3L8RA

The crystal structure of ptca from s. mutans
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
102
structure length
102
Chain Sequence
MNTEELQVAAFEIILNSGNARSIVHEAFDAMREKNYILAEQKLQEANDELLKAHQAQTDLLQEYASGTEIKIEIIMVHAQDHLMTTMTLREVAIEMLELYKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Putative PTS system, cellobiose-specific IIA component
publication title The crystal structure of PtcA from Streptococcus mutans
rcsb
source organism Streptococcus mutans
total genus 45
structure length 102
sequence length 102
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 2.7.1.69: Transferred entry: 2.7.1.191, 2.7.1.192, 2.7.1.193, 2.7.1.194, 2.7.1.195,
pdb deposition date 2010-01-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02255 PTS_IIA PTS system, Lactose/Cellobiose specific IIA subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.80 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Phosphotransferase system, lactose/cellobiose-type IIA subunit 3l8rA00
1E2AA 3L8RA 2E2AA
chains in the Genus database with same CATH superfamily
2X0HA 3P50A 1SA0E 4DVDA 2XASB 4HEAA 1WRDA 5JR9C 3ZEFB 2J4GA 3PUGA 3L09A 3VKGA 4KX6A 3AB3B 1HG2A 4QWNB 4PK4A 3J9X1 3FHNA 2M67A 2KNDA 3QB5K 2XQ5A 4IDZA 2NW9A 2NP9A 3C51A 5KXJA 2YK0A 2XTLA 1IBKT 5A1LA 2VKOA 2BG9C 2BG9E 4LF6T 2X68A 4U7YA 4LMJA 5LCYA 5AQUB 3RGLA 2CXLA 2LM9A 3A5XA 5L3FB 1YD8G 4JI1T 3U78A 5F3JA 3ZC0A 5JTGA 4I55E 1KF6A 1NAFA 4PAGA 3KFWX 1KNZA 1W0BA 4HWIB 4QH1A 4AKHA 3AEFA 2VL8A 3K3NA 2BDEA 3KV5A 1FJGT 2ODUA 5DQWA 2A72A 3UT5E 4F8HA 2VB6A 3CWZB 4IDOA 3S4UA 4PW8A 4AIUA 1YXRA 4YY3T 1XDPA 1ZKEA 5FYMA 2MPKA 4IGUA 2QYWA 5ABFB 4ZZCA 2VL0A 5KX5E 3OYZA 4YTMA 3C4XA 4X5TA 2IMLA 3N2GE 4Z8XA 3LJCA 1E2AA 3FZLB 2JQKA 2XQ6A 1MMAA 3ZT7A 4B3ST 4IL9A 2V7KA 2DCFA 3ZKRA 4DV4T 1QSDA 3SWHA 4IDPA 4JEHB 2CEAA 3LFMA 3RYCE 4EYUA 3H37A 5HXSA 3AE7A 4GK5E 5HXEA 2JJ9A 3PUQA 3TKLB 3ZJ1A 3RF1A 4PJJA 3GN5A 5AQMB 3RRCA 5LOVE 3ZLIA 3O1JA 3PUAA 2ODVA 3O1IA 3HA4A 2QGSA 1WLXA 4JUYA 4CN6A 3HI2A 2LOPA 3U3IA 2IC6A 5LMUT 4TWFA 3PDYA 2D2SA 5FXWA 3L39A 3K3QC 4HFVA 3JC6D 4UVBB 5JQGE 3MZKB 2BBJA 2Y6XA 2XSAA 3NKZA 4DV2T 4HFIA 2X9WA 1XNRT 4V1Av 5AFUL 2JMHA 2YN6A 4KHPT 3MXZA 5IUXA 2DI4A 4YTNA 4ZS2A 3AEBA 5JRCB 5J2UE 4ILCA 3B13A 3CIRA 3ZMUB 3AAIA 2V5DA 2E9XD 2DL1A 3HKCE 5LGUB 4P0BA 4OHFA 4IE0A 5AQOB 4DV5T 2IIUA 3MACA 3FXEB 3TLSA 2I6HA 3AA6B 4DR5T 4F6RC 4JI6T 3CMLA 4WNKA 4HFHA 2ACXA 2VK9A 2IUBA 3MKDA 1JNZA 2JQQA 2CRBA 2LM2A 4XZCA 5LG3A 3ONXA 3T1HT 4A98A 3SFDA 2JPFA 3AXJB 4IE4A 4AKRB 2CHNA 4XAXB 5JDHA 5FVKA 2CA5A 2A2FX 2V6YB 3C50A 1S94A 3VU7H 1NENA 4HWHA 2C5KT 3K8PC 2LKGA 2CXDA 4TWHA 3QC9A 5AQRB 3CX8B 1HX8A 1WCRA 4AISA 1D0YA 5CGMA 1MNDA 3KVAA 4ZI7E 3E22E 1SHZC 3OVUA 1UURA 4U2ZA 3AE6A 2LEHA 1HCIA 1YKEB 5HWXA 2BS4A 2Y8DA 2SPCA 4XBFB 4ZI3D 1IZNB 2DHRA 1KEYA 1HS7A 2E2AA 1EZ3A 2P9BA 4PFOA 1M7KA 1I94T 3O4XE 4X65T 4P0AA 3B5MA 3PUZF 2WP9A 1R8IA 4TV9E 4EZHA 4U33A 3CK6A 3PUXF 3ZSTA 3CX7B 1ZEEA 2KWIB 3P4QA 4ERRA 3MJXA 3PUVF 2VKDA 2X67A 1ZV4X 5BR8T 5EK4A 3ZYKA 4OK0A 4FI5A 1WYBA 2XM1A 5L3EB 1GQEA 5JDLA 2VKHA 4IL4A 4U7IA 5CFBA 2YU2A 4ISSA 3WI3A 5AQHB 4ZZBA 3P7IA 3UU6A 4HWCA 4LMLA 2XQ7A 5HWYA 2IDOB 1JNRA 4HFCA 5HEOA 5JDFA 3EABA 3P4SA 4AKGA 5ABEA 1E7PA 2BVMA 3N9LA 3VKHA 3C98B 2V26A 5FP3A 3T1YT 4IREA 4DUYT 2Q9QA 2DNXA 4HE8A 4DR6T 3EAMA 3RYFE 1MMNA 5JR9B 3QB5A 1J5ET 3F31A 5HEJA 3N9PA 4TUYE 4BAYB 4NUVA 1Y64B 2GK9A 2J62A 2X9YA 1HFAA 4L0RA 3MA9A 5L2LA 3PUSA 5LGTB 3T8OA 4KI0F 3AAAB 1BR1A 1US7B 1KK7A 3ZYMA 1X9BA 2W63A 2BS3A 4QX7B 4QXHB 1UK5A 3RX6A 2H89A 3VRBA 3ZT5A 3ONJA 5C3JA 3N9MA 4G63A 4KUMB 4K0UA 5IYZE 3JAFA 4O8SA 2V7IA 4QH4A 2YDSA 1LVKA 1W9RA 3ZC1A 5FY1A 1VCTA 3CVRA 4JI0T 5AQVB 3PU8A 4PJMA 1IJ6A 2YU1A 1KNPA 3RC8A 3KINB 2XM2A 4GYRA 2NWBA 2XQAA 3RI5A 3AA0B 5FL0A 5FMNA 4GKKT 2UXDT 3UUMA 2UXCT 2HHHT 5JH7E 4K0KT 2LKHA 1Y01A 4COFA 3FZHB 3Q2MA 4LMKA 4ZXLA 3TLWA 3AE2A 3QUJA 5TAOA 3SOLA 5L3CB 2NW8A 1ZP0A 4LF7T 2NTXA 4OYKA 3Q5XA 1OWAA 4HGAA 2WQYA 2XAFB 4YXDA 2YDQA 4KBMB 2MBGA 3ZYLA 2V7MA 2EHOB 4GOUA 2IW5B 1S35A 2PFVA 5F5WA 3RIFA 4AQGA 3IA3A 3N2OA 4IE6A 3X1DA 1FEWA 4Z91A 3ANWB 5FXXA 3HKEE 5M4YA 4EYYR 1XMQT 3LSVA 4HFEA 1N33T 3AE3A 4UVCB 5FNVE 4J2CA 4Z90A 4DNDA 2BKOA 4HWFA 1D0ZA 3ABVA 5L4EA 4DMVA 2WU2A 2HH7A 1MNEA 4O4HE 3FBLA 2B76A 2K24A 5CJ5A 5L3GB 1VRBA 4EZ4A 2NOXA 3E08A 3AECA 2C5JA 5AQLB 2VVNA 3N9QA 4X1KE 3Q5EA 3LBXB 2J47A 3ETVA 2MTQA 2XQ8A 4EGWA 4AQFC 3KV6A 4ZHQE 4C91A 2M6IA 2Q9QB 5LJMA 4GYSA 2XY8B 4WYVA 3ESLA 2CHOA 3F57A 2JQ9A 2EHOC 2X9HA 4O4LE 3AE8A 5L47A 3CKDA 5AQGB 5LBMA 3FB2A 2ZM2A 3ZPOA 2D5UA 4DR7T 2WWUA 2IHR1 2OV9A 2VWAA 1WR6A 1SE7A 3KBTA 1IAPA 3M3ZB 3ZMZB 1XDOA 2PJQA 3UULA 3NRXA 2V1DB 3O1HA 3KV9A 2BBHA 4UV8B 4BA9A 4TX5A 1L0VA 3RYHE 3ZT6A 3VRAA 5CA1E 2L3LA 1MIWA 3CQCB 4Q25A 4O4IE 5JDQA 4AKIA 4MBQA 4PK5A 1BR0A 4NIQA 3UUNA 2HPJA 2E5LT 1UGOA 2Y48B 4EXTA 5L3DB 4HN9A 4YJ3E 5LMNT 1OXZA 4CN4A 3H3MA 5JVDE 1LKXA 3IHRA 3M65A 2BKPA 5DQVA 2Q9QC 4UF0A 2V6XA 5CA0E 4JI8T 2VURA 3PTRB 3QK6A 3IBPA 2X51A 2JQHA 4P09A 1D1BA 2C0SA 2E9XA 5IWAT 1G73A 4ZI2D 5FXVA 4LFAT 5FY7A 2LSYA 3Q5DA 3LK2B 4QH5A 3FZKB 1G8XA 4IHJE 1T98A 2OLTA 2CPTA 1XMOT 5ABHA 4CXWA 4H9SE 2V7JA 2QVAA 1J5WA 2RP4A 3PURA 3FZFB 2LSIA 1E1HB 2W0GA 5JDGA 5EK3A 2IAKA 3FZMB 3ETUA 2XJ7A 4E7ZA 2WMNA 3AA1B 5J0ZA 2WDVA 2C5IT 3EUHA 4KMCA 3PE0A 4EOZB 4TN7B 4AKLA 2HN1A 4BJMA 1N32T 3I1AA 4LF9T 4JBWF 5E0OA 3EI0A 4DMWA 3VR9A 5C2TA 1W09A 1MMDA 2K9AA 2KLQA 2KWHA 4I43B 3AEGA 4H9NC 3QNUA 4YHHT 4E7SA 5H6QB 3TLUA 4EAHA 4GIWA 1D1CA 3AE1A 2X0LB 2H7VC 3C4ZA 3OPCA 3RKOA 4N78D 4UR9A 3RIAA 2BG9A 2XQYA 2BS2A 2WM9A 2L8KA 1J1JA 3Q9DA 2LHNA 3JAEA 2RPAA 2XPKA 1KFYA 4I4TE 4PJNA 3KV4A 3I0OA 4FJOA 4HFDA 4U74A 1OEDA 4GKJT 1XNQT 2A3DA 4HTEA 5JDMA 3GN5B 2JMKA 4DBQA 1B7TA 1Z8UA 4MALA 2ZM6T 3O9XA 3RKGA 4YSYA 4X20E 5LHHB 3N5LA 3ZJ2A 2WCAA 4JYAT 5LB7B 2CCQA 3DJBA 1IJ5A 1CUNA 2PTFA 3ONLC 3VHLA 3LG7A 4ISTA 2ACZA 2WU5A 2YDRA 2EHOD 4NUUA 3J7Yq 1MMGA 2CBIA 2ZM8A 3QOFA 4UEMA 2JRKA 2H88A 3LK3B 4JI3T 4CQIA 1FMWA 4B3TT 4AQYT 1HF8A 3EHZA 2K48A 1O3XA 3OJAA 3LK42 5AQPB 2YEVC 5ETWA 5AQFB 3AEEA 3UUXB 2K3WA 2IC9A 4OFZA 5HXHA 2W62A 5LJNA 3IF8B 1SUMB 5LG4A 2W2UA 5HCMA 3KVBA 2QA7A 2UUAT 3UU5A 4EV6A 4UV9B 4P1NA 4PJLA 4WZXA 5FVLA 2CLYC 5LBQB 2G0UA 3AE5A 4TWDA 4ILUA 1HNZT 5ABFA 1YQ3A 3RH3A 2MOZA 3RIUA 3SS1A 3DP7A 3P4RA 4H9RC 1UX5A 3JC6C 3WAKA 5EK2A 4DR1T 2CWYA 3DTOA 4B6XA 4H63V 5CB4E 2DLRA 1HX1B 3NWIA 1FIOA 4TNVA 1VCSA 1D1AA 4I50E 2E8IA 3CX6B 2J1DG 3PUYF 2BVLA 2XQ9A 2H7OA 5LGNB 3NZPA 3AEDA 1H7CA 2E9XC 3A8YC 4LFCT 4U31A 4EIWA 5LYJE 4O2AE 3NVOA 4AI6A 2VQET 4DO0A 2FJBA 4C90A 1HR0T 4WBOA 4CI2B 4TV8E 3LDQB 4ANJA 5JREA 3FXDB 4YFSA 1XZYA 2KSRA 1IBLT 3AVSA 3K3OA 4NPPA 2UUCT 1KNRA 3OTOT 3D0TA 2XQ3A 3P8CD 4KHZF 4LF5T 4QX8B 4A5XA 2UUBT 3HKDE 3EVYA 2OA5A 4DBRA 3RQWA 2CBJA 3Q5WA 3UQ4A 3RLFF 2D0UA 5JRCA 2HN2A 5FXZA 5AQJB 2UXNB 3BQIA 5HEGA 4EEDA 3PU3A 3OKQA 4HWDA 4H9QC 4ILBA 5LXTE 4UELA 2LHRA 2LRLA 4IE7A 1U5PA 4QXBB 2ZLYA 4H9OC 3UFEA 3GMIA 4YJ2E 5AQNB 2KXPB 3WAJA 4DV3T 2V5CA 3I9WA 1HTJF 3CPZA 2LSKA 3IEEA 3UU3A 1LRZA 1XWMA 2LSGA 4ZI3C 2ZMAA 3AXJA 5J1GA 1FMVA 3HR0A 1OEDC 1OEDE 2V6YA 4YSZA 2FJAA 2X66A 4X1YE 2WZHA 3HKBE 5HEUA 2WWVA 3OBVE 5AQSB 3RHWA 3AVRA 4OX9T 2W4XA 5ADXL 2ZM0A 4U2YA 2WDRA 2NR4A 2KZ7B 2XQ4A 4YLHA 2XAQB 2XUEA 2X9XA 2F4VT 4HKAA 2W00A 1YW0A 2XAGB 2FJEA 2CE7A 5AQIB 3L3PA 3BQLA 3NBXX 5DABA 1HG5A 4QXCB 4UIGA 4O4JE 3TLTA 3A7MA 3JCFA 2CM0A 4MLKA 2I0MA 2D9DA 3P4WA 4U3CA 3V5UA 3E0ZA 2V7LA 3EDVA 3BK9A 3OYXA 4YTPA 3ZN0B 5H6RB 3R84B 2WY2A 4IDQA 3R6NA 3V5SA 2FJDA 2VKJA 2UU9T 4QKNA 1LVFA 2XAJB 2LSJA 3KBUA 3L8RA 4U72A 4CXYA 3RIUC 1QLBA 5LHGB 4JI4T 2V8SV 4NXNT 1WR0A 4JLEA 2KT9A 3PV0F 3N9NA 1UX4A 2WZIA 3W15B 2BZBA 2B1EA 5LA6E 3UUBA 1QUUA 4IT4A 3RQUA 1U4QA 3C64A 1IBMT 1BR2A 3RPUA 3BQKA 5JDNA 3I0QA 4PK6A 4GK0E 2VQFT 4LF4T 1HNWT 1MIVA 3RYIE 3I9YA 3UFGA 2XHEB 3N2KE 3NRYA 3PUWF 4H9PC 2Z6EA 1CHUA 3AEAA 4I0UA 3UTKA 5JR9A 2DWKA 3ZCJA 4DV7T 1BR4A 2R6GF 2W67A 4IE5A 2RA1A 4UVAB 4PNIA 2E5VA 2WB5A 3AE4A 5L4HA 3AE9A 3ZMVB 2L9QA 4PFPA 4JV5T 4L9IA 2LOSA 2N9DA 5AQKB 4HFBA 5ABGA 2BKNA 4UXNB 2K5BB 4M1PA 2WAUA 2MYSA 2WBLA 1VOMA 5FY0A 2LT3A 4DV6T 3ZSSA 2CWOA 3ZCIA 1ZOYA 2KINB 4B3MT 4YT0A 1T8BA 5FL1A 2JIWA 4ZS3A 4EEBA 5C8YE 4DV0T 4H63H 4ZEYA 4CXXA 2DWGA 5LNKA 3KDSE 4BJNA 5HYAA 3RC3A 4CI1B 3K1SA 4IDNA 2YKSA 2FUPA 4JI5T 2QRXA 5L3BB 4ASKA 1WFDA 2XAHB 4TZ4C 3N9OA 2A9UA 4QHOA 2CLYB 2LLYA 2KMFA 2AE9A 1ZHCA 3JADA 2X0YA 3SFEA 4OYJA 1HNXT 3UU8A 4A97A 1UCUA 2YOEA 4CZZB 4MFRA 3C4WA 1MIYA 4AQFA 2VASA 4CN1A 2CMRA 2WDQA 2UXBT 3H3AA 2N2NA 2WMOA 3EDUA 1YKHB 5AQTB 2LE8A 2EHOA 3FBZA 4ILAA 5HCJA 5EZYE 4UF0B 5FKYA 3UU4A 2FBWA 2VVSA 3CQXC 4YSXA 1V9DA 4LFBT 2LRKA 3ANWA 1YQ4A 3AA7B 5LP6E 3ZMTB 2N1GA 2E9XB 4A56A 3AAEB 3F2EA 3TLVA 2W61A 2I59A 4JEUB 4X64T 4B3RT 5IHYA 2HPLA 1I6ZA 1D0XA 5GONE 1NWMX 5AQQB 4EB6E 2AXDS 2XZEA 4YHJA 2UXXB 4DV1T 5BMVE 4NXMT 4JI7T 4X66T 4G2AA 3G06A 1W0AA 4X1IE 1Z0PA 3LBXA 4WW0A 2W66A 2Q9QD 1T72A 1N34T 3CQGB 4WBNE 2ES0A 1AJ3A 2LJLA 3HL6A 1M62A 2YINA 4CI3B 2M6BA 3UQ7A 3PJAJ 5F8PA 3SRZA 1N36T 2CXFA 1X79A 5HAXA 4DIDB 3GWHA 4DR3T 2WSSV 1T7SA 4LF8T 2MAWA 4AXPA 2H3RA 3VR8A 4DR2T 3ZMSB 4MHCA 2NTYA 4O2BE 2PBIA 1WYCA 5HXRA 4ZI2C 3GA8A 3RRWA 5J2TE 5LHIB 1DU2A 1UUSA 5HXCA 5HEHA 4X62T 4ADZA 4L5GA 2WS3A 2BG9B 3PJAA 2NW7A 5KDMC 2XSBA 4JI2T 3MK7C 1NEKA 3ZN1B 4TNWA 5DJQC 3B57A 2D0TA 1OEDB 4DR4T 4ZOLE 2PG8A 5KMGP 4IIJE 3NZQA 4DUZT 3P4PA 4KP3C
chains in the Genus database with same CATH topology
1E2AA 3L8RA 2E2AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E2A A;  3L8R A;  2E2A A; 
#chains in the Genus database with same CATH topology
 2X0H A;  3P50 A;  1SA0 E;  4DVD A;  2XAS B;  4HEA A;  1WRD A;  5JR9 C;  3ZEF B;  2J4G A;  3PUG A;  3L09 A;  3VKG A;  4KX6 A;  3AB3 B;  1HG2 A;  4QWN B;  4PK4 A;  3J9X 1;  3FHN A;  2M67 A;  2KND A;  3QB5 K;  2XQ5 A;  4IDZ A;  2NW9 A;  2NP9 A;  3C51 A;  5KXJ A;  2YK0 A;  2XTL A;  1IBK T;  5A1L A;  2VKO A;  2BG9 C;  2BG9 E;  4LF6 T;  2X68 A;  4U7Y A;  4LMJ A;  5LCY A;  5AQU B;  3RGL A;  2CXL A;  2LM9 A;  3A5X A;  5L3F B;  1YD8 G;  4JI1 T;  3U78 A;  5F3J A;  3ZC0 A;  5JTG A;  4I55 E;  1KF6 A;  1NAF A;  4PAG A;  3KFW X;  1KNZ A;  1W0B A;  4HWI B;  4QH1 A;  4AKH A;  3AEF A;  2VL8 A;  3K3N A;  2BDE A;  3KV5 A;  1FJG T;  2ODU A;  5DQW A;  2A72 A;  3UT5 E;  4F8H A;  2VB6 A;  3CWZ B;  4IDO A;  3S4U A;  4PW8 A;  4AIU A;  1YXR A;  4YY3 T;  1XDP A;  1ZKE A;  5FYM A;  2MPK A;  4IGU A;  2QYW A;  5ABF B;  4ZZC A;  2VL0 A;  5KX5 E;  3OYZ A;  4YTM A;  3C4X A;  4X5T A;  2IML A;  3N2G E;  4Z8X A;  3LJC A;  1E2A A;  3FZL B;  2JQK A;  2XQ6 A;  1MMA A;  3ZT7 A;  4B3S T;  4IL9 A;  2V7K A;  2DCF A;  3ZKR A;  4DV4 T;  1QSD A;  3SWH A;  4IDP A;  4JEH B;  2CEA A;  3LFM A;  3RYC E;  4EYU A;  3H37 A;  5HXS A;  3AE7 A;  4GK5 E;  5HXE A;  2JJ9 A;  3PUQ A;  3TKL B;  3ZJ1 A;  3RF1 A;  4PJJ A;  3GN5 A;  5AQM B;  3RRC A;  5LOV E;  3ZLI A;  3O1J A;  3PUA A;  2ODV A;  3O1I A;  3HA4 A;  2QGS A;  1WLX A;  4JUY A;  4CN6 A;  3HI2 A;  2LOP A;  3U3I A;  2IC6 A;  5LMU T;  4TWF A;  3PDY A;  2D2S A;  5FXW A;  3L39 A;  3K3Q C;  4HFV A;  3JC6 D;  4UVB B;  5JQG E;  3MZK B;  2BBJ A;  2Y6X A;  2XSA A;  3NKZ A;  4DV2 T;  4HFI A;  2X9W A;  1XNR T;  4V1A v;  5AFU L;  2JMH A;  2YN6 A;  4KHP T;  3MXZ A;  5IUX A;  2DI4 A;  4YTN A;  4ZS2 A;  3AEB A;  5JRC B;  5J2U E;  4ILC A;  3B13 A;  3CIR A;  3ZMU B;  3AAI A;  2V5D A;  2E9X D;  2DL1 A;  3HKC E;  5LGU B;  4P0B A;  4OHF A;  4IE0 A;  5AQO B;  4DV5 T;  2IIU A;  3MAC A;  3FXE B;  3TLS A;  2I6H A;  3AA6 B;  4DR5 T;  4F6R C;  4JI6 T;  3CML A;  4WNK A;  4HFH A;  2ACX A;  2VK9 A;  2IUB A;  3MKD A;  1JNZ A;  2JQQ A;  2CRB A;  2LM2 A;  4XZC A;  5LG3 A;  3ONX A;  3T1H T;  4A98 A;  3SFD A;  2JPF A;  3AXJ B;  4IE4 A;  4AKR B;  2CHN A;  4XAX B;  5JDH A;  5FVK A;  2CA5 A;  2A2F X;  2V6Y B;  3C50 A;  1S94 A;  3VU7 H;  1NEN A;  4HWH A;  2C5K T;  3K8P C;  2LKG A;  2CXD A;  4TWH A;  3QC9 A;  5AQR B;  3CX8 B;  1HX8 A;  1WCR A;  4AIS A;  1D0Y A;  5CGM A;  1MND A;  3KVA A;  4ZI7 E;  3E22 E;  1SHZ C;  3OVU A;  1UUR A;  4U2Z A;  3AE6 A;  2LEH A;  1HCI A;  1YKE B;  5HWX A;  2BS4 A;  2Y8D A;  2SPC A;  4XBF B;  4ZI3 D;  1IZN B;  2DHR A;  1KEY A;  1HS7 A;  2E2A A;  1EZ3 A;  2P9B A;  4PFO A;  1M7K A;  1I94 T;  3O4X E;  4X65 T;  4P0A A;  3B5M A;  3PUZ F;  2WP9 A;  1R8I A;  4TV9 E;  4EZH A;  4U33 A;  3CK6 A;  3PUX F;  3ZST A;  3CX7 B;  1ZEE A;  2KWI B;  3P4Q A;  4ERR A;  3MJX A;  3PUV F;  2VKD A;  2X67 A;  1ZV4 X;  5BR8 T;  5EK4 A;  3ZYK A;  4OK0 A;  4FI5 A;  1WYB A;  2XM1 A;  5L3E B;  1GQE A;  5JDL A;  2VKH A;  4IL4 A;  4U7I A;  5CFB A;  2YU2 A;  4ISS A;  3WI3 A;  5AQH B;  4ZZB A;  3P7I A;  3UU6 A;  4HWC A;  4LML A;  2XQ7 A;  5HWY A;  2IDO B;  1JNR A;  4HFC A;  5HEO A;  5JDF A;  3EAB A;  3P4S A;  4AKG A;  5ABE A;  1E7P A;  2BVM A;  3N9L A;  3VKH A;  3C98 B;  2V26 A;  5FP3 A;  3T1Y T;  4IRE A;  4DUY T;  2Q9Q A;  2DNX A;  4HE8 A;  4DR6 T;  3EAM A;  3RYF E;  1MMN A;  5JR9 B;  3QB5 A;  1J5E T;  3F31 A;  5HEJ A;  3N9P A;  4TUY E;  4BAY B;  4NUV A;  1Y64 B;  2GK9 A;  2J62 A;  2X9Y A;  1HFA A;  4L0R A;  3MA9 A;  5L2L A;  3PUS A;  5LGT B;  3T8O A;  4KI0 F;  3AAA B;  1BR1 A;  1US7 B;  1KK7 A;  3ZYM A;  1X9B A;  2W63 A;  2BS3 A;  4QX7 B;  4QXH B;  1UK5 A;  3RX6 A;  2H89 A;  3VRB A;  3ZT5 A;  3ONJ A;  5C3J A;  3N9M A;  4G63 A;  4KUM B;  4K0U A;  5IYZ E;  3JAF A;  4O8S A;  2V7I A;  4QH4 A;  2YDS A;  1LVK A;  1W9R A;  3ZC1 A;  5FY1 A;  1VCT A;  3CVR A;  4JI0 T;  5AQV B;  3PU8 A;  4PJM A;  1IJ6 A;  2YU1 A;  1KNP A;  3RC8 A;  3KIN B;  2XM2 A;  4GYR A;  2NWB A;  2XQA A;  3RI5 A;  3AA0 B;  5FL0 A;  5FMN A;  4GKK T;  2UXD T;  3UUM A;  2UXC T;  2HHH T;  5JH7 E;  4K0K T;  2LKH A;  1Y01 A;  4COF A;  3FZH B;  3Q2M A;  4LMK A;  4ZXL A;  3TLW A;  3AE2 A;  3QUJ A;  5TAO A;  3SOL A;  5L3C B;  2NW8 A;  1ZP0 A;  4LF7 T;  2NTX A;  4OYK A;  3Q5X A;  1OWA A;  4HGA A;  2WQY A;  2XAF B;  4YXD A;  2YDQ A;  4KBM B;  2MBG A;  3ZYL A;  2V7M A;  2EHO B;  4GOU A;  2IW5 B;  1S35 A;  2PFV A;  5F5W A;  3RIF A;  4AQG A;  3IA3 A;  3N2O A;  4IE6 A;  3X1D A;  1FEW A;  4Z91 A;  3ANW B;  5FXX A;  3HKE E;  5M4Y A;  4EYY R;  1XMQ T;  3LSV A;  4HFE A;  1N33 T;  3AE3 A;  4UVC B;  5FNV E;  4J2C A;  4Z90 A;  4DND A;  2BKO A;  4HWF A;  1D0Z A;  3ABV A;  5L4E A;  4DMV A;  2WU2 A;  2HH7 A;  1MNE A;  4O4H E;  3FBL A;  2B76 A;  2K24 A;  5CJ5 A;  5L3G B;  1VRB A;  4EZ4 A;  2NOX A;  3E08 A;  3AEC A;  2C5J A;  5AQL B;  2VVN A;  3N9Q A;  4X1K E;  3Q5E A;  3LBX B;  2J47 A;  3ETV A;  2MTQ A;  2XQ8 A;  4EGW A;  4AQF C;  3KV6 A;  4ZHQ E;  4C91 A;  2M6I A;  2Q9Q B;  5LJM A;  4GYS A;  2XY8 B;  4WYV A;  3ESL A;  2CHO A;  3F57 A;  2JQ9 A;  2EHO C;  2X9H A;  4O4L E;  3AE8 A;  5L47 A;  3CKD A;  5AQG B;  5LBM A;  3FB2 A;  2ZM2 A;  3ZPO A;  2D5U A;  4DR7 T;  2WWU A;  2IHR 1;  2OV9 A;  2VWA A;  1WR6 A;  1SE7 A;  3KBT A;  1IAP A;  3M3Z B;  3ZMZ B;  1XDO A;  2PJQ A;  3UUL A;  3NRX A;  2V1D B;  3O1H A;  3KV9 A;  2BBH A;  4UV8 B;  4BA9 A;  4TX5 A;  1L0V A;  3RYH E;  3ZT6 A;  3VRA A;  5CA1 E;  2L3L A;  1MIW A;  3CQC B;  4Q25 A;  4O4I E;  5JDQ A;  4AKI A;  4MBQ A;  4PK5 A;  1BR0 A;  4NIQ A;  3UUN A;  2HPJ A;  2E5L T;  1UGO A;  2Y48 B;  4EXT A;  5L3D B;  4HN9 A;  4YJ3 E;  5LMN T;  1OXZ A;  4CN4 A;  3H3M A;  5JVD E;  1LKX A;  3IHR A;  3M65 A;  2BKP A;  5DQV A;  2Q9Q C;  4UF0 A;  2V6X A;  5CA0 E;  4JI8 T;  2VUR A;  3PTR B;  3QK6 A;  3IBP A;  2X51 A;  2JQH A;  4P09 A;  1D1B A;  2C0S A;  2E9X A;  5IWA T;  1G73 A;  4ZI2 D;  5FXV A;  4LFA T;  5FY7 A;  2LSY A;  3Q5D A;  3LK2 B;  4QH5 A;  3FZK B;  1G8X A;  4IHJ E;  1T98 A;  2OLT A;  2CPT A;  1XMO T;  5ABH A;  4CXW A;  4H9S E;  2V7J A;  2QVA A;  1J5W A;  2RP4 A;  3PUR A;  3FZF B;  2LSI A;  1E1H B;  2W0G A;  5JDG A;  5EK3 A;  2IAK A;  3FZM B;  3ETU A;  2XJ7 A;  4E7Z A;  2WMN A;  3AA1 B;  5J0Z A;  2WDV A;  2C5I T;  3EUH A;  4KMC A;  3PE0 A;  4EOZ B;  4TN7 B;  4AKL A;  2HN1 A;  4BJM A;  1N32 T;  3I1A A;  4LF9 T;  4JBW F;  5E0O A;  3EI0 A;  4DMW A;  3VR9 A;  5C2T A;  1W09 A;  1MMD A;  2K9A A;  2KLQ A;  2KWH A;  4I43 B;  3AEG A;  4H9N C;  3QNU A;  4YHH T;  4E7S A;  5H6Q B;  3TLU A;  4EAH A;  4GIW A;  1D1C A;  3AE1 A;  2X0L B;  2H7V C;  3C4Z A;  3OPC A;  3RKO A;  4N78 D;  4UR9 A;  3RIA A;  2BG9 A;  2XQY A;  2BS2 A;  2WM9 A;  2L8K A;  1J1J A;  3Q9D A;  2LHN A;  3JAE A;  2RPA A;  2XPK A;  1KFY A;  4I4T E;  4PJN A;  3KV4 A;  3I0O A;  4FJO A;  4HFD A;  4U74 A;  1OED A;  4GKJ T;  1XNQ T;  2A3D A;  4HTE A;  5JDM A;  3GN5 B;  2JMK A;  4DBQ A;  1B7T A;  1Z8U A;  4MAL A;  2ZM6 T;  3O9X A;  3RKG A;  4YSY A;  4X20 E;  5LHH B;  3N5L A;  3ZJ2 A;  2WCA A;  4JYA T;  5LB7 B;  2CCQ A;  3DJB A;  1IJ5 A;  1CUN A;  2PTF A;  3ONL C;  3VHL A;  3LG7 A;  4IST A;  2ACZ A;  2WU5 A;  2YDR A;  2EHO D;  4NUU A;  3J7Y q;  1MMG A;  2CBI A;  2ZM8 A;  3QOF A;  4UEM A;  2JRK A;  2H88 A;  3LK3 B;  4JI3 T;  4CQI A;  1FMW A;  4B3T T;  4AQY T;  1HF8 A;  3EHZ A;  2K48 A;  1O3X A;  3OJA A;  3LK4 2;  5AQP B;  2YEV C;  5ETW A;  5AQF B;  3AEE A;  3UUX B;  2K3W A;  2IC9 A;  4OFZ A;  5HXH A;  2W62 A;  5LJN A;  3IF8 B;  1SUM B;  5LG4 A;  2W2U A;  5HCM A;  3KVB A;  2QA7 A;  2UUA T;  3UU5 A;  4EV6 A;  4UV9 B;  4P1N A;  4PJL A;  4WZX A;  5FVL A;  2CLY C;  5LBQ B;  2G0U A;  3AE5 A;  4TWD A;  4ILU A;  1HNZ T;  5ABF A;  1YQ3 A;  3RH3 A;  2MOZ A;  3RIU A;  3SS1 A;  3DP7 A;  3P4R A;  4H9R C;  1UX5 A;  3JC6 C;  3WAK A;  5EK2 A;  4DR1 T;  2CWY A;  3DTO A;  4B6X A;  4H63 V;  5CB4 E;  2DLR A;  1HX1 B;  3NWI A;  1FIO A;  4TNV A;  1VCS A;  1D1A A;  4I50 E;  2E8I A;  3CX6 B;  2J1D G;  3PUY F;  2BVL A;  2XQ9 A;  2H7O A;  5LGN B;  3NZP A;  3AED A;  1H7C A;  2E9X C;  3A8Y C;  4LFC T;  4U31 A;  4EIW A;  5LYJ E;  4O2A E;  3NVO A;  4AI6 A;  2VQE T;  4DO0 A;  2FJB A;  4C90 A;  1HR0 T;  4WBO A;  4CI2 B;  4TV8 E;  3LDQ B;  4ANJ A;  5JRE A;  3FXD B;  4YFS A;  1XZY A;  2KSR A;  1IBL T;  3AVS A;  3K3O A;  4NPP A;  2UUC T;  1KNR A;  3OTO T;  3D0T A;  2XQ3 A;  3P8C D;  4KHZ F;  4LF5 T;  4QX8 B;  4A5X A;  2UUB T;  3HKD E;  3EVY A;  2OA5 A;  4DBR A;  3RQW A;  2CBJ A;  3Q5W A;  3UQ4 A;  3RLF F;  2D0U A;  5JRC A;  2HN2 A;  5FXZ A;  5AQJ B;  2UXN B;  3BQI A;  5HEG A;  4EED A;  3PU3 A;  3OKQ A;  4HWD A;  4H9Q C;  4ILB A;  5LXT E;  4UEL A;  2LHR A;  2LRL A;  4IE7 A;  1U5P A;  4QXB B;  2ZLY A;  4H9O C;  3UFE A;  3GMI A;  4YJ2 E;  5AQN B;  2KXP B;  3WAJ A;  4DV3 T;  2V5C A;  3I9W A;  1HTJ F;  3CPZ A;  2LSK A;  3IEE A;  3UU3 A;  1LRZ A;  1XWM A;  2LSG A;  4ZI3 C;  2ZMA A;  3AXJ A;  5J1G A;  1FMV A;  3HR0 A;  1OED C;  1OED E;  2V6Y A;  4YSZ A;  2FJA A;  2X66 A;  4X1Y E;  2WZH A;  3HKB E;  5HEU A;  2WWV A;  3OBV E;  5AQS B;  3RHW A;  3AVR A;  4OX9 T;  2W4X A;  5ADX L;  2ZM0 A;  4U2Y A;  2WDR A;  2NR4 A;  2KZ7 B;  2XQ4 A;  4YLH A;  2XAQ B;  2XUE A;  2X9X A;  2F4V T;  4HKA A;  2W00 A;  1YW0 A;  2XAG B;  2FJE A;  2CE7 A;  5AQI B;  3L3P A;  3BQL A;  3NBX X;  5DAB A;  1HG5 A;  4QXC B;  4UIG A;  4O4J E;  3TLT A;  3A7M A;  3JCF A;  2CM0 A;  4MLK A;  2I0M A;  2D9D A;  3P4W A;  4U3C A;  3V5U A;  3E0Z A;  2V7L A;  3EDV A;  3BK9 A;  3OYX A;  4YTP A;  3ZN0 B;  5H6R B;  3R84 B;  2WY2 A;  4IDQ A;  3R6N A;  3V5S A;  2FJD A;  2VKJ A;  2UU9 T;  4QKN A;  1LVF A;  2XAJ B;  2LSJ A;  3KBU A;  3L8R A;  4U72 A;  4CXY A;  3RIU C;  1QLB A;  5LHG B;  4JI4 T;  2V8S V;  4NXN T;  1WR0 A;  4JLE A;  2KT9 A;  3PV0 F;  3N9N A;  1UX4 A;  2WZI A;  3W15 B;  2BZB A;  2B1E A;  5LA6 E;  3UUB A;  1QUU A;  4IT4 A;  3RQU A;  1U4Q A;  3C64 A;  1IBM T;  1BR2 A;  3RPU A;  3BQK A;  5JDN A;  3I0Q A;  4PK6 A;  4GK0 E;  2VQF T;  4LF4 T;  1HNW T;  1MIV A;  3RYI E;  3I9Y A;  3UFG A;  2XHE B;  3N2K E;  3NRY A;  3PUW F;  4H9P C;  2Z6E A;  1CHU A;  3AEA A;  4I0U A;  3UTK A;  5JR9 A;  2DWK A;  3ZCJ A;  4DV7 T;  1BR4 A;  2R6G F;  2W67 A;  4IE5 A;  2RA1 A;  4UVA B;  4PNI A;  2E5V A;  2WB5 A;  3AE4 A;  5L4H A;  3AE9 A;  3ZMV B;  2L9Q A;  4PFP A;  4JV5 T;  4L9I A;  2LOS A;  2N9D A;  5AQK B;  4HFB A;  5ABG A;  2BKN A;  4UXN B;  2K5B B;  4M1P A;  2WAU A;  2MYS A;  2WBL A;  1VOM A;  5FY0 A;  2LT3 A;  4DV6 T;  3ZSS A;  2CWO A;  3ZCI A;  1ZOY A;  2KIN B;  4B3M T;  4YT0 A;  1T8B A;  5FL1 A;  2JIW A;  4ZS3 A;  4EEB A;  5C8Y E;  4DV0 T;  4H63 H;  4ZEY A;  4CXX A;  2DWG A;  5LNK A;  3KDS E;  4BJN A;  5HYA A;  3RC3 A;  4CI1 B;  3K1S A;  4IDN A;  2YKS A;  2FUP A;  4JI5 T;  2QRX A;  5L3B B;  4ASK A;  1WFD A;  2XAH B;  4TZ4 C;  3N9O A;  2A9U A;  4QHO A;  2CLY B;  2LLY A;  2KMF A;  2AE9 A;  1ZHC A;  3JAD A;  2X0Y A;  3SFE A;  4OYJ A;  1HNX T;  3UU8 A;  4A97 A;  1UCU A;  2YOE A;  4CZZ B;  4MFR A;  3C4W A;  1MIY A;  4AQF A;  2VAS A;  4CN1 A;  2CMR A;  2WDQ A;  2UXB T;  3H3A A;  2N2N A;  2WMO A;  3EDU A;  1YKH B;  5AQT B;  2LE8 A;  2EHO A;  3FBZ A;  4ILA A;  5HCJ A;  5EZY E;  4UF0 B;  5FKY A;  3UU4 A;  2FBW A;  2VVS A;  3CQX C;  4YSX A;  1V9D A;  4LFB T;  2LRK A;  3ANW A;  1YQ4 A;  3AA7 B;  5LP6 E;  3ZMT B;  2N1G A;  2E9X B;  4A56 A;  3AAE B;  3F2E A;  3TLV A;  2W61 A;  2I59 A;  4JEU B;  4X64 T;  4B3R T;  5IHY A;  2HPL A;  1I6Z A;  1D0X A;  5GON E;  1NWM X;  5AQQ B;  4EB6 E;  2AXD S;  2XZE A;  4YHJ A;  2UXX B;  4DV1 T;  5BMV E;  4NXM T;  4JI7 T;  4X66 T;  4G2A A;  3G06 A;  1W0A A;  4X1I E;  1Z0P A;  3LBX A;  4WW0 A;  2W66 A;  2Q9Q D;  1T72 A;  1N34 T;  3CQG B;  4WBN E;  2ES0 A;  1AJ3 A;  2LJL A;  3HL6 A;  1M62 A;  2YIN A;  4CI3 B;  2M6B A;  3UQ7 A;  3PJA J;  5F8P A;  3SRZ A;  1N36 T;  2CXF A;  1X79 A;  5HAX A;  4DID B;  3GWH A;  4DR3 T;  2WSS V;  1T7S A;  4LF8 T;  2MAW A;  4AXP A;  2H3R A;  3VR8 A;  4DR2 T;  3ZMS B;  4MHC A;  2NTY A;  4O2B E;  2PBI A;  1WYC A;  5HXR A;  4ZI2 C;  3GA8 A;  3RRW A;  5J2T E;  5LHI B;  1DU2 A;  1UUS A;  5HXC A;  5HEH A;  4X62 T;  4ADZ A;  4L5G A;  2WS3 A;  2BG9 B;  3PJA A;  2NW7 A;  5KDM C;  2XSB A;  4JI2 T;  3MK7 C;  1NEK A;  3ZN1 B;  4TNW A;  5DJQ C;  3B57 A;  2D0T A;  1OED B;  4DR4 T;  4ZOL E;  2PG8 A;  5KMG P;  4IIJ E;  3NZQ A;  4DUZ T;  3P4P A;  4KP3 C; 
#chains in the Genus database with same CATH homology
 1E2A A;  3L8R A;  2E2A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...