3L8RA

The crystal structure of ptca from s. mutans
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
102
structure length
102
Chain Sequence
MNTEELQVAAFEIILNSGNARSIVHEAFDAMREKNYILAEQKLQEANDELLKAHQAQTDLLQEYASGTEIKIEIIMVHAQDHLMTTMTLREVAIEMLELYKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative PTS system, cellobiose-specific IIA component
publication title The crystal structure of PtcA from Streptococcus mutans
rcsb
source organism Streptococcus mutans
molecule tags Transferase
total genus 45
structure length 102
sequence length 102
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 2.7.1.69: Transferred entry: 2.7.1.191, 2.7.1.192, 2.7.1.193, 2.7.1.194, 2.7.1.195,
pdb deposition date 2010-01-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02255 PTS_IIA PTS system, Lactose/Cellobiose specific IIA subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.80 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Phosphotransferase system, lactose/cellobiose-type IIA subunit 3l8rA00
3L8RA 1E2AA 2E2AA
chains in the Genus database with same CATH superfamily
2HPLA 5H6QB 1E2AA 5L3FB 2WZIA 3AEDA 3SRZA 3AE8A 4LFAT 3KFWX 4U3CA 3TKLB 4ZI3C 3ETUA 3WAJA 2XQAA 3ZCIA 4F8HA 5C8YE 2NTYA 4O4IE 2LRLA 3AXJB 2D5UA 4PNIA 4DV5T 4IGUA 4JI7T 2XQ7A 4EAHA 4AKRB 5HXSA 1UURA 2J4GA 2LRKA 2ACXA 3O4XE 2WB5A 4DUZT 3O9XA 2WDRA 3AECA 3CWZB 5J2TE 4MBQA 2XHEB 4JI1T 1DU2A 4HKAA 4YXDA 5FY7A 3RH3A 4O4LE 5AQPB 2CLYC 3ONXA 5FL1A 3ZKRA 5AQFB 3CQGB 4OYJA 4EYUA 2MPKA 1OEDE 4JI4T 2UXCT 4GYRA 5FMNA 1M7KA 2M67A 2KLQA 4IDQA 3UUNA 3FXEB 5DQWA 1US7B 3PDYA 2J47A 2C5IT 5CJ5A 4IE5A 1QSDA 5JDLA 2CXFA 3L39A 3HKCE 2PTFA 3JCFA 4IT4A 2CBIA 2FUPA 3AE5A 2XSAA 4JI8T 3ZEFB 4ZI3D 1D0YA 4K0UA 4YSXA 5HWYA 1I6ZA 5KXJA 4EOZB 3Q5XA 2NTXA 3ZYMA 3P8CD 1BR4A 2YKSA 1XDPA 2UXDT 3ZJ2A 3ZT5A 2Q9QB 1D0ZA 4C91A 3AVRA 3C64A 3S4UA 5JDNA 4AKHA 2X9HA 2QGSA 2UXNB 4JEUB 2W67A 5LJMA 3H3MA 4TN7B 2VVSA 2BZBA 3IA3A 2LM2A 4ILUA 4H9OC 4EZ4A 2K24A 3PUYF 4ANJA 3MK7C 5L3EB 3PTRB 4Z8XA 4CQIA 3UTKA 2IAKA 4MHCA 4LMLA 4CXWA 2XAQB 2V5DA 5AQOB 4LF8T 4UVAB 2CXDA 3LK42 2J62A 4HWFA 3LFMA 3RIAA 3ZC1A 4EEBA 2WDQA 4ISTA 4DR5T 4X20E 4IL4A 2IUBA 2Y8DA 3VRBA 3ZMZB 3F2EA 5LYJE 3UQ7A 3CQXC 2LM9A 2XQ4A 1S94A 3KV4A 4I0UA 3Q5WA 1XMQT 4E7SA 2W2UA 3AA7B 4GKJT 5JRCA 1N33T 1WRDA 2BS3A 3RYIE 5JTGA 2CBJA 3RLFF 3AA0B 3H37A 1EZ3A 3PJAA 2BBJA 2XPKA 5AFUL 4OHFA 3EAMA 2WCAA 3I0OA 4IDOA 4IE4A 3L09A 4NXMT 4U7IA 2ACZA 4CZZB 1KEYA 1OWAA 3AXJA 3J9X1 3MZKB 2XTLA 2E5LT 3A5XA 5J1GA 4BJMA 3DJBA 2YINA 4LF7T 3O1HA 1LVKA 5FXZA 2WSSV 2ZLYA 3BQKA 1MNDA 3UT5E 5HEUA 1HS7A 3FB2A 3LBXB 3MKDA 3O1IA 4FI5A 5JDGA 2H89A 4AXPA 4GK0E 3JC6C 2XY8B 2G0UA 3OKQA 1QUUA 2X9YA 3PUWF 1CUNA 1FEWA 4I55E 1D1BA 3HKEE 1HR0T 5HEOA 5JR9A 4ILAA 2CWYA 3Q2MA 4YT0A 2N1GA 2PBIA 3CVRA 2XM1A 4ZI2C 3B13A 5C2TA 1BR2A 5FXVA 2FJEA 4ZHQE 3ZC0A 4KMCA 2N9DA 1KFYA 3AEAA 4YTPA 1HCIA 4U7YA 4ILBA 3ZLIA 2CE7A 2XQ3A 3JADA 3Q5DA 4Q25A 3AEGA 3LDQB 1AJ3A 3HA4A 3UUXB 4XAXB 2Q9QA 2PG8A 4QHOA 2BVLA 2X51A 1MIWA 3AE7A 1WYBA 3PUSA 1IBKT 4DR1T 3JC6D 4UIGA 3PU3A 3ZMSB 4DNDA 2WAUA 5FYMA 2IC6A 2WWUA 2XQ6A 4YY3T 3ZN0B 4AKGA 1Y64B 4IHJE 5AQGB 4IDPA 2BG9C 2CPTA 1U5PA 5LMUT 2XSBA 2LKHA 2NR4A 5JDHA 4U72A 5F3JA 4P1NA 4YLHA 2KXPB 2YDQA 2X66A 4A56A 2BS4A 5HXEA 2OA5A 3EHZA 4NUVA 4PK6A 2NWBA 1SE7A 4DVDA 4J2CA 2LSJA 4E7ZA 3HI2A 5LMNT 4O8SA 4CN4A 2QA7A 4B6XA 4NIQA 4DR2T 1NEKA 4NXNT 2XAHB 4DMVA 1XWMA 4IE6A 1FMVA 2X0HA 1WR6A 1U4QA 3ZMVB 4LMKA 3K3QC 4YTNA 3RIFA 2NW8A 2H7OA 3CX8B 2IIUA 3BQIA 1XZYA 4P0BA 4IREA 5AQRB 3L8RA 4PJMA 2B1EA 5AQLB 2V6YB 2W66A 4O2AE 4U2YA 2E9XB 1KK7A 2V5CA 3OPCA 5CA0E 3IEEA 5J2UE 4AQYT 2YDRA 5LHGB 3ETVA 2D0TA 3PJAJ 2ZMAA 5HEHA 2P9BA 2HH7A 3UUMA 3C4WA 5KDMC 4DMWA 4H9NC 4QXCB 4YTMA 3KDSE 5GONE 4H9RC 4GK5E 1YQ3A 4EXTA 2CM0A 1D1AA 2BS2A 3AAEB 3LJCA 2MOZA 3LBXA 3RRWA 3HKBE 1M62A 2A2FX 3P4QA 3C4ZA 4AISA 4IIJE 5BR8T 4JBWF 2H7VC 3AEBA 3AE1A 2JJ9A 3MJXA 1D1CA 1XNQT 4HFHA 2D0UA 4B3ST 3DTOA 4DBQA 3FZMB 1IAPA 5LHHB 4YFSA 3UU4A 4JI6T 5HXCA 3UULA 3RQWA 3ZJ1A 2XAGB 4TNVA 2JQ9A 4IE7A 4PW8A 4ASKA 3FZLB 1HNXT 5EK2A 2F4VT 2VB6A 5HCJA 2EHOC 5AQUB 4XZCA 4JUYA 3P4SA 4HFCA 4O4JE 1V9DA 5JR9B 4MFRA 2IDOB 2RA1A 3GWHA 1N34T 3A7MA 5DQVA 4LF5T 3P4PA 2DWKA 2N2NA 4X1YE 2V7JA 2V6XA 4CI1B 1ZEEA 3AE3A 2UU9T 1VCSA 5KX5E 1X79A 2V26A 4DV2T 1HF8A 1OEDC 4TX5A 2WDVA 2CMRA 2BVMA 3PUVF 4JI0T 3D0TA 3ZSTA 4Z90A 4OYKA 4ZI7E 4BAYB 1JNRA 3CX6B 2MTQA 5L3DB 4QH5A 2KINB 4HFVA 5HWXA 2ZM8A 5LOVE 5L2LA 2I0MA 4V1Av 3DP7A 5ABEA 3LK3B 1LKXA 3RIUA 2ODVA 1NAFA 2XUEA 4G63A 4UVBB 2KWIB 3N2GE 5LG4A 1XDOA 5AQVB 2UXXB 4DBRA 2X0LB 2DL1A 3AE6A 2ES0A 2L8KA 4QWNB 3O1JA 3KVAA 3FBZA 5ADXL 4ILCA 2EHOD 4DR6T 1J5ET 2CHNA 2LHRA 5FY0A 5C3JA 1LRZA 2CLYB 4OFZA 3RYCE 4B3TT 5L4EA 3AAAB 4TV9E 3ONJA 5AQKB 2A9UA 1WFDA 4KHZF 2YU1A 2WBLA 4GKKT 4TWHA 3HR0A 4YSZA 3K8PC 4AQFA 3N9MA 3WAKA 4LFBT 2JMHA 3RKOA 4CXXA 3CPZA 2K48A 1UX4A 2BKNA 4MLKA 5AQMB 4Z91A 1O3XA 2V6YA 1ZV4X 2BDEA 2XASB 2E9XA 4P09A 3C51A 2WU5A 4GYSA 5FY1A 3ZYLA 4A97A 1XNRT 2D2SA 3PUXF 3UU8A 1KF6A 3PUZF 2IHR1 2WS3A 2BBHA 2YK0A 3M65A 3PUAA 1UCUA 2BG9A 3VR8A 2VKJA 3M3ZB 5LBQB 5LGUB 5JREA 1W09A 3T8OA 3SOLA 2QRXA 1HTJF 4X65T 2M6IA 4WBNE 1HX8A 3KBUA 1E1HB 2CXLA 1ZHCA 4PJLA 2HHHT 1G8XA 1WR0A 3NZPA 3K1SA 3ONLC 1HNWT 2NP9A 3WI3A 5LA6E 2J1DG 5M4YA 4UXNB 1IJ6A 2IMLA 4UELA 4UR9A 3KVBA 5IHYA 4ZZBA 3P4RA 3LK2B 4DV7T 3QOFA 5LJNA 2X9XA 2FJAA 3RQUA 3MA9A 2W00A 2OV9A 3N9NA 4EZHA 4UEMA 3QK6A 3H3AA 4ZEYA 2JQKA 2LJLA 2MAWA 2XQYA 3TLTA 2YN6A 4O2BE 4UV8B 1KNRA 5JDMA 1MIYA 5FL0A 3VRAA 5LXTE 4JI3T 5JQGE 3VHLA 1NWMX 4EYYR 4EGWA 1IJ5A 2WWVA 4AKLA 3TLWA 4I50E 1MMGA 4N78D 4DV3T 5J0ZA 4H63V 1D0XA 3PE0A 3R6NA 3GA8A 4JLEA 4BA9A 3HKDE 5HCMA 2V7MA 4JEHB 4ZS3A 2NW7A 4HN9A 5ABHA 2E2AA 2XM2A 2I6HA 5A1LA 5IYZE 3TLVA 4UF0B 4QKNA 2JIWA 4F6RC 2AE9A 3RI5A 1Z0PA 2WM9A 4L5GA 2LKGA 4DV0T 2DCFA 3FHNA 2WZHA 1E7PA 1W9RA 5LGNB 4HFDA 5CA1E 3UQ4A 4NPPA 3KINB 1UX5A 1YD8G 2LOPA 2JQHA 2XAJB 1HFAA 3N9OA 2LLYA 2M6BA 2LSYA 2BG9E 3Q5EA 3HL6A 2JPFA 3ZSSA 4H63H 1YKEB 2VKDA 1H7CA 2C5JA 2KWHA 2EHOA 2KZ7B 4H9QC 2R6GF 1YW0A 4DUYT 1GQEA 4U33A 4YHJA 3RYFE 3MXZA 4ZI2D 2DI4A 4YJ2E 1W0AA 1I94T 4U74A 3EVYA 3EDVA 2YDSA 1HG5A 2XJ7A 5HXHA 3V5UA 1XMOT 2UUBT 3KV9A 1R8IA 1HX1B 1UUSA 1FIOA 4QH1A 5ABFA 1BR1A 3JAEA 5LP6E 1T72A 4HFIA 1UK5A 2VASA 5AQHB 4QX8B 4WBOA 5FKYA 3T1YT 3OJAA 4JV5T 3P7IA 3U78A 2CRBA 3K3NA 3ZMUB 2BKPA 1BR0A 3ZYKA 4HEAA 3ZMTB 5AQTB 5EK3A 1SUMB 3QB5A 4HWCA 5DJQC 4X66T 2C5KT 4PFPA 2V8SV 3TLSA 2X0YA 3UFGA 3B5MA 3SWHA 4TWFA 2DHRA 5TAOA 5BMVE 2BG9B 3LG7A 3NVOA 3ZT6A 3AEEA 4YHHT 3B57A 4PFOA 4ZXLA 2MBGA 3UFEA 4DR7T 5CFBA 5L4HA 3ZCJA 2VL8A 3KV5A 4QH4A 2KT9A 5EZYE 1IBLT 3AVSA 1SA0E 2D9DA 2LSGA 2KMFA 2PJQA 5FVLA 3RGLA 5F8PA 3PV0F 2NW9A 4C90A 1HG2A 3OBVE 3V5SA 5LG3A 5EK4A 2RPAA 3NKZA 2MYSA 3NWIA 4PAGA 4L0RA 4CI3B 2H3RA 4H9SE 4BJNA 5LB7B 2H88A 1WCRA 5AQIB 4XBFB 3W15B 2FJBA 2JQQA 1VOMA 3GN5A 4FJOA 3CKDA 5IWAT 3FZFB 3PURA 1T8BA 2Q9QC 2I59A 3R84B 2VQET 2L9QA 4I43B 2OLTA 4UF0A 2CA5A 4HWHA 4AKIA 3NRXA 4COFA 2VQFT 1N32T 5JH7E 4WZXA 2WQYA 3CQCB 3MACA 4HWDA 3CK6A 4P0AA 5LBMA 1MMNA 3U3IA 2CEAA 3RKGA 1VCTA 1IZNB 3T1HT 4KUMB 4CI2B 3SS1A 1G73A 2V7IA 2Z6EA 3I0QA 4NUUA 3RC3A 3ZPOA 2VWAA 4YJ3E 3QUJA 4ZS2A 3NBXX 3EDUA 4LF4T 4YSYA 2VK9A 4KX6A 3AAIA 3PUQA 5CGMA 2L3LA 2Q9QD 3OYXA 3ANWB 2LSIA 5AQQB 1NENA 4ZZCA 4AIUA 2GK9A 2B76A 1T98A 4X62T 1ZP0A 1Y01A 1QLBA 3RYHE 1JNZA 4PK4A 4EIWA 4PJNA 4HFEA 5LCYA 2ZM6T 2CCQA 4QXBB 4IDNA 4IDZA 2EHOB 2WMOA 4WNKA 4JI5T 4MALA 4O4HE 1B7TA 2NOXA 1ZKEA 3I9WA 4IL9A 5H6RB 5IUXA 5F5WA 5HXRA 3QNUA 2YU2A 3AA1B 2V7KA 2XQ8A 5AQSB 5FVKA 3FZKB 2CWOA 4KI0F 2LOSA 2W0GA 2UUAT 1OEDB 2A3DA 4TV8E 5HEJA 4X64T 3UU3A 4B3RT 5JDFA 2LE8A 5LNKA 5L3BB 4WW0A 2WMNA 2WP9A 5L3GB 4L9IA 5ABFB 4OK0A 1Z8UA 3N5LA 4ZOLE 1YXRA 4TZ4C 1YQ4A 4DO0A 2IC9A 4A5XA 1UGOA 2FJDA 2QVAA 2VVNA 4UV9B 2X67A 4PK5A 2LT3A 1KNZA 4U2ZA 2DNXA 3A8YC 2XQ5A 2VL0A 4GOUA 2X9WA 3K3OA 1L0VA 3VKGA 4TUYE 2XQ9A 4HGAA 1MMAA 3C98B 4DR4T 3AA6B 2Y48B 4OX9T 2K5BB 4LFCT 4X5TA 2ZM0A 3AE9A 4K0KT 2YOEA 1MIVA 1WYCA 4QX7B 4H9PC 4ADZA 3NZQA 4UVCB 3TLUA 3IHRA 4KBMB 2E8IA 2FBWA 3RC8A 4KHPT 3J7Yq 4G2AA 5FNVE 1WLXA 3RHWA 5L47A 2W4XA 2KNDA 3KV6A 4B3MT 3N9PA 3AE4A 4DV4T 4CN6A 3PU8A 2VKOA 4PJJA 4M1PA 3NRYA 3AE2A 1W0BA 4HFBA 1FMWA 5CB4E 1J1JA 1X9BA 4AI6A 2DLRA 4EEDA 3RIUC 3LSVA 3FBLA 3EABA 3GN5B 4DIDB 2K9AA 1T7SA 5JDQA 4HTEA 3E22E 3E08A 2BKOA 3KBTA 3UUBA 3CIRA 1SHZC 2ZM2A 4X1IE 4CN1A 5ETWA 3I9YA 3UU6A 2IW5B 2WU2A 4CXYA 3CX7B 2W63A 2C0SA 2HPJA 5LHIB 3OTOT 2LHNA 3QB5K 2XAFB 3RPUA 5FXXA 3C4XA 3X1DA 5JVDE 4HE8A 2XZEA 4JI2T 3P4WA 2LSKA 3QC9A 3ANWA 3CMLA 4TWDA 4WYVA 4AQFC 2DWGA 3P50A 4I4TE 1HNZT 1FJGT 3C50A 2QYWA 2X68A 3EUHA 4KP3C 4X1KE 3ZT7A 2K3WA 4LMJA 2V1DB 5DABA 2HN1A 3JAFA 4DR3T 1YKHB 2E9XC 3RF1A 3F31A 5AQNB 3IBPA 3IF8B 1N36T 1J5WA 5AQJB 3OVUA 4A98A 2E5VA 2W61A 4DV1T 4QXHB 5FP3A 2AXDS 3N2KE 3UU5A 2V7LA 4GIWA 2SPCA 4JYAT 5FXWA 2LEHA 4EB6E 1CHUA 5HYAA 2HN2A 3VU7H 2UXBT 2A72A 2ODUA 3VKHA 1OEDA 2VKHA 3FXDB 3N9QA 3OYZA 3G06A 3SFDA 3EI0A 1S35A 4HWIB 2W62A 3PUGA 2PFVA 3N9LA 4IE0A 1ZOYA 3SFEA 4LF9T 3VR9A 3E0ZA 3Q9DA 3BK9A 3F57A 1LVFA 2WY2A 3AB3B 1OXZA 3L3PA 2UUCT 2JMKA 2VURA 5ABGA 1KNPA 2Y6XA 5LGTB 2E9XD 4EV6A 3AEFA 3BQLA 4ERRA 5E0OA 1IBMT 2CHOA 5HEGA 2YEVC 4ISSA 3RRCA 1VRBA 1MNEA 2KSRA 2RP4A 4DV6T 3ABVA 3I1AA 3N2OA 4U31A 3ZN1B 5JR9C 4TNWA 3RX6A 5L3CB 1MMDA 4AQGA 3ESLA 3GMIA 3FZHB 5HAXA 5JRCB 4LF6T 2JRKA 5KMGP
chains in the Genus database with same CATH topology
3L8RA 1E2AA 2E2AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L8R A;  1E2A A;  2E2A A; 
#chains in the Genus database with same CATH topology
 2HPL A;  5H6Q B;  1E2A A;  5L3F B;  2WZI A;  3AED A;  3SRZ A;  3AE8 A;  4LFA T;  3KFW X;  4U3C A;  3TKL B;  4ZI3 C;  3ETU A;  3WAJ A;  2XQA A;  3ZCI A;  4F8H A;  5C8Y E;  2NTY A;  4O4I E;  2LRL A;  3AXJ B;  2D5U A;  4PNI A;  4DV5 T;  4IGU A;  4JI7 T;  2XQ7 A;  4EAH A;  4AKR B;  5HXS A;  1UUR A;  2J4G A;  2LRK A;  2ACX A;  3O4X E;  2WB5 A;  4DUZ T;  3O9X A;  2WDR A;  3AEC A;  3CWZ B;  5J2T E;  4MBQ A;  2XHE B;  4JI1 T;  1DU2 A;  4HKA A;  4YXD A;  5FY7 A;  3RH3 A;  4O4L E;  5AQP B;  2CLY C;  3ONX A;  5FL1 A;  3ZKR A;  5AQF B;  3CQG B;  4OYJ A;  4EYU A;  2MPK A;  1OED E;  4JI4 T;  2UXC T;  4GYR A;  5FMN A;  1M7K A;  2M67 A;  2KLQ A;  4IDQ A;  3UUN A;  3FXE B;  5DQW A;  1US7 B;  3PDY A;  2J47 A;  2C5I T;  5CJ5 A;  4IE5 A;  1QSD A;  5JDL A;  2CXF A;  3L39 A;  3HKC E;  2PTF A;  3JCF A;  4IT4 A;  2CBI A;  2FUP A;  3AE5 A;  2XSA A;  4JI8 T;  3ZEF B;  4ZI3 D;  1D0Y A;  4K0U A;  4YSX A;  5HWY A;  1I6Z A;  5KXJ A;  4EOZ B;  3Q5X A;  2NTX A;  3ZYM A;  3P8C D;  1BR4 A;  2YKS A;  1XDP A;  2UXD T;  3ZJ2 A;  3ZT5 A;  2Q9Q B;  1D0Z A;  4C91 A;  3AVR A;  3C64 A;  3S4U A;  5JDN A;  4AKH A;  2X9H A;  2QGS A;  2UXN B;  4JEU B;  2W67 A;  5LJM A;  3H3M A;  4TN7 B;  2VVS A;  2BZB A;  3IA3 A;  2LM2 A;  4ILU A;  4H9O C;  4EZ4 A;  2K24 A;  3PUY F;  4ANJ A;  3MK7 C;  5L3E B;  3PTR B;  4Z8X A;  4CQI A;  3UTK A;  2IAK A;  4MHC A;  4LML A;  4CXW A;  2XAQ B;  2V5D A;  5AQO B;  4LF8 T;  4UVA B;  2CXD A;  3LK4 2;  2J62 A;  4HWF A;  3LFM A;  3RIA A;  3ZC1 A;  4EEB A;  2WDQ A;  4IST A;  4DR5 T;  4X20 E;  4IL4 A;  2IUB A;  2Y8D A;  3VRB A;  3ZMZ B;  3F2E A;  5LYJ E;  3UQ7 A;  3CQX C;  2LM9 A;  2XQ4 A;  1S94 A;  3KV4 A;  4I0U A;  3Q5W A;  1XMQ T;  4E7S A;  2W2U A;  3AA7 B;  4GKJ T;  5JRC A;  1N33 T;  1WRD A;  2BS3 A;  3RYI E;  5JTG A;  2CBJ A;  3RLF F;  3AA0 B;  3H37 A;  1EZ3 A;  3PJA A;  2BBJ A;  2XPK A;  5AFU L;  4OHF A;  3EAM A;  2WCA A;  3I0O A;  4IDO A;  4IE4 A;  3L09 A;  4NXM T;  4U7I A;  2ACZ A;  4CZZ B;  1KEY A;  1OWA A;  3AXJ A;  3J9X 1;  3MZK B;  2XTL A;  2E5L T;  3A5X A;  5J1G A;  4BJM A;  3DJB A;  2YIN A;  4LF7 T;  3O1H A;  1LVK A;  5FXZ A;  2WSS V;  2ZLY A;  3BQK A;  1MND A;  3UT5 E;  5HEU A;  1HS7 A;  3FB2 A;  3LBX B;  3MKD A;  3O1I A;  4FI5 A;  5JDG A;  2H89 A;  4AXP A;  4GK0 E;  3JC6 C;  2XY8 B;  2G0U A;  3OKQ A;  1QUU A;  2X9Y A;  3PUW F;  1CUN A;  1FEW A;  4I55 E;  1D1B A;  3HKE E;  1HR0 T;  5HEO A;  5JR9 A;  4ILA A;  2CWY A;  3Q2M A;  4YT0 A;  2N1G A;  2PBI A;  3CVR A;  2XM1 A;  4ZI2 C;  3B13 A;  5C2T A;  1BR2 A;  5FXV A;  2FJE A;  4ZHQ E;  3ZC0 A;  4KMC A;  2N9D A;  1KFY A;  3AEA A;  4YTP A;  1HCI A;  4U7Y A;  4ILB A;  3ZLI A;  2CE7 A;  2XQ3 A;  3JAD A;  3Q5D A;  4Q25 A;  3AEG A;  3LDQ B;  1AJ3 A;  3HA4 A;  3UUX B;  4XAX B;  2Q9Q A;  2PG8 A;  4QHO A;  2BVL A;  2X51 A;  1MIW A;  3AE7 A;  1WYB A;  3PUS A;  1IBK T;  4DR1 T;  3JC6 D;  4UIG A;  3PU3 A;  3ZMS B;  4DND A;  2WAU A;  5FYM A;  2IC6 A;  2WWU A;  2XQ6 A;  4YY3 T;  3ZN0 B;  4AKG A;  1Y64 B;  4IHJ E;  5AQG B;  4IDP A;  2BG9 C;  2CPT A;  1U5P A;  5LMU T;  2XSB A;  2LKH A;  2NR4 A;  5JDH A;  4U72 A;  5F3J A;  4P1N A;  4YLH A;  2KXP B;  2YDQ A;  2X66 A;  4A56 A;  2BS4 A;  5HXE A;  2OA5 A;  3EHZ A;  4NUV A;  4PK6 A;  2NWB A;  1SE7 A;  4DVD A;  4J2C A;  2LSJ A;  4E7Z A;  3HI2 A;  5LMN T;  4O8S A;  4CN4 A;  2QA7 A;  4B6X A;  4NIQ A;  4DR2 T;  1NEK A;  4NXN T;  2XAH B;  4DMV A;  1XWM A;  4IE6 A;  1FMV A;  2X0H A;  1WR6 A;  1U4Q A;  3ZMV B;  4LMK A;  3K3Q C;  4YTN A;  3RIF A;  2NW8 A;  2H7O A;  3CX8 B;  2IIU A;  3BQI A;  1XZY A;  4P0B A;  4IRE A;  5AQR B;  3L8R A;  4PJM A;  2B1E A;  5AQL B;  2V6Y B;  2W66 A;  4O2A E;  4U2Y A;  2E9X B;  1KK7 A;  2V5C A;  3OPC A;  5CA0 E;  3IEE A;  5J2U E;  4AQY T;  2YDR A;  5LHG B;  3ETV A;  2D0T A;  3PJA J;  2ZMA A;  5HEH A;  2P9B A;  2HH7 A;  3UUM A;  3C4W A;  5KDM C;  4DMW A;  4H9N C;  4QXC B;  4YTM A;  3KDS E;  5GON E;  4H9R C;  4GK5 E;  1YQ3 A;  4EXT A;  2CM0 A;  1D1A A;  2BS2 A;  3AAE B;  3LJC A;  2MOZ A;  3LBX A;  3RRW A;  3HKB E;  1M62 A;  2A2F X;  3P4Q A;  3C4Z A;  4AIS A;  4IIJ E;  5BR8 T;  4JBW F;  2H7V C;  3AEB A;  3AE1 A;  2JJ9 A;  3MJX A;  1D1C A;  1XNQ T;  4HFH A;  2D0U A;  4B3S T;  3DTO A;  4DBQ A;  3FZM B;  1IAP A;  5LHH B;  4YFS A;  3UU4 A;  4JI6 T;  5HXC A;  3UUL A;  3RQW A;  3ZJ1 A;  2XAG B;  4TNV A;  2JQ9 A;  4IE7 A;  4PW8 A;  4ASK A;  3FZL B;  1HNX T;  5EK2 A;  2F4V T;  2VB6 A;  5HCJ A;  2EHO C;  5AQU B;  4XZC A;  4JUY A;  3P4S A;  4HFC A;  4O4J E;  1V9D A;  5JR9 B;  4MFR A;  2IDO B;  2RA1 A;  3GWH A;  1N34 T;  3A7M A;  5DQV A;  4LF5 T;  3P4P A;  2DWK A;  2N2N A;  4X1Y E;  2V7J A;  2V6X A;  4CI1 B;  1ZEE A;  3AE3 A;  2UU9 T;  1VCS A;  5KX5 E;  1X79 A;  2V26 A;  4DV2 T;  1HF8 A;  1OED C;  4TX5 A;  2WDV A;  2CMR A;  2BVM A;  3PUV F;  4JI0 T;  3D0T A;  3ZST A;  4Z90 A;  4OYK A;  4ZI7 E;  4BAY B;  1JNR A;  3CX6 B;  2MTQ A;  5L3D B;  4QH5 A;  2KIN B;  4HFV A;  5HWX A;  2ZM8 A;  5LOV E;  5L2L A;  2I0M A;  4V1A v;  3DP7 A;  5ABE A;  3LK3 B;  1LKX A;  3RIU A;  2ODV A;  1NAF A;  2XUE A;  4G63 A;  4UVB B;  2KWI B;  3N2G E;  5LG4 A;  1XDO A;  5AQV B;  2UXX B;  4DBR A;  2X0L B;  2DL1 A;  3AE6 A;  2ES0 A;  2L8K A;  4QWN B;  3O1J A;  3KVA A;  3FBZ A;  5ADX L;  4ILC A;  2EHO D;  4DR6 T;  1J5E T;  2CHN A;  2LHR A;  5FY0 A;  5C3J A;  1LRZ A;  2CLY B;  4OFZ A;  3RYC E;  4B3T T;  5L4E A;  3AAA B;  4TV9 E;  3ONJ A;  5AQK B;  2A9U A;  1WFD A;  4KHZ F;  2YU1 A;  2WBL A;  4GKK T;  4TWH A;  3HR0 A;  4YSZ A;  3K8P C;  4AQF A;  3N9M A;  3WAK A;  4LFB T;  2JMH A;  3RKO A;  4CXX A;  3CPZ A;  2K48 A;  1UX4 A;  2BKN A;  4MLK A;  5AQM B;  4Z91 A;  1O3X A;  2V6Y A;  1ZV4 X;  2BDE A;  2XAS B;  2E9X A;  4P09 A;  3C51 A;  2WU5 A;  4GYS A;  5FY1 A;  3ZYL A;  4A97 A;  1XNR T;  2D2S A;  3PUX F;  3UU8 A;  1KF6 A;  3PUZ F;  2IHR 1;  2WS3 A;  2BBH A;  2YK0 A;  3M65 A;  3PUA A;  1UCU A;  2BG9 A;  3VR8 A;  2VKJ A;  3M3Z B;  5LBQ B;  5LGU B;  5JRE A;  1W09 A;  3T8O A;  3SOL A;  2QRX A;  1HTJ F;  4X65 T;  2M6I A;  4WBN E;  1HX8 A;  3KBU A;  1E1H B;  2CXL A;  1ZHC A;  4PJL A;  2HHH T;  1G8X A;  1WR0 A;  3NZP A;  3K1S A;  3ONL C;  1HNW T;  2NP9 A;  3WI3 A;  5LA6 E;  2J1D G;  5M4Y A;  4UXN B;  1IJ6 A;  2IML A;  4UEL A;  4UR9 A;  3KVB A;  5IHY A;  4ZZB A;  3P4R A;  3LK2 B;  4DV7 T;  3QOF A;  5LJN A;  2X9X A;  2FJA A;  3RQU A;  3MA9 A;  2W00 A;  2OV9 A;  3N9N A;  4EZH A;  4UEM A;  3QK6 A;  3H3A A;  4ZEY A;  2JQK A;  2LJL A;  2MAW A;  2XQY A;  3TLT A;  2YN6 A;  4O2B E;  4UV8 B;  1KNR A;  5JDM A;  1MIY A;  5FL0 A;  3VRA A;  5LXT E;  4JI3 T;  5JQG E;  3VHL A;  1NWM X;  4EYY R;  4EGW A;  1IJ5 A;  2WWV A;  4AKL A;  3TLW A;  4I50 E;  1MMG A;  4N78 D;  4DV3 T;  5J0Z A;  4H63 V;  1D0X A;  3PE0 A;  3R6N A;  3GA8 A;  4JLE A;  4BA9 A;  3HKD E;  5HCM A;  2V7M A;  4JEH B;  4ZS3 A;  2NW7 A;  4HN9 A;  5ABH A;  2E2A A;  2XM2 A;  2I6H A;  5A1L A;  5IYZ E;  3TLV A;  4UF0 B;  4QKN A;  2JIW A;  4F6R C;  2AE9 A;  3RI5 A;  1Z0P A;  2WM9 A;  4L5G A;  2LKG A;  4DV0 T;  2DCF A;  3FHN A;  2WZH A;  1E7P A;  1W9R A;  5LGN B;  4HFD A;  5CA1 E;  3UQ4 A;  4NPP A;  3KIN B;  1UX5 A;  1YD8 G;  2LOP A;  2JQH A;  2XAJ B;  1HFA A;  3N9O A;  2LLY A;  2M6B A;  2LSY A;  2BG9 E;  3Q5E A;  3HL6 A;  2JPF A;  3ZSS A;  4H63 H;  1YKE B;  2VKD A;  1H7C A;  2C5J A;  2KWH A;  2EHO A;  2KZ7 B;  4H9Q C;  2R6G F;  1YW0 A;  4DUY T;  1GQE A;  4U33 A;  4YHJ A;  3RYF E;  3MXZ A;  4ZI2 D;  2DI4 A;  4YJ2 E;  1W0A A;  1I94 T;  4U74 A;  3EVY A;  3EDV A;  2YDS A;  1HG5 A;  2XJ7 A;  5HXH A;  3V5U A;  1XMO T;  2UUB T;  3KV9 A;  1R8I A;  1HX1 B;  1UUS A;  1FIO A;  4QH1 A;  5ABF A;  1BR1 A;  3JAE A;  5LP6 E;  1T72 A;  4HFI A;  1UK5 A;  2VAS A;  5AQH B;  4QX8 B;  4WBO A;  5FKY A;  3T1Y T;  3OJA A;  4JV5 T;  3P7I A;  3U78 A;  2CRB A;  3K3N A;  3ZMU B;  2BKP A;  1BR0 A;  3ZYK A;  4HEA A;  3ZMT B;  5AQT B;  5EK3 A;  1SUM B;  3QB5 A;  4HWC A;  5DJQ C;  4X66 T;  2C5K T;  4PFP A;  2V8S V;  3TLS A;  2X0Y A;  3UFG A;  3B5M A;  3SWH A;  4TWF A;  2DHR A;  5TAO A;  5BMV E;  2BG9 B;  3LG7 A;  3NVO A;  3ZT6 A;  3AEE A;  4YHH T;  3B57 A;  4PFO A;  4ZXL A;  2MBG A;  3UFE A;  4DR7 T;  5CFB A;  5L4H A;  3ZCJ A;  2VL8 A;  3KV5 A;  4QH4 A;  2KT9 A;  5EZY E;  1IBL T;  3AVS A;  1SA0 E;  2D9D A;  2LSG A;  2KMF A;  2PJQ A;  5FVL A;  3RGL A;  5F8P A;  3PV0 F;  2NW9 A;  4C90 A;  1HG2 A;  3OBV E;  3V5S A;  5LG3 A;  5EK4 A;  2RPA A;  3NKZ A;  2MYS A;  3NWI A;  4PAG A;  4L0R A;  4CI3 B;  2H3R A;  4H9S E;  4BJN A;  5LB7 B;  2H88 A;  1WCR A;  5AQI B;  4XBF B;  3W15 B;  2FJB A;  2JQQ A;  1VOM A;  3GN5 A;  4FJO A;  3CKD A;  5IWA T;  3FZF B;  3PUR A;  1T8B A;  2Q9Q C;  2I59 A;  3R84 B;  2VQE T;  2L9Q A;  4I43 B;  2OLT A;  4UF0 A;  2CA5 A;  4HWH A;  4AKI A;  3NRX A;  4COF A;  2VQF T;  1N32 T;  5JH7 E;  4WZX A;  2WQY A;  3CQC B;  3MAC A;  4HWD A;  3CK6 A;  4P0A A;  5LBM A;  1MMN A;  3U3I A;  2CEA A;  3RKG A;  1VCT A;  1IZN B;  3T1H T;  4KUM B;  4CI2 B;  3SS1 A;  1G73 A;  2V7I A;  2Z6E A;  3I0Q A;  4NUU A;  3RC3 A;  3ZPO A;  2VWA A;  4YJ3 E;  3QUJ A;  4ZS2 A;  3NBX X;  3EDU A;  4LF4 T;  4YSY A;  2VK9 A;  4KX6 A;  3AAI A;  3PUQ A;  5CGM A;  2L3L A;  2Q9Q D;  3OYX A;  3ANW B;  2LSI A;  5AQQ B;  1NEN A;  4ZZC A;  4AIU A;  2GK9 A;  2B76 A;  1T98 A;  4X62 T;  1ZP0 A;  1Y01 A;  1QLB A;  3RYH E;  1JNZ A;  4PK4 A;  4EIW A;  4PJN A;  4HFE A;  5LCY A;  2ZM6 T;  2CCQ A;  4QXB B;  4IDN A;  4IDZ A;  2EHO B;  2WMO A;  4WNK A;  4JI5 T;  4MAL A;  4O4H E;  1B7T A;  2NOX A;  1ZKE A;  3I9W A;  4IL9 A;  5H6R B;  5IUX A;  5F5W A;  5HXR A;  3QNU A;  2YU2 A;  3AA1 B;  2V7K A;  2XQ8 A;  5AQS B;  5FVK A;  3FZK B;  2CWO A;  4KI0 F;  2LOS A;  2W0G A;  2UUA T;  1OED B;  2A3D A;  4TV8 E;  5HEJ A;  4X64 T;  3UU3 A;  4B3R T;  5JDF A;  2LE8 A;  5LNK A;  5L3B B;  4WW0 A;  2WMN A;  2WP9 A;  5L3G B;  4L9I A;  5ABF B;  4OK0 A;  1Z8U A;  3N5L A;  4ZOL E;  1YXR A;  4TZ4 C;  1YQ4 A;  4DO0 A;  2IC9 A;  4A5X A;  1UGO A;  2FJD A;  2QVA A;  2VVN A;  4UV9 B;  2X67 A;  4PK5 A;  2LT3 A;  1KNZ A;  4U2Z A;  2DNX A;  3A8Y C;  2XQ5 A;  2VL0 A;  4GOU A;  2X9W A;  3K3O A;  1L0V A;  3VKG A;  4TUY E;  2XQ9 A;  4HGA A;  1MMA A;  3C98 B;  4DR4 T;  3AA6 B;  2Y48 B;  4OX9 T;  2K5B B;  4LFC T;  4X5T A;  2ZM0 A;  3AE9 A;  4K0K T;  2YOE A;  1MIV A;  1WYC A;  4QX7 B;  4H9P C;  4ADZ A;  3NZQ A;  4UVC B;  3TLU A;  3IHR A;  4KBM B;  2E8I A;  2FBW A;  3RC8 A;  4KHP T;  3J7Y q;  4G2A A;  5FNV E;  1WLX A;  3RHW A;  5L47 A;  2W4X A;  2KND A;  3KV6 A;  4B3M T;  3N9P A;  3AE4 A;  4DV4 T;  4CN6 A;  3PU8 A;  2VKO A;  4PJJ A;  4M1P A;  3NRY A;  3AE2 A;  1W0B A;  4HFB A;  1FMW A;  5CB4 E;  1J1J A;  1X9B A;  4AI6 A;  2DLR A;  4EED A;  3RIU C;  3LSV A;  3FBL A;  3EAB A;  3GN5 B;  4DID B;  2K9A A;  1T7S A;  5JDQ A;  4HTE A;  3E22 E;  3E08 A;  2BKO A;  3KBT A;  3UUB A;  3CIR A;  1SHZ C;  2ZM2 A;  4X1I E;  4CN1 A;  5ETW A;  3I9Y A;  3UU6 A;  2IW5 B;  2WU2 A;  4CXY A;  3CX7 B;  2W63 A;  2C0S A;  2HPJ A;  5LHI B;  3OTO T;  2LHN A;  3QB5 K;  2XAF B;  3RPU A;  5FXX A;  3C4X A;  3X1D A;  5JVD E;  4HE8 A;  2XZE A;  4JI2 T;  3P4W A;  2LSK A;  3QC9 A;  3ANW A;  3CML A;  4TWD A;  4WYV A;  4AQF C;  2DWG A;  3P50 A;  4I4T E;  1HNZ T;  1FJG T;  3C50 A;  2QYW A;  2X68 A;  3EUH A;  4KP3 C;  4X1K E;  3ZT7 A;  2K3W A;  4LMJ A;  2V1D B;  5DAB A;  2HN1 A;  3JAF A;  4DR3 T;  1YKH B;  2E9X C;  3RF1 A;  3F31 A;  5AQN B;  3IBP A;  3IF8 B;  1N36 T;  1J5W A;  5AQJ B;  3OVU A;  4A98 A;  2E5V A;  2W61 A;  4DV1 T;  4QXH B;  5FP3 A;  2AXD S;  3N2K E;  3UU5 A;  2V7L A;  4GIW A;  2SPC A;  4JYA T;  5FXW A;  2LEH A;  4EB6 E;  1CHU A;  5HYA A;  2HN2 A;  3VU7 H;  2UXB T;  2A72 A;  2ODU A;  3VKH A;  1OED A;  2VKH A;  3FXD B;  3N9Q A;  3OYZ A;  3G06 A;  3SFD A;  3EI0 A;  1S35 A;  4HWI B;  2W62 A;  3PUG A;  2PFV A;  3N9L A;  4IE0 A;  1ZOY A;  3SFE A;  4LF9 T;  3VR9 A;  3E0Z A;  3Q9D A;  3BK9 A;  3F57 A;  1LVF A;  2WY2 A;  3AB3 B;  1OXZ A;  3L3P A;  2UUC T;  2JMK A;  2VUR A;  5ABG A;  1KNP A;  2Y6X A;  5LGT B;  2E9X D;  4EV6 A;  3AEF A;  3BQL A;  4ERR A;  5E0O A;  1IBM T;  2CHO A;  5HEG A;  2YEV C;  4ISS A;  3RRC A;  1VRB A;  1MNE A;  2KSR A;  2RP4 A;  4DV6 T;  3ABV A;  3I1A A;  3N2O A;  4U31 A;  3ZN1 B;  5JR9 C;  4TNW A;  3RX6 A;  5L3C B;  1MMD A;  4AQG A;  3ESL A;  3GMI A;  3FZH B;  5HAX A;  5JRC B;  4LF6 T;  2JRK A;  5KMG P; 
#chains in the Genus database with same CATH homology
 3L8R A;  1E2A A;  2E2A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...