3L8RA

The crystal structure of ptca from s. mutans
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
102
structure length
102
Chain Sequence
MNTEELQVAAFEIILNSGNARSIVHEAFDAMREKNYILAEQKLQEANDELLKAHQAQTDLLQEYASGTEIKIEIIMVHAQDHLMTTMTLREVAIEMLELYKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative PTS system, cellobiose-specific IIA component
publication title The crystal structure of PtcA from Streptococcus mutans
rcsb
source organism Streptococcus mutans
molecule tags Transferase
total genus 45
structure length 102
sequence length 102
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 2.7.1.69: Transferred entry: 2.7.1.191, 2.7.1.192, 2.7.1.193, 2.7.1.194, 2.7.1.195,
pdb deposition date 2010-01-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02255 PTS_IIA PTS system, Lactose/Cellobiose specific IIA subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.80 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Phosphotransferase system, lactose/cellobiose-type IIA subunit 3l8rA00
3L8RA 2E2AA 1E2AA
chains in the Genus database with same CATH superfamily
5TAOA 5DQWA 1OEDC 3VKGA 2WY2A 4FI5A 3VU7H 4LF8T 4IDZA 1MMNA 4TWHA 3T1HT 2CLYB 1T72A 1WFDA 3AAIA 5E0OA 3FHNA 2WWVA 4K0KT 3N5LA 3Q5EA 2A9UA 5AQSB 5LB7B 4CQIA 3EHZA 3MACA 4BJNA 2XHEB 2XQ3A 4DV3T 3AEEA 4U72A 1FEWA 4GK5E 3AXJB 3P4PA 2K3WA 4QXCB 1YKHB 3I9YA 2NW7A 3MA9A 2UXDT 4ZI2D 3AVRA 2IC9A 2JQHA 2J4GA 2VWAA 2KLQA 2XJ7A 1W0AA 2BS2A 4TNVA 5LNKA 4ISTA 3CQGB 3Q5DA 2LSIA 1UURA 4WW0A 2YOEA 3AAEB 3O1HA 4MALA 2BG9C 2YKSA 4WBNE 1XNRT 2VKHA 5LJMA 2LKGA 3NZPA 2HPJA 5C3JA 3E08A 4AKHA 2LM9A 2W4XA 4P09A 4UEMA 1WYBA 2IHR1 1MNEA 1S35A 4JI7T 2DLRA 3N9PA 3H3AA 3HR0A 5HEGA 5JVDE 5AQNB 4ZOLE 5LGUB 3F57A 5HEHA 3OYZA 2E5VA 4DV4T 2ZM2A 2V1DB 5LXTE 1IJ5A 4YTMA 3V5UA 4NIQA 3H37A 3Q9DA 1LVFA 1HTJF 5JDHA 3L09A 2EHOD 3CK6A 3PUGA 4CI1B 2CXFA 4IREA 3A5XA 4DV6T 2WZIA 3W15B 2YK0A 1ZV4X 3CWZB 2XASB 4U2ZA 2W00A 4HFEA 5FKYA 3N9NA 4JEUB 2JMKA 4DIDB 1D1CA 2MBGA 4N78D 2E9XD 4QH1A 3AEDA 1ZOYA 2XQ7A 5HEUA 2RA1A 4X65T 3ZSTA 3KV5A 3F2EA 1XNQT 4KI0F 3PJAA 3JADA 3DTOA 4I43B 3CX8B 5CB4E 4H9NC 4KBMB 3VKHA 3ANWB 5AQTB 4BAYB 3L3PA 4YSZA 3MKDA 4ZZCA 2F4VT 4Q25A 3AE6A 2BS4A 3GN5A 3O1JA 5AQOB 2MOZA 3IF8B 5AQHB 5ETWA 3ZMSB 1GQEA 3UULA 2CBJA 2N1GA 3K1SA 3PUQA 4EV6A 2CRBA 2LOSA 2DWKA 3EDVA 4E7SA 3KINB 5HXCA 4HFDA 1MMAA 2I0MA 2WMNA 2XAJB 3NZQA 2BBJA 3B57A 3DJBA 4OHFA 4YT0A 1JNZA 2VQET 5JDGA 4AKIA 3AE9A 3C50A 1IBKT 2XQ6A 2W66A 5AQFB 3C4XA 2B76A 3N2OA 3I0OA 2CWOA 5LHIB 3CX6B 4E7ZA 2KZ7B 1XDPA 3LBXB 5HYAA 4DV1T 2PG8A 2ACZA 1KNPA 3RRWA 3OBVE 2BKOA 1M7KA 2H7VC 1Y64B 2BVLA 3KBTA 2JQ9A 4YJ3E 2N9DA 4H9QC 5HXRA 5FVKA 3ZKRA 5FY1A 2FJAA 5LHGB 4UF0B 5AQRB 3LK42 1SUMB 4AKRB 1LRZA 2XQ8A 3LBXA 3O9XA 1MIVA 5HAXA 4ILAA 1XDOA 1IBLT 3AE4A 4OK0A 4QX7B 5FXVA 3NRYA 2D5UA 4DV0T 5CGMA 4UF0A 3L39A 4IL9A 3IEEA 1CHUA 2M6BA 4NPPA 4OFZA 4JI3T 3CVRA 5F3JA 4K0UA 2K9AA 2A2FX 4NXNT 2DCFA 2E9XB 4H63V 1N34T 2C5KT 3ZJ1A 1G73A 3UUBA 2K5BB 2LHRA 4KUMB 4JI5T 2CE7A 3R84B 5AQMB 3LK2B 3PU3A 3KDSE 5ABFA 5AQUB 4DR4T 3RLFF 1FJGT 4JBWF 2E5LT 3H3MA 4U7YA 5J0ZA 2E9XA 4AQFA 3QUJA 2NW8A 2BKNA 2V7MA 4NXMT 3ETUA 3BK9A 5KMGP 2V7JA 2KWIB 4Z91A 3CKDA 5L4HA 1IJ6A 3VR9A 2VL8A 2ES0A 2ZM8A 2GK9A 3KBUA 1WYCA 3IA3A 3VR8A 4TZ4C 2FJBA 4F6RC 2D0UA 2UXBT 1YXRA 2XAGB 4YTNA 5AFUL 2CEAA 4LFBT 3KVBA 3ZEFB 3IBPA 3V5SA 5H6QB 3GA8A 3Q2MA 2XQAA 3TKLB 2AE9A 5F5WA 4AQYT 4IE5A 3OJAA 2D0TA 5HEOA 1OEDB 4AISA 3NBXX 2RPAA 2LKHA 3UU6A 2W0GA 2X51A 2V5DA 5HWXA 3RYCE 1HNZT 4J2CA 2EHOC 3X1DA 4XBFB 3RHWA 2IDOB 5JREA 2X9YA 4B3TT 5CJ5A 5JDNA 4I50E 2XY8B 1KEYA 2XTLA 2WMOA 5AQQB 5JDMA 3T8OA 4A5XA 3PUSA 4Z90A 2OLTA 5CA0E 3RIFA 2JQQA 2WS3A 5IWAT 4DR3T 4CI3B 4WYVA 2WCAA 5HEJA 2L3LA 4A97A 2LHNA 2QYWA 1MNDA 2V5CA 2Q9QC 3MZKB 2N2NA 3WAKA 3QB5K 2W67A 4YFSA 4IT4A 4X20E 3UFEA 1VCSA 2W63A 5AQJB 2PBIA 4IDNA 4C90A 4HTEA 3MJXA 2IMLA 4PW8A 3RIUC 4QX8B 2WU5A 4O8SA 5AQVB 3EDUA 3JAFA 2AXDS 3ZYLA 2LSGA 3HKBE 3R6NA 4LFCT 1X79A 3ESLA 3CX7B 5LP6E 4EYUA 2ZLYA 2BG9A 3VHLA 3UQ4A 5FXXA 1BR2A 4LMKA 5LOVE 3A8YC 2E8IA 2DHRA 5KDMC 4EEBA 2VKJA 5JTGA 4QWNB 3P4RA 3KV4A 3LDQB 3FBZA 4X62T 3UU4A 5JR9A 3KV6A 4MFRA 2WDRA 3SWHA 1ZP0A 4AQGA 3AB3B 3NKZA 4AKLA 4EB6E 2UXNB 4PJMA 4AKGA 5J2TE 3FZHB 3AE1A 3TLSA 4ZS2A 4IE6A 4O4JE 2Y8DA 2CCQA 4YSYA 2JRKA 4B3RT 3AXJA 3CQXC 2QGSA 2CA5A 2I59A 3AEAA 1LVKA 3HL6A 2A72A 2B1EA 4HEAA 3ZYMA 4TN7B 4DR6T 1YQ3A 4DV5T 5JH7E 3RC8A 3E22E 3ZT7A 3P4SA 2D9DA 3CPZA 4X64T 3T1YT 5FMNA 3UFGA 3P4WA 1YD8G 5LGTB 2G0UA 3M65A 2KINB 1U5PA 3WAJA 3RKOA 3K3QC 3ZMUB 3L8RA 4DR1T 1KF6A 4EXTA 4YSXA 1T8BA 3ZJ2A 4U33A 2HPLA 1VOMA 4UIGA 1Z0PA 3EABA 4XAXB 4X5TA 4DMWA 1DU2A 4H9SE 2KT9A 3AVSA 1HCIA 4YLHA 4JI8T 4IGUA 3FZFB 1HX1B 3I0QA 1D1BA 4PK6A 4LF5T 4PFOA 3WI3A 3BQIA 4LFAT 3ONXA 2NWBA 4ILBA 4B3ST 2LSJA 4GK0E 4HFBA 4ZHQE 4UV9B 3NWIA 3ZCIA 3AA7B 2Q9QD 3C4ZA 1H7CA 2V26A 5L3GB 3RI5A 4HWIB 5LMUT 3ZT5A 4LF6T 5DQVA 5EK4A 3LSVA 3RF1A 1NAFA 4IDOA 3AE2A 4HN9A 2K24A 5LCYA 5EK2A 3JAEA 3PU8A 3FXEB 3HI2A 1J1JA 1JNRA 3AE3A 4DMVA 3UT5E 3ANWA 2XAHB 4JEHB 3AA6B 1M62A 4QXBB 4UV8B 2YEVC 2CXLA 1J5WA 3HKEE 2NW9A 4PFPA 1D0ZA 3PTRB 2UXXB 4HGAA 2YDQA 4DO0A 2JMHA 2OA5A 1Z8UA 5ADXL 3I9WA 1L0VA 2QVAA 3ONLC 4DR7T 3ONJA 5KXJA 1HNWT 5ABEA 3BQLA 1T98A 5C8YE 2UUCT 4AIUA 4JV5T 4HFIA 2YDSA 3LK3B 4I55E 3ETVA 3K3NA 2CXDA 4O4HE 2CHNA 2XUEA 4O2BE 5LGNB 2V7KA 1BR1A 4G63A 5FNVE 2NR4A 5JRCB 4ILUA 2EHOB 3PUYF 4IE0A 2X9HA 1R8IA 2CM0A 2XM2A 1U4QA 4GKJT 4TWFA 2VQFT 3HA4A 5IHYA 3QK6A 4ZZBA 1D1AA 3N9LA 3QNUA 1UCUA 3QOFA 2NTXA 3VRAA 1OWAA 5AQIB 2MPKA 4HFHA 3AE8A 4U2YA 2EHOA 2C5IT 4HWHA 1MIYA 3RRCA 1OEDE 4H9OC 4GYSA 4CXXA 3FZKB 3RH3A 2IIUA 3N9OA 5HCJA 4EAHA 2ZM6T 5IYZE 3CIRA 2Q9QB 5CA1E 2M67A 5IUXA 4EOZB 1WR6A 3I1AA 2VASA 2WBLA 3OVUA 4L0RA 3PUAA 2JJ9A 1MMDA 3FB2A 4PJNA 3ZMZB 2CHOA 4B6XA 1VCTA 2V6YB 1N33T 3FXDB 2X0LB 1HS7A 4LMLA 1BR0A 4AI6A 4I4TE 5JDFA 3RIUA 2X67A 3UU5A 2BG9E 4TNWA 2WU2A 4UVBB 2FBWA 1NEKA 2JIWA 3ZLIA 1CUNA 3CQCB 3RYHE 4A56A 5HXHA 3QB5A 2KXPB 4Z8XA 4WZXA 2Z6EA 3ZSSA 2LJLA 2K48A 4EYYR 5LMNT 2X9WA 5DJQC 4JI6T 2H89A 1OEDA 1B7TA 3UUNA 1X9BA 3AEFA 3O4XE 4NUUA 4DR5T 2M6IA 1NENA 3FBLA 1KK7A 5HXSA 3ABVA 5BMVE 4CI2B 2ODVA 1T7SA 2CBIA 3QC9A 3SOLA 3C64A 3ZT6A 3B13A 3NVOA 3RGLA 1I94T 2FUPA 2OV9A 2H7OA 2XQ5A 2LSYA 3N2KE 2LRLA 3AECA 1EZ3A 3N9QA 3PUVF 4UELA 2I6HA 4QXHB 4TUYE 5LG3A 4UVCB 2V7LA 5FP3A 3AE5A 3EAMA 2MYSA 5FVLA 2VKOA 1WCRA 2XQ9A 2WB5A 2C5JA 4O4LE 1O3XA 4ISSA 2A3DA 4MLKA 3RQUA 2P9BA 4TV8E 4KMCA 2H3RA 5L3DB 3EI0A 3C51A 3ZMVB 1SE7A 4L9IA 2VK9A 3AEGA 5KX5E 3G06A 2XZEA 5L2LA 2W61A 4QH4A 1N32T 3RKGA 1OXZA 5BR8T 1SA0E 3MK7C 4DR2T 4EZHA 4MBQA 2D2SA 2SPCA 3Q5WA 3UU8A 3Q5XA 3U3IA 1IAPA 5EZYE 2VB6A 3C98B 4UXNB 3D0TA 2X66A 3UTKA 1UGOA 2W62A 4CN1A 3SRZA 1D0XA 4ZXLA 5L3EB 2KSRA 4FJOA 4JI1T 4L5GA 4EZ4A 1N36T 2LM2A 4P0AA 1YW0A 2BBHA 1W0BA 4F8HA 2KWHA 3LG7A 5LJNA 3PURA 3RPUA 4MHCA 4YXDA 4HWCA 2C0SA 5C2TA 3HKCE 3B5MA 3O1IA 2MAWA 2WSSV 2LOPA 3E0ZA 5JDLA 3TLVA 4G2AA 2WWUA 3IHRA 3ZC0A 3ZN0B 2UXCT 3PUWF 4YHHT 4DUZT 4LF7T 2CWYA 1G8XA 4IE4A 2KMFA 4HFCA 2XSAA 3J7Yq 2PTFA 2MTQA 2BDEA 2V8SV 4DV7T 5FL1A 1E2AA 2XQ4A 2UUAT 5HXEA 2WQYA 5DABA 5LG4A 1FMVA 1E1HB 3SFDA 2DNXA 1KFYA 4ADZA 1BR4A 3PDYA 4KHPT 3P8CD 2JPFA 2XAQB 3OKQA 4KX6A 3P7IA 4O4IE 5JR9C 1FIOA 5AQKB 4KP3C 4JYAT 1UK5A 1XWMA 2UU9T 2CLYC 1HX8A 5F8PA 3KV9A 4A98A 5AQPB 3ZPOA 3JC6D 2J1DG 4COFA 4JI0T 4GIWA 2FJEA 3VRBA 3ZC1A 4O2AE 3KFWX 4B3MT 4CN4A 2ZM0A 4OX9T 4CZZB 5ABHA 1QLBA 4P0BA 4LMJA 5LHHB 4JUYA 4QKNA 4ANJA 3TLTA 3RX6A 3GN5B 3EUHA 4LF4T 3A7MA 3F31A 2ODUA 4DBQA 2JQKA 4ZI3C 1SHZC 4HWFA 4QH5A 3K8PC 3RYIE 1KNRA 5FXWA 4XZCA 1WRDA 2X0YA 1MIWA 4KHZF 4PK5A 2XAFB 3PUXF 5FY7A 4IDQA 2NOXA 2QA7A 4PNIA 5A1LA 4BA9A 4ASKA 4QHOA 2FJDA 3PE0A 4ILCA 3EVYA 5J1GA 2RP4A 2CMRA 3P50A 4OYKA 4HKAA 1ZKEA 1WLXA 1HG5A 2X68A 5AQLB 2Y48B 3P4QA 4U7IA 5FYMA 2DI4A 4TX5A 4HWDA 1W09A 2R6GF 3DP7A 2VVNA 3C4WA 4TWDA 2J62A 3SS1A 1S94A 4PJJA 4X1IE 4M1PA 1NWMX 2LSKA 4HFVA 2KNDA 1IBMT 4GOUA 4GKKT 4C91A 4DVDA 1MMGA 4PJLA 2WDVA 4H9RC 1HF8A 4ZEYA 5L3BB 2H88A 3RIAA 4EEDA 3JCFA 3UU3A 4IIJE 2DL1A 4EGWA 2BVMA 2V7IA 3AAAB 3BQKA 2VL0A 1QUUA 4YJ2E 3M3ZB 5JRCA 5FL0A 4DNDA 3TLUA 2UUBT 2ACXA 4DUYT 2X0HA 4NUVA 5ABFB 3KVAA 3HKDE 2BKPA 5GONE 2QRXA 4I0UA 3K3OA 2HN2A 4YTPA 1D0YA 3J9X1 4OYJA 4JI2T 4DBRA 4DV2T 3FZMB 3UUXB 5M4YA 4BJMA 4P1NA 3RQWA 1UX4A 2LT3A 2HHHT 1XMOT 4ZI2C 3OPCA 3CMLA 1QSDA 4ZI7E 4LF9T 2VKDA 1HG2A 2IC6A 5AQGB 4X1YE 2PFVA 2VVSA 2Q9QA 1HR0T 2WP9A 4CXYA 5ABGA 4EIWA 5L3FB 2IUBA 2J47A 3AE7A 3LJCA 3GWHA 4AXPA 1HFAA 3LFMA 4ZS3A 2LEHA 1V9DA 2ZMAA 1VRBA 3MXZA 3OYXA 5J2UE 2V6YA 2DWGA 2IW5B 2L8KA 2W2UA 5LBQB 2HN1A 4JLEA 3GMIA 3ZN1B 1HNXT 2WAUA 4PAGA 2NTYA 2YU1A 1J5ET 2XM1A 1ZHCA 1US7B 4HE8A 2XQYA 4H9PC 2E2AA 2XPKA 4ZI3D 1WR0A 1AJ3A 3RYFE 1E7PA 4H63H 3PV0F 4CN6A 5LYJE 3ZYKA 5FY0A 2VURA 1KNZA 3UUMA 2PJQA 5JDQA 4V1Av 3UQ7A 3NRXA 4GYRA 2WZHA 5L4EA 5EK3A 5L3CB 4IE7A 4YY3T 3FZLB 1FMWA 3N9MA 2NP9A 3JC6C 2IAKA 1I6ZA 2V6XA 5FXZA 2E9XC 5JQGE 4AQFC 4CXWA 2LLYA 2WM9A 5LBMA 4X1KE 3TLWA 1W9RA 3AEBA 5LA6E 3OTOT 2BS3A 4U74A 4UVAB 4JI4T 1UUSA 1YKEB 1IZNB 4U31A 4WBOA 1YQ4A 2L9QA 4TV9E 2XSBA 1LKXA 2BG9B 3SFEA 5H6RB 2LE8A 3U78A 1UX5A 4ERRA 1ZEEA 2BZBA 4X66T 2LRKA 5HWYA 2Y6XA 1Y01A 2YDRA 3ZCJA 3PJAJ 4IL4A 3RC3A 4WNKA 3AA0B 2HH7A 2CPTA 2WDQA 3AA1B 4YHJA 2YN6A 4PK4A 2X9XA 4U3CA 3N2GE 1XZYA 2YINA 5L47A 1XMQT 3PUZF 4IDPA 4IHJE 4UR9A 2YU2A 3S4UA 5JR9B 5CFBA 3ZMTB 5HCMA
chains in the Genus database with same CATH topology
3L8RA 2E2AA 1E2AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L8R A;  2E2A A;  1E2A A; 
#chains in the Genus database with same CATH topology
 5TAO A;  5DQW A;  1OED C;  3VKG A;  2WY2 A;  4FI5 A;  3VU7 H;  4LF8 T;  4IDZ A;  1MMN A;  4TWH A;  3T1H T;  2CLY B;  1T72 A;  1WFD A;  3AAI A;  5E0O A;  3FHN A;  2WWV A;  4K0K T;  3N5L A;  3Q5E A;  2A9U A;  5AQS B;  5LB7 B;  4CQI A;  3EHZ A;  3MAC A;  4BJN A;  2XHE B;  2XQ3 A;  4DV3 T;  3AEE A;  4U72 A;  1FEW A;  4GK5 E;  3AXJ B;  3P4P A;  2K3W A;  4QXC B;  1YKH B;  3I9Y A;  2NW7 A;  3MA9 A;  2UXD T;  4ZI2 D;  3AVR A;  2IC9 A;  2JQH A;  2J4G A;  2VWA A;  2KLQ A;  2XJ7 A;  1W0A A;  2BS2 A;  4TNV A;  5LNK A;  4IST A;  3CQG B;  3Q5D A;  2LSI A;  1UUR A;  4WW0 A;  2YOE A;  3AAE B;  3O1H A;  4MAL A;  2BG9 C;  2YKS A;  4WBN E;  1XNR T;  2VKH A;  5LJM A;  2LKG A;  3NZP A;  2HPJ A;  5C3J A;  3E08 A;  4AKH A;  2LM9 A;  2W4X A;  4P09 A;  4UEM A;  1WYB A;  2IHR 1;  1MNE A;  1S35 A;  4JI7 T;  2DLR A;  3N9P A;  3H3A A;  3HR0 A;  5HEG A;  5JVD E;  5AQN B;  4ZOL E;  5LGU B;  3F57 A;  5HEH A;  3OYZ A;  2E5V A;  4DV4 T;  2ZM2 A;  2V1D B;  5LXT E;  1IJ5 A;  4YTM A;  3V5U A;  4NIQ A;  3H37 A;  3Q9D A;  1LVF A;  1HTJ F;  5JDH A;  3L09 A;  2EHO D;  3CK6 A;  3PUG A;  4CI1 B;  2CXF A;  4IRE A;  3A5X A;  4DV6 T;  2WZI A;  3W15 B;  2YK0 A;  1ZV4 X;  3CWZ B;  2XAS B;  4U2Z A;  2W00 A;  4HFE A;  5FKY A;  3N9N A;  4JEU B;  2JMK A;  4DID B;  1D1C A;  2MBG A;  4N78 D;  2E9X D;  4QH1 A;  3AED A;  1ZOY A;  2XQ7 A;  5HEU A;  2RA1 A;  4X65 T;  3ZST A;  3KV5 A;  3F2E A;  1XNQ T;  4KI0 F;  3PJA A;  3JAD A;  3DTO A;  4I43 B;  3CX8 B;  5CB4 E;  4H9N C;  4KBM B;  3VKH A;  3ANW B;  5AQT B;  4BAY B;  3L3P A;  4YSZ A;  3MKD A;  4ZZC A;  2F4V T;  4Q25 A;  3AE6 A;  2BS4 A;  3GN5 A;  3O1J A;  5AQO B;  2MOZ A;  3IF8 B;  5AQH B;  5ETW A;  3ZMS B;  1GQE A;  3UUL A;  2CBJ A;  2N1G A;  3K1S A;  3PUQ A;  4EV6 A;  2CRB A;  2LOS A;  2DWK A;  3EDV A;  4E7S A;  3KIN B;  5HXC A;  4HFD A;  1MMA A;  2I0M A;  2WMN A;  2XAJ B;  3NZQ A;  2BBJ A;  3B57 A;  3DJB A;  4OHF A;  4YT0 A;  1JNZ A;  2VQE T;  5JDG A;  4AKI A;  3AE9 A;  3C50 A;  1IBK T;  2XQ6 A;  2W66 A;  5AQF B;  3C4X A;  2B76 A;  3N2O A;  3I0O A;  2CWO A;  5LHI B;  3CX6 B;  4E7Z A;  2KZ7 B;  1XDP A;  3LBX B;  5HYA A;  4DV1 T;  2PG8 A;  2ACZ A;  1KNP A;  3RRW A;  3OBV E;  2BKO A;  1M7K A;  2H7V C;  1Y64 B;  2BVL A;  3KBT A;  2JQ9 A;  4YJ3 E;  2N9D A;  4H9Q C;  5HXR A;  5FVK A;  3ZKR A;  5FY1 A;  2FJA A;  5LHG B;  4UF0 B;  5AQR B;  3LK4 2;  1SUM B;  4AKR B;  1LRZ A;  2XQ8 A;  3LBX A;  3O9X A;  1MIV A;  5HAX A;  4ILA A;  1XDO A;  1IBL T;  3AE4 A;  4OK0 A;  4QX7 B;  5FXV A;  3NRY A;  2D5U A;  4DV0 T;  5CGM A;  4UF0 A;  3L39 A;  4IL9 A;  3IEE A;  1CHU A;  2M6B A;  4NPP A;  4OFZ A;  4JI3 T;  3CVR A;  5F3J A;  4K0U A;  2K9A A;  2A2F X;  4NXN T;  2DCF A;  2E9X B;  4H63 V;  1N34 T;  2C5K T;  3ZJ1 A;  1G73 A;  3UUB A;  2K5B B;  2LHR A;  4KUM B;  4JI5 T;  2CE7 A;  3R84 B;  5AQM B;  3LK2 B;  3PU3 A;  3KDS E;  5ABF A;  5AQU B;  4DR4 T;  3RLF F;  1FJG T;  4JBW F;  2E5L T;  3H3M A;  4U7Y A;  5J0Z A;  2E9X A;  4AQF A;  3QUJ A;  2NW8 A;  2BKN A;  2V7M A;  4NXM T;  3ETU A;  3BK9 A;  5KMG P;  2V7J A;  2KWI B;  4Z91 A;  3CKD A;  5L4H A;  1IJ6 A;  3VR9 A;  2VL8 A;  2ES0 A;  2ZM8 A;  2GK9 A;  3KBU A;  1WYC A;  3IA3 A;  3VR8 A;  4TZ4 C;  2FJB A;  4F6R C;  2D0U A;  2UXB T;  1YXR A;  2XAG B;  4YTN A;  5AFU L;  2CEA A;  4LFB T;  3KVB A;  3ZEF B;  3IBP A;  3V5S A;  5H6Q B;  3GA8 A;  3Q2M A;  2XQA A;  3TKL B;  2AE9 A;  5F5W A;  4AQY T;  4IE5 A;  3OJA A;  2D0T A;  5HEO A;  1OED B;  4AIS A;  3NBX X;  2RPA A;  2LKH A;  3UU6 A;  2W0G A;  2X51 A;  2V5D A;  5HWX A;  3RYC E;  1HNZ T;  4J2C A;  2EHO C;  3X1D A;  4XBF B;  3RHW A;  2IDO B;  5JRE A;  2X9Y A;  4B3T T;  5CJ5 A;  5JDN A;  4I50 E;  2XY8 B;  1KEY A;  2XTL A;  2WMO A;  5AQQ B;  5JDM A;  3T8O A;  4A5X A;  3PUS A;  4Z90 A;  2OLT A;  5CA0 E;  3RIF A;  2JQQ A;  2WS3 A;  5IWA T;  4DR3 T;  4CI3 B;  4WYV A;  2WCA A;  5HEJ A;  2L3L A;  4A97 A;  2LHN A;  2QYW A;  1MND A;  2V5C A;  2Q9Q C;  3MZK B;  2N2N A;  3WAK A;  3QB5 K;  2W67 A;  4YFS A;  4IT4 A;  4X20 E;  3UFE A;  1VCS A;  2W63 A;  5AQJ B;  2PBI A;  4IDN A;  4C90 A;  4HTE A;  3MJX A;  2IML A;  4PW8 A;  3RIU C;  4QX8 B;  2WU5 A;  4O8S A;  5AQV B;  3EDU A;  3JAF A;  2AXD S;  3ZYL A;  2LSG A;  3HKB E;  3R6N A;  4LFC T;  1X79 A;  3ESL A;  3CX7 B;  5LP6 E;  4EYU A;  2ZLY A;  2BG9 A;  3VHL A;  3UQ4 A;  5FXX A;  1BR2 A;  4LMK A;  5LOV E;  3A8Y C;  2E8I A;  2DHR A;  5KDM C;  4EEB A;  2VKJ A;  5JTG A;  4QWN B;  3P4R A;  3KV4 A;  3LDQ B;  3FBZ A;  4X62 T;  3UU4 A;  5JR9 A;  3KV6 A;  4MFR A;  2WDR A;  3SWH A;  1ZP0 A;  4AQG A;  3AB3 B;  3NKZ A;  4AKL A;  4EB6 E;  2UXN B;  4PJM A;  4AKG A;  5J2T E;  3FZH B;  3AE1 A;  3TLS A;  4ZS2 A;  4IE6 A;  4O4J E;  2Y8D A;  2CCQ A;  4YSY A;  2JRK A;  4B3R T;  3AXJ A;  3CQX C;  2QGS A;  2CA5 A;  2I59 A;  3AEA A;  1LVK A;  3HL6 A;  2A72 A;  2B1E A;  4HEA A;  3ZYM A;  4TN7 B;  4DR6 T;  1YQ3 A;  4DV5 T;  5JH7 E;  3RC8 A;  3E22 E;  3ZT7 A;  3P4S A;  2D9D A;  3CPZ A;  4X64 T;  3T1Y T;  5FMN A;  3UFG A;  3P4W A;  1YD8 G;  5LGT B;  2G0U A;  3M65 A;  2KIN B;  1U5P A;  3WAJ A;  3RKO A;  3K3Q C;  3ZMU B;  3L8R A;  4DR1 T;  1KF6 A;  4EXT A;  4YSX A;  1T8B A;  3ZJ2 A;  4U33 A;  2HPL A;  1VOM A;  4UIG A;  1Z0P A;  3EAB A;  4XAX B;  4X5T A;  4DMW A;  1DU2 A;  4H9S E;  2KT9 A;  3AVS A;  1HCI A;  4YLH A;  4JI8 T;  4IGU A;  3FZF B;  1HX1 B;  3I0Q A;  1D1B A;  4PK6 A;  4LF5 T;  4PFO A;  3WI3 A;  3BQI A;  4LFA T;  3ONX A;  2NWB A;  4ILB A;  4B3S T;  2LSJ A;  4GK0 E;  4HFB A;  4ZHQ E;  4UV9 B;  3NWI A;  3ZCI A;  3AA7 B;  2Q9Q D;  3C4Z A;  1H7C A;  2V26 A;  5L3G B;  3RI5 A;  4HWI B;  5LMU T;  3ZT5 A;  4LF6 T;  5DQV A;  5EK4 A;  3LSV A;  3RF1 A;  1NAF A;  4IDO A;  3AE2 A;  4HN9 A;  2K24 A;  5LCY A;  5EK2 A;  3JAE A;  3PU8 A;  3FXE B;  3HI2 A;  1J1J A;  1JNR A;  3AE3 A;  4DMV A;  3UT5 E;  3ANW A;  2XAH B;  4JEH B;  3AA6 B;  1M62 A;  4QXB B;  4UV8 B;  2YEV C;  2CXL A;  1J5W A;  3HKE E;  2NW9 A;  4PFP A;  1D0Z A;  3PTR B;  2UXX B;  4HGA A;  2YDQ A;  4DO0 A;  2JMH A;  2OA5 A;  1Z8U A;  5ADX L;  3I9W A;  1L0V A;  2QVA A;  3ONL C;  4DR7 T;  3ONJ A;  5KXJ A;  1HNW T;  5ABE A;  3BQL A;  1T98 A;  5C8Y E;  2UUC T;  4AIU A;  4JV5 T;  4HFI A;  2YDS A;  3LK3 B;  4I55 E;  3ETV A;  3K3N A;  2CXD A;  4O4H E;  2CHN A;  2XUE A;  4O2B E;  5LGN B;  2V7K A;  1BR1 A;  4G63 A;  5FNV E;  2NR4 A;  5JRC B;  4ILU A;  2EHO B;  3PUY F;  4IE0 A;  2X9H A;  1R8I A;  2CM0 A;  2XM2 A;  1U4Q A;  4GKJ T;  4TWF A;  2VQF T;  3HA4 A;  5IHY A;  3QK6 A;  4ZZB A;  1D1A A;  3N9L A;  3QNU A;  1UCU A;  3QOF A;  2NTX A;  3VRA A;  1OWA A;  5AQI B;  2MPK A;  4HFH A;  3AE8 A;  4U2Y A;  2EHO A;  2C5I T;  4HWH A;  1MIY A;  3RRC A;  1OED E;  4H9O C;  4GYS A;  4CXX A;  3FZK B;  3RH3 A;  2IIU A;  3N9O A;  5HCJ A;  4EAH A;  2ZM6 T;  5IYZ E;  3CIR A;  2Q9Q B;  5CA1 E;  2M67 A;  5IUX A;  4EOZ B;  1WR6 A;  3I1A A;  2VAS A;  2WBL A;  3OVU A;  4L0R A;  3PUA A;  2JJ9 A;  1MMD A;  3FB2 A;  4PJN A;  3ZMZ B;  2CHO A;  4B6X A;  1VCT A;  2V6Y B;  1N33 T;  3FXD B;  2X0L B;  1HS7 A;  4LML A;  1BR0 A;  4AI6 A;  4I4T E;  5JDF A;  3RIU A;  2X67 A;  3UU5 A;  2BG9 E;  4TNW A;  2WU2 A;  4UVB B;  2FBW A;  1NEK A;  2JIW A;  3ZLI A;  1CUN A;  3CQC B;  3RYH E;  4A56 A;  5HXH A;  3QB5 A;  2KXP B;  4Z8X A;  4WZX A;  2Z6E A;  3ZSS A;  2LJL A;  2K48 A;  4EYY R;  5LMN T;  2X9W A;  5DJQ C;  4JI6 T;  2H89 A;  1OED A;  1B7T A;  3UUN A;  1X9B A;  3AEF A;  3O4X E;  4NUU A;  4DR5 T;  2M6I A;  1NEN A;  3FBL A;  1KK7 A;  5HXS A;  3ABV A;  5BMV E;  4CI2 B;  2ODV A;  1T7S A;  2CBI A;  3QC9 A;  3SOL A;  3C64 A;  3ZT6 A;  3B13 A;  3NVO A;  3RGL A;  1I94 T;  2FUP A;  2OV9 A;  2H7O A;  2XQ5 A;  2LSY A;  3N2K E;  2LRL A;  3AEC A;  1EZ3 A;  3N9Q A;  3PUV F;  4UEL A;  2I6H A;  4QXH B;  4TUY E;  5LG3 A;  4UVC B;  2V7L A;  5FP3 A;  3AE5 A;  3EAM A;  2MYS A;  5FVL A;  2VKO A;  1WCR A;  2XQ9 A;  2WB5 A;  2C5J A;  4O4L E;  1O3X A;  4ISS A;  2A3D A;  4MLK A;  3RQU A;  2P9B A;  4TV8 E;  4KMC A;  2H3R A;  5L3D B;  3EI0 A;  3C51 A;  3ZMV B;  1SE7 A;  4L9I A;  2VK9 A;  3AEG A;  5KX5 E;  3G06 A;  2XZE A;  5L2L A;  2W61 A;  4QH4 A;  1N32 T;  3RKG A;  1OXZ A;  5BR8 T;  1SA0 E;  3MK7 C;  4DR2 T;  4EZH A;  4MBQ A;  2D2S A;  2SPC A;  3Q5W A;  3UU8 A;  3Q5X A;  3U3I A;  1IAP A;  5EZY E;  2VB6 A;  3C98 B;  4UXN B;  3D0T A;  2X66 A;  3UTK A;  1UGO A;  2W62 A;  4CN1 A;  3SRZ A;  1D0X A;  4ZXL A;  5L3E B;  2KSR A;  4FJO A;  4JI1 T;  4L5G A;  4EZ4 A;  1N36 T;  2LM2 A;  4P0A A;  1YW0 A;  2BBH A;  1W0B A;  4F8H A;  2KWH A;  3LG7 A;  5LJN A;  3PUR A;  3RPU A;  4MHC A;  4YXD A;  4HWC A;  2C0S A;  5C2T A;  3HKC E;  3B5M A;  3O1I A;  2MAW A;  2WSS V;  2LOP A;  3E0Z A;  5JDL A;  3TLV A;  4G2A A;  2WWU A;  3IHR A;  3ZC0 A;  3ZN0 B;  2UXC T;  3PUW F;  4YHH T;  4DUZ T;  4LF7 T;  2CWY A;  1G8X A;  4IE4 A;  2KMF A;  4HFC A;  2XSA A;  3J7Y q;  2PTF A;  2MTQ A;  2BDE A;  2V8S V;  4DV7 T;  5FL1 A;  1E2A A;  2XQ4 A;  2UUA T;  5HXE A;  2WQY A;  5DAB A;  5LG4 A;  1FMV A;  1E1H B;  3SFD A;  2DNX A;  1KFY A;  4ADZ A;  1BR4 A;  3PDY A;  4KHP T;  3P8C D;  2JPF A;  2XAQ B;  3OKQ A;  4KX6 A;  3P7I A;  4O4I E;  5JR9 C;  1FIO A;  5AQK B;  4KP3 C;  4JYA T;  1UK5 A;  1XWM A;  2UU9 T;  2CLY C;  1HX8 A;  5F8P A;  3KV9 A;  4A98 A;  5AQP B;  3ZPO A;  3JC6 D;  2J1D G;  4COF A;  4JI0 T;  4GIW A;  2FJE A;  3VRB A;  3ZC1 A;  4O2A E;  3KFW X;  4B3M T;  4CN4 A;  2ZM0 A;  4OX9 T;  4CZZ B;  5ABH A;  1QLB A;  4P0B A;  4LMJ A;  5LHH B;  4JUY A;  4QKN A;  4ANJ A;  3TLT A;  3RX6 A;  3GN5 B;  3EUH A;  4LF4 T;  3A7M A;  3F31 A;  2ODU A;  4DBQ A;  2JQK A;  4ZI3 C;  1SHZ C;  4HWF A;  4QH5 A;  3K8P C;  3RYI E;  1KNR A;  5FXW A;  4XZC A;  1WRD A;  2X0Y A;  1MIW A;  4KHZ F;  4PK5 A;  2XAF B;  3PUX F;  5FY7 A;  4IDQ A;  2NOX A;  2QA7 A;  4PNI A;  5A1L A;  4BA9 A;  4ASK A;  4QHO A;  2FJD A;  3PE0 A;  4ILC A;  3EVY A;  5J1G A;  2RP4 A;  2CMR A;  3P50 A;  4OYK A;  4HKA A;  1ZKE A;  1WLX A;  1HG5 A;  2X68 A;  5AQL B;  2Y48 B;  3P4Q A;  4U7I A;  5FYM A;  2DI4 A;  4TX5 A;  4HWD A;  1W09 A;  2R6G F;  3DP7 A;  2VVN A;  3C4W A;  4TWD A;  2J62 A;  3SS1 A;  1S94 A;  4PJJ A;  4X1I E;  4M1P A;  1NWM X;  2LSK A;  4HFV A;  2KND A;  1IBM T;  4GOU A;  4GKK T;  4C91 A;  4DVD A;  1MMG A;  4PJL A;  2WDV A;  4H9R C;  1HF8 A;  4ZEY A;  5L3B B;  2H88 A;  3RIA A;  4EED A;  3JCF A;  3UU3 A;  4IIJ E;  2DL1 A;  4EGW A;  2BVM A;  2V7I A;  3AAA B;  3BQK A;  2VL0 A;  1QUU A;  4YJ2 E;  3M3Z B;  5JRC A;  5FL0 A;  4DND A;  3TLU A;  2UUB T;  2ACX A;  4DUY T;  2X0H A;  4NUV A;  5ABF B;  3KVA A;  3HKD E;  2BKP A;  5GON E;  2QRX A;  4I0U A;  3K3O A;  2HN2 A;  4YTP A;  1D0Y A;  3J9X 1;  4OYJ A;  4JI2 T;  4DBR A;  4DV2 T;  3FZM B;  3UUX B;  5M4Y A;  4BJM A;  4P1N A;  3RQW A;  1UX4 A;  2LT3 A;  2HHH T;  1XMO T;  4ZI2 C;  3OPC A;  3CML A;  1QSD A;  4ZI7 E;  4LF9 T;  2VKD A;  1HG2 A;  2IC6 A;  5AQG B;  4X1Y E;  2PFV A;  2VVS A;  2Q9Q A;  1HR0 T;  2WP9 A;  4CXY A;  5ABG A;  4EIW A;  5L3F B;  2IUB A;  2J47 A;  3AE7 A;  3LJC A;  3GWH A;  4AXP A;  1HFA A;  3LFM A;  4ZS3 A;  2LEH A;  1V9D A;  2ZMA A;  1VRB A;  3MXZ A;  3OYX A;  5J2U E;  2V6Y A;  2DWG A;  2IW5 B;  2L8K A;  2W2U A;  5LBQ B;  2HN1 A;  4JLE A;  3GMI A;  3ZN1 B;  1HNX T;  2WAU A;  4PAG A;  2NTY A;  2YU1 A;  1J5E T;  2XM1 A;  1ZHC A;  1US7 B;  4HE8 A;  2XQY A;  4H9P C;  2E2A A;  2XPK A;  4ZI3 D;  1WR0 A;  1AJ3 A;  3RYF E;  1E7P A;  4H63 H;  3PV0 F;  4CN6 A;  5LYJ E;  3ZYK A;  5FY0 A;  2VUR A;  1KNZ A;  3UUM A;  2PJQ A;  5JDQ A;  4V1A v;  3UQ7 A;  3NRX A;  4GYR A;  2WZH A;  5L4E A;  5EK3 A;  5L3C B;  4IE7 A;  4YY3 T;  3FZL B;  1FMW A;  3N9M A;  2NP9 A;  3JC6 C;  2IAK A;  1I6Z A;  2V6X A;  5FXZ A;  2E9X C;  5JQG E;  4AQF C;  4CXW A;  2LLY A;  2WM9 A;  5LBM A;  4X1K E;  3TLW A;  1W9R A;  3AEB A;  5LA6 E;  3OTO T;  2BS3 A;  4U74 A;  4UVA B;  4JI4 T;  1UUS A;  1YKE B;  1IZN B;  4U31 A;  4WBO A;  1YQ4 A;  2L9Q A;  4TV9 E;  2XSB A;  1LKX A;  2BG9 B;  3SFE A;  5H6R B;  2LE8 A;  3U78 A;  1UX5 A;  4ERR A;  1ZEE A;  2BZB A;  4X66 T;  2LRK A;  5HWY A;  2Y6X A;  1Y01 A;  2YDR A;  3ZCJ A;  3PJA J;  4IL4 A;  3RC3 A;  4WNK A;  3AA0 B;  2HH7 A;  2CPT A;  2WDQ A;  3AA1 B;  4YHJ A;  2YN6 A;  4PK4 A;  2X9X A;  4U3C A;  3N2G E;  1XZY A;  2YIN A;  5L47 A;  1XMQ T;  3PUZ F;  4IDP A;  4IHJ E;  4UR9 A;  2YU2 A;  3S4U A;  5JR9 B;  5CFB A;  3ZMT B;  5HCM A; 
#chains in the Genus database with same CATH homology
 3L8R A;  2E2A A;  1E2A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...