2VQET

Modified uridines with c5-methylene substituents at the first position of the trna anticodon stabilize u-g wobble pairing during decoding
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAVQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Modified Uridines with C5-Methylene Substituents at the First Position of the tRNA Anticodon Stabilize U.G Wobble Pairing During Decoding.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RRNA
total genus 34
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2008-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 2vqeT00
2F4VT 4LF4T 5BR8T 5LMNT 1IBLT 2UUCT 1N32T 1I94T 2VQET 4JV5T 4K0KT 4DV7T 2UXBT 1HNZT 1N33T 4DUZT 5IWAT 3T1HT 2ZM6T 4B3TT 4NXNT 4OX9T 4GKJT 4B3ST 4DV1T 2UUBT 2E5LT 4LF5T 4JI2T 4LF8T 1IBKT 4GKKT 4DV3T 4AQYT 1HNXT 4KHPT 1J5ET 4DV6T 3OTOT 4DR6T 2UXCT 4DR2T 1HNWT 4DR1T 2HHHT 4X64T 4DR5T 4X66T 4B3RT 4NXMT 4X62T 1FJGT 4JI0T 1N36T 4YHHT 5LMUT 4LF9T 4LFBT 4JI4T 4LFCT 1HR0T 4JI7T 4X65T 4DUYT 3T1YT 4JI6T 4DV4T 1XMOT 1IBMT 2VQFT 4DR7T 2UU9T 4LF6T 4JI8T 2UXDT 4DV5T 4LF7T 2UUAT 4JI1T 4LFAT 4B3MT 4JYAT 1XNRT 4DV2T 4JI5T 1XMQT 1N34T 4DR4T 4DV0T 4YY3T 4JI3T 4DR3T 1XNQT
chains in the Genus database with same CATH superfamily
3NRYA 2RA1A 4PK6A 2K9AA 4DBRA 3U3IA 1WRDA 4LF4T 1D1BA 5CB4E 2GK9A 4TV8E 2BKNA 4U3CA 5HXCA 3UQ4A 2LHNA 2XAHB 5C2TA 1MMAA 1IBLT 5KMGP 2N2NA 5JDQA 1KEYA 3F57A 5LHHB 4IE5A 4EEDA 4ISTA 1V9DA 2FJBA 2V26A 3LSVA 2XHEB 3RRWA 3UU6A 2VK9A 4LF9T 2CBIA 4K0KT 3CPZA 5HEUA 3WAKA 4DUZT 3PV0F 4JEUB 2JQHA 3KBUA 3N9QA 2Y8DA 3PUAA 4B3TT 4QXCB 5ABHA 5HXSA 2ZM2A 4EYYR 3IF8B 2HN1A 2I0MA 2LT3A 2PJQA 2CXFA 2Q9QD 1D0ZA 3RYHE 4DV1T 1YKHB 3AE4A 4Z90A 2CEAA 3Q5EA 3KV9A 4M1PA 2V7KA 3L8RA 3FXDB 3AAEB 1ZP0A 2XZEA 1X9BA 4GYRA 3CWZB 2WDVA 3TKLB 5HWXA 4DVDA 2KSRA 3LG7A 3HKCE 2ODVA 3KV4A 2VASA 2KXPB 3WI3A 1G8XA 2XM1A 4HFCA 2V6YB 2BG9A 1R8IA 2WQYA 5H6QB 3UUMA 3ZT7A 3PU8A 5LG4A 1J5ET 2WM9A 3L39A 4DV6T 5CGMA 3RIUA 4GOUA 3UULA 1W09A 2XAJB 4DR6T 1GQEA 3F2EA 4B6XA 3AEFA 3UUNA 3KVBA 1Y01A 1B7TA 3EHZA 5LBQB 1OEDB 2FJAA 3FBLA 1WR6A 4OYJA 3H3AA 1SUMB 4Z91A 2FJDA 1HNWT 2E9XA 1SA0E 2DLRA 2NWBA 2WAUA 2YDSA 3I1AA 5JH7E 4CXYA 2HHHT 1FIOA 4X64T 3K1SA 4O4IE 2C5JA 1XDOA 2IMLA 2ZM0A 3DP7A 4IIJE 4AISA 4QH4A 3FZHB 3RQWA 5AQMB 5AQOB 3TLUA 2Q9QB 2JRKA 3C64A 3C51A 3AE7A 3EVYA 4CXWA 3RC8A 4MLKA 1LRZA 3N9NA 4AKHA 2UUBT 5L3BB 4F6RC 2QVAA 1WLXA 2YKSA 3T8OA 2QRXA 2WWUA 1OEDC 3CK6A 1VOMA 4UXNB 4O2AE 4CZZB 2LLYA 3HA4A 3V5SA 5C8YE 3ONXA 3N2KE 1MMGA 1N36T 4PJLA 3E22E 4JBWF 5HEOA 3RI5A 1ZKEA 1HTJF 2KWHA 2ZLYA 5J1GA 2V5CA 3ONLC 1VCTA 4IGUA 3UFGA 2X9WA 4QWNB 3V5UA 4U2YA 4LFCT 3RIUC 4HGAA 1KNPA 2W0GA 2XQ5A 4HFVA 3UTKA 5KXJA 4JI7T 2MPKA 2DL1A 4TX5A 3ZN1B 4P0AA 4EB6E 3N9PA 3T1YT 2BG9E 3FHNA 5AQIB 3QK6A 4LF5T 4GK0E 4JI6T 4EXTA 4QXBB 2NOXA 3C50A 5HWYA 4O2BE 5FVKA 2KMFA 2L9QA 3MZKB 1ZOYA 4ZXLA 5F3JA 2UXDT 3QUJA 2DNXA 1E1HB 1D0XA 3AAIA 3JAEA 3S4UA 1MIWA 5HXEA 4CI1B 1H7CA 3LK42 2VVNA 4U31A 2IUBA 4YHJA 4KP3C 5ADXL 3Q5DA 5L47A 3AVRA 2NP9A 3AE6A 3I0OA 4JYAT 3ANWB 2WB5A 5AQUB 4CN4A 4CN6A 1XNRT 4HFIA 2E9XB 2V7JA 4UV9B 4YJ3E 5LG3A 5AQQB 3LFMA 2LEHA 5FKYA 3L3PA 4AXPA 2M67A 5FNVE 5JR9B 2BS2A 3H37A 2M6IA 3RHWA 4BAYB 1MMDA 5BMVE 5HEJA 2V7IA 4HWDA 3CQXC 4DR4T 2MOZA 2QYWA 4YY3T 1T8BA 1IJ6A 3LBXB 4QKNA 3ZJ2A 2A2FX 2D5UA 3KV5A 2H89A 3VRAA 4TWHA 4DR3T 1DU2A 2A3DA 4UIGA 2EHOC 2CWYA 2E9XD 4TNVA 4UF0A 5AQNB 4CI3B 2L3LA 3RYFE 3BQKA 2DHRA 3ZMUB 4FI5A 5JVDE 3N9OA 4ZI7E 4PFOA 5M4YA 5LMNT 3ZPOA 2K3WA 3IHRA 2CA5A 4ZI2D 1E7PA 3Q9DA 5JQGE 1HS7A 5IUXA 4JV5T 3OVUA 1CUNA 3QB5A 2WMNA 4HFHA 1BR0A 1HNZT 2XSBA 5JDGA 4BJNA 3O1HA 2CLYB 2HPLA 2L8KA 2J47A 5IWAT 5IHYA 5CFBA 4F8HA 4EAHA 3QB5K 3TLWA 4XBFB 1CHUA 4IDNA 4CI2B 2DWKA 3A7MA 2G0UA 4B3ST 2V7LA 2J62A 2IIUA 3AA1B 3OYZA 3PUYF 2MAWA 3ZC0A 3L09A 5JDHA 3FZMB 2KINB 2LM2A 3KVAA 4PJNA 1IJ5A 4PNIA 4U2ZA 4BA9A 4P1NA 2PG8A 3GMIA 3RIAA 3MACA 1WCRA 3ZYMA 1HX8A 4TUYE 4U74A 2IAKA 2MTQA 3BQLA 5GONE 2VVSA 4GKKT 1BR1A 1HFAA 2NTXA 2W61A 3ZCJA 4IT4A 4QXHB 4AQYT 2CLYC 3OBVE 1YW0A 3P7IA 4IE4A 4DMWA 4A5XA 4YTNA 4ZI2C 5JDMA 2WDQA 3D0TA 4AKGA 2K24A 1T98A 2ES0A 2BVLA 2LKGA 4YLHA 5ABFB 4ZEYA 4YSXA 4ZS3A 4QX7B 4DIDB 4I4TE 5L4EA 3RQUA 2UXCT 3AE8A 4X5TA 4U7YA 3HL6A 5DQVA 5AQTB 3ZT5A 1MIVA 1KNZA 2NW8A 3J7Yq 2YINA 3UT5E 1U4QA 4DR1T 2EHOB 4YTMA 4ADZA 5LYJE 2IW5B 5JDFA 5J2TE 4IDZA 5HXHA 4BJMA 2PTFA 3LJCA 4DR5T 4X66T 2CM0A 1YQ3A 2LHRA 4GYSA 4J2CA 4Z8XA 1W0BA 5AQGB 4X62T 2QGSA 4YSYA 3AECA 2YU1A 3C4WA 2ACXA 4OHFA 3M3ZB 3SS1A 4ANJA 4JI0T 4NUVA 2ACZA 2DWGA 4MBQA 1JNZA 2XPKA 1T7SA 2E9XC 2Y48B 4UR9A 3JC6D 5CA1E 5LCYA 5LHGB 4H9RC 2E8IA 4IE0A 1WFDA 1UUSA 4X20E 1W9RA 4YXDA 3ZJ1A 1UCUA 2WY2A 2KLQA 2X0HA 3N9LA 3MXZA 3ZYKA 2V1DB 4DBQA 5KX5E 4G63A 3AE3A 3O4XE 2YDQA 2C0SA 5AQJB 4WBNE 4JLEA 4N78D 1S94A 2OV9A 3QOFA 3SOLA 2YU2A 2FUPA 4X65T 4IDPA 1OEDA 2XQYA 2VB6A 1D0YA 4PW8A 4IL4A 3VKHA 3EUHA 3ABVA 4I50E 1YQ4A 3KV6A 4ILAA 3SFDA 4ASKA 1IBMT 2VQFT 5JRCA 3HKDE 3GA8A 1LVFA 4A98A 5L3FB 2WMOA 3U78A 3UU8A 1G73A 2CRBA 1FEWA 2J1DG 2LRLA 3K8PC 2BG9B 4I0UA 4KBMB 1BR2A 2VURA 5E0OA 4DV5T 1LKXA 4LF7T 2BS4A 4OFZA 2XQ4A 3B5MA 3NKZA 1S35A 2MBGA 3VR9A 3FZFB 2X66A 1XZYA 2Y6XA 4ERRA 3PJAA 3PU3A 3Q5WA 3RPUA 4HKAA 2C5KT 1D1AA 4LMLA 4TWFA 4V1Av 5EK3A 3JAFA 2R6GF 2QA7A 2YOEA 2FBWA 3KFWX 5J0ZA 2CBJA 3SFEA 4HN9A 3RC3A 2BVMA 5ABEA 5LA6E 2W00A 1XMQT 2E2AA 2LSKA 5L4HA 1HG5A 2BS3A 4JUYA 3AB3B 3AVSA 1N34T 5ABFA 1AJ3A 4IREA 1NEKA 3DTOA 2CMRA 4HWIB 4H9NC 3AEDA 3E08A 4AKRB 2CPTA 2LSIA 2M6BA 1QUUA 2VKHA 3C4ZA 2CHNA 4ZZCA 3HKEE 5L3DB 3NZQA 5A1LA 2WCAA 3E0ZA 5IYZE 3W15B 2K48A 1J5WA 2I59A 5ETWA 3UU3A 3C4XA 3LDQB 4EOZB 1KF6A 2J4GA 1X79A 3P4WA 3X1DA 2UUCT 1N32T 1OEDE 2JIWA 2LKHA 3NZPA 3PUZF 3TLSA 5L2LA 2ODUA 5JDLA 2Z6EA 2XSAA 2W63A 3HKBE 2NTYA 4DV7T 5DJQC 3VRBA 3QC9A 3EAMA 3ONJA 3T1HT 2ZM6T 1HG2A 4NXNT 1HCIA 4XZCA 1MNDA 4H9SE 4LMJA 2H3RA 3I9WA 2X67A 3I0QA 3N5LA 1QLBA 3TLVA 3ZMSB 4C90A 4WW0A 1L0VA 4GKJT 2LJLA 4MFRA 2N1GA 2XQ8A 1HX1B 3K3NA 4YSZA 2VL8A 3FZLB 4HWHA 2VL0A 1IZNB 3MKDA 4IHJE 4X1YE 2NW7A 4ZOLE 3FB2A 4EV6A 2E5LT 5F8PA 4JI2T 3I9YA 1Z0PA 2XQ9A 2XQ3A 2BBJA 2XASB 1US7B 5DQWA 5HAXA 4LF8T 4L9IA 4UF0B 5KDMC 1BR4A 4OK0A 1FMVA 4CQIA 3CMLA 4DV3T 5AQFB 2V5DA 1VCSA 3PTRB 4I43B 5JRCB 1Y64B 3UU4A 4B3RT 4AQFA 4EIWA 5FL1A 2LE8A 4JEHB 3P4QA 4HTEA 3AEBA 5FXZA 4IE6A 2MYSA 3LK2B 5AQPB 3IBPA 5AQHB 5FXWA 1I6ZA 3ANWA 3J9X1 5AQSB 3OPCA 2LRKA 2Q9QC 4E7SA 1WYBA 3LK3B 4NUUA 4YJ2E 3IEEA 3DJBA 2UXNB 3MJXA 2XUEA 4GIWA 3ZEFB 5CJ5A 1UX5A 1ZEEA 2VKOA 2X51A 5EK2A 5LNKA 1O3XA 3K3OA 3RX6A 3WAJA 2VKDA 3FBZA 3Q5XA 5AQVB 4LMKA 2BKPA 5HCJA 3PUVF 4Q25A 4COFA 4ILUA 2BZBA 3NWIA 3KDSE 4MALA 4K0UA 3CQCB 3UUXB 4TNWA 3N2GE 5FL0A 5LOVE 2D9DA 3ZCIA 3ZSSA 3A5XA 5FXVA 3JCFA 3C98B 4EEBA 4ZHQE 4DNDA 4O4JE 2CCQA 3UUBA 4LFBT 5HCMA 2P9BA 1D1CA 4NIQA 4TWDA 3EDVA 3P4RA 4IDOA 4IDQA 2CXLA 4OYKA 5FYMA 1J1JA 4TN7B 5HEGA 5L3GB 5EK4A 4KI0F 5JREA 1M7KA 2YK0A 4A97A 4DR7T 2UU9T 4XAXB 1HF8A 4PJJA 3RIFA 3ZKRA 4LF6T 2WWVA 4GK5E 1LVKA 3AXJB 3IA3A 4CN1A 2X9HA 2D0TA 1NAFA 2XAGB 3MA9A 2CHOA 5FY7A 2UUAT 1OXZA 2HN2A 4UVCB 4PK5A 2V6XA 5FY0A 5EZYE 2NW9A 4JI1T 3O1IA 4EGWA 3AE1A 2LM9A 1VRBA 2JJ9A 3CVRA 3FZKB 3ESLA 1YXRA 3KINB 3PJAJ 3PUSA 3UFEA 4KMCA 4KX6A 5DABA 2IDOB 3VHLA 4YTPA 5J2UE 4X1KE 5LB7B 5ABGA 4LFAT 1EZ3A 2CXDA 2RPAA 3ZYLA 3RLFF 2WS3A 3EABA 1Z8UA 3ETUA 4G2AA 4UELA 4AKLA 4UV8B 2DI4A 1W0AA 1MIYA 1HNXT 1QSDA 2KZ7B 1NENA 4JI5T 1KFYA 4AI6A 4PFPA 4O4LE 2LOPA 2DCFA 3N2OA 4YFSA 3R84B 4C91A 4DV0T 1SHZC 2CE7A 4AIUA 5L3EB 5LXTE 1NWMX 3AA7B 1XNQT 2WP9A 1JNRA 4U7IA 2W67A 3G06A 1MNEA 2XQ7A 2V6YA 1FMWA 2I6HA 3CX6B 3GN5A 4I55E 4CXXA 5LHIB 3GN5B 2F4VT 3PUQA 5BR8T 3EI0A 4DO0A 4HWFA 2AE9A 2LSYA 3MK7C 5LBMA 3LBXA 1I94T 2D0UA 4U33A 3ZN0B 2VQET 2BKOA 3SWHA 2PBIA 5H6RB 3VKGA 3PUGA 2JQQA 2UXBT 2X9YA 4ZI3C 4YT0A 5JR9A 1N33T 3AEAA 2WZIA 2YEVC 3CQGB 5LGUB 1E2AA 2N9DA 2KNDA 2UXXB 3UU5A 1KNRA 5LP6E 2BG9C 1UURA 2XAFB 4UVAB 5FMNA 4OX9T 4MHCA 2NR4A 2X68A 4HWCA 4QX8B 4ZS2A 2A72A 2XQ6A 3AE5A 3NVOA 2ZMAA 3RH3A 3ZLIA 3UQ7A 4X1IE 3TLTA 2JQ9A 3BK9A 2IC6A 2A9UA 4KHZF 3ZMVB 2IHR1 1IAPA 1UX4A 2D2SA 2XQAA 2YDRA 3ETVA 2EHOD 3JC6C 3PUWF 2WBLA 4UEMA 4EYUA 3EDUA 1IBKT 3AXJA 4QH5A 2WZHA 2JMHA 4ISSA 4WBOA 2BBHA 5FVLA 4DMVA 2XJ7A 3AAAB 3FXEB 3OTOT 1SE7A 4HE8A 4ILBA 2E5VA 4IL9A 1YKEB 3RGLA 3RYIE 4EZHA 4ZI3D 5HYAA 2H7VC 1XWMA 4E7ZA 1ZV4X 5AQLB 2SPCA 4DR2T 1OWAA 3ZT6A 5FXXA 4HFBA 2KWIB 4WYVA 4ILCA 3N9MA 2WU5A 1UK5A 3A8YC 4NXMT 1T72A 4O8SA 3P8CD 1FJGT 1XDPA 2XTLA 4U72A 3SRZA 4AQFC 5JR9C 3H3MA 5CA0E 3PDYA 5AQKB 3O1JA 5JDNA 3BQIA 2XAQB 4HEAA 4PAGA 3B57A 2V7MA 1ZHCA 2W2UA 4HFDA 4IE7A 4JI3T 2W66A 2JQKA 3OYXA 4L0RA 3RRCA 2Q9QA 5L3CB 3RKOA 3B13A 2ZM8A 2YN6A 2B76A 3CKDA 4YHHT 5LMUT 3AEGA 3KBTA 3K3QC 2H7OA 2K5BB 4H9OC 4NPPA 5AFUL 4JI4T 3RF1A 3PUXF 3P4PA 3CX7B 3ZMTB 2LOSA 2OLTA 2FJEA 1HR0T 1M62A 2X0LB 3QNUA 5FP3A 4P09A 2AXDS 3R6NA 3Q2MA 2X9XA 3P4SA 4EZ4A 4DUYT 2VKJA 2C5IT 3OJAA 4H63H 3ZSTA 4DV4T 1XMOT 3OKQA 2WSSV 3AEEA 4H9QC 1MMNA 4TV9E 3AE2A 4TZ4C 3F31A 5C3JA 5LJNA 1WR0A 3O9XA 1KK7A 4H63V 4UVBB 3RYCE 2JMKA 2V8SV 5TAOA 4AQGA 4JI8T 2W4XA 3PURA 3AA0B 5HEHA 2H88A 2KT9A 3CX8B 4WNKA 2XY8B 5LJMA 2LSGA 3RKGA 4AKIA 4QHOA 3AE9A 4L5GA 2XM2A 3P50A 2X0YA 4KUMB 5F5WA 5HXRA 2PFVA 1UGOA 2LSJA 2WU2A 5AQRB 5LGNB 3JADA 2OA5A 3NRXA 3VR8A 4FJOA 4H9PC 4A56A 4B3MT 2RP4A 3PE0A 2BDEA 3HR0A 2EHOA 4HFEA 1YD8G 2HPJA 5LGTB 4DV2T 4P0BA 4QH1A 3NBXX 3AA6B 2IC9A 3GWHA 4WZXA 2WDRA 2VWAA 2JPFA 3CIRA 4O4HE 5JTGA 2B1EA 2HH7A 4PJMA 5FY1A 4ZZBA 4KHPT 3ZC1A 1U5PA 3ZMZB 1WYCA 3M65A 4PK4A 3VU7H 3HI2A 2CWOA 2W62A
chains in the Genus database with same CATH topology
2F4VT 4LF4T 5BR8T 5LMNT 1IBLT 2UUCT 1N32T 1I94T 2VQET 4JV5T 4K0KT 4DV7T 2UXBT 1HNZT 1N33T 4DUZT 5IWAT 3T1HT 2ZM6T 4B3TT 4NXNT 4OX9T 4GKJT 4B3ST 4DV1T 2UUBT 2E5LT 4LF5T 4JI2T 4LF8T 1IBKT 4GKKT 4DV3T 4AQYT 1HNXT 4KHPT 1J5ET 4DV6T 3OTOT 4DR6T 2UXCT 4DR2T 1HNWT 4DR1T 2HHHT 4X64T 4DR5T 4X66T 4B3RT 4NXMT 4X62T 1FJGT 4JI0T 1N36T 4YHHT 5LMUT 4LF9T 4LFBT 4JI4T 4LFCT 1HR0T 4JI7T 4X65T 4DUYT 3T1YT 4JI6T 4DV4T 1XMOT 1IBMT 2VQFT 4DR7T 2UU9T 4LF6T 4JI8T 2UXDT 4DV5T 4LF7T 2UUAT 4JI1T 4LFAT 4B3MT 4JYAT 1XNRT 4DV2T 4JI5T 1XMQT 1N34T 4DR4T 4DV0T 4YY3T 4JI3T 4DR3T 1XNQT
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F4V T;  4LF4 T;  5BR8 T;  5LMN T;  1IBL T;  2UUC T;  1N32 T;  1I94 T;  2VQE T;  4JV5 T;  4K0K T;  4DV7 T;  2UXB T;  1HNZ T;  1N33 T;  4DUZ T;  5IWA T;  3T1H T;  2ZM6 T;  4B3T T;  4NXN T;  4OX9 T;  4GKJ T;  4B3S T;  4DV1 T;  2UUB T;  2E5L T;  4LF5 T;  4JI2 T;  4LF8 T;  1IBK T;  4GKK T;  4DV3 T;  4AQY T;  1HNX T;  4KHP T;  1J5E T;  4DV6 T;  3OTO T;  4DR6 T;  2UXC T;  4DR2 T;  1HNW T;  4DR1 T;  2HHH T;  4X64 T;  4DR5 T;  4X66 T;  4B3R T;  4NXM T;  4X62 T;  1FJG T;  4JI0 T;  1N36 T;  4YHH T;  5LMU T;  4LF9 T;  4LFB T;  4JI4 T;  4LFC T;  1HR0 T;  4JI7 T;  4X65 T;  4DUY T;  3T1Y T;  4JI6 T;  4DV4 T;  1XMO T;  1IBM T;  2VQF T;  4DR7 T;  2UU9 T;  4LF6 T;  4JI8 T;  2UXD T;  4DV5 T;  4LF7 T;  2UUA T;  4JI1 T;  4LFA T;  4B3M T;  4JYA T;  1XNR T;  4DV2 T;  4JI5 T;  1XMQ T;  1N34 T;  4DR4 T;  4DV0 T;  4YY3 T;  4JI3 T;  4DR3 T;  1XNQ T; 
#chains in the Genus database with same CATH topology
 3NRY A;  2RA1 A;  4PK6 A;  2K9A A;  4DBR A;  3U3I A;  1WRD A;  4LF4 T;  1D1B A;  5CB4 E;  2GK9 A;  4TV8 E;  2BKN A;  4U3C A;  5HXC A;  3UQ4 A;  2LHN A;  2XAH B;  5C2T A;  1MMA A;  1IBL T;  5KMG P;  2N2N A;  5JDQ A;  1KEY A;  3F57 A;  5LHH B;  4IE5 A;  4EED A;  4IST A;  1V9D A;  2FJB A;  2V26 A;  3LSV A;  2XHE B;  3RRW A;  3UU6 A;  2VK9 A;  4LF9 T;  2CBI A;  4K0K T;  3CPZ A;  5HEU A;  3WAK A;  4DUZ T;  3PV0 F;  4JEU B;  2JQH A;  3KBU A;  3N9Q A;  2Y8D A;  3PUA A;  4B3T T;  4QXC B;  5ABH A;  5HXS A;  2ZM2 A;  4EYY R;  3IF8 B;  2HN1 A;  2I0M A;  2LT3 A;  2PJQ A;  2CXF A;  2Q9Q D;  1D0Z A;  3RYH E;  4DV1 T;  1YKH B;  3AE4 A;  4Z90 A;  2CEA A;  3Q5E A;  3KV9 A;  4M1P A;  2V7K A;  3L8R A;  3FXD B;  3AAE B;  1ZP0 A;  2XZE A;  1X9B A;  4GYR A;  3CWZ B;  2WDV A;  3TKL B;  5HWX A;  4DVD A;  2KSR A;  3LG7 A;  3HKC E;  2ODV A;  3KV4 A;  2VAS A;  2KXP B;  3WI3 A;  1G8X A;  2XM1 A;  4HFC A;  2V6Y B;  2BG9 A;  1R8I A;  2WQY A;  5H6Q B;  3UUM A;  3ZT7 A;  3PU8 A;  5LG4 A;  1J5E T;  2WM9 A;  3L39 A;  4DV6 T;  5CGM A;  3RIU A;  4GOU A;  3UUL A;  1W09 A;  2XAJ B;  4DR6 T;  1GQE A;  3F2E A;  4B6X A;  3AEF A;  3UUN A;  3KVB A;  1Y01 A;  1B7T A;  3EHZ A;  5LBQ B;  1OED B;  2FJA A;  3FBL A;  1WR6 A;  4OYJ A;  3H3A A;  1SUM B;  4Z91 A;  2FJD A;  1HNW T;  2E9X A;  1SA0 E;  2DLR A;  2NWB A;  2WAU A;  2YDS A;  3I1A A;  5JH7 E;  4CXY A;  2HHH T;  1FIO A;  4X64 T;  3K1S A;  4O4I E;  2C5J A;  1XDO A;  2IML A;  2ZM0 A;  3DP7 A;  4IIJ E;  4AIS A;  4QH4 A;  3FZH B;  3RQW A;  5AQM B;  5AQO B;  3TLU A;  2Q9Q B;  2JRK A;  3C64 A;  3C51 A;  3AE7 A;  3EVY A;  4CXW A;  3RC8 A;  4MLK A;  1LRZ A;  3N9N A;  4AKH A;  2UUB T;  5L3B B;  4F6R C;  2QVA A;  1WLX A;  2YKS A;  3T8O A;  2QRX A;  2WWU A;  1OED C;  3CK6 A;  1VOM A;  4UXN B;  4O2A E;  4CZZ B;  2LLY A;  3HA4 A;  3V5S A;  5C8Y E;  3ONX A;  3N2K E;  1MMG A;  1N36 T;  4PJL A;  3E22 E;  4JBW F;  5HEO A;  3RI5 A;  1ZKE A;  1HTJ F;  2KWH A;  2ZLY A;  5J1G A;  2V5C A;  3ONL C;  1VCT A;  4IGU A;  3UFG A;  2X9W A;  4QWN B;  3V5U A;  4U2Y A;  4LFC T;  3RIU C;  4HGA A;  1KNP A;  2W0G A;  2XQ5 A;  4HFV A;  3UTK A;  5KXJ A;  4JI7 T;  2MPK A;  2DL1 A;  4TX5 A;  3ZN1 B;  4P0A A;  4EB6 E;  3N9P A;  3T1Y T;  2BG9 E;  3FHN A;  5AQI B;  3QK6 A;  4LF5 T;  4GK0 E;  4JI6 T;  4EXT A;  4QXB B;  2NOX A;  3C50 A;  5HWY A;  4O2B E;  5FVK A;  2KMF A;  2L9Q A;  3MZK B;  1ZOY A;  4ZXL A;  5F3J A;  2UXD T;  3QUJ A;  2DNX A;  1E1H B;  1D0X A;  3AAI A;  3JAE A;  3S4U A;  1MIW A;  5HXE A;  4CI1 B;  1H7C A;  3LK4 2;  2VVN A;  4U31 A;  2IUB A;  4YHJ A;  4KP3 C;  5ADX L;  3Q5D A;  5L47 A;  3AVR A;  2NP9 A;  3AE6 A;  3I0O A;  4JYA T;  3ANW B;  2WB5 A;  5AQU B;  4CN4 A;  4CN6 A;  1XNR T;  4HFI A;  2E9X B;  2V7J A;  4UV9 B;  4YJ3 E;  5LG3 A;  5AQQ B;  3LFM A;  2LEH A;  5FKY A;  3L3P A;  4AXP A;  2M67 A;  5FNV E;  5JR9 B;  2BS2 A;  3H37 A;  2M6I A;  3RHW A;  4BAY B;  1MMD A;  5BMV E;  5HEJ A;  2V7I A;  4HWD A;  3CQX C;  4DR4 T;  2MOZ A;  2QYW A;  4YY3 T;  1T8B A;  1IJ6 A;  3LBX B;  4QKN A;  3ZJ2 A;  2A2F X;  2D5U A;  3KV5 A;  2H89 A;  3VRA A;  4TWH A;  4DR3 T;  1DU2 A;  2A3D A;  4UIG A;  2EHO C;  2CWY A;  2E9X D;  4TNV A;  4UF0 A;  5AQN B;  4CI3 B;  2L3L A;  3RYF E;  3BQK A;  2DHR A;  3ZMU B;  4FI5 A;  5JVD E;  3N9O A;  4ZI7 E;  4PFO A;  5M4Y A;  5LMN T;  3ZPO A;  2K3W A;  3IHR A;  2CA5 A;  4ZI2 D;  1E7P A;  3Q9D A;  5JQG E;  1HS7 A;  5IUX A;  4JV5 T;  3OVU A;  1CUN A;  3QB5 A;  2WMN A;  4HFH A;  1BR0 A;  1HNZ T;  2XSB A;  5JDG A;  4BJN A;  3O1H A;  2CLY B;  2HPL A;  2L8K A;  2J47 A;  5IWA T;  5IHY A;  5CFB A;  4F8H A;  4EAH A;  3QB5 K;  3TLW A;  4XBF B;  1CHU A;  4IDN A;  4CI2 B;  2DWK A;  3A7M A;  2G0U A;  4B3S T;  2V7L A;  2J62 A;  2IIU A;  3AA1 B;  3OYZ A;  3PUY F;  2MAW A;  3ZC0 A;  3L09 A;  5JDH A;  3FZM B;  2KIN B;  2LM2 A;  3KVA A;  4PJN A;  1IJ5 A;  4PNI A;  4U2Z A;  4BA9 A;  4P1N A;  2PG8 A;  3GMI A;  3RIA A;  3MAC A;  1WCR A;  3ZYM A;  1HX8 A;  4TUY E;  4U74 A;  2IAK A;  2MTQ A;  3BQL A;  5GON E;  2VVS A;  4GKK T;  1BR1 A;  1HFA A;  2NTX A;  2W61 A;  3ZCJ A;  4IT4 A;  4QXH B;  4AQY T;  2CLY C;  3OBV E;  1YW0 A;  3P7I A;  4IE4 A;  4DMW A;  4A5X A;  4YTN A;  4ZI2 C;  5JDM A;  2WDQ A;  3D0T A;  4AKG A;  2K24 A;  1T98 A;  2ES0 A;  2BVL A;  2LKG A;  4YLH A;  5ABF B;  4ZEY A;  4YSX A;  4ZS3 A;  4QX7 B;  4DID B;  4I4T E;  5L4E A;  3RQU A;  2UXC T;  3AE8 A;  4X5T A;  4U7Y A;  3HL6 A;  5DQV A;  5AQT B;  3ZT5 A;  1MIV A;  1KNZ A;  2NW8 A;  3J7Y q;  2YIN A;  3UT5 E;  1U4Q A;  4DR1 T;  2EHO B;  4YTM A;  4ADZ A;  5LYJ E;  2IW5 B;  5JDF A;  5J2T E;  4IDZ A;  5HXH A;  4BJM A;  2PTF A;  3LJC A;  4DR5 T;  4X66 T;  2CM0 A;  1YQ3 A;  2LHR A;  4GYS A;  4J2C A;  4Z8X A;  1W0B A;  5AQG B;  4X62 T;  2QGS A;  4YSY A;  3AEC A;  2YU1 A;  3C4W A;  2ACX A;  4OHF A;  3M3Z B;  3SS1 A;  4ANJ A;  4JI0 T;  4NUV A;  2ACZ A;  2DWG A;  4MBQ A;  1JNZ A;  2XPK A;  1T7S A;  2E9X C;  2Y48 B;  4UR9 A;  3JC6 D;  5CA1 E;  5LCY A;  5LHG B;  4H9R C;  2E8I A;  4IE0 A;  1WFD A;  1UUS A;  4X20 E;  1W9R A;  4YXD A;  3ZJ1 A;  1UCU A;  2WY2 A;  2KLQ A;  2X0H A;  3N9L A;  3MXZ A;  3ZYK A;  2V1D B;  4DBQ A;  5KX5 E;  4G63 A;  3AE3 A;  3O4X E;  2YDQ A;  2C0S A;  5AQJ B;  4WBN E;  4JLE A;  4N78 D;  1S94 A;  2OV9 A;  3QOF A;  3SOL A;  2YU2 A;  2FUP A;  4X65 T;  4IDP A;  1OED A;  2XQY A;  2VB6 A;  1D0Y A;  4PW8 A;  4IL4 A;  3VKH A;  3EUH A;  3ABV A;  4I50 E;  1YQ4 A;  3KV6 A;  4ILA A;  3SFD A;  4ASK A;  1IBM T;  2VQF T;  5JRC A;  3HKD E;  3GA8 A;  1LVF A;  4A98 A;  5L3F B;  2WMO A;  3U78 A;  3UU8 A;  1G73 A;  2CRB A;  1FEW A;  2J1D G;  2LRL A;  3K8P C;  2BG9 B;  4I0U A;  4KBM B;  1BR2 A;  2VUR A;  5E0O A;  4DV5 T;  1LKX A;  4LF7 T;  2BS4 A;  4OFZ A;  2XQ4 A;  3B5M A;  3NKZ A;  1S35 A;  2MBG A;  3VR9 A;  3FZF B;  2X66 A;  1XZY A;  2Y6X A;  4ERR A;  3PJA A;  3PU3 A;  3Q5W A;  3RPU A;  4HKA A;  2C5K T;  1D1A A;  4LML A;  4TWF A;  4V1A v;  5EK3 A;  3JAF A;  2R6G F;  2QA7 A;  2YOE A;  2FBW A;  3KFW X;  5J0Z A;  2CBJ A;  3SFE A;  4HN9 A;  3RC3 A;  2BVM A;  5ABE A;  5LA6 E;  2W00 A;  1XMQ T;  2E2A A;  2LSK A;  5L4H A;  1HG5 A;  2BS3 A;  4JUY A;  3AB3 B;  3AVS A;  1N34 T;  5ABF A;  1AJ3 A;  4IRE A;  1NEK A;  3DTO A;  2CMR A;  4HWI B;  4H9N C;  3AED A;  3E08 A;  4AKR B;  2CPT A;  2LSI A;  2M6B A;  1QUU A;  2VKH A;  3C4Z A;  2CHN A;  4ZZC A;  3HKE E;  5L3D B;  3NZQ A;  5A1L A;  2WCA A;  3E0Z A;  5IYZ E;  3W15 B;  2K48 A;  1J5W A;  2I59 A;  5ETW A;  3UU3 A;  3C4X A;  3LDQ B;  4EOZ B;  1KF6 A;  2J4G A;  1X79 A;  3P4W A;  3X1D A;  2UUC T;  1N32 T;  1OED E;  2JIW A;  2LKH A;  3NZP A;  3PUZ F;  3TLS A;  5L2L A;  2ODU A;  5JDL A;  2Z6E A;  2XSA A;  2W63 A;  3HKB E;  2NTY A;  4DV7 T;  5DJQ C;  3VRB A;  3QC9 A;  3EAM A;  3ONJ A;  3T1H T;  2ZM6 T;  1HG2 A;  4NXN T;  1HCI A;  4XZC A;  1MND A;  4H9S E;  4LMJ A;  2H3R A;  3I9W A;  2X67 A;  3I0Q A;  3N5L A;  1QLB A;  3TLV A;  3ZMS B;  4C90 A;  4WW0 A;  1L0V A;  4GKJ T;  2LJL A;  4MFR A;  2N1G A;  2XQ8 A;  1HX1 B;  3K3N A;  4YSZ A;  2VL8 A;  3FZL B;  4HWH A;  2VL0 A;  1IZN B;  3MKD A;  4IHJ E;  4X1Y E;  2NW7 A;  4ZOL E;  3FB2 A;  4EV6 A;  2E5L T;  5F8P A;  4JI2 T;  3I9Y A;  1Z0P A;  2XQ9 A;  2XQ3 A;  2BBJ A;  2XAS B;  1US7 B;  5DQW A;  5HAX A;  4LF8 T;  4L9I A;  4UF0 B;  5KDM C;  1BR4 A;  4OK0 A;  1FMV A;  4CQI A;  3CML A;  4DV3 T;  5AQF B;  2V5D A;  1VCS A;  3PTR B;  4I43 B;  5JRC B;  1Y64 B;  3UU4 A;  4B3R T;  4AQF A;  4EIW A;  5FL1 A;  2LE8 A;  4JEH B;  3P4Q A;  4HTE A;  3AEB A;  5FXZ A;  4IE6 A;  2MYS A;  3LK2 B;  5AQP B;  3IBP A;  5AQH B;  5FXW A;  1I6Z A;  3ANW A;  3J9X 1;  5AQS B;  3OPC A;  2LRK A;  2Q9Q C;  4E7S A;  1WYB A;  3LK3 B;  4NUU A;  4YJ2 E;  3IEE A;  3DJB A;  2UXN B;  3MJX A;  2XUE A;  4GIW A;  3ZEF B;  5CJ5 A;  1UX5 A;  1ZEE A;  2VKO A;  2X51 A;  5EK2 A;  5LNK A;  1O3X A;  3K3O A;  3RX6 A;  3WAJ A;  2VKD A;  3FBZ A;  3Q5X A;  5AQV B;  4LMK A;  2BKP A;  5HCJ A;  3PUV F;  4Q25 A;  4COF A;  4ILU A;  2BZB A;  3NWI A;  3KDS E;  4MAL A;  4K0U A;  3CQC B;  3UUX B;  4TNW A;  3N2G E;  5FL0 A;  5LOV E;  2D9D A;  3ZCI A;  3ZSS A;  3A5X A;  5FXV A;  3JCF A;  3C98 B;  4EEB A;  4ZHQ E;  4DND A;  4O4J E;  2CCQ A;  3UUB A;  4LFB T;  5HCM A;  2P9B A;  1D1C A;  4NIQ A;  4TWD A;  3EDV A;  3P4R A;  4IDO A;  4IDQ A;  2CXL A;  4OYK A;  5FYM A;  1J1J A;  4TN7 B;  5HEG A;  5L3G B;  5EK4 A;  4KI0 F;  5JRE A;  1M7K A;  2YK0 A;  4A97 A;  4DR7 T;  2UU9 T;  4XAX B;  1HF8 A;  4PJJ A;  3RIF A;  3ZKR A;  4LF6 T;  2WWV A;  4GK5 E;  1LVK A;  3AXJ B;  3IA3 A;  4CN1 A;  2X9H A;  2D0T A;  1NAF A;  2XAG B;  3MA9 A;  2CHO A;  5FY7 A;  2UUA T;  1OXZ A;  2HN2 A;  4UVC B;  4PK5 A;  2V6X A;  5FY0 A;  5EZY E;  2NW9 A;  4JI1 T;  3O1I A;  4EGW A;  3AE1 A;  2LM9 A;  1VRB A;  2JJ9 A;  3CVR A;  3FZK B;  3ESL A;  1YXR A;  3KIN B;  3PJA J;  3PUS A;  3UFE A;  4KMC A;  4KX6 A;  5DAB A;  2IDO B;  3VHL A;  4YTP A;  5J2U E;  4X1K E;  5LB7 B;  5ABG A;  4LFA T;  1EZ3 A;  2CXD A;  2RPA A;  3ZYL A;  3RLF F;  2WS3 A;  3EAB A;  1Z8U A;  3ETU A;  4G2A A;  4UEL A;  4AKL A;  4UV8 B;  2DI4 A;  1W0A A;  1MIY A;  1HNX T;  1QSD A;  2KZ7 B;  1NEN A;  4JI5 T;  1KFY A;  4AI6 A;  4PFP A;  4O4L E;  2LOP A;  2DCF A;  3N2O A;  4YFS A;  3R84 B;  4C91 A;  4DV0 T;  1SHZ C;  2CE7 A;  4AIU A;  5L3E B;  5LXT E;  1NWM X;  3AA7 B;  1XNQ T;  2WP9 A;  1JNR A;  4U7I A;  2W67 A;  3G06 A;  1MNE A;  2XQ7 A;  2V6Y A;  1FMW A;  2I6H A;  3CX6 B;  3GN5 A;  4I55 E;  4CXX A;  5LHI B;  3GN5 B;  2F4V T;  3PUQ A;  5BR8 T;  3EI0 A;  4DO0 A;  4HWF A;  2AE9 A;  2LSY A;  3MK7 C;  5LBM A;  3LBX A;  1I94 T;  2D0U A;  4U33 A;  3ZN0 B;  2VQE T;  2BKO A;  3SWH A;  2PBI A;  5H6R B;  3VKG A;  3PUG A;  2JQQ A;  2UXB T;  2X9Y A;  4ZI3 C;  4YT0 A;  5JR9 A;  1N33 T;  3AEA A;  2WZI A;  2YEV C;  3CQG B;  5LGU B;  1E2A A;  2N9D A;  2KND A;  2UXX B;  3UU5 A;  1KNR A;  5LP6 E;  2BG9 C;  1UUR A;  2XAF B;  4UVA B;  5FMN A;  4OX9 T;  4MHC A;  2NR4 A;  2X68 A;  4HWC A;  4QX8 B;  4ZS2 A;  2A72 A;  2XQ6 A;  3AE5 A;  3NVO A;  2ZMA A;  3RH3 A;  3ZLI A;  3UQ7 A;  4X1I E;  3TLT A;  2JQ9 A;  3BK9 A;  2IC6 A;  2A9U A;  4KHZ F;  3ZMV B;  2IHR 1;  1IAP A;  1UX4 A;  2D2S A;  2XQA A;  2YDR A;  3ETV A;  2EHO D;  3JC6 C;  3PUW F;  2WBL A;  4UEM A;  4EYU A;  3EDU A;  1IBK T;  3AXJ A;  4QH5 A;  2WZH A;  2JMH A;  4ISS A;  4WBO A;  2BBH A;  5FVL A;  4DMV A;  2XJ7 A;  3AAA B;  3FXE B;  3OTO T;  1SE7 A;  4HE8 A;  4ILB A;  2E5V A;  4IL9 A;  1YKE B;  3RGL A;  3RYI E;  4EZH A;  4ZI3 D;  5HYA A;  2H7V C;  1XWM A;  4E7Z A;  1ZV4 X;  5AQL B;  2SPC A;  4DR2 T;  1OWA A;  3ZT6 A;  5FXX A;  4HFB A;  2KWI B;  4WYV A;  4ILC A;  3N9M A;  2WU5 A;  1UK5 A;  3A8Y C;  4NXM T;  1T72 A;  4O8S A;  3P8C D;  1FJG T;  1XDP A;  2XTL A;  4U72 A;  3SRZ A;  4AQF C;  5JR9 C;  3H3M A;  5CA0 E;  3PDY A;  5AQK B;  3O1J A;  5JDN A;  3BQI A;  2XAQ B;  4HEA A;  4PAG A;  3B57 A;  2V7M A;  1ZHC A;  2W2U A;  4HFD A;  4IE7 A;  4JI3 T;  2W66 A;  2JQK A;  3OYX A;  4L0R A;  3RRC A;  2Q9Q A;  5L3C B;  3RKO A;  3B13 A;  2ZM8 A;  2YN6 A;  2B76 A;  3CKD A;  4YHH T;  5LMU T;  3AEG A;  3KBT A;  3K3Q C;  2H7O A;  2K5B B;  4H9O C;  4NPP A;  5AFU L;  4JI4 T;  3RF1 A;  3PUX F;  3P4P A;  3CX7 B;  3ZMT B;  2LOS A;  2OLT A;  2FJE A;  1HR0 T;  1M62 A;  2X0L B;  3QNU A;  5FP3 A;  4P09 A;  2AXD S;  3R6N A;  3Q2M A;  2X9X A;  3P4S A;  4EZ4 A;  4DUY T;  2VKJ A;  2C5I T;  3OJA A;  4H63 H;  3ZST A;  4DV4 T;  1XMO T;  3OKQ A;  2WSS V;  3AEE A;  4H9Q C;  1MMN A;  4TV9 E;  3AE2 A;  4TZ4 C;  3F31 A;  5C3J A;  5LJN A;  1WR0 A;  3O9X A;  1KK7 A;  4H63 V;  4UVB B;  3RYC E;  2JMK A;  2V8S V;  5TAO A;  4AQG A;  4JI8 T;  2W4X A;  3PUR A;  3AA0 B;  5HEH A;  2H88 A;  2KT9 A;  3CX8 B;  4WNK A;  2XY8 B;  5LJM A;  2LSG A;  3RKG A;  4AKI A;  4QHO A;  3AE9 A;  4L5G A;  2XM2 A;  3P50 A;  2X0Y A;  4KUM B;  5F5W A;  5HXR A;  2PFV A;  1UGO A;  2LSJ A;  2WU2 A;  5AQR B;  5LGN B;  3JAD A;  2OA5 A;  3NRX A;  3VR8 A;  4FJO A;  4H9P C;  4A56 A;  4B3M T;  2RP4 A;  3PE0 A;  2BDE A;  3HR0 A;  2EHO A;  4HFE A;  1YD8 G;  2HPJ A;  5LGT B;  4DV2 T;  4P0B A;  4QH1 A;  3NBX X;  3AA6 B;  2IC9 A;  3GWH A;  4WZX A;  2WDR A;  2VWA A;  2JPF A;  3CIR A;  4O4H E;  5JTG A;  2B1E A;  2HH7 A;  4PJM A;  5FY1 A;  4ZZB A;  4KHP T;  3ZC1 A;  1U5P A;  3ZMZ B;  1WYC A;  3M65 A;  4PK4 A;  3VU7 H;  3HI2 A;  2CWO A;  2W62 A; 
#chains in the Genus database with same CATH homology
 2F4V T;  4LF4 T;  5BR8 T;  5LMN T;  1IBL T;  2UUC T;  1N32 T;  1I94 T;  2VQE T;  4JV5 T;  4K0K T;  4DV7 T;  2UXB T;  1HNZ T;  1N33 T;  4DUZ T;  5IWA T;  3T1H T;  2ZM6 T;  4B3T T;  4NXN T;  4OX9 T;  4GKJ T;  4B3S T;  4DV1 T;  2UUB T;  2E5L T;  4LF5 T;  4JI2 T;  4LF8 T;  1IBK T;  4GKK T;  4DV3 T;  4AQY T;  1HNX T;  4KHP T;  1J5E T;  4DV6 T;  3OTO T;  4DR6 T;  2UXC T;  4DR2 T;  1HNW T;  4DR1 T;  2HHH T;  4X64 T;  4DR5 T;  4X66 T;  4B3R T;  4NXM T;  4X62 T;  1FJG T;  4JI0 T;  1N36 T;  4YHH T;  5LMU T;  4LF9 T;  4LFB T;  4JI4 T;  4LFC T;  1HR0 T;  4JI7 T;  4X65 T;  4DUY T;  3T1Y T;  4JI6 T;  4DV4 T;  1XMO T;  1IBM T;  2VQF T;  4DR7 T;  2UU9 T;  4LF6 T;  4JI8 T;  2UXD T;  4DV5 T;  4LF7 T;  2UUA T;  4JI1 T;  4LFA T;  4B3M T;  4JYA T;  1XNR T;  4DV2 T;  4JI5 T;  1XMQ T;  1N34 T;  4DR4 T;  4DV0 T;  4YY3 T;  4JI3 T;  4DR3 T;  1XNQ T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...