3L8RA

The crystal structure of ptca from s. mutans
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
102
structure length
102
Chain Sequence
MNTEELQVAAFEIILNSGNARSIVHEAFDAMREKNYILAEQKLQEANDELLKAHQAQTDLLQEYASGTEIKIEIIMVHAQDHLMTTMTLREVAIEMLELYKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of PtcA from Streptococcus mutans
rcsb
source organism Streptococcus mutans
molecule tags Transferase
molecule keywords Putative PTS system, cellobiose-specific IIA component
total genus 45
structure length 102
sequence length 102
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 2.7.1.69: Transferred entry: 2.7.1.191, 2.7.1.192, 2.7.1.193, 2.7.1.194, 2.7.1.195,
pdb deposition date 2010-01-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02255 PTS_IIA PTS system, Lactose/Cellobiose specific IIA subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.80 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Phosphotransferase system, lactose/cellobiose-type IIA subunit 3l8rA00
2E2AA 3L8RA 1E2AA
chains in the Genus database with same CATH superfamily
5LCYA 5AQTB 4IHJE 4H9PC 5FYMA 3ZMZB 3N5LA 3R84B 1NAFA 2KT9A 5FL0A 5CB4E 2UXCT 4FI5A 3N9QA 5AQHB 1O3XA 1KNRA 2P9BA 5FMNA 3TKLB 2AXDS 4C90A 2H3RA 2MAWA 4EYUA 5FY7A 5JDQA 3R6NA 4YY3T 2QRXA 4QX7B 3ZMVB 3RF1A 4XAXB 2IAKA 1CUNA 3H3MA 2BKNA 2LSJA 3EDUA 4FJOA 1I94T 2NTXA 2KINB 3G06A 3P4WA 4I0UA 5LYJE 2VKDA 3H3AA 4UELA 3RPUA 4YXDA 4KBMB 4TZ4C 2B76A 1FEWA 5L3GB 2IC9A 3NRXA 3PV0F 3UUMA 3UUBA 2VVSA 3HR0A 3A5XA 1B7TA 2YDSA 3P4PA 4AIUA 4ZI7E 5AFUL 3RIUA 5M4YA 2UU9T 1WR6A 3PUAA 5LJNA 4IREA 4CXWA 4DV0T 3K3OA 2FJEA 2JQHA 3EVYA 4YFSA 4HFHA 3K3NA 4PNIA 3OPCA 1HCIA 3AA0B 4PJNA 2BG9E 4LFAT 2A72A 2I6HA 2WQYA 3K8PC 5AQLB 3RYCE 4JI5T 2OLTA 2WMOA 4JYAT 5AQVB 3ZN1B 5L2LA 2CHOA 1S35A 2B1EA 2BDEA 4UV8B 4B3TT 5H6RB 2WP9A 4CN4A 4DIDB 5ABFA 5JH7E 2K3WA 4DR4T 4DMVA 2HN1A 3ANWA 1WFDA 3CVRA 1VCSA 3LK2B 1YKEB 5L3DB 2YEVC 4ERRA 3OTOT 4TV9E 1HNWT 4PJLA 3E0ZA 3LK42 4HWHA 5AQKB 5ETWA 5FP3A 3U3IA 4UIGA 1ZP0A 5LBMA 2WDVA 3P4QA 3SS1A 4AQGA 4JI6T 5JDLA 4CN6A 2PBIA 2X9HA 3M65A 4CN1A 2VKOA 2W0GA 2NW7A 4ZOLE 2DHRA 4DV6T 5JRCA 2LKHA 3FBLA 2CBJA 2QGSA 4BJMA 4EYYR 3EUHA 1OXZA 5FXZA 1VCTA 2XTLA 4E7SA 2PTFA 2XZEA 2K48A 5KXJA 3K3QC 2KSRA 3C51A 4COFA 3QB5K 5JDHA 3AEDA 5DABA 3M3ZB 4UVCB 5J2TE 2UUAT 1M62A 1E7PA 2ZM2A 5FKYA 2CXDA 1HFAA 3RLFF 3E08A 3AXJA 4YSYA 5CA1E 2CCQA 3CQCB 3U78A 4ILCA 4BA9A 4DVDA 4C91A 2N2NA 4CI3B 1X9BA 3EABA 2CEAA 1XWMA 3RRCA 2WDQA 3RQWA 3UUNA 5C2TA 5FL1A 5ADXL 1T8BA 2HN2A 1XMQT 4MFRA 2A9UA 2NTYA 2W61A 3UFEA 2CWYA 4OYKA 5HXSA 5FXXA 5AQRB 3UQ7A 1R8IA 3ZCJA 2XSAA 3KV9A 5AQQB 5DQWA 2BS3A 2LHRA 3RIAA 4EZ4A 2JMHA 4IDOA 4KUMB 5AQNB 3RX6A 2JMKA 2W4XA 3RRWA 5FXVA 1VRBA 4KHPT 1LRZA 3CX8B 5FY0A 2W66A 3EDVA 1D0YA 3VHLA 2NR4A 3MZKB 3FXEB 5C3JA 1HNXT 4JI8T 2X67A 4IIJE 4WZXA 2M6IA 3VRBA 5EK2A 3ZLIA 4A56A 2LKGA 3IA3A 4XZCA 4YHHT 2XQ5A 2VKJA 4AXPA 4AQFC 2XUEA 1GQEA 2Q9QB 2Z6EA 4X65T 3HKEE 4IL9A 3PJAA 2LRLA 2XM2A 3ETVA 3SFEA 2JQKA 2LM2A 4DO0A 2J47A 2VKHA 4EEBA 4HFBA 3CQXC 3OYXA 4I55E 4X1YE 1N36T 2WB5A 1XNRT 1HF8A 3A8YC 1WYCA 3N9OA 4YHJA 1D1BA 5HYAA 2IHR1 2Y8DA 2WWUA 2JRKA 3NZQA 4KP3C 1U5PA 3FBZA 1OEDE 3PUGA 4U31A 3J9X1 1HG5A 3ONXA 4ASKA 3VKHA 2HPLA 4H63V 3NZPA 3CIRA 3IF8B 4IDNA 4O2BE 5LGTB 2YN6A 2MOZA 5AQOB 4DV7T 4H9SE 1X79A 3CKDA 2WY2A 3FHNA 3LBXB 1OEDC 4QKNA 4UVBB 2V6XA 4X1KE 1MMGA 4ISTA 2EHOC 5LOVE 3JCFA 2E9XB 3UT5E 5F5WA 4QX8B 3PUSA 3Q5DA 5AQUB 3V5SA 1IBLT 4IE7A 2C0SA 1WLXA 4O8SA 4UR9A 2C5IT 2X68A 5LG4A 3PUVF 2LE8A 4QXBB 3B57A 2BG9B 2XQ7A 4QXCB 4DR7T 3ZSSA 4CI2B 1BR0A 1Y01A 1BR1A 3VKGA 2JQQA 2PG8A 5JRCB 1JNRA 3T1YT 2UUCT 3P4SA 3RKOA 4X1IE 1WCRA 5L47A 3O4XE 2H7VC 1L0VA 2XQ3A 2DL1A 3TLSA 4DR5T 1E2AA 3FZHB 3N2GE 3H37A 2WM9A 4WNKA 2IUBA 5LJMA 4DV2T 4ZI3C 3ZPOA 3NWIA 4CQIA 3ESLA 3KBUA 3T8OA 5LHGB 2D0TA 4EAHA 2D9DA 3RKGA 4HEAA 4AKIA 4AKHA 3TLVA 2W63A 5KMGP 4GK0E 2DCFA 2XASB 2FUPA 3RHWA 3JC6D 2X9XA 4U33A 4NIQA 4B3RT 3RYFE 4A98A 3AE3A 3L09A 4PFPA 1HS7A 5EZYE 2NWBA 4LMLA 4MALA 4ZS3A 4TWFA 2WS3A 1NENA 1V9DA 3AEEA 3N9LA 4TX5A 1U4QA 2ZMAA 3AVRA 2M67A 3NBXX 4NXMT 5FY1A 1I6ZA 4ILBA 1UGOA 3S4UA 2PJQA 1Z8UA 3NKZA 2AE9A 4P09A 2R6GF 4EOZB 4HFDA 2X66A 2ZLYA 2EHOD 4UXNB 4X5TA 4DMWA 2ACXA 3GN5A 3ZT7A 5HXHA 2Y48B 4DR3T 3MA9A 3K1SA 1YQ3A 3ONJA 5HXRA 1IJ5A 1UX4A 4UF0A 2XQ9A 2HHHT 4DNDA 2KZ7B 3ONLC 2F4VT 4L9IA 3PE0A 3PU3A 1AJ3A 4AI6A 2WWVA 4HTEA 4ZZCA 4HWDA 2UXNB 2XPKA 4U72A 3GWHA 4WW0A 4BAYB 3I9WA 2DNXA 5HWYA 2V7MA 1HX8A 1M7KA 5LXTE 1KNPA 2LLYA 3CWZB 3F2EA 3O1IA 2I0MA 5L3BB 3AA6B 4IE6A 4JEUB 1IAPA 3LBXA 2XQ6A 2IMLA 4LMKA 2CLYC 3Q9DA 3WI3A 3DTOA 2C5KT 1FMWA 2QYWA 2VL0A 2IIUA 3UU3A 3O9XA 2LSIA 1N34T 2SPCA 1QUUA 2N9DA 2CPTA 3PUXF 4L0RA 4CI1B 3CX7B 2FBWA 1UURA 3MJXA 1US7B 2DWGA 1MIVA 4MLKA 4ILUA 3J7Yq 1SA0E 3OVUA 4K0KT 3GA8A 4NUUA 2XAGB 3I0OA 2YKSA 1YD8G 4H9OC 4UV9B 3UQ4A 2BBJA 2LRKA 3KFWX 4LF6T 4GKJT 2WU5A 2VK9A 4PAGA 3RC3A 3OKQA 3ZMUB 2MTQA 3ZC1A 1KFYA 3PJAJ 4N78D 4V1Av 4DV4T 3RC8A 2Y6XA 2WZHA 3V5UA 3OYZA 5AQJB 4CXYA 4U3CA 2WU2A 2VQET 2FJBA 5LBQB 4IDQA 4YSXA 3NRYA 3ZYKA 2CMRA 2DI4A 2ODVA 3ZCIA 2LT3A 4ZI2D 1H7CA 4NXNT 1W9RA 3PUWF 4I43B 1YW0A 4U74A 1Z0PA 2QA7A 2MBGA 5HEGA 5JR9C 3UU8A 1FMVA 2BG9A 2K5BB 2W62A 4ZEYA 5IHYA 3ZJ2A 4HWCA 2E2AA 5FVKA 3UULA 2LHNA 3T1HT 1HX1B 2ODUA 4KI0F 4PK5A 1KF6A 2ACZA 2V26A 3CPZA 4L5GA 3Q5EA 2M6BA 3LJCA 3FZLB 2C5JA 4GOUA 2CXLA 3MK7C 4AQFA 3PDYA 3UU6A 2GK9A 3ZT6A 2CM0A 5LP6E 5AQMB 4ZZBA 5LHIB 2MYSA 2YU1A 3FZMB 4UEMA 5HEOA 2Q9QD 2CRBA 1SE7A 3I9YA 3ZT5A 2E8IA 3Q5XA 3QB5A 4U2ZA 4NPPA 4KX6A 4AQYT 2V6YB 4MHCA 1T7SA 2LJLA 3AEBA 4O4HE 4PJJA 2H89A 4JI4T 1WRDA 1ZKEA 1E1HB 3OJAA 4YT0A 1W0BA 2NW8A 3L8RA 4GK5E 2KMFA 4H63H 3FZKB 4Q25A 4HWFA 4YTNA 4LFBT 4TNWA 3WAJA 2H88A 3GMIA 4LF5T 4H9QC 3ZJ1A 2BBHA 4LF7T 3RYIE 4O2AE 4H9RC 4QH1A 3WAKA 1IJ6A 3IBPA 4M1PA 5AQGB 2Q9QC 2LM9A 1XDPA 2WMNA 4HFEA 1ZV4X 4PFOA 3KVBA 5H6QB 5JDFA 5TAOA 4DBQA 2WZIA 1CHUA 3ANWB 3UFGA 3HKDE 1MIYA 3HL6A 3F31A 4OFZA 2XSBA 5JDNA 1FJGT 2X51A 3SRZA 4TNVA 5L3FB 5LHHB 2VQFT 3ZYLA 1HNZT 1N32T 3VRAA 4PK6A 4F8HA 2BVMA 2XQ8A 2XM1A 5LB7B 3W15B 5J2UE 4P0AA 3JADA 1Y64B 1IZNB 1FIOA 2L3LA 2ZM8A 4G63A 2YU2A 4LF8T 5J0ZA 2LSKA 2X9YA 4HWIB 4JBWF 1J5ET 2CBIA 4HN9A 3ZEFB 3QOFA 4CXXA 5CJ5A 2WBLA 3IEEA 3RYHE 2J4GA 2CWOA 3P4RA 2RP4A 3AECA 4IE0A 2EHOB 3OBVE 4OK0A 4LF9T 4IL4A 1XDOA 2JQ9A 2L9QA 2LSGA 3ZMSB 4EIWA 4YSZA 4PW8A 5CGMA 4DUZT 3P8CD 3MKDA 3FZFB 3Q2MA 2BG9C 5HCMA 4DV3T 2WDRA 5BMVE 4GIWA 4JEHB 1ZOYA 4KMCA 5EK3A 4CZZB 2WSSV 2DLRA 1SHZC 2HPJA 3CK6A 3PTRB 4YTPA 1SUMB 4E7ZA 2BS2A 1J1JA 4IDZA 4JI0T 4H9NC 3HKBE 4EZHA 4DV1T 2CA5A 4HFIA 3PURA 4F6RC 4DR6T 2YDQA 3I1AA 3AAIA 1JNZA 2N1GA 5JQGE 4BJNA 3LSVA 5ABEA 3C4ZA 3X1DA 2IDOB 3AE5A 3AA1B 3Q5WA 2XY8B 4QH5A 5HEHA 2VL8A 3ZN0B 3MXZA 3L39A 5JTGA 2D0UA 1UX5A 3B5MA 4LMJA 4OHFA 5JVDE 3AXJB 3UUXB 3ZKRA 5HEJA 2LSYA 4EEDA 3N2OA 2CXFA 2JIWA 2NOXA 5ABFB 1HR0T 2K24A 2BKPA 4X20E 3TLTA 3P7IA 3AEAA 4B6XA 4K0UA 2X9WA 2V7JA 3AE4A 4JUYA 4WYVA 3PUQA 4TV8E 2IW5B 3BQKA 3AB3B 4JI2T 5F3JA 3AEFA 4B3MT 3KVAA 4JLEA 5JDMA 5LG3A 3RI5A 2XAJB 2V7KA 2YK0A 1N33T 1DU2A 4HFCA 4O4IE 3AAAB 4Z91A 2YINA 4EXTA 4ZI3D 2KWIB 4JI3T 2CE7A 2W67A 3PUYF 4AKLA 1KK7A 3TLWA 2I59A 1J5WA 5J1GA 3VR8A 2WAUA 4X62T 5BR8T 2KXPB 3E22E 3HI2A 4GYRA 5HEUA 5JR9A 3C50A 5FXWA 3BQIA 2E9XD 2XHEB 1KNZA 4DV5T 2XJ7A 5DQVA 3A7MA 3RQUA 4DBRA 3RIFA 2VVNA 4PJMA 1QSDA 4IE5A 2V7IA 1NWMX 1NEKA 3C64A 4QHOA 4QWNB 4X66T 5HCJA 2UXBT 3LG7A 3BK9A 2QVAA 3JC6C 4G2AA 3ZC0A 2ZM0A 3AE9A 2JPFA 1HG2A 1UK5A 2X0YA 4OYJA 4ZXLA 2L8KA 2W00A 5ABGA 3RH3A 1WYBA 5AQIB 4Z90A 4WBNE 4TWHA 2XQYA 3AVSA 4HKAA 3QNUA 4ZS2A 2KWHA 2OV9A 2RPAA 1T72A 5AQSB 1VOMA 3VR9A 3PUZF 2CLYB 2JJ9A 2VB6A 2D2SA 1ZHCA 2VURA 1D0XA 5IYZE 5C8YE 3NVOA 2XQ4A 2PFVA 2BS4A 3BQLA 1EZ3A 2KNDA 3CX6B 2XAHB 2YOEA 3GN5B 3N2KE 1BR2A 5L4HA 3AE2A 2V1DB 5EK4A 5ABHA 5IWAT 2FJDA 2XQAA 4IDPA 4YTMA 5LGUB 4JV5T 1OEDB 2E5LT 5F8PA 2Q9QA 2LEHA 4O4JE 2E9XC 2UXDT 3AE1A 3QUJA 4KHZF 4OX9T 4DR2T 2A3DA 1UCUA 4Z8XA 5L3CB 3B13A 5HXEA 4A5XA 4B3ST 4AKGA 3QC9A 5HAXA 1YKHB 2D5UA 4ZHQE 3RGLA 3ABVA 1YXRA 4MBQA 1MNEA 1LKXA 5IUXA 1QLBA 5CFBA 2W2UA 4ZI2C 3AAEB 5JDGA 3C4XA 3JAEA 4J2CA 4A97A 1UUSA 1ZEEA 2DWKA 1G8XA 2V8SV 2V5CA 4IGUA 3ETUA 1D1AA 4U7IA 3EAMA 4IE4A 4HFVA 2UUBT 1T98A 2H7OA 4JI7T 4DUYT 2WCAA 4ADZA 3LDQB 4TWDA 3AA7B 1MMDA 1OEDA 3AE7A 3VU7H 5JREA 4U7YA 3KV4A 4LF4T 2V5DA 3SOLA 2CHNA 3CMLA 4YLHA 2UXXB 2J62A 3C4WA 4AISA 3PU8A 4JI1T 3KINB 4TUYE 4ILAA 1YQ4A 4EB6E 2V6YA 1KEYA 4P0BA 3DP7A 4EV6A 3O1HA 3IHRA 5LMNT 2LOSA 4IT4A 4GYSA 3UU4A 1XMOT 3KV6A 5GONE 3N9MA 1MMAA 4GKKT 2ES0A 2E9XA 3O1JA 5AQPB 5HWXA 2VASA 3RIUC 1MNDA 4HGAA 4YJ2E 1D1CA 2IC6A 2VWAA 2XAQB 3EHZA 1BR4A 3CQGB 4ISSA 2X0HA 5HXCA 1MIWA 4YJ3E 2NW9A 3LFMA 4EGWA 5A1LA 5LGNB 1XNQT 3D0TA 2BVLA 3KBTA 2G0UA 3KV5A 1MMNA 2MPKA 4U2YA 5KX5E 3ZYMA 4LFCT 3ZSTA 5E0OA 2FJAA 4O4LE 3SWHA 2KLQA 2K9AA 4UF0B 5AQFB 4P1NA 4PK4A 3AEGA 5FNVE 5KDMC 5JR9B 1LVFA 2XAFB 2BZBA 2YDRA 3KDSE 1W0AA 2LOPA 3QK6A 4I50E 1S94A 4UVAB 3C98B 1D0ZA 2E5VA 4AKRB 3SFDA 1OWAA 3N9NA 2EHOA 3HKCE 4TN7B 3TLUA 5L3EB 3AE8A 1G73A 4QH4A 2OA5A 2BKOA 2X0LB 2HH7A 4I4TE 2J1DG 3ZMTB 2ZM6T 3UU5A 2V7LA 1W09A 5LNKA 3FXDB 1IBMT 5L4EA 3AE6A 3UTKA 1HTJF 2NP9A 3I0QA 5LA6E 1IBKT 4DR1T 3HA4A 3P50A 3N9PA 3MACA 4NUVA 5DJQC 1LVKA 5LMUT 4XBFB 4X64T 2RA1A 5FVLA 4ANJA 3L3PA 3JAFA 1XZYA 4HE8A 1WR0A 3DJBA 4QXHB 3LK3B 4WBOA 5CA0E 3FB2A 2A2FX 3EI0A 3F57A
chains in the Genus database with same CATH topology
2E2AA 3L8RA 1E2AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E2A A;  3L8R A;  1E2A A; 
#chains in the Genus database with same CATH topology
 5LCY A;  5AQT B;  4IHJ E;  4H9P C;  5FYM A;  3ZMZ B;  3N5L A;  3R84 B;  1NAF A;  2KT9 A;  5FL0 A;  5CB4 E;  2UXC T;  4FI5 A;  3N9Q A;  5AQH B;  1O3X A;  1KNR A;  2P9B A;  5FMN A;  3TKL B;  2AXD S;  4C90 A;  2H3R A;  2MAW A;  4EYU A;  5FY7 A;  5JDQ A;  3R6N A;  4YY3 T;  2QRX A;  4QX7 B;  3ZMV B;  3RF1 A;  4XAX B;  2IAK A;  1CUN A;  3H3M A;  2BKN A;  2LSJ A;  3EDU A;  4FJO A;  1I94 T;  2NTX A;  2KIN B;  3G06 A;  3P4W A;  4I0U A;  5LYJ E;  2VKD A;  3H3A A;  4UEL A;  3RPU A;  4YXD A;  4KBM B;  4TZ4 C;  2B76 A;  1FEW A;  5L3G B;  2IC9 A;  3NRX A;  3PV0 F;  3UUM A;  3UUB A;  2VVS A;  3HR0 A;  3A5X A;  1B7T A;  2YDS A;  3P4P A;  4AIU A;  4ZI7 E;  5AFU L;  3RIU A;  5M4Y A;  2UU9 T;  1WR6 A;  3PUA A;  5LJN A;  4IRE A;  4CXW A;  4DV0 T;  3K3O A;  2FJE A;  2JQH A;  3EVY A;  4YFS A;  4HFH A;  3K3N A;  4PNI A;  3OPC A;  1HCI A;  3AA0 B;  4PJN A;  2BG9 E;  4LFA T;  2A72 A;  2I6H A;  2WQY A;  3K8P C;  5AQL B;  3RYC E;  4JI5 T;  2OLT A;  2WMO A;  4JYA T;  5AQV B;  3ZN1 B;  5L2L A;  2CHO A;  1S35 A;  2B1E A;  2BDE A;  4UV8 B;  4B3T T;  5H6R B;  2WP9 A;  4CN4 A;  4DID B;  5ABF A;  5JH7 E;  2K3W A;  4DR4 T;  4DMV A;  2HN1 A;  3ANW A;  1WFD A;  3CVR A;  1VCS A;  3LK2 B;  1YKE B;  5L3D B;  2YEV C;  4ERR A;  3OTO T;  4TV9 E;  1HNW T;  4PJL A;  3E0Z A;  3LK4 2;  4HWH A;  5AQK B;  5ETW A;  5FP3 A;  3U3I A;  4UIG A;  1ZP0 A;  5LBM A;  2WDV A;  3P4Q A;  3SS1 A;  4AQG A;  4JI6 T;  5JDL A;  4CN6 A;  2PBI A;  2X9H A;  3M65 A;  4CN1 A;  2VKO A;  2W0G A;  2NW7 A;  4ZOL E;  2DHR A;  4DV6 T;  5JRC A;  2LKH A;  3FBL A;  2CBJ A;  2QGS A;  4BJM A;  4EYY R;  3EUH A;  1OXZ A;  5FXZ A;  1VCT A;  2XTL A;  4E7S A;  2PTF A;  2XZE A;  2K48 A;  5KXJ A;  3K3Q C;  2KSR A;  3C51 A;  4COF A;  3QB5 K;  5JDH A;  3AED A;  5DAB A;  3M3Z B;  4UVC B;  5J2T E;  2UUA T;  1M62 A;  1E7P A;  2ZM2 A;  5FKY A;  2CXD A;  1HFA A;  3RLF F;  3E08 A;  3AXJ A;  4YSY A;  5CA1 E;  2CCQ A;  3CQC B;  3U78 A;  4ILC A;  4BA9 A;  4DVD A;  4C91 A;  2N2N A;  4CI3 B;  1X9B A;  3EAB A;  2CEA A;  1XWM A;  3RRC A;  2WDQ A;  3RQW A;  3UUN A;  5C2T A;  5FL1 A;  5ADX L;  1T8B A;  2HN2 A;  1XMQ T;  4MFR A;  2A9U A;  2NTY A;  2W61 A;  3UFE A;  2CWY A;  4OYK A;  5HXS A;  5FXX A;  5AQR B;  3UQ7 A;  1R8I A;  3ZCJ A;  2XSA A;  3KV9 A;  5AQQ B;  5DQW A;  2BS3 A;  2LHR A;  3RIA A;  4EZ4 A;  2JMH A;  4IDO A;  4KUM B;  5AQN B;  3RX6 A;  2JMK A;  2W4X A;  3RRW A;  5FXV A;  1VRB A;  4KHP T;  1LRZ A;  3CX8 B;  5FY0 A;  2W66 A;  3EDV A;  1D0Y A;  3VHL A;  2NR4 A;  3MZK B;  3FXE B;  5C3J A;  1HNX T;  4JI8 T;  2X67 A;  4IIJ E;  4WZX A;  2M6I A;  3VRB A;  5EK2 A;  3ZLI A;  4A56 A;  2LKG A;  3IA3 A;  4XZC A;  4YHH T;  2XQ5 A;  2VKJ A;  4AXP A;  4AQF C;  2XUE A;  1GQE A;  2Q9Q B;  2Z6E A;  4X65 T;  3HKE E;  4IL9 A;  3PJA A;  2LRL A;  2XM2 A;  3ETV A;  3SFE A;  2JQK A;  2LM2 A;  4DO0 A;  2J47 A;  2VKH A;  4EEB A;  4HFB A;  3CQX C;  3OYX A;  4I55 E;  4X1Y E;  1N36 T;  2WB5 A;  1XNR T;  1HF8 A;  3A8Y C;  1WYC A;  3N9O A;  4YHJ A;  1D1B A;  5HYA A;  2IHR 1;  2Y8D A;  2WWU A;  2JRK A;  3NZQ A;  4KP3 C;  1U5P A;  3FBZ A;  1OED E;  3PUG A;  4U31 A;  3J9X 1;  1HG5 A;  3ONX A;  4ASK A;  3VKH A;  2HPL A;  4H63 V;  3NZP A;  3CIR A;  3IF8 B;  4IDN A;  4O2B E;  5LGT B;  2YN6 A;  2MOZ A;  5AQO B;  4DV7 T;  4H9S E;  1X79 A;  3CKD A;  2WY2 A;  3FHN A;  3LBX B;  1OED C;  4QKN A;  4UVB B;  2V6X A;  4X1K E;  1MMG A;  4IST A;  2EHO C;  5LOV E;  3JCF A;  2E9X B;  3UT5 E;  5F5W A;  4QX8 B;  3PUS A;  3Q5D A;  5AQU B;  3V5S A;  1IBL T;  4IE7 A;  2C0S A;  1WLX A;  4O8S A;  4UR9 A;  2C5I T;  2X68 A;  5LG4 A;  3PUV F;  2LE8 A;  4QXB B;  3B57 A;  2BG9 B;  2XQ7 A;  4QXC B;  4DR7 T;  3ZSS A;  4CI2 B;  1BR0 A;  1Y01 A;  1BR1 A;  3VKG A;  2JQQ A;  2PG8 A;  5JRC B;  1JNR A;  3T1Y T;  2UUC T;  3P4S A;  3RKO A;  4X1I E;  1WCR A;  5L47 A;  3O4X E;  2H7V C;  1L0V A;  2XQ3 A;  2DL1 A;  3TLS A;  4DR5 T;  1E2A A;  3FZH B;  3N2G E;  3H37 A;  2WM9 A;  4WNK A;  2IUB A;  5LJM A;  4DV2 T;  4ZI3 C;  3ZPO A;  3NWI A;  4CQI A;  3ESL A;  3KBU A;  3T8O A;  5LHG B;  2D0T A;  4EAH A;  2D9D A;  3RKG A;  4HEA A;  4AKI A;  4AKH A;  3TLV A;  2W63 A;  5KMG P;  4GK0 E;  2DCF A;  2XAS B;  2FUP A;  3RHW A;  3JC6 D;  2X9X A;  4U33 A;  4NIQ A;  4B3R T;  3RYF E;  4A98 A;  3AE3 A;  3L09 A;  4PFP A;  1HS7 A;  5EZY E;  2NWB A;  4LML A;  4MAL A;  4ZS3 A;  4TWF A;  2WS3 A;  1NEN A;  1V9D A;  3AEE A;  3N9L A;  4TX5 A;  1U4Q A;  2ZMA A;  3AVR A;  2M67 A;  3NBX X;  4NXM T;  5FY1 A;  1I6Z A;  4ILB A;  1UGO A;  3S4U A;  2PJQ A;  1Z8U A;  3NKZ A;  2AE9 A;  4P09 A;  2R6G F;  4EOZ B;  4HFD A;  2X66 A;  2ZLY A;  2EHO D;  4UXN B;  4X5T A;  4DMW A;  2ACX A;  3GN5 A;  3ZT7 A;  5HXH A;  2Y48 B;  4DR3 T;  3MA9 A;  3K1S A;  1YQ3 A;  3ONJ A;  5HXR A;  1IJ5 A;  1UX4 A;  4UF0 A;  2XQ9 A;  2HHH T;  4DND A;  2KZ7 B;  3ONL C;  2F4V T;  4L9I A;  3PE0 A;  3PU3 A;  1AJ3 A;  4AI6 A;  2WWV A;  4HTE A;  4ZZC A;  4HWD A;  2UXN B;  2XPK A;  4U72 A;  3GWH A;  4WW0 A;  4BAY B;  3I9W A;  2DNX A;  5HWY A;  2V7M A;  1HX8 A;  1M7K A;  5LXT E;  1KNP A;  2LLY A;  3CWZ B;  3F2E A;  3O1I A;  2I0M A;  5L3B B;  3AA6 B;  4IE6 A;  4JEU B;  1IAP A;  3LBX A;  2XQ6 A;  2IML A;  4LMK A;  2CLY C;  3Q9D A;  3WI3 A;  3DTO A;  2C5K T;  1FMW A;  2QYW A;  2VL0 A;  2IIU A;  3UU3 A;  3O9X A;  2LSI A;  1N34 T;  2SPC A;  1QUU A;  2N9D A;  2CPT A;  3PUX F;  4L0R A;  4CI1 B;  3CX7 B;  2FBW A;  1UUR A;  3MJX A;  1US7 B;  2DWG A;  1MIV A;  4MLK A;  4ILU A;  3J7Y q;  1SA0 E;  3OVU A;  4K0K T;  3GA8 A;  4NUU A;  2XAG B;  3I0O A;  2YKS A;  1YD8 G;  4H9O C;  4UV9 B;  3UQ4 A;  2BBJ A;  2LRK A;  3KFW X;  4LF6 T;  4GKJ T;  2WU5 A;  2VK9 A;  4PAG A;  3RC3 A;  3OKQ A;  3ZMU B;  2MTQ A;  3ZC1 A;  1KFY A;  3PJA J;  4N78 D;  4V1A v;  4DV4 T;  3RC8 A;  2Y6X A;  2WZH A;  3V5U A;  3OYZ A;  5AQJ B;  4CXY A;  4U3C A;  2WU2 A;  2VQE T;  2FJB A;  5LBQ B;  4IDQ A;  4YSX A;  3NRY A;  3ZYK A;  2CMR A;  2DI4 A;  2ODV A;  3ZCI A;  2LT3 A;  4ZI2 D;  1H7C A;  4NXN T;  1W9R A;  3PUW F;  4I43 B;  1YW0 A;  4U74 A;  1Z0P A;  2QA7 A;  2MBG A;  5HEG A;  5JR9 C;  3UU8 A;  1FMV A;  2BG9 A;  2K5B B;  2W62 A;  4ZEY A;  5IHY A;  3ZJ2 A;  4HWC A;  2E2A A;  5FVK A;  3UUL A;  2LHN A;  3T1H T;  1HX1 B;  2ODU A;  4KI0 F;  4PK5 A;  1KF6 A;  2ACZ A;  2V26 A;  3CPZ A;  4L5G A;  3Q5E A;  2M6B A;  3LJC A;  3FZL B;  2C5J A;  4GOU A;  2CXL A;  3MK7 C;  4AQF A;  3PDY A;  3UU6 A;  2GK9 A;  3ZT6 A;  2CM0 A;  5LP6 E;  5AQM B;  4ZZB A;  5LHI B;  2MYS A;  2YU1 A;  3FZM B;  4UEM A;  5HEO A;  2Q9Q D;  2CRB A;  1SE7 A;  3I9Y A;  3ZT5 A;  2E8I A;  3Q5X A;  3QB5 A;  4U2Z A;  4NPP A;  4KX6 A;  4AQY T;  2V6Y B;  4MHC A;  1T7S A;  2LJL A;  3AEB A;  4O4H E;  4PJJ A;  2H89 A;  4JI4 T;  1WRD A;  1ZKE A;  1E1H B;  3OJA A;  4YT0 A;  1W0B A;  2NW8 A;  3L8R A;  4GK5 E;  2KMF A;  4H63 H;  3FZK B;  4Q25 A;  4HWF A;  4YTN A;  4LFB T;  4TNW A;  3WAJ A;  2H88 A;  3GMI A;  4LF5 T;  4H9Q C;  3ZJ1 A;  2BBH A;  4LF7 T;  3RYI E;  4O2A E;  4H9R C;  4QH1 A;  3WAK A;  1IJ6 A;  3IBP A;  4M1P A;  5AQG B;  2Q9Q C;  2LM9 A;  1XDP A;  2WMN A;  4HFE A;  1ZV4 X;  4PFO A;  3KVB A;  5H6Q B;  5JDF A;  5TAO A;  4DBQ A;  2WZI A;  1CHU A;  3ANW B;  3UFG A;  3HKD E;  1MIY A;  3HL6 A;  3F31 A;  4OFZ A;  2XSB A;  5JDN A;  1FJG T;  2X51 A;  3SRZ A;  4TNV A;  5L3F B;  5LHH B;  2VQF T;  3ZYL A;  1HNZ T;  1N32 T;  3VRA A;  4PK6 A;  4F8H A;  2BVM A;  2XQ8 A;  2XM1 A;  5LB7 B;  3W15 B;  5J2U E;  4P0A A;  3JAD A;  1Y64 B;  1IZN B;  1FIO A;  2L3L A;  2ZM8 A;  4G63 A;  2YU2 A;  4LF8 T;  5J0Z A;  2LSK A;  2X9Y A;  4HWI B;  4JBW F;  1J5E T;  2CBI A;  4HN9 A;  3ZEF B;  3QOF A;  4CXX A;  5CJ5 A;  2WBL A;  3IEE A;  3RYH E;  2J4G A;  2CWO A;  3P4R A;  2RP4 A;  3AEC A;  4IE0 A;  2EHO B;  3OBV E;  4OK0 A;  4LF9 T;  4IL4 A;  1XDO A;  2JQ9 A;  2L9Q A;  2LSG A;  3ZMS B;  4EIW A;  4YSZ A;  4PW8 A;  5CGM A;  4DUZ T;  3P8C D;  3MKD A;  3FZF B;  3Q2M A;  2BG9 C;  5HCM A;  4DV3 T;  2WDR A;  5BMV E;  4GIW A;  4JEH B;  1ZOY A;  4KMC A;  5EK3 A;  4CZZ B;  2WSS V;  2DLR A;  1SHZ C;  2HPJ A;  3CK6 A;  3PTR B;  4YTP A;  1SUM B;  4E7Z A;  2BS2 A;  1J1J A;  4IDZ A;  4JI0 T;  4H9N C;  3HKB E;  4EZH A;  4DV1 T;  2CA5 A;  4HFI A;  3PUR A;  4F6R C;  4DR6 T;  2YDQ A;  3I1A A;  3AAI A;  1JNZ A;  2N1G A;  5JQG E;  4BJN A;  3LSV A;  5ABE A;  3C4Z A;  3X1D A;  2IDO B;  3AE5 A;  3AA1 B;  3Q5W A;  2XY8 B;  4QH5 A;  5HEH A;  2VL8 A;  3ZN0 B;  3MXZ A;  3L39 A;  5JTG A;  2D0U A;  1UX5 A;  3B5M A;  4LMJ A;  4OHF A;  5JVD E;  3AXJ B;  3UUX B;  3ZKR A;  5HEJ A;  2LSY A;  4EED A;  3N2O A;  2CXF A;  2JIW A;  2NOX A;  5ABF B;  1HR0 T;  2K24 A;  2BKP A;  4X20 E;  3TLT A;  3P7I A;  3AEA A;  4B6X A;  4K0U A;  2X9W A;  2V7J A;  3AE4 A;  4JUY A;  4WYV A;  3PUQ A;  4TV8 E;  2IW5 B;  3BQK A;  3AB3 B;  4JI2 T;  5F3J A;  3AEF A;  4B3M T;  3KVA A;  4JLE A;  5JDM A;  5LG3 A;  3RI5 A;  2XAJ B;  2V7K A;  2YK0 A;  1N33 T;  1DU2 A;  4HFC A;  4O4I E;  3AAA B;  4Z91 A;  2YIN A;  4EXT A;  4ZI3 D;  2KWI B;  4JI3 T;  2CE7 A;  2W67 A;  3PUY F;  4AKL A;  1KK7 A;  3TLW A;  2I59 A;  1J5W A;  5J1G A;  3VR8 A;  2WAU A;  4X62 T;  5BR8 T;  2KXP B;  3E22 E;  3HI2 A;  4GYR A;  5HEU A;  5JR9 A;  3C50 A;  5FXW A;  3BQI A;  2E9X D;  2XHE B;  1KNZ A;  4DV5 T;  2XJ7 A;  5DQV A;  3A7M A;  3RQU A;  4DBR A;  3RIF A;  2VVN A;  4PJM A;  1QSD A;  4IE5 A;  2V7I A;  1NWM X;  1NEK A;  3C64 A;  4QHO A;  4QWN B;  4X66 T;  5HCJ A;  2UXB T;  3LG7 A;  3BK9 A;  2QVA A;  3JC6 C;  4G2A A;  3ZC0 A;  2ZM0 A;  3AE9 A;  2JPF A;  1HG2 A;  1UK5 A;  2X0Y A;  4OYJ A;  4ZXL A;  2L8K A;  2W00 A;  5ABG A;  3RH3 A;  1WYB A;  5AQI B;  4Z90 A;  4WBN E;  4TWH A;  2XQY A;  3AVS A;  4HKA A;  3QNU A;  4ZS2 A;  2KWH A;  2OV9 A;  2RPA A;  1T72 A;  5AQS B;  1VOM A;  3VR9 A;  3PUZ F;  2CLY B;  2JJ9 A;  2VB6 A;  2D2S A;  1ZHC A;  2VUR A;  1D0X A;  5IYZ E;  5C8Y E;  3NVO A;  2XQ4 A;  2PFV A;  2BS4 A;  3BQL A;  1EZ3 A;  2KND A;  3CX6 B;  2XAH B;  2YOE A;  3GN5 B;  3N2K E;  1BR2 A;  5L4H A;  3AE2 A;  2V1D B;  5EK4 A;  5ABH A;  5IWA T;  2FJD A;  2XQA A;  4IDP A;  4YTM A;  5LGU B;  4JV5 T;  1OED B;  2E5L T;  5F8P A;  2Q9Q A;  2LEH A;  4O4J E;  2E9X C;  2UXD T;  3AE1 A;  3QUJ A;  4KHZ F;  4OX9 T;  4DR2 T;  2A3D A;  1UCU A;  4Z8X A;  5L3C B;  3B13 A;  5HXE A;  4A5X A;  4B3S T;  4AKG A;  3QC9 A;  5HAX A;  1YKH B;  2D5U A;  4ZHQ E;  3RGL A;  3ABV A;  1YXR A;  4MBQ A;  1MNE A;  1LKX A;  5IUX A;  1QLB A;  5CFB A;  2W2U A;  4ZI2 C;  3AAE B;  5JDG A;  3C4X A;  3JAE A;  4J2C A;  4A97 A;  1UUS A;  1ZEE A;  2DWK A;  1G8X A;  2V8S V;  2V5C A;  4IGU A;  3ETU A;  1D1A A;  4U7I A;  3EAM A;  4IE4 A;  4HFV A;  2UUB T;  1T98 A;  2H7O A;  4JI7 T;  4DUY T;  2WCA A;  4ADZ A;  3LDQ B;  4TWD A;  3AA7 B;  1MMD A;  1OED A;  3AE7 A;  3VU7 H;  5JRE A;  4U7Y A;  3KV4 A;  4LF4 T;  2V5D A;  3SOL A;  2CHN A;  3CML A;  4YLH A;  2UXX B;  2J62 A;  3C4W A;  4AIS A;  3PU8 A;  4JI1 T;  3KIN B;  4TUY E;  4ILA A;  1YQ4 A;  4EB6 E;  2V6Y A;  1KEY A;  4P0B A;  3DP7 A;  4EV6 A;  3O1H A;  3IHR A;  5LMN T;  2LOS A;  4IT4 A;  4GYS A;  3UU4 A;  1XMO T;  3KV6 A;  5GON E;  3N9M A;  1MMA A;  4GKK T;  2ES0 A;  2E9X A;  3O1J A;  5AQP B;  5HWX A;  2VAS A;  3RIU C;  1MND A;  4HGA A;  4YJ2 E;  1D1C A;  2IC6 A;  2VWA A;  2XAQ B;  3EHZ A;  1BR4 A;  3CQG B;  4ISS A;  2X0H A;  5HXC A;  1MIW A;  4YJ3 E;  2NW9 A;  3LFM A;  4EGW A;  5A1L A;  5LGN B;  1XNQ T;  3D0T A;  2BVL A;  3KBT A;  2G0U A;  3KV5 A;  1MMN A;  2MPK A;  4U2Y A;  5KX5 E;  3ZYM A;  4LFC T;  3ZST A;  5E0O A;  2FJA A;  4O4L E;  3SWH A;  2KLQ A;  2K9A A;  4UF0 B;  5AQF B;  4P1N A;  4PK4 A;  3AEG A;  5FNV E;  5KDM C;  5JR9 B;  1LVF A;  2XAF B;  2BZB A;  2YDR A;  3KDS E;  1W0A A;  2LOP A;  3QK6 A;  4I50 E;  1S94 A;  4UVA B;  3C98 B;  1D0Z A;  2E5V A;  4AKR B;  3SFD A;  1OWA A;  3N9N A;  2EHO A;  3HKC E;  4TN7 B;  3TLU A;  5L3E B;  3AE8 A;  1G73 A;  4QH4 A;  2OA5 A;  2BKO A;  2X0L B;  2HH7 A;  4I4T E;  2J1D G;  3ZMT B;  2ZM6 T;  3UU5 A;  2V7L A;  1W09 A;  5LNK A;  3FXD B;  1IBM T;  5L4E A;  3AE6 A;  3UTK A;  1HTJ F;  2NP9 A;  3I0Q A;  5LA6 E;  1IBK T;  4DR1 T;  3HA4 A;  3P50 A;  3N9P A;  3MAC A;  4NUV A;  5DJQ C;  1LVK A;  5LMU T;  4XBF B;  4X64 T;  2RA1 A;  5FVL A;  4ANJ A;  3L3P A;  3JAF A;  1XZY A;  4HE8 A;  1WR0 A;  3DJB A;  4QXH B;  3LK3 B;  4WBO A;  5CA0 E;  3FB2 A;  2A2F X;  3EI0 A;  3F57 A; 
#chains in the Genus database with same CATH homology
 2E2A A;  3L8R A;  1E2A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...