2VQET

Modified uridines with c5-methylene substituents at the first position of the trna anticodon stabilize u-g wobble pairing during decoding
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAVQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RRNA
publication title Modified Uridines with C5-Methylene Substituents at the First Position of the tRNA Anticodon Stabilize U.G Wobble Pairing During Decoding.
pubmed doi rcsb
molecule tags Ribosome
total genus 34
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2008-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 2vqeT00
1N36T 4JI7T 4DR2T 4X62T 4GKJT 4B3ST 4LFBT 4DR3T 1N32T 1J5ET 3T1YT 4JI5T 4YHHT 2UUCT 4NXNT 3T1HT 1FJGT 4LF4T 2UUAT 4DR4T 4NXMT 2UXDT 3OTOT 4DV5T 2VQET 4DR1T 1HR0T 4DUZT 4JI6T 4DV0T 2UXBT 4DV2T 1I94T 1HNWT 4LF5T 4JI3T 4JI0T 1IBKT 1IBLT 4B3MT 4DR5T 4JI8T 1N34T 4LF7T 1HNXT 4LF8T 1N33T 4DV1T 1XMOT 4JV5T 4LFCT 2ZM6T 4JI4T 4X65T 4B3RT 2F4VT 4JYAT 4YY3T 4X66T 4DV6T 4JI1T 2UUBT 4B3TT 4DV4T 2HHHT 4OX9T 4DUYT 1XNRT 4DR7T 4DV3T 4X64T 4DV7T 2VQFT 4DR6T 5BR8T 1IBMT 5LMNT 4LF6T 4AQYT 5LMUT 4GKKT 4JI2T 2UU9T 1HNZT 4LFAT 4K0KT 1XMQT 1XNQT 4LF9T 2E5LT 4KHPT 5IWAT 2UXCT
chains in the Genus database with same CATH superfamily
3PUQA 1WR0A 2C0SA 5L3FB 5DQWA 1ZEEA 4G2AA 3ZMZB 4B3ST 3WAKA 4JBWF 4DBQA 4OHFA 2BVLA 4UV8B 4AQGA 2WBLA 2E9XA 5LP6E 2WMNA 5JDGA 3T1HT 3FZKB 3KVAA 5HCJA 3Q5EA 3HR0A 3CQXC 5AQOB 4WYVA 2PTFA 1FMVA 4IDOA 3PU8A 3H3MA 2HPLA 5H6RB 2CWOA 4ZEYA 4DR5T 5LJMA 5IYZE 4KMCA 3UFGA 2H89A 4LF8T 4UVCB 2XQ7A 1W0AA 1T72A 2PJQA 3CQCB 4UF0A 5FXVA 3LBXA 5CB4E 2LM2A 3KV6A 3MJXA 2WWVA 5DQVA 4QWNB 4PJLA 2J1DG 1MMGA 4DV3T 1X79A 1T8BA 4I43B 1WCRA 1CHUA 3KBTA 2HN2A 2B1EA 2NW7A 3UU6A 4IT4A 4AI6A 2XUEA 3UT5E 2HH7A 4JI7T 2XQ4A 3EHZA 2MYSA 3VR8A 4IDQA 4ANJA 4ILBA 2VL0A 5LOVE 3E22E 4O8SA 1NEKA 3BQLA 5FL0A 2EHOD 4QXCB 2H88A 3CKDA 1FJGT 2QYWA 5FL1A 3RYHE 4OYKA 1W9RA 4DR1T 2EHOA 2FUPA 3SWHA 2CLYB 3UUNA 2UXBT 2X0YA 3QB5K 1D1BA 4YHJA 4CN4A 3CIRA 4ZI3C 2D2SA 5C8YE 4EZHA 3I0QA 4EEDA 5HXSA 3RIFA 2JQHA 5HEOA 4CXWA 2WWUA 3PE0A 5ABFB 4DV6T 2AXDS 4OFZA 2CHNA 4CN1A 1SE7A 2NTXA 4MFRA 2IHR1 4IDPA 5J2UE 3PTRB 4CI2B 3BK9A 1U5PA 4CN6A 1YKHB 2IC6A 3ABVA 3L3PA 3GMIA 2Q9QD 4WBOA 3UU4A 1XNQT 5JTGA 2WP9A 3LK2B 4GIWA 1MIVA 2JQQA 5AQIB 3DJBA 3NZPA 5JR9C 4DR2T 2KMFA 2H7VC 2C5JA 3PUYF 4EIWA 4O4HE 4YT0A 3E0ZA 3EVYA 1E7PA 3L39A 1QUUA 3CMLA 5F3JA 1WLXA 3P50A 2SPCA 2W62A 4GYRA 4H9NC 4TV8E 2N9DA 2LRLA 4PW8A 4EB6E 3EDVA 2H3RA 3PUXF 1YKEB 2X66A 2W66A 3AE4A 4AKGA 3QNUA 4JI8T 3KV5A 4YJ2E 4CZZB 3AECA 4LFCT 2WM9A 3P7IA 4X65T 3TLUA 2V6XA 3ZC1A 4XZCA 2JJ9A 1OWAA 4TWHA 3HKBE 4CI1B 2LSGA 4HWHA 5IHYA 2K3WA 2HHHT 1XNRT 4HFHA 4TZ4C 4DMWA 5JDNA 4AKIA 3ONJA 4YTPA 3AA1B 4U3CA 4IE6A 2KZ7B 4EYYR 2X9XA 3NBXX 3KINB 3UU5A 3AEDA 3N9MA 3ZCJA 3PU3A 3PUWF 5LA6E 3LJCA 3C4WA 5ABFA 2LSKA 4H9QC 2YKSA 3AE1A 2W00A 3FXEB 4DBRA 4BAYB 4HFBA 3MKDA 3AAIA 3PJAJ 2MPKA 1LKXA 4NXNT 4JUYA 2UUAT 1LVFA 1OEDC 4C91A 3PV0F 1MMAA 3PUSA 1E1HB 4PAGA 3FZMB 2V1DB 5DABA 2XASB 4HWDA 4LMKA 4YJ3E 3AA6B 3HA4A 1KEYA 1HNWT 2ODVA 2WDVA 3GN5B 2WS3A 1XMOT 3UUXB 4ZS3A 3AAEB 5JQGE 3AEAA 3QUJA 1T7SA 1AJ3A 4Z91A 2QVAA 2XM1A 2JMHA 4P0BA 5FY0A 4BJMA 4KI0F 1W09A 2DI4A 2LOSA 2WDRA 3N9NA 5FY7A 3R84B 5E0OA 3VKHA 2LLYA 1VCTA 2RP4A 1J1JA 3OKQA 2LHNA 5BMVE 2NP9A 3RHWA 4IREA 4CXYA 4QXBB 3WAJA 3RYCE 3FZLB 2LSYA 3AA0B 1Y01A 4O4IE 3OYXA 4MBQA 3RIAA 3U78A 2LEHA 4L5GA 5HEHA 1UCUA 3ZJ1A 1J5ET 3HL6A 1UX5A 2UUCT 3RC3A 1GQEA 3EDUA 3B57A 3FBZA 5J2TE 3ONXA 2V8SV 4AQFA 4DUZT 2XQ8A 4IE0A 4TWDA 1I6ZA 4EGWA 2DNXA 3PDYA 4L9IA 1H7CA 4A56A 3AVSA 1SA0E 3VR9A 4UF0B 2CMRA 3V5SA 4ILUA 3LBXB 3O4XE 4EZ4A 5LG3A 2VVNA 1N33T 4IE4A 2ZM6T 5C3JA 3J9X1 2XJ7A 3KVBA 4X66T 2I59A 4CXXA 3Q5WA 2BG9A 3RYIE 2K9AA 4B3TT 2XQ9A 4DUYT 4DR7T 3ZT7A 1U4QA 3MZKB 1YD8G 2CCQA 4PK5A 1IZNB 3RKOA 4IIJE 4N78D 2WAUA 1KF6A 3N9LA 3RGLA 4HGAA 4HWIB 4Z90A 2YN6A 1JNZA 4MLKA 2UXCT 3Q9DA 5GONE 3K3OA 2E2AA 4X62T 5M4YA 1W0BA 5JVDE 1N32T 3IA3A 4H63V 2EHOB 2IUBA 4QH5A 4AXPA 2L8KA 5ABEA 4HE8A 2BBHA 2WB5A 3TLSA 4GOUA 4DV5T 1LVKA 1WRDA 4E7ZA 4ZOLE 5CJ5A 3Q5XA 1XZYA 2VKOA 1KFYA 3IBPA 4P1NA 4NUVA 4ZXLA 3OPCA 3HI2A 4ADZA 3HKEE 3IF8B 2LKHA 1D0ZA 4O4JE 4ZI2C 2CXFA 2CWYA 1XWMA 3PUGA 2LSIA 2CM0A 4TNVA 2XQYA 5IUXA 2VWAA 2I0MA 4ZI3D 5FVLA 4LMLA 4EAHA 2YU1A 3NZQA 3FZHB 2D5UA 4WBNE 2XQ6A 1KK7A 5ETWA 4AKLA 3RRCA 2Q9QB 4WW0A 5LMUT 3JC6C 2M6IA 4HTEA 3I0OA 5HWXA 4AKRB 3K3NA 2LT3A 3DP7A 3ZMUB 1L0VA 1JNRA 2JQ9A 3N2GE 4KHPT 3UUBA 3MA9A 1S94A 5LNKA 3ZMTB 4LFBT 4IGUA 2WY2A 2CRBA 5FKYA 2V7IA 1WFDA 3NWIA 4O2AE 3X1DA 4L0RA 1G8XA 1KNPA 2VQET 4YSZA 5ADXL 2ZMAA 5LJNA 4DV2T 4QX8B 3PURA 4IE7A 3RH3A 3P4RA 2W63A 1FMWA 4B3MT 2XPKA 2IW5B 2ODUA 5LB7B 2E9XC 2VASA 3UU3A 5HWYA 3AE6A 4PNIA 1MNDA 1IJ5A 3JCFA 4UVAB 4JV5T 4H9RC 4JYAT 2YOEA 1FEWA 3I9WA 5EZYE 3OVUA 4HWFA 3EABA 5LGNB 5AQFB 3ZMVB 3NKZA 2VQFT 4U7YA 2XAJB 3H37A 5TAOA 5HEUA 4QHOA 4U7IA 4LF6T 2OLTA 3AE7A 4EEBA 5FYMA 3AB3B 4TN7B 3HKCE 5AQGB 3VRBA 2MAWA 1UURA 2DHRA 4KBMB 4GKJT 2XM2A 1YXRA 4PJNA 2VVSA 4EXTA 2VB6A 3LSVA 3ZT5A 3JAEA 2VKDA 2ZM2A 3AXJA 3RPUA 4OYJA 3AE2A 3M3ZB 4K0UA 3P8CD 2Q9QA 3UQ4A 2L9QA 5JH7E 4M1PA 3LG7A 4O4LE 4PFPA 4P09A 3C4ZA 1DU2A 3B13A 4JI3T 4IDZA 4UIGA 3ZYKA 3C4XA 2BG9E 3K3QC 2J4GA 4PK4A 5AQPB 1J5WA 2J62A 3N9OA 4ZHQE 2N2NA 4H9PC 2FJBA 1HX1B 2EHOC 2ES0A 1M7KA 5L3BB 5FMNA 3P4WA 1MMNA 3OYZA 2J47A 5HXHA 2W2UA 3AE8A 3BQKA 1B7TA 4PK6A 1NAFA 2NOXA 2QRXA 2YDQA 3A5XA 1BR0A 5HEJA 4JEUB 4ZI7E 4X1YE 4YLHA 3FHNA 2CHOA 2C5IT 4AKHA 4H9SE 3RYFE 4JLEA 3EI0A 3CX8B 3SOLA 2D9DA 3L8RA 3QOFA 5L3GB 2MTQA 2LOPA 5AQSB 3SRZA 4LF4T 4TUYE 2DWKA 2VKJA 1D0XA 2WMOA 1YQ3A 2LRKA 4MALA 3JADA 4HKAA 5EK4A 5AQQB 3A7MA 3NVOA 1X9BA 5FXZA 1BR2A 4YSYA 1XDPA 2BG9B 3RIUA 3RLFF 2XQAA 4HFIA 4QH4A 4JI1T 4A5XA 5LGUB 4B6XA 2X9WA 3DTOA 3VHLA 1WR6A 1BR4A 2JPFA 2DCFA 4XBFB 2P9BA 4HEAA 3ETVA 4YTMA 5AQMB 3M65A 2V7KA 4UVBB 2YINA 2WSSV 4JI2T 4LFAT 3Q5DA 4AIUA 5ABHA 1V9DA 4YXDA 2PG8A 2BKNA 3C51A 4TWFA 3KFWX 4HFVA 4ILCA 2V26A 2L3LA 3ZJ2A 2CLYC 3RQWA 3ZC0A 5H6QB 1HF8A 4MHCA 5L4EA 3U3IA 2M67A 3AE9A 5LBQB 2YDSA 5AQJB 1YQ4A 3O1HA 2WCAA 1G73A 2WDQA 2N1GA 2NWBA 4DV0T 2IDOB 4UV9B 3AA7B 5FXXA 4GK0E 2WU2A 2RA1A 3CK6A 1Z8UA 2PBIA 3UU8A 3O9XA 2X0LB 2ZM8A 2JMKA 4IL9A 4UR9A 2OV9A 4NIQA 4OK0A 5DJQC 3ZLIA 5EK3A 3VU7H 4UXNB 3ZSTA 4FI5A 4TNWA 1Y64B 3ZSSA 4OX9T 5AQKB 3ZN0B 3KV4A 3RI5A 3LFMA 3P4QA 4K0KT 4ZI2D 2XHEB 4HWCA 1HFAA 5A1LA 3CWZB 3ZN1B 3SFDA 4ISSA 4NUUA 3ZMSB 3N2KE 5L2LA 3EAMA 4I4TE 5AQVB 2NW9A 4KHZF 3KDSE 5FY1A 4JI5T 1M62A 2JQKA 3JC6D 3TKLB 1E2AA 3LK42 2V5DA 3L09A 2H7OA 2BS4A 3H3AA 2V5CA 4COFA 2XAFB 4YTNA 4A98A 3RQUA 3RC8A 4DIDB 1UX4A 2AE9A 2V7MA 3FB2A 5LHIB 4LF5T 3ZYLA 1IBKT 3OBVE 1OEDE 3T8OA 3N5LA 4KX6A 3ZCIA 1UGOA 4AQFC 3AEBA 2XAGB 4UELA 5L4HA 5L3DB 2LJLA 3TLVA 1ZHCA 2LHRA 3CX7B 2FBWA 1MIWA 4DV4T 3N9QA 3PUAA 2YEVC 2JIWA 4X64T 4DV7T 4DR6T 1ZOYA 2VK9A 2HN1A 2QA7A 1QSDA 2E9XD 3AEGA 2YK0A 3O1JA 3EUHA 4IL4A 4I50E 5AFUL 2D0TA 1VRBA 2FJDA 2XQ5A 2DWGA 1NENA 2BG9C 3RX6A 3PJAA 5F5WA 2V7LA 3AXJB 3C98B 3PUZF 4TV9E 2LE8A 3ESLA 2NR4A 4PJMA 4I55E 1QLBA 3G06A 3T1YT 2BKPA 4YHHT 3MXZA 3FXDB 3RRWA 2KWIB 4NXMT 5HYAA 4F8HA 3I9YA 5FVKA 3GWHA 3NRXA 5LBMA 4ERRA 5F8PA 2HPJA 1BR1A 3R6NA 3IHRA 5LG4A 5CGMA 1HS7A 1ZV4X 2KINB 1S35A 3AVRA 5LCYA 2KLQA 1OEDB 3SFEA 2A2FX 5AQTB 2IIUA 1ZP0A 2UUBT 2XY8B 2MOZA 4DNDA 4QH1A 5JDFA 1OXZA 5J0ZA 4YFSA 5JR9A 4HFDA 3LK3B 4QX7B 5HXCA 5HCMA 2LKGA 4C90A 2UU9T 2ACXA 3Q2MA 4GK5E 5LXTE 4ZS2A 2B76A 2A72A 5HEGA 2DLRA 3ANWB 2FJEA 5JRCA 4GYSA 4ILAA 4PJJA 1N36T 1D1CA 4Q25A 5FNVE 2BS3A 3A8YC 3C64A 2XSBA 4I0UA 2W61A 3OTOT 2E8IA 3O1IA 4TX5A 2I6HA 2YU2A 5KMGP 4JI6T 4U31A 2BS2A 4G63A 4HFEA 4P0AA 4EOZB 4U2YA 4EV6A 3LDQB 2PFVA 3F31A 4JI4T 1UUSA 2F4VT 1UK5A 2BKOA 1US7B 5LHHB 4DMVA 2BDEA 4ZZCA 5BR8T 1WYBA 3ZPOA 1XMQT 1HTJF 1Z0PA 2IMLA 2WZHA 4F6RC 1OEDA 1T98A 2KWHA 2V6YB 2JRKA 4BA9A 3IEEA 2X9HA 3GA8A 3D0TA 3AE5A 5CA0E 4EYUA 5AQLB 5L3CB 4DR3T 5CA1E 4DVDA 4YSXA 3ZT6A 4X1IE 1WYCA 2CXDA 4DR4T 4X5TA 2UXNB 4U33A 2BZBA 5CFBA 1IAPA 4AISA 1HR0T 2NW8A 5AQNB 2XSAA 1SHZC 4O2BE 5JREA 2ZM0A 1I94T 3ANWA 3F57A 5HXEA 1D1AA 3K1SA 1N34T 2X68A 1LRZA 1HNXT 2WZIA 2OA5A 2V7JA 2Y8DA 2Q9QC 3TLWA 2ACZA 2CE7A 2C5KT 4YY3T 3UULA 3UFEA 4U74A 3QB5A 3E08A 2QGSA 3K8PC 5FXWA 5LYJE 4KUMB 2E5VA 2X51A 2K24A 1KNZA 3CPZA 2CBIA 1HG5A 2XTLA 3TLTA 4UEMA 3ETUA 2K5BB 4ASKA 3ZKRA 4GKKT 1HG2A 2Y6XA 1HNZT 4ZZBA 5LGTB 2XQ3A 5HAXA 3P4SA 4IE5A 4LF9T 2KSRA 1SUMB 3SS1A 2XAHB 2A3DA 5IWAT 1MNEA 5KX5E 3PUVF 4J2CA 3HKDE 2KT9A 4FJOA 2BBJA 1HCIA 5J1GA 3FBLA 3WI3A 5JDMA 4LMJA 1XDOA 3QK6A 3AEFA 1HX8A 2CEAA 5AQRB 3RF1A 2XAQB 2Z6EA 3S4UA 5L47A 1VCSA 3OJAA 5AQUB 2V6YA 3F2EA 4IDNA 1ZKEA 2X9YA 4V1Av 4JEHB 2NTYA 1D0YA 5KXJA 4HFCA 1IJ6A 4LF7T 1CUNA 4CI3B 2WU5A 3CQGB 4B3RT 2CA5A 3V5UA 3ZYMA 4BJNA 2CXLA 3FZFB 1EZ3A 2E9XB 3J7Yq 3RIUC 1IBMT 3AE3A 2ZLYA 3KBUA 3JAFA 5ABGA 4PFOA 1KNRA 2VL8A 2VURA 4WZXA 2R6GF 2WQYA 4XAXB 5AQHB 2W67A 2X0HA 1MIYA 5HXRA 4ISTA 1R8IA 4CQIA 3C50A 2KXPB 2XZEA 4WNKA 5LHGB 3KV9A 3B5MA 4QKNA 3I1AA 5JDQA 4U72A 1NWMX 2FJAA 3ONLC 2UXDT 3BQIA 3VKGA 2IC9A 4H9OC 4X20E 1VOMA 5JDHA 2DL1A 2W0GA 3UTKA 3CX6B 4H63H 2IAKA 2VKHA 3MACA 2KNDA 2G0UA 1MMDA 5KDMC 2UXXB 3CVRA 3NRYA 4JI0T 1IBLT 2M6BA 5JDLA 5C2TA 2YDRA 2BVMA 4DV1T 3AEEA 5JR9B 2LM9A 5FP3A 4IHJE 3N9PA 3VRAA 5EK2A 3GN5A 4Z8XA 4E7SA 2MBGA 3UUMA 4NPPA 4QXHB 2CPTA 3AAAB 2LSJA 5LMNT 5JRCB 4A97A 2K48A 1FIOA 4AQYT 3P4PA 4U2ZA 2D0UA 3UQ7A 2GK9A 4KP3C 3MK7C 3RKGA 3QC9A 4DO0A 2Y48B 2X67A 1O3XA 4HN9A 2RPAA 4X1KE 2CBJA 2E5LT 3W15B 3ZEFB 5L3EB 2W4XA 2A9UA 3N2OA 1YW0A
chains in the Genus database with same CATH topology
1N36T 4JI7T 4DR2T 4X62T 4GKJT 4B3ST 4LFBT 4DR3T 1N32T 1J5ET 3T1YT 4JI5T 4YHHT 2UUCT 4NXNT 3T1HT 1FJGT 4LF4T 2UUAT 4DR4T 4NXMT 2UXDT 3OTOT 4DV5T 2VQET 4DR1T 1HR0T 4DUZT 4JI6T 4DV0T 2UXBT 4DV2T 1I94T 1HNWT 4LF5T 4JI3T 4JI0T 1IBKT 1IBLT 4B3MT 4DR5T 4JI8T 1N34T 4LF7T 1HNXT 4LF8T 1N33T 4DV1T 1XMOT 4JV5T 4LFCT 2ZM6T 4JI4T 4X65T 4B3RT 2F4VT 4JYAT 4YY3T 4X66T 4DV6T 4JI1T 2UUBT 4B3TT 4DV4T 2HHHT 4OX9T 4DUYT 1XNRT 4DR7T 4DV3T 4X64T 4DV7T 2VQFT 4DR6T 5BR8T 1IBMT 5LMNT 4LF6T 4AQYT 5LMUT 4GKKT 4JI2T 2UU9T 1HNZT 4LFAT 4K0KT 1XMQT 1XNQT 4LF9T 2E5LT 4KHPT 5IWAT 2UXCT
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N36 T;  4JI7 T;  4DR2 T;  4X62 T;  4GKJ T;  4B3S T;  4LFB T;  4DR3 T;  1N32 T;  1J5E T;  3T1Y T;  4JI5 T;  4YHH T;  2UUC T;  4NXN T;  3T1H T;  1FJG T;  4LF4 T;  2UUA T;  4DR4 T;  4NXM T;  2UXD T;  3OTO T;  4DV5 T;  2VQE T;  4DR1 T;  1HR0 T;  4DUZ T;  4JI6 T;  4DV0 T;  2UXB T;  4DV2 T;  1I94 T;  1HNW T;  4LF5 T;  4JI3 T;  4JI0 T;  1IBK T;  1IBL T;  4B3M T;  4DR5 T;  4JI8 T;  1N34 T;  4LF7 T;  1HNX T;  4LF8 T;  1N33 T;  4DV1 T;  1XMO T;  4JV5 T;  4LFC T;  2ZM6 T;  4JI4 T;  4X65 T;  4B3R T;  2F4V T;  4JYA T;  4YY3 T;  4X66 T;  4DV6 T;  4JI1 T;  2UUB T;  4B3T T;  4DV4 T;  2HHH T;  4OX9 T;  4DUY T;  1XNR T;  4DR7 T;  4DV3 T;  4X64 T;  4DV7 T;  2VQF T;  4DR6 T;  5BR8 T;  1IBM T;  5LMN T;  4LF6 T;  4AQY T;  5LMU T;  4GKK T;  4JI2 T;  2UU9 T;  1HNZ T;  4LFA T;  4K0K T;  1XMQ T;  1XNQ T;  4LF9 T;  2E5L T;  4KHP T;  5IWA T;  2UXC T; 
#chains in the Genus database with same CATH topology
 3PUQ A;  1WR0 A;  2C0S A;  5L3F B;  5DQW A;  1ZEE A;  4G2A A;  3ZMZ B;  4B3S T;  3WAK A;  4JBW F;  4DBQ A;  4OHF A;  2BVL A;  4UV8 B;  4AQG A;  2WBL A;  2E9X A;  5LP6 E;  2WMN A;  5JDG A;  3T1H T;  3FZK B;  3KVA A;  5HCJ A;  3Q5E A;  3HR0 A;  3CQX C;  5AQO B;  4WYV A;  2PTF A;  1FMV A;  4IDO A;  3PU8 A;  3H3M A;  2HPL A;  5H6R B;  2CWO A;  4ZEY A;  4DR5 T;  5LJM A;  5IYZ E;  4KMC A;  3UFG A;  2H89 A;  4LF8 T;  4UVC B;  2XQ7 A;  1W0A A;  1T72 A;  2PJQ A;  3CQC B;  4UF0 A;  5FXV A;  3LBX A;  5CB4 E;  2LM2 A;  3KV6 A;  3MJX A;  2WWV A;  5DQV A;  4QWN B;  4PJL A;  2J1D G;  1MMG A;  4DV3 T;  1X79 A;  1T8B A;  4I43 B;  1WCR A;  1CHU A;  3KBT A;  2HN2 A;  2B1E A;  2NW7 A;  3UU6 A;  4IT4 A;  4AI6 A;  2XUE A;  3UT5 E;  2HH7 A;  4JI7 T;  2XQ4 A;  3EHZ A;  2MYS A;  3VR8 A;  4IDQ A;  4ANJ A;  4ILB A;  2VL0 A;  5LOV E;  3E22 E;  4O8S A;  1NEK A;  3BQL A;  5FL0 A;  2EHO D;  4QXC B;  2H88 A;  3CKD A;  1FJG T;  2QYW A;  5FL1 A;  3RYH E;  4OYK A;  1W9R A;  4DR1 T;  2EHO A;  2FUP A;  3SWH A;  2CLY B;  3UUN A;  2UXB T;  2X0Y A;  3QB5 K;  1D1B A;  4YHJ A;  4CN4 A;  3CIR A;  4ZI3 C;  2D2S A;  5C8Y E;  4EZH A;  3I0Q A;  4EED A;  5HXS A;  3RIF A;  2JQH A;  5HEO A;  4CXW A;  2WWU A;  3PE0 A;  5ABF B;  4DV6 T;  2AXD S;  4OFZ A;  2CHN A;  4CN1 A;  1SE7 A;  2NTX A;  4MFR A;  2IHR 1;  4IDP A;  5J2U E;  3PTR B;  4CI2 B;  3BK9 A;  1U5P A;  4CN6 A;  1YKH B;  2IC6 A;  3ABV A;  3L3P A;  3GMI A;  2Q9Q D;  4WBO A;  3UU4 A;  1XNQ T;  5JTG A;  2WP9 A;  3LK2 B;  4GIW A;  1MIV A;  2JQQ A;  5AQI B;  3DJB A;  3NZP A;  5JR9 C;  4DR2 T;  2KMF A;  2H7V C;  2C5J A;  3PUY F;  4EIW A;  4O4H E;  4YT0 A;  3E0Z A;  3EVY A;  1E7P A;  3L39 A;  1QUU A;  3CML A;  5F3J A;  1WLX A;  3P50 A;  2SPC A;  2W62 A;  4GYR A;  4H9N C;  4TV8 E;  2N9D A;  2LRL A;  4PW8 A;  4EB6 E;  3EDV A;  2H3R A;  3PUX F;  1YKE B;  2X66 A;  2W66 A;  3AE4 A;  4AKG A;  3QNU A;  4JI8 T;  3KV5 A;  4YJ2 E;  4CZZ B;  3AEC A;  4LFC T;  2WM9 A;  3P7I A;  4X65 T;  3TLU A;  2V6X A;  3ZC1 A;  4XZC A;  2JJ9 A;  1OWA A;  4TWH A;  3HKB E;  4CI1 B;  2LSG A;  4HWH A;  5IHY A;  2K3W A;  2HHH T;  1XNR T;  4HFH A;  4TZ4 C;  4DMW A;  5JDN A;  4AKI A;  3ONJ A;  4YTP A;  3AA1 B;  4U3C A;  4IE6 A;  2KZ7 B;  4EYY R;  2X9X A;  3NBX X;  3KIN B;  3UU5 A;  3AED A;  3N9M A;  3ZCJ A;  3PU3 A;  3PUW F;  5LA6 E;  3LJC A;  3C4W A;  5ABF A;  2LSK A;  4H9Q C;  2YKS A;  3AE1 A;  2W00 A;  3FXE B;  4DBR A;  4BAY B;  4HFB A;  3MKD A;  3AAI A;  3PJA J;  2MPK A;  1LKX A;  4NXN T;  4JUY A;  2UUA T;  1LVF A;  1OED C;  4C91 A;  3PV0 F;  1MMA A;  3PUS A;  1E1H B;  4PAG A;  3FZM B;  2V1D B;  5DAB A;  2XAS B;  4HWD A;  4LMK A;  4YJ3 E;  3AA6 B;  3HA4 A;  1KEY A;  1HNW T;  2ODV A;  2WDV A;  3GN5 B;  2WS3 A;  1XMO T;  3UUX B;  4ZS3 A;  3AAE B;  5JQG E;  3AEA A;  3QUJ A;  1T7S A;  1AJ3 A;  4Z91 A;  2QVA A;  2XM1 A;  2JMH A;  4P0B A;  5FY0 A;  4BJM A;  4KI0 F;  1W09 A;  2DI4 A;  2LOS A;  2WDR A;  3N9N A;  5FY7 A;  3R84 B;  5E0O A;  3VKH A;  2LLY A;  1VCT A;  2RP4 A;  1J1J A;  3OKQ A;  2LHN A;  5BMV E;  2NP9 A;  3RHW A;  4IRE A;  4CXY A;  4QXB B;  3WAJ A;  3RYC E;  3FZL B;  2LSY A;  3AA0 B;  1Y01 A;  4O4I E;  3OYX A;  4MBQ A;  3RIA A;  3U78 A;  2LEH A;  4L5G A;  5HEH A;  1UCU A;  3ZJ1 A;  1J5E T;  3HL6 A;  1UX5 A;  2UUC T;  3RC3 A;  1GQE A;  3EDU A;  3B57 A;  3FBZ A;  5J2T E;  3ONX A;  2V8S V;  4AQF A;  4DUZ T;  2XQ8 A;  4IE0 A;  4TWD A;  1I6Z A;  4EGW A;  2DNX A;  3PDY A;  4L9I A;  1H7C A;  4A56 A;  3AVS A;  1SA0 E;  3VR9 A;  4UF0 B;  2CMR A;  3V5S A;  4ILU A;  3LBX B;  3O4X E;  4EZ4 A;  5LG3 A;  2VVN A;  1N33 T;  4IE4 A;  2ZM6 T;  5C3J A;  3J9X 1;  2XJ7 A;  3KVB A;  4X66 T;  2I59 A;  4CXX A;  3Q5W A;  2BG9 A;  3RYI E;  2K9A A;  4B3T T;  2XQ9 A;  4DUY T;  4DR7 T;  3ZT7 A;  1U4Q A;  3MZK B;  1YD8 G;  2CCQ A;  4PK5 A;  1IZN B;  3RKO A;  4IIJ E;  4N78 D;  2WAU A;  1KF6 A;  3N9L A;  3RGL A;  4HGA A;  4HWI B;  4Z90 A;  2YN6 A;  1JNZ A;  4MLK A;  2UXC T;  3Q9D A;  5GON E;  3K3O A;  2E2A A;  4X62 T;  5M4Y A;  1W0B A;  5JVD E;  1N32 T;  3IA3 A;  4H63 V;  2EHO B;  2IUB A;  4QH5 A;  4AXP A;  2L8K A;  5ABE A;  4HE8 A;  2BBH A;  2WB5 A;  3TLS A;  4GOU A;  4DV5 T;  1LVK A;  1WRD A;  4E7Z A;  4ZOL E;  5CJ5 A;  3Q5X A;  1XZY A;  2VKO A;  1KFY A;  3IBP A;  4P1N A;  4NUV A;  4ZXL A;  3OPC A;  3HI2 A;  4ADZ A;  3HKE E;  3IF8 B;  2LKH A;  1D0Z A;  4O4J E;  4ZI2 C;  2CXF A;  2CWY A;  1XWM A;  3PUG A;  2LSI A;  2CM0 A;  4TNV A;  2XQY A;  5IUX A;  2VWA A;  2I0M A;  4ZI3 D;  5FVL A;  4LML A;  4EAH A;  2YU1 A;  3NZQ A;  3FZH B;  2D5U A;  4WBN E;  2XQ6 A;  1KK7 A;  5ETW A;  4AKL A;  3RRC A;  2Q9Q B;  4WW0 A;  5LMU T;  3JC6 C;  2M6I A;  4HTE A;  3I0O A;  5HWX A;  4AKR B;  3K3N A;  2LT3 A;  3DP7 A;  3ZMU B;  1L0V A;  1JNR A;  2JQ9 A;  3N2G E;  4KHP T;  3UUB A;  3MA9 A;  1S94 A;  5LNK A;  3ZMT B;  4LFB T;  4IGU A;  2WY2 A;  2CRB A;  5FKY A;  2V7I A;  1WFD A;  3NWI A;  4O2A E;  3X1D A;  4L0R A;  1G8X A;  1KNP A;  2VQE T;  4YSZ A;  5ADX L;  2ZMA A;  5LJN A;  4DV2 T;  4QX8 B;  3PUR A;  4IE7 A;  3RH3 A;  3P4R A;  2W63 A;  1FMW A;  4B3M T;  2XPK A;  2IW5 B;  2ODU A;  5LB7 B;  2E9X C;  2VAS A;  3UU3 A;  5HWY A;  3AE6 A;  4PNI A;  1MND A;  1IJ5 A;  3JCF A;  4UVA B;  4JV5 T;  4H9R C;  4JYA T;  2YOE A;  1FEW A;  3I9W A;  5EZY E;  3OVU A;  4HWF A;  3EAB A;  5LGN B;  5AQF B;  3ZMV B;  3NKZ A;  2VQF T;  4U7Y A;  2XAJ B;  3H37 A;  5TAO A;  5HEU A;  4QHO A;  4U7I A;  4LF6 T;  2OLT A;  3AE7 A;  4EEB A;  5FYM A;  3AB3 B;  4TN7 B;  3HKC E;  5AQG B;  3VRB A;  2MAW A;  1UUR A;  2DHR A;  4KBM B;  4GKJ T;  2XM2 A;  1YXR A;  4PJN A;  2VVS A;  4EXT A;  2VB6 A;  3LSV A;  3ZT5 A;  3JAE A;  2VKD A;  2ZM2 A;  3AXJ A;  3RPU A;  4OYJ A;  3AE2 A;  3M3Z B;  4K0U A;  3P8C D;  2Q9Q A;  3UQ4 A;  2L9Q A;  5JH7 E;  4M1P A;  3LG7 A;  4O4L E;  4PFP A;  4P09 A;  3C4Z A;  1DU2 A;  3B13 A;  4JI3 T;  4IDZ A;  4UIG A;  3ZYK A;  3C4X A;  2BG9 E;  3K3Q C;  2J4G A;  4PK4 A;  5AQP B;  1J5W A;  2J62 A;  3N9O A;  4ZHQ E;  2N2N A;  4H9P C;  2FJB A;  1HX1 B;  2EHO C;  2ES0 A;  1M7K A;  5L3B B;  5FMN A;  3P4W A;  1MMN A;  3OYZ A;  2J47 A;  5HXH A;  2W2U A;  3AE8 A;  3BQK A;  1B7T A;  4PK6 A;  1NAF A;  2NOX A;  2QRX A;  2YDQ A;  3A5X A;  1BR0 A;  5HEJ A;  4JEU B;  4ZI7 E;  4X1Y E;  4YLH A;  3FHN A;  2CHO A;  2C5I T;  4AKH A;  4H9S E;  3RYF E;  4JLE A;  3EI0 A;  3CX8 B;  3SOL A;  2D9D A;  3L8R A;  3QOF A;  5L3G B;  2MTQ A;  2LOP A;  5AQS B;  3SRZ A;  4LF4 T;  4TUY E;  2DWK A;  2VKJ A;  1D0X A;  2WMO A;  1YQ3 A;  2LRK A;  4MAL A;  3JAD A;  4HKA A;  5EK4 A;  5AQQ B;  3A7M A;  3NVO A;  1X9B A;  5FXZ A;  1BR2 A;  4YSY A;  1XDP A;  2BG9 B;  3RIU A;  3RLF F;  2XQA A;  4HFI A;  4QH4 A;  4JI1 T;  4A5X A;  5LGU B;  4B6X A;  2X9W A;  3DTO A;  3VHL A;  1WR6 A;  1BR4 A;  2JPF A;  2DCF A;  4XBF B;  2P9B A;  4HEA A;  3ETV A;  4YTM A;  5AQM B;  3M65 A;  2V7K A;  4UVB B;  2YIN A;  2WSS V;  4JI2 T;  4LFA T;  3Q5D A;  4AIU A;  5ABH A;  1V9D A;  4YXD A;  2PG8 A;  2BKN A;  3C51 A;  4TWF A;  3KFW X;  4HFV A;  4ILC A;  2V26 A;  2L3L A;  3ZJ2 A;  2CLY C;  3RQW A;  3ZC0 A;  5H6Q B;  1HF8 A;  4MHC A;  5L4E A;  3U3I A;  2M67 A;  3AE9 A;  5LBQ B;  2YDS A;  5AQJ B;  1YQ4 A;  3O1H A;  2WCA A;  1G73 A;  2WDQ A;  2N1G A;  2NWB A;  4DV0 T;  2IDO B;  4UV9 B;  3AA7 B;  5FXX A;  4GK0 E;  2WU2 A;  2RA1 A;  3CK6 A;  1Z8U A;  2PBI A;  3UU8 A;  3O9X A;  2X0L B;  2ZM8 A;  2JMK A;  4IL9 A;  4UR9 A;  2OV9 A;  4NIQ A;  4OK0 A;  5DJQ C;  3ZLI A;  5EK3 A;  3VU7 H;  4UXN B;  3ZST A;  4FI5 A;  4TNW A;  1Y64 B;  3ZSS A;  4OX9 T;  5AQK B;  3ZN0 B;  3KV4 A;  3RI5 A;  3LFM A;  3P4Q A;  4K0K T;  4ZI2 D;  2XHE B;  4HWC A;  1HFA A;  5A1L A;  3CWZ B;  3ZN1 B;  3SFD A;  4ISS A;  4NUU A;  3ZMS B;  3N2K E;  5L2L A;  3EAM A;  4I4T E;  5AQV B;  2NW9 A;  4KHZ F;  3KDS E;  5FY1 A;  4JI5 T;  1M62 A;  2JQK A;  3JC6 D;  3TKL B;  1E2A A;  3LK4 2;  2V5D A;  3L09 A;  2H7O A;  2BS4 A;  3H3A A;  2V5C A;  4COF A;  2XAF B;  4YTN A;  4A98 A;  3RQU A;  3RC8 A;  4DID B;  1UX4 A;  2AE9 A;  2V7M A;  3FB2 A;  5LHI B;  4LF5 T;  3ZYL A;  1IBK T;  3OBV E;  1OED E;  3T8O A;  3N5L A;  4KX6 A;  3ZCI A;  1UGO A;  4AQF C;  3AEB A;  2XAG B;  4UEL A;  5L4H A;  5L3D B;  2LJL A;  3TLV A;  1ZHC A;  2LHR A;  3CX7 B;  2FBW A;  1MIW A;  4DV4 T;  3N9Q A;  3PUA A;  2YEV C;  2JIW A;  4X64 T;  4DV7 T;  4DR6 T;  1ZOY A;  2VK9 A;  2HN1 A;  2QA7 A;  1QSD A;  2E9X D;  3AEG A;  2YK0 A;  3O1J A;  3EUH A;  4IL4 A;  4I50 E;  5AFU L;  2D0T A;  1VRB A;  2FJD A;  2XQ5 A;  2DWG A;  1NEN A;  2BG9 C;  3RX6 A;  3PJA A;  5F5W A;  2V7L A;  3AXJ B;  3C98 B;  3PUZ F;  4TV9 E;  2LE8 A;  3ESL A;  2NR4 A;  4PJM A;  4I55 E;  1QLB A;  3G06 A;  3T1Y T;  2BKP A;  4YHH T;  3MXZ A;  3FXD B;  3RRW A;  2KWI B;  4NXM T;  5HYA A;  4F8H A;  3I9Y A;  5FVK A;  3GWH A;  3NRX A;  5LBM A;  4ERR A;  5F8P A;  2HPJ A;  1BR1 A;  3R6N A;  3IHR A;  5LG4 A;  5CGM A;  1HS7 A;  1ZV4 X;  2KIN B;  1S35 A;  3AVR A;  5LCY A;  2KLQ A;  1OED B;  3SFE A;  2A2F X;  5AQT B;  2IIU A;  1ZP0 A;  2UUB T;  2XY8 B;  2MOZ A;  4DND A;  4QH1 A;  5JDF A;  1OXZ A;  5J0Z A;  4YFS A;  5JR9 A;  4HFD A;  3LK3 B;  4QX7 B;  5HXC A;  5HCM A;  2LKG A;  4C90 A;  2UU9 T;  2ACX A;  3Q2M A;  4GK5 E;  5LXT E;  4ZS2 A;  2B76 A;  2A72 A;  5HEG A;  2DLR A;  3ANW B;  2FJE A;  5JRC A;  4GYS A;  4ILA A;  4PJJ A;  1N36 T;  1D1C A;  4Q25 A;  5FNV E;  2BS3 A;  3A8Y C;  3C64 A;  2XSB A;  4I0U A;  2W61 A;  3OTO T;  2E8I A;  3O1I A;  4TX5 A;  2I6H A;  2YU2 A;  5KMG P;  4JI6 T;  4U31 A;  2BS2 A;  4G63 A;  4HFE A;  4P0A A;  4EOZ B;  4U2Y A;  4EV6 A;  3LDQ B;  2PFV A;  3F31 A;  4JI4 T;  1UUS A;  2F4V T;  1UK5 A;  2BKO A;  1US7 B;  5LHH B;  4DMV A;  2BDE A;  4ZZC A;  5BR8 T;  1WYB A;  3ZPO A;  1XMQ T;  1HTJ F;  1Z0P A;  2IML A;  2WZH A;  4F6R C;  1OED A;  1T98 A;  2KWH A;  2V6Y B;  2JRK A;  4BA9 A;  3IEE A;  2X9H A;  3GA8 A;  3D0T A;  3AE5 A;  5CA0 E;  4EYU A;  5AQL B;  5L3C B;  4DR3 T;  5CA1 E;  4DVD A;  4YSX A;  3ZT6 A;  4X1I E;  1WYC A;  2CXD A;  4DR4 T;  4X5T A;  2UXN B;  4U33 A;  2BZB A;  5CFB A;  1IAP A;  4AIS A;  1HR0 T;  2NW8 A;  5AQN B;  2XSA A;  1SHZ C;  4O2B E;  5JRE A;  2ZM0 A;  1I94 T;  3ANW A;  3F57 A;  5HXE A;  1D1A A;  3K1S A;  1N34 T;  2X68 A;  1LRZ A;  1HNX T;  2WZI A;  2OA5 A;  2V7J A;  2Y8D A;  2Q9Q C;  3TLW A;  2ACZ A;  2CE7 A;  2C5K T;  4YY3 T;  3UUL A;  3UFE A;  4U74 A;  3QB5 A;  3E08 A;  2QGS A;  3K8P C;  5FXW A;  5LYJ E;  4KUM B;  2E5V A;  2X51 A;  2K24 A;  1KNZ A;  3CPZ A;  2CBI A;  1HG5 A;  2XTL A;  3TLT A;  4UEM A;  3ETU A;  2K5B B;  4ASK A;  3ZKR A;  4GKK T;  1HG2 A;  2Y6X A;  1HNZ T;  4ZZB A;  5LGT B;  2XQ3 A;  5HAX A;  3P4S A;  4IE5 A;  4LF9 T;  2KSR A;  1SUM B;  3SS1 A;  2XAH B;  2A3D A;  5IWA T;  1MNE A;  5KX5 E;  3PUV F;  4J2C A;  3HKD E;  2KT9 A;  4FJO A;  2BBJ A;  1HCI A;  5J1G A;  3FBL A;  3WI3 A;  5JDM A;  4LMJ A;  1XDO A;  3QK6 A;  3AEF A;  1HX8 A;  2CEA A;  5AQR B;  3RF1 A;  2XAQ B;  2Z6E A;  3S4U A;  5L47 A;  1VCS A;  3OJA A;  5AQU B;  2V6Y A;  3F2E A;  4IDN A;  1ZKE A;  2X9Y A;  4V1A v;  4JEH B;  2NTY A;  1D0Y A;  5KXJ A;  4HFC A;  1IJ6 A;  4LF7 T;  1CUN A;  4CI3 B;  2WU5 A;  3CQG B;  4B3R T;  2CA5 A;  3V5U A;  3ZYM A;  4BJN A;  2CXL A;  3FZF B;  1EZ3 A;  2E9X B;  3J7Y q;  3RIU C;  1IBM T;  3AE3 A;  2ZLY A;  3KBU A;  3JAF A;  5ABG A;  4PFO A;  1KNR A;  2VL8 A;  2VUR A;  4WZX A;  2R6G F;  2WQY A;  4XAX B;  5AQH B;  2W67 A;  2X0H A;  1MIY A;  5HXR A;  4IST A;  1R8I A;  4CQI A;  3C50 A;  2KXP B;  2XZE A;  4WNK A;  5LHG B;  3KV9 A;  3B5M A;  4QKN A;  3I1A A;  5JDQ A;  4U72 A;  1NWM X;  2FJA A;  3ONL C;  2UXD T;  3BQI A;  3VKG A;  2IC9 A;  4H9O C;  4X20 E;  1VOM A;  5JDH A;  2DL1 A;  2W0G A;  3UTK A;  3CX6 B;  4H63 H;  2IAK A;  2VKH A;  3MAC A;  2KND A;  2G0U A;  1MMD A;  5KDM C;  2UXX B;  3CVR A;  3NRY A;  4JI0 T;  1IBL T;  2M6B A;  5JDL A;  5C2T A;  2YDR A;  2BVM A;  4DV1 T;  3AEE A;  5JR9 B;  2LM9 A;  5FP3 A;  4IHJ E;  3N9P A;  3VRA A;  5EK2 A;  3GN5 A;  4Z8X A;  4E7S A;  2MBG A;  3UUM A;  4NPP A;  4QXH B;  2CPT A;  3AAA B;  2LSJ A;  5LMN T;  5JRC B;  4A97 A;  2K48 A;  1FIO A;  4AQY T;  3P4P A;  4U2Z A;  2D0U A;  3UQ7 A;  2GK9 A;  4KP3 C;  3MK7 C;  3RKG A;  3QC9 A;  4DO0 A;  2Y48 B;  2X67 A;  1O3X A;  4HN9 A;  2RPA A;  4X1K E;  2CBJ A;  2E5L T;  3W15 B;  3ZEF B;  5L3E B;  2W4X A;  2A9U A;  3N2O A;  1YW0 A; 
#chains in the Genus database with same CATH homology
 1N36 T;  4JI7 T;  4DR2 T;  4X62 T;  4GKJ T;  4B3S T;  4LFB T;  4DR3 T;  1N32 T;  1J5E T;  3T1Y T;  4JI5 T;  4YHH T;  2UUC T;  4NXN T;  3T1H T;  1FJG T;  4LF4 T;  2UUA T;  4DR4 T;  4NXM T;  2UXD T;  3OTO T;  4DV5 T;  2VQE T;  4DR1 T;  1HR0 T;  4DUZ T;  4JI6 T;  4DV0 T;  2UXB T;  4DV2 T;  1I94 T;  1HNW T;  4LF5 T;  4JI3 T;  4JI0 T;  1IBK T;  1IBL T;  4B3M T;  4DR5 T;  4JI8 T;  1N34 T;  4LF7 T;  1HNX T;  4LF8 T;  1N33 T;  4DV1 T;  1XMO T;  4JV5 T;  4LFC T;  2ZM6 T;  4JI4 T;  4X65 T;  4B3R T;  2F4V T;  4JYA T;  4YY3 T;  4X66 T;  4DV6 T;  4JI1 T;  2UUB T;  4B3T T;  4DV4 T;  2HHH T;  4OX9 T;  4DUY T;  1XNR T;  4DR7 T;  4DV3 T;  4X64 T;  4DV7 T;  2VQF T;  4DR6 T;  5BR8 T;  1IBM T;  5LMN T;  4LF6 T;  4AQY T;  5LMU T;  4GKK T;  4JI2 T;  2UU9 T;  1HNZ T;  4LFA T;  4K0K T;  1XMQ T;  1XNQ T;  4LF9 T;  2E5L T;  4KHP T;  5IWA T;  2UXC T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...