FL0 A;  3EDU A;  2AXD S;  1D0X A;  5DAB A;  1SHZ C;  3F31 A;  2EHO B;  2CMR A;  4LFA T;  3T1Y T;  5IYZ E;  4AIU A;  4KI0 F;  4YJ2 E;  4FJO A;  3BK9 A;  4U7I A;  4ZI2 C;  1H7C A;  3AE1 A;  2OA5 A;  3ZC1 A;  1LVK A;  2VK9 A;  1NAF A;  4JUY A;  3RGL A;  3HKD E;  5L3F B;  4TNV A;  2Y48 B;  1HX8 A;  4PJN A;  1ZP0 A;  2KSR A;  2W2U A;  2VQE T;  1WR6 A;  2LT3 A;  2C5K T;  2JMK A;  3VR9 A;  3O1H A;  2XJ7 A;  2QYW A;  3N2O A;  2W62 A;  3PE0 A;  2ACX A;  2NP9 A;  2R6G F;  2D2S A;  4IDO A;  4TV8 E;  2CXL A;  3PUZ F;  4I0U A;  2BG9 A;  4KBM B;  2X9H A;  3I9Y A;  4M1P A;  5ABE A;  1Y64 B;  2XAH B;  3PUW F;  5DQW A;  4NXN T;  1LRZ A;  3VR8 A;  2VKJ A;  3EVY A;  5AQQ B;  4MLK A;  5J2U E;  3E08 A;  4OX9 T;  3WAJ A;  2MYS A;  2V26 A;  4BJN A;  3SWH A;  4HFC A;  4JEH B;  2CA5 A;  3RKO A;  4HN9 A;  4QXB B;  2FBW A;  3PUA A;  2PG8 A;  3UUN A;  3ZC0 A;  2FJD A;  4ANJ A;  4HKA A;  2V8S V;  2WU2 A;  3R6N A;  3RLF F;  3CX8 B;  2BBJ A;  3O9X A;  5LMU T;  4NUV A;  4CXY A;  3VKG A;  5LP6 E;  1FMW A;  3KFW X;  3MJX A;  4JI2 T;  3ZLI A;  2CXD A;  3AE9 A;  4ZEY A;  2LRK A;  4QWN B;  3KVB A;  3B13 A;  5KMG P;  1HX1 B;  3AE4 A;  3K3O A;  3ANW A;  4QXC B;  5FP3 A;  4MHC A;  4QXH B;  2W67 A;  4AQY T;  1IJ5 A;  3FZF B;  5AQL B;  1QSD A;  3I1A A;  2BS2 A;  5AQP B;  3LK4 2;  1O3X A;  1D1A A;  2NTY A;  3NVO A;  5EK2 A;  5LJM A;  4OYK A;  5AFU L;  3M3Z B;  3AED A;  3NZQ A;  4DBR A;  1FEW A;  1WYC A;  4X1Y E;  2ZM0 A;  1WLX A;  1US7 B;  3MA9 A;  4AKI A;  4C91 A;  3PU8 A;  2N9D A;  2E9X B;  2DL1 A;  4BA9 A;  4PFO A;  3C51 A;  5FXZ A;  4IL9 A;  4ASK A;  2X66 A;  5LHH B;  2UXB T;  4B3S T;  2BS3 A;  4IE6 A;  3U3I A;  4DUY T;  3CQX C;  3N9L A;  1W0B A;  1IZN B;  3NBX X;  3NRY A;  2WBL A;  2V1D B;  2LEH A;  2E9X C;  3UFG A;  1ZHC A;  4ILC A;  4OK0 A;  5HEH A;  2H7V C;  3WAK A;  3FBZ A;  3TKL B;  1MNE A;  2DNX A;  2KXP B;  3PJA A;  4HFI A;  2WDQ A;  3H37 A;  3RH3 A;  5EK4 A;  3B5M A;  4UVB B;  4HEA A;  3ZST A;  2BBH A;  1S35 A;  2H7O A;  3PDY A;  4QX8 B;  1OED E;  4O4H E;  4QKN A;  2V6Y B;  3LK2 B;  2G0U A;  2CHN A;  4IST A;  4DR6 T;  2NR4 A;  2ODU A;  4QH4 A;  1SE7 A;  4HFB A;  2LSI A;  3I0Q A;  3Q5W A;  3B57 A;  1ZV4 X;  4HWF A;  2J47 A;  4WW0 A;  4DND A;  1J5W A;  4COF A;  4WBN E;  4DV7 T;  2XAG B;  3TLV A;  3AE7 A;  3HA4 A;  2ODV A;  5JRC A;  4J2C A;  1UUS A;  4ILU A;  1D1C A;  5TAO A;  2LSK A;  3M65 A;  4GKK T;  2WMO A;  2HHH T;  3CML A;  2P9B A;  4F8H A;  2BKP A;  2XZE A;  2KWI B;  3GA8 A;  5FYM A;  2IW5 B;  3ONX A;  1N32 T;  2ZM8 A;  1UGO A;  3AEG A;  2EHO A;  5HEO A;  1HF8 A;  4TX5 A;  2HPJ A;  4H9S E;  3ZMU B;  4U3C A;  3ONJ A;  4ZXL A;  3JCF A;  3N2G E;  2WM9 A;  2BDE A;  3ZYL A;  3RF1 A;  1HNZ T;  4UIG A;  4CZZ B;  2VB6 A;  4ZI3 D;  4UEM A;  3TLS A;  3JAE A;  2V5D A;  2XTL A;  2LSJ A;  3CQC B;  4O8S A;  2XQ8 A;  4H9Q C;  5HCM A;  1U4Q A;  3RRW A;  1IBL T;  4EAH A;  4BAY B;  3CIR A;  4I4T E;  3A8Y C;  4ZS2 A;  4JEU B;  2IAK A;  2WMN A;  1IJ6 A;  4KHP T;  3P4S A;  4X20 E;  2CCQ A;  2DCF A;  4O4J E;  5AQM B;  2K5B B;  5JR9 B;  1U5P A;  2YU2 A;  4DV5 T;  3OTO T;  2XPK A;  3CWZ B;  2KIN B;  2WWU A;  3VRB A;  3Q5X A;  2H89 A;  4DR3 T;  4HGA A;  3RQU A;  4IGU A;  2XHE B;  5AQK B;  1HR0 T;  1VRB A;  2KT9 A;  4EB6 E;  5JR9 C;  3TLW A;  4PW8 A;  5HEU A;  1N36 T;  1UUR A;  3J9X 1;  4ZI2 D;  3ZN1 B;  4QX7 B;  3N9P A;  1E1H B;  1HG2 A;  2WS3 A;  2FJA A;  3IA3 A;  4YTN A;  1IBM T;  4JI0 T;  4ILB A;  1UK5 A;  3KV6 A;  2I59 A;  2EHO D;  4TN7 B;  4PNI A;  3U78 A;  1KK7 A;  1EZ3 A;  3NRX A;  5CA1 E;  3HR0 A;  5IHY A;  5JDN A;  4WZX A;  3OVU A;  3ZT7 A;  1E7P A;  3AAE B;  2VL0 A;  3KBU A;  4EV6 A;  4ZI7 E;  1BR0 A;  4OHF A;  2LJL A;  1NEN A;  2LLY A;  5FY0 A;  5M4Y A;  2VKH A;  3N9N A;  1YQ4 A;  1ZOY A;  3FB2 A;  2C5I T;  3AXJ B;  4H9P C;  2DLR A;  2V6X A;  3AE5 A;  4DV1 T;  3K1S A;  4JI6 T;  4Q25 A;  3P4W A;  4L9I A;  2X9Y A;  3RRC A;  1BR4 A;  3ZT5 A;  4O2B E;  4IDP A;  4DR5 T;  3C4X A;  5CB4 E;  2LRL A;  4A97 A;  4JYA T;  4YSX A;  2E9X A;  3ABV A;  5EK3 A;  1JNR A;  3CX6 B;  4O2A E;  4Z90 A;  3S4U A;  1CHU A;  3UT5 E;  2NWB A;  2IC6 A;  4PK5 A;  4AXP A;  4YLH A;  3L39 A;  2L3L A;  3C4W A;  4QHO A;  1CUN A;  1YW0 A;  2HPL A;  5AQN B;  3DP7 A;  1X9B A;  4FI5 A;  4GK5 E;  4WBO A;  2LSY A;  5JQG E;  3NKZ A;  2WZI A;  5ADX L;  4UV8 B;  2PTF A;  4HWD A;  3JC6 C;  3EDV A;  3PJA J;  3H3M A;  2WY2 A;  1IAP A;  1ZEE A;  2D5U A;  4IL4 A;  2A9U A;  2D9D A;  2XQ6 A;  2IC9 A;  2V7J A;  3L3P A;  2XQ9 A;  1Y01 A;  2V6Y A;  2VUR A;  5HYA A;  2MTQ A;  3T1H T;  2LHN A;  3RYC E;  5HXC A;  2YDS A;  3N2K E;  4F6R C;  3HI2 A;  2KMF A;  4U33 A;  2X9X A;  3FZH B;  5ETW A;  3AE3 A;  1VCT A;  5ABF B;  1T72 A;  5H6Q B;  1QUU A;  5ABH A;  4EZH A;  4YHJ A;  5JVD E;  2UXD T;  4EYU A;  1X79 A;  3UU4 A;  5LJN A;  3ZT6 A;  1HFA A;  4PJL A;  2YDR A;  4HFH A;  4U72 A;  3ZJ2 A;  4X62 T;  2E9X D;  1VCS A;  1OED B;  3C50 A;  2E8I A;  2N1G A;  2CXF A;  4X66 T;  2X9W A;  5AQF B;  3ONL C; 
#chains in the Genus database with same CATH homology
 1E2A A;  2E2A A;  3L8R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...