2VQET

Modified uridines with c5-methylene substituents at the first position of the trna anticodon stabilize u-g wobble pairing during decoding
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAVQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S RRNA
publication title Modified Uridines with C5-Methylene Substituents at the First Position of the tRNA Anticodon Stabilize U.G Wobble Pairing During Decoding.
pubmed doi rcsb
total genus 34
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2008-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 2vqeT00
4DV1T 4JI3T 4JYAT 4AQYT 4X66T 1N34T 5LMNT 5IWAT 2UUAT 4X62T 1J5ET 4DR5T 1I94T 4JI4T 2VQFT 4JI8T 4YY3T 1XNQT 4DR7T 1HNWT 1N32T 2UXDT 1FJGT 4DV4T 1HR0T 4LFAT 4DR1T 5BR8T 4JI0T 3T1HT 2VQET 4KHPT 1IBLT 4LF5T 4OX9T 2UXBT 4YHHT 4DUZT 4LF7T 4DUYT 1IBMT 2HHHT 4NXMT 4X65T 1HNZT 3T1YT 1IBKT 4LF4T 4B3ST 4DV0T 4JI7T 4DR2T 1N36T 4LF6T 4DR6T 4DV5T 1XMOT 2UXCT 4JI1T 1N33T 4NXNT 4JI5T 4LFCT 4DV7T 2ZM6T 4LF9T 4GKKT 4JI6T 4LF8T 4B3RT 4GKJT 4X64T 4K0KT 4DR3T 4DR4T 1XMQT 1HNXT 1XNRT 4LFBT 4B3TT 2UU9T 2UUCT 4DV2T 2UUBT 4JI2T 2E5LT 5LMUT 4JV5T 2F4VT 4DV3T 4B3MT 3OTOT 4DV6T
chains in the Genus database with same CATH superfamily
3PUXF 5J2UE 1LVKA 3L09A 4U74A 5HEHA 1FEWA 2WZHA 5L4EA 4CXXA 3PTRB 5IWAT 2NOXA 4HFCA 4MBQA 3KBUA 2BKNA 2LLYA 1OEDE 4HE8A 4M1PA 2L3LA 2UXXB 2WS3A 4ILAA 4HFVA 3RGLA 3BQLA 5FXZA 3G06A 1ZEEA 3PUVF 3PDYA 3JAFA 3OBVE 2OV9A 4AI6A 4ZI2D 3UUXB 1D1BA 3LK3B 2LT3A 1BR4A 4G63A 3RHWA 3RYCE 4LF4T 4O2BE 5FXVA 3FZLB 2V7MA 3PU8A 2X66A 2NWBA 3CX6B 1N36T 5LP6E 1UGOA 4E7SA 2KXPB 2WQYA 2OA5A 4U31A 4PW8A 3HR0A 1YW0A 4EYUA 2HN2A 3GWHA 3OYXA 3VR8A 3U3IA 3P4QA 2WSSV 5HYAA 4LMKA 2V7LA 4NUUA 4O8SA 3Q5EA 2B76A 1T7SA 2YN6A 5JVDE 3FZFB 2BVLA 1SE7A 2BKPA 5EK4A 4XBFB 2BG9B 4DV6T 3W15B 4ANJA 2D5UA 4WNKA 1E7PA 4WBNE 3ZT6A 4WW0A 4X1KE 5LMNT 4QXHB 2VVNA 3B57A 3CPZA 5L3DB 1KK7A 4IE4A 3CQCB 4IDPA 4IE0A 5JTGA 5EZYE 2XAFB 4KHZF 2IUBA 1MMGA 2LKGA 4YTPA 2IDOB 4HN9A 2CWYA 4EV6A 4X20E 2MTQA 4E7ZA 4KHPT 1X9BA 2KLQA 2FJBA 3ZYMA 2MYSA 2RPAA 4CI2B 1SA0E 4DVDA 1IBMT 4IE5A 3N9QA 3E22E 5AQKB 4IT4A 3CKDA 3T1YT 5CGMA 3HKEE 4C90A 2VKDA 5LYJE 3U78A 3L39A 4ILUA 3VKGA 2MPKA 4I4TE 4JI6T 3C4ZA 2J4GA 3UUMA 3O1HA 1XMQT 1YQ4A 1HTJF 2XAHB 4QH1A 2J47A 3LFMA 4CN1A 1WRDA 2NP9A 2M67A 1D0YA 3P50A 2ES0A 3R84B 3WAJA 3AAIA 3Q5DA 2YOEA 3PU3A 3AA7B 1D0ZA 2CBJA 5BMVE 5JH7E 5AQSB 4UXNB 4TV8E 4X62T 2H7OA 2KINB 3RIAA 2DLRA 4CN4A 2XSAA 1VRBA 3CVRA 4EIWA 4KMCA 2AXDS 2LSIA 4L9IA 3KBTA 2HN1A 3RLFF 4BJMA 3UT5E 4HFDA 1LVFA 4ZZBA 2A3DA 2BG9E 3SOLA 4GYRA 4YSXA 3K3QC 1IBKT 3NRXA 5L3GB 4QKNA 2MBGA 4ZS3A 4KP3C 4EYYR 4OYKA 3AAAB 3QNUA 3EI0A 4EOZB 4B3RT 5EK3A 3RKGA 4X64T 2SPCA 2CE7A 4F6RC 2JMKA 2JQQA 5AQPB 1HNXT 2X9XA 3AE8A 4UELA 3UQ7A 5AQUB 4O2AE 5J0ZA 2UUCT 4YJ3E 5HCMA 3LK2B 2E9XC 5AQJB 1SHZC 3RQWA 5CA1E 4JUYA 1DU2A 3JCFA 5AFUL 1S35A 3QOFA 2XJ7A 2LSKA 4UVBB 1J5ET 3H3AA 2NW8A 1UK5A 5JDFA 4KX6A 2CHNA 3SWHA 3C64A 4O4JE 3FZMB 2I6HA 5ABEA 3LBXA 2HPLA 3IBPA 4HGAA 5DABA 5HXHA 2X9HA 1WYCA 2K5BB 3CWZB 1HG5A 4LF5T 3E0ZA 3RF1A 4YJ2E 4DUZT 4TWDA 2LKHA 3AEBA 3OVUA 2KSRA 2W0GA 2CLYC 3E08A 4A98A 3AVRA 3CIRA 4AXPA 2D0UA 3ANWA 3LJCA 3NZPA 3ZC1A 5ABGA 4Z8XA 3TLTA 4CXWA 3RIUC 4GKKT 4LF8T 2IIUA 2WU2A 4GKJT 5F3JA 3HKCE 4EAHA 3AEGA 4DR3T 3UUBA 4C91A 3HI2A 3UFEA 2DL1A 2JJ9A 3PUQA 2JMHA 2WWUA 3PE0A 3KV4A 4YT0A 2LHRA 4DV2T 2Y48B 4A56A 3ESLA 2YKSA 4H9OC 5L2LA 4PFOA 2J1DG 3QC9A 2JPFA 4AISA 3UTKA 2KWIB 1YKHB 2W66A 3SRZA 4JI8T 4TNWA 2VVSA 1YXRA 4PJLA 5IHYA 1HNWT 5AQRB 1YD8G 1YKEB 4ZZCA 4HTEA 3X1DA 3UU8A 3QK6A 2X9WA 3J9X1 2W63A 4HEAA 4A97A 3EVYA 1V9DA 4DUYT 3ZMZB 3FXDB 2PTFA 2DI4A 2YDRA 2CRBA 5LHIB 4DV0T 2VWAA 2WWVA 4DR2T 3ZCIA 2NTYA 4IREA 3ZC0A 4IHJE 4L5GA 4FI5A 3KDSE 5L3EB 5LJMA 4GK0E 4QHOA 4NXNT 4CZZB 3PUWF 3RYIE 3AE9A 3WI3A 5HEOA 5AQTB 1M7KA 1IZNB 2JQHA 1OEDA 2YDQA 2H88A 3LG7A 4EXTA 3ZEFB 4L0RA 5JR9B 4DMWA 3HKBE 2CBIA 3PUAA 1IJ6A 3N2KE 3EAMA 4JI2T 5IUXA 3MK7C 4ILBA 2VL8A 2IC9A 3CQXC 1M62A 3ZMTB 3ZSSA 5LA6E 4KI0F 4ZHQE 1HG2A 5JDHA 2QYWA 5HXSA 4CQIA 2QGSA 2WB5A 3GN5A 4YLHA 2ODVA 4YY3T 1LKXA 1XWMA 4EZHA 3Q5XA 1G8XA 1G73A 3MKDA 2Q9QC 2IAKA 1HCIA 2CLYB 4NXMT 4QXCB 4BAYB 2K9AA 3KFWX 2KMFA 3BQKA 1CHUA 1UCUA 4HWFA 3RYHE 2KNDA 2JRKA 3AXJB 3IF8B 3N9PA 2ODUA 2EHOA 3CK6A 3HKDE 3VRBA 3VU7H 1ZHCA 4K0KT 2ACXA 1XDOA 2VKOA 3FHNA 4COFA 2WDQA 3ONLC 4EZ4A 1W0AA 1FMWA 2LSYA 2LE8A 1GQEA 2IMLA 4H9RC 2Y6XA 2AE9A 4MALA 4QH4A 2C5KT 2FJEA 5FP3A 4UR9A 3O1IA 5JDNA 2I0MA 3D0TA 3Q9DA 3FXEB 4P0AA 2V7IA 2XM2A 1U5PA 1N32T 2V5DA 5CJ5A 4DBQA 1EZ3A 2E2AA 4NIQA 3P4SA 4I55E 2VQET 4P0BA 2DNXA 2XQ8A 5LG3A 3MZKB 5FVLA 2HHHT 2CPTA 2YU1A 3ZT5A 1MMDA 2PG8A 4UEMA 5JDLA 1WR0A 3AXJA 2Q9QD 2KWHA 4YXDA 4U7IA 1XZYA 3KV9A 4JI5T 3UULA 2B1EA 2ZMAA 3BQIA 4NPPA 2V5CA 4TV9E 1T8BA 2W00A 1BR1A 4WBOA 3ZMSB 5JDMA 4PFPA 5FL1A 3LK42 4OFZA 4JV5T 2V1DB 5LHGB 1HS7A 3JAEA 2BBJA 4P09A 1Y01A 3I0OA 2KT9A 1NENA 4DNDA 5LGNB 4IIJE 2M6IA 4AKLA 3AE7A 3AA1B 4DR5T 2BG9A 4QX8B 2LEHA 5FVKA 2ACZA 4PJMA 2WY2A 5AQVB 1CUNA 2XAJB 5LOVE 5HXRA 4V1Av 2Q9QB 4ISSA 3N9NA 4AKIA 1OEDC 1KNPA 1MIWA 4LF7T 5L3FB 1SUMB 2HPJA 2D2SA 4LMJA 2WBLA 3AECA 3OPCA 2XQYA 3NRYA 3FBZA 1T72A 3AA0B 2VL0A 5IYZE 4LF9T 3ZYLA 2HH7A 4TWFA 2FJDA 3K1SA 4U2ZA 2XY8B 3TLWA 4F8HA 4AQFA 2XAGB 2C5IT 5ETWA 4EB6E 2CMRA 4AQGA 2W2UA 4HWDA 3AEAA 2UU9T 5C3JA 5FL0A 3OKQA 3ZT7A 3SFDA 5AQOB 2YDSA 2DWGA 5J2TE 4AQYT 2RA1A 4X66T 2Y8DA 3RH3A 3MACA 3S4UA 4PNIA 3EDVA 3CX8B 4HFHA 5HEUA 4KBMB 4GOUA 4IDZA 2VQFT 1X79A 2A9UA 3EHZA 3ZCJA 4X1YE 4ZXLA 3RQUA 4IE7A 1VCTA 5CB4E 1W9RA 4OYJA 4JI0T 3F2EA 2C5JA 2WP9A 3T1HT 2MOZA 5HCJA 4H63H 4IL4A 2N9DA 4CXYA 3NBXX 4HWCA 1L0VA 3KINB 2VKHA 2XM1A 1UUSA 5JDGA 4DV5T 5KMGP 1D1AA 4U33A 1MNEA 2DCFA 4GIWA 3V5SA 4JEHB 1D1CA 4TUYE 5JRCB 5KX5E 3RC3A 2WDVA 4UF0B 4A5XA 5H6QB 5JREA 1KF6A 4DBRA 4H63V 1KEYA 3UFGA 1W0BA 2XQ6A 3ZJ1A 2XAQB 2YK0A 1Z8UA 2JQKA 3LDQB 2D0TA 4JYAT 1U4QA 3PJAJ 3I9WA 2KZ7B 5FY1A 3DP7A 2MAWA 3PUYF 4HWHA 1XDPA 4IDQA 2X67A 2WAUA 3A5XA 2VASA 1H7CA 4U2YA 2LHNA 5AQQB 5LGTB 4FJOA 2NW7A 2R6GF 4EEBA 3M65A 2E9XD 5JDQA 3MXZA 4HWIB 3IA3A 3ONJA 3TLSA 4LMLA 1NAFA 4XAXB 1OWAA 2XSBA 2ZM2A 3HA4A 3AE1A 3VKHA 3VRAA 4TX5A 1JNRA 2XTLA 2V8SV 5HWXA 4ERRA 3AEDA 2XQ3A 3UU6A 5CA0E 3F57A 4UF0A 2L9QA 1UX4A 3RRWA 3P4RA 2LM9A 1VOMA 4CI1B 4QXBB 2QA7A 2VKJA 5HAXA 2LOPA 2JIWA 5LJNA 2BS3A 4TN7B 4ZI2C 3KVBA 2H7VC 2IW5B 2I59A 2XQ4A 4O4IE 2WU5A 4X5TA 5L3BB 3UQ4A 3B5MA 2E9XB 2V7JA 4MLKA 3ZN0B 4DO0A 2LOSA 3DTOA 5LNKA 3I1AA 3ETUA 3NZQA 4LFAT 1QSDA 4TWHA 3SFEA 4H9NC 2BKOA 1US7B 4EGWA 2VK9A 3LSVA 3K3NA 3L3PA 4HFBA 2X0YA 2PFVA 4Q25A 4DIDB 5L4HA 2CM0A 4AKHA 2V7KA 2ZLYA 4LF6T 3I0QA 3PURA 3RRCA 2WZIA 2LM2A 1WFDA 3FZHB 3CQGB 2X51A 4H9PC 1FIOA 1NEKA 4YSZA 2M6BA 4ASKA 3UUNA 3GMIA 2QVAA 3OYZA 3UU4A 4UVCB 4X1IE 2CHOA 1Z0PA 3EDUA 3Q2MA 5F8PA 4UV9B 3AA6B 2XQAA 2V6YB 4U3CA 3FZKB 3AE3A 2LJLA 2VB6A 4YTMA 5JR9A 5LHHB 1ZP0A 2E9XA 3J7Yq 2UUAT 3N2GE 3IEEA 2H89A 2X0LB 4I0UA 4ADZA 4HKAA 1FMVA 3ZSTA 4AIUA 1LRZA 4JI4T 3TKLB 5LCYA 2NW9A 3ZMUB 2WCAA 1I6ZA 1HX1B 1J5WA 4ISTA 5EK2A 1WLXA 2XHEB 3AAEB 3VHLA 4K0UA 3ZMVB 3C98B 4PAGA 2CEAA 4NUVA 3WAKA 4UVAB 4X65T 3C4WA 2X9YA 4TNVA 2W67A 1IAPA 5DQVA 4JBWF 4PJNA 4ZOLE 5H6RB 3P4WA 5AQFB 3IHRA 3KV6A 1XMOT 5FXXA 3NVOA 1J1JA 1UURA 5GONE 2ZM6T 4O4HE 4XZCA 2FUPA 2DHRA 4I50E 2N1GA 5HXCA 2XQ9A 2V6YA 2PBIA 5E0OA 1MMNA 3RIUA 3O9XA 3HL6A 4YSYA 1O3XA 4U72A 1VCSA 2LRLA 2XPKA 1E2AA 3M3ZB 3CMLA 3I9YA 3P8CD 2LSGA 3RYFE 1N34T 2X0HA 4YFSA 1D0XA 5FY0A 2LRKA 3T8OA 3H3MA 2XUEA 3CX7B 2ZM8A 1YQ3A 3JC6C 3RC8A 5LXTE 5AQLB 2FBWA 4PJJA 2YEVC 4P1NA 4DR7T 4HFIA 2UXDT 2XASB 4ILCA 4I43B 4DR1T 1NWMX 5TAOA 4GK5E 3A8YC 3TLUA 2DWKA 1MIVA 4ZEYA 4U7YA 4PK6A 2V26A 4YHJA 2V6XA 1HFAA 3AE6A 5LB7B 4JI7T 2D9DA 3AE5A 2BS2A 4IDNA 4DR6T 1UX5A 2X68A 3MJXA 2UXCT 3AVSA 1E1HB 3AE4A 1T98A 2ZM0A 3C50A 1JNZA 3K8PC 4DR4T 1QLBA 3TLVA 4AKRB 4OHFA 3KVAA 3O1JA 3ABVA 2CA5A 1BR2A 4DV1T 4JI3T 2BS4A 3PUSA 1MMAA 3N9MA 5AQNB 5FMNA 3ZYKA 2PJQA 2GK9A 3LBXB 3RKOA 4G2AA 4IE6A 2Z6EA 4N78D 3EABA 5C8YE 1ZV4X 1XNQT 3GA8A 2NTXA 1BR0A 2H3RA 4ZI3C 5JQGE 2NR4A 3JC6D 4BA9A 5DQWA 2W62A 3O4XE 3OJAA 5M4YA 2OLTA 2E5VA 5FY7A 1IBLT 3ANWB 4DMVA 2CXDA 1R8IA 2XQ7A 5FKYA 5HXEA 5LG4A 2JQ9A 5L47A 1HNZT 3VR9A 3ZN1B 2W61A 2EHOC 1B7TA 2Q9QA 1IJ5A 3PJAA 3EUHA 2YU2A 5JR9C 3B13A 3DJBA 1N33T 3QB5K 4WYVA 1WYBA 4CN6A 5FYMA 2VURA 5AQHB 5HWYA 2L8KA 3ZJ2A 4ZI7E 3N9OA 4BJNA 3PUGA 4HFEA 3UU5A 3NWIA 3ETVA 3C51A 2WM9A 3OTOT 4Z90A 5ABFB 2CWOA 3R6NA 1KNRA 3QUJA 5LGUB 5AQIB 3N5LA 5FXWA 2BBHA 3H37A 2UXNB 4GYSA 3C4XA 3SS1A 4PK4A 2G0UA 3JADA 3ONXA 5LBQB 2WDRA 5A1LA 3PV0F 2RP4A 2A72A 2QRXA 5HEGA 1FJGT 4CI3B 4DV4T 4KUMB 1ZKEA 1HR0T 1MIYA 5BR8T 4UV8B 3RPUA 3ZKRA 3AB3B 4YHHT 1ZOYA 1WCRA 2K24A 4ZI3D 4B3ST 4UIGA 1HF8A 1S94A 3QB5A 1OEDB 3AEEA 4JI1T 4ZS2A 5L3CB 4LFCT 4DV7T 2BVMA 3KV5A 2P9BA 2EHOD 4Z91A 4IGUA 1KFYA 2YINA 1XNRT 4JLEA 2K48A 4LFBT 4B3TT 4QH5A 4H9SE 3Q5WA 5ABFA 2WMOA 3BK9A 3F31A 1AJ3A 2UUBT 4IDOA 5LMUT 2E5LT 5JRCA 3AEFA 2F4VT 1W09A 4EEDA 2IHR1 4O4LE 5KDMC 2BG9C 3RIFA 3N9LA 5ABHA 3GN5B 1KNZA 4WZXA 4PK5A 3K3OA 5ADXL 5AQMB 3A7MA 2W4XA 3ZLIA 5HEJA 1I94T 2C0SA 4QWNB 5J1GA 3P7IA 3NKZA 3FB2A 4B6XA 2IC6A 2CXLA 3ZPOA 5FNVE 1OXZA 2BZBA 3RX6A 5KXJA 2XQ5A 4MFRA 4OK0A 4IL9A 2XZEA 2LSJA 2CXFA 3V5UA 2BDEA 4OX9T 2A2FX 2UXBT 5C2TA 4JEUB 2WMNA 4J2CA 3UU3A 2J62A 2EHOB 5CFBA 4AKGA 1Y64B 4YTNA 4TZ4C 3L8RA 3MA9A 2K3WA 1QUUA 3PUZF 2N2NA 4AQFC 3RI5A 5F5WA 1HX8A 5AQGB 5DJQC 2CCQA 3AE2A 4MHCA 1WR6A 4H9QC 5LBMA 2E8IA 3P4PA 4QX7B 3FBLA 2FJAA 4DV3T 4B3MT 1MNDA 3N2OA
chains in the Genus database with same CATH topology
4DV1T 4JI3T 4JYAT 4AQYT 4X66T 1N34T 5LMNT 5IWAT 2UUAT 4X62T 1J5ET 4DR5T 1I94T 4JI4T 2VQFT 4JI8T 4YY3T 1XNQT 4DR7T 1HNWT 1N32T 2UXDT 1FJGT 4DV4T 1HR0T 4LFAT 4DR1T 5BR8T 4JI0T 3T1HT 2VQET 4KHPT 1IBLT 4LF5T 4OX9T 2UXBT 4YHHT 4DUZT 4LF7T 4DUYT 1IBMT 2HHHT 4NXMT 4X65T 1HNZT 3T1YT 1IBKT 4LF4T 4B3ST 4DV0T 4JI7T 4DR2T 1N36T 4LF6T 4DR6T 4DV5T 1XMOT 2UXCT 4JI1T 1N33T 4NXNT 4JI5T 4LFCT 4DV7T 2ZM6T 4LF9T 4GKKT 4JI6T 4LF8T 4B3RT 4GKJT 4X64T 4K0KT 4DR3T 4DR4T 1XMQT 1HNXT 1XNRT 4LFBT 4B3TT 2UU9T 2UUCT 4DV2T 2UUBT 4JI2T 2E5LT 5LMUT 4JV5T 2F4VT 4DV3T 4B3MT 3OTOT 4DV6T
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV1 T;  4JI3 T;  4JYA T;  4AQY T;  4X66 T;  1N34 T;  5LMN T;  5IWA T;  2UUA T;  4X62 T;  1J5E T;  4DR5 T;  1I94 T;  4JI4 T;  2VQF T;  4JI8 T;  4YY3 T;  1XNQ T;  4DR7 T;  1HNW T;  1N32 T;  2UXD T;  1FJG T;  4DV4 T;  1HR0 T;  4LFA T;  4DR1 T;  5BR8 T;  4JI0 T;  3T1H T;  2VQE T;  4KHP T;  1IBL T;  4LF5 T;  4OX9 T;  2UXB T;  4YHH T;  4DUZ T;  4LF7 T;  4DUY T;  1IBM T;  2HHH T;  4NXM T;  4X65 T;  1HNZ T;  3T1Y T;  1IBK T;  4LF4 T;  4B3S T;  4DV0 T;  4JI7 T;  4DR2 T;  1N36 T;  4LF6 T;  4DR6 T;  4DV5 T;  1XMO T;  2UXC T;  4JI1 T;  1N33 T;  4NXN T;  4JI5 T;  4LFC T;  4DV7 T;  2ZM6 T;  4LF9 T;  4GKK T;  4JI6 T;  4LF8 T;  4B3R T;  4GKJ T;  4X64 T;  4K0K T;  4DR3 T;  4DR4 T;  1XMQ T;  1HNX T;  1XNR T;  4LFB T;  4B3T T;  2UU9 T;  2UUC T;  4DV2 T;  2UUB T;  4JI2 T;  2E5L T;  5LMU T;  4JV5 T;  2F4V T;  4DV3 T;  4B3M T;  3OTO T;  4DV6 T; 
#chains in the Genus database with same CATH topology
 3PUX F;  5J2U E;  1LVK A;  3L09 A;  4U74 A;  5HEH A;  1FEW A;  2WZH A;  5L4E A;  4CXX A;  3PTR B;  5IWA T;  2NOX A;  4HFC A;  4MBQ A;  3KBU A;  2BKN A;  2LLY A;  1OED E;  4HE8 A;  4M1P A;  2L3L A;  2UXX B;  2WS3 A;  4ILA A;  4HFV A;  3RGL A;  3BQL A;  5FXZ A;  3G06 A;  1ZEE A;  3PUV F;  3PDY A;  3JAF A;  3OBV E;  2OV9 A;  4AI6 A;  4ZI2 D;  3UUX B;  1D1B A;  3LK3 B;  2LT3 A;  1BR4 A;  4G63 A;  3RHW A;  3RYC E;  4LF4 T;  4O2B E;  5FXV A;  3FZL B;  2V7M A;  3PU8 A;  2X66 A;  2NWB A;  3CX6 B;  1N36 T;  5LP6 E;  1UGO A;  4E7S A;  2KXP B;  2WQY A;  2OA5 A;  4U31 A;  4PW8 A;  3HR0 A;  1YW0 A;  4EYU A;  2HN2 A;  3GWH A;  3OYX A;  3VR8 A;  3U3I A;  3P4Q A;  2WSS V;  5HYA A;  4LMK A;  2V7L A;  4NUU A;  4O8S A;  3Q5E A;  2B76 A;  1T7S A;  2YN6 A;  5JVD E;  3FZF B;  2BVL A;  1SE7 A;  2BKP A;  5EK4 A;  4XBF B;  2BG9 B;  4DV6 T;  3W15 B;  4ANJ A;  2D5U A;  4WNK A;  1E7P A;  4WBN E;  3ZT6 A;  4WW0 A;  4X1K E;  5LMN T;  4QXH B;  2VVN A;  3B57 A;  3CPZ A;  5L3D B;  1KK7 A;  4IE4 A;  3CQC B;  4IDP A;  4IE0 A;  5JTG A;  5EZY E;  2XAF B;  4KHZ F;  2IUB A;  1MMG A;  2LKG A;  4YTP A;  2IDO B;  4HN9 A;  2CWY A;  4EV6 A;  4X20 E;  2MTQ A;  4E7Z A;  4KHP T;  1X9B A;  2KLQ A;  2FJB A;  3ZYM A;  2MYS A;  2RPA A;  4CI2 B;  1SA0 E;  4DVD A;  1IBM T;  4IE5 A;  3N9Q A;  3E22 E;  5AQK B;  4IT4 A;  3CKD A;  3T1Y T;  5CGM A;  3HKE E;  4C90 A;  2VKD A;  5LYJ E;  3U78 A;  3L39 A;  4ILU A;  3VKG A;  2MPK A;  4I4T E;  4JI6 T;  3C4Z A;  2J4G A;  3UUM A;  3O1H A;  1XMQ T;  1YQ4 A;  1HTJ F;  2XAH B;  4QH1 A;  2J47 A;  3LFM A;  4CN1 A;  1WRD A;  2NP9 A;  2M67 A;  1D0Y A;  3P50 A;  2ES0 A;  3R84 B;  3WAJ A;  3AAI A;  3Q5D A;  2YOE A;  3PU3 A;  3AA7 B;  1D0Z A;  2CBJ A;  5BMV E;  5JH7 E;  5AQS B;  4UXN B;  4TV8 E;  4X62 T;  2H7O A;  2KIN B;  3RIA A;  2DLR A;  4CN4 A;  2XSA A;  1VRB A;  3CVR A;  4EIW A;  4KMC A;  2AXD S;  2LSI A;  4L9I A;  3KBT A;  2HN1 A;  3RLF F;  4BJM A;  3UT5 E;  4HFD A;  1LVF A;  4ZZB A;  2A3D A;  2BG9 E;  3SOL A;  4GYR A;  4YSX A;  3K3Q C;  1IBK T;  3NRX A;  5L3G B;  4QKN A;  2MBG A;  4ZS3 A;  4KP3 C;  4EYY R;  4OYK A;  3AAA B;  3QNU A;  3EI0 A;  4EOZ B;  4B3R T;  5EK3 A;  3RKG A;  4X64 T;  2SPC A;  2CE7 A;  4F6R C;  2JMK A;  2JQQ A;  5AQP B;  1HNX T;  2X9X A;  3AE8 A;  4UEL A;  3UQ7 A;  5AQU B;  4O2A E;  5J0Z A;  2UUC T;  4YJ3 E;  5HCM A;  3LK2 B;  2E9X C;  5AQJ B;  1SHZ C;  3RQW A;  5CA1 E;  4JUY A;  1DU2 A;  3JCF A;  5AFU L;  1S35 A;  3QOF A;  2XJ7 A;  2LSK A;  4UVB B;  1J5E T;  3H3A A;  2NW8 A;  1UK5 A;  5JDF A;  4KX6 A;  2CHN A;  3SWH A;  3C64 A;  4O4J E;  3FZM B;  2I6H A;  5ABE A;  3LBX A;  2HPL A;  3IBP A;  4HGA A;  5DAB A;  5HXH A;  2X9H A;  1WYC A;  2K5B B;  3CWZ B;  1HG5 A;  4LF5 T;  3E0Z A;  3RF1 A;  4YJ2 E;  4DUZ T;  4TWD A;  2LKH A;  3AEB A;  3OVU A;  2KSR A;  2W0G A;  2CLY C;  3E08 A;  4A98 A;  3AVR A;  3CIR A;  4AXP A;  2D0U A;  3ANW A;  3LJC A;  3NZP A;  3ZC1 A;  5ABG A;  4Z8X A;  3TLT A;  4CXW A;  3RIU C;  4GKK T;  4LF8 T;  2IIU A;  2WU2 A;  4GKJ T;  5F3J A;  3HKC E;  4EAH A;  3AEG A;  4DR3 T;  3UUB A;  4C91 A;  3HI2 A;  3UFE A;  2DL1 A;  2JJ9 A;  3PUQ A;  2JMH A;  2WWU A;  3PE0 A;  3KV4 A;  4YT0 A;  2LHR A;  4DV2 T;  2Y48 B;  4A56 A;  3ESL A;  2YKS A;  4H9O C;  5L2L A;  4PFO A;  2J1D G;  3QC9 A;  2JPF A;  4AIS A;  3UTK A;  2KWI B;  1YKH B;  2W66 A;  3SRZ A;  4JI8 T;  4TNW A;  2VVS A;  1YXR A;  4PJL A;  5IHY A;  1HNW T;  5AQR B;  1YD8 G;  1YKE B;  4ZZC A;  4HTE A;  3X1D A;  3UU8 A;  3QK6 A;  2X9W A;  3J9X 1;  2W63 A;  4HEA A;  4A97 A;  3EVY A;  1V9D A;  4DUY T;  3ZMZ B;  3FXD B;  2PTF A;  2DI4 A;  2YDR A;  2CRB A;  5LHI B;  4DV0 T;  2VWA A;  2WWV A;  4DR2 T;  3ZCI A;  2NTY A;  4IRE A;  3ZC0 A;  4IHJ E;  4L5G A;  4FI5 A;  3KDS E;  5L3E B;  5LJM A;  4GK0 E;  4QHO A;  4NXN T;  4CZZ B;  3PUW F;  3RYI E;  3AE9 A;  3WI3 A;  5HEO A;  5AQT B;  1M7K A;  1IZN B;  2JQH A;  1OED A;  2YDQ A;  2H88 A;  3LG7 A;  4EXT A;  3ZEF B;  4L0R A;  5JR9 B;  4DMW A;  3HKB E;  2CBI A;  3PUA A;  1IJ6 A;  3N2K E;  3EAM A;  4JI2 T;  5IUX A;  3MK7 C;  4ILB A;  2VL8 A;  2IC9 A;  3CQX C;  1M62 A;  3ZMT B;  3ZSS A;  5LA6 E;  4KI0 F;  4ZHQ E;  1HG2 A;  5JDH A;  2QYW A;  5HXS A;  4CQI A;  2QGS A;  2WB5 A;  3GN5 A;  4YLH A;  2ODV A;  4YY3 T;  1LKX A;  1XWM A;  4EZH A;  3Q5X A;  1G8X A;  1G73 A;  3MKD A;  2Q9Q C;  2IAK A;  1HCI A;  2CLY B;  4NXM T;  4QXC B;  4BAY B;  2K9A A;  3KFW X;  2KMF A;  3BQK A;  1CHU A;  1UCU A;  4HWF A;  3RYH E;  2KND A;  2JRK A;  3AXJ B;  3IF8 B;  3N9P A;  2ODU A;  2EHO A;  3CK6 A;  3HKD E;  3VRB A;  3VU7 H;  1ZHC A;  4K0K T;  2ACX A;  1XDO A;  2VKO A;  3FHN A;  4COF A;  2WDQ A;  3ONL C;  4EZ4 A;  1W0A A;  1FMW A;  2LSY A;  2LE8 A;  1GQE A;  2IML A;  4H9R C;  2Y6X A;  2AE9 A;  4MAL A;  4QH4 A;  2C5K T;  2FJE A;  5FP3 A;  4UR9 A;  3O1I A;  5JDN A;  2I0M A;  3D0T A;  3Q9D A;  3FXE B;  4P0A A;  2V7I A;  2XM2 A;  1U5P A;  1N32 T;  2V5D A;  5CJ5 A;  4DBQ A;  1EZ3 A;  2E2A A;  4NIQ A;  3P4S A;  4I55 E;  2VQE T;  4P0B A;  2DNX A;  2XQ8 A;  5LG3 A;  3MZK B;  5FVL A;  2HHH T;  2CPT A;  2YU1 A;  3ZT5 A;  1MMD A;  2PG8 A;  4UEM A;  5JDL A;  1WR0 A;  3AXJ A;  2Q9Q D;  2KWH A;  4YXD A;  4U7I A;  1XZY A;  3KV9 A;  4JI5 T;  3UUL A;  2B1E A;  2ZMA A;  3BQI A;  4NPP A;  2V5C A;  4TV9 E;  1T8B A;  2W00 A;  1BR1 A;  4WBO A;  3ZMS B;  5JDM A;  4PFP A;  5FL1 A;  3LK4 2;  4OFZ A;  4JV5 T;  2V1D B;  5LHG B;  1HS7 A;  3JAE A;  2BBJ A;  4P09 A;  1Y01 A;  3I0O A;  2KT9 A;  1NEN A;  4DND A;  5LGN B;  4IIJ E;  2M6I A;  4AKL A;  3AE7 A;  3AA1 B;  4DR5 T;  2BG9 A;  4QX8 B;  2LEH A;  5FVK A;  2ACZ A;  4PJM A;  2WY2 A;  5AQV B;  1CUN A;  2XAJ B;  5LOV E;  5HXR A;  4V1A v;  2Q9Q B;  4ISS A;  3N9N A;  4AKI A;  1OED C;  1KNP A;  1MIW A;  4LF7 T;  5L3F B;  1SUM B;  2HPJ A;  2D2S A;  4LMJ A;  2WBL A;  3AEC A;  3OPC A;  2XQY A;  3NRY A;  3FBZ A;  1T72 A;  3AA0 B;  2VL0 A;  5IYZ E;  4LF9 T;  3ZYL A;  2HH7 A;  4TWF A;  2FJD A;  3K1S A;  4U2Z A;  2XY8 B;  3TLW A;  4F8H A;  4AQF A;  2XAG B;  2C5I T;  5ETW A;  4EB6 E;  2CMR A;  4AQG A;  2W2U A;  4HWD A;  3AEA A;  2UU9 T;  5C3J A;  5FL0 A;  3OKQ A;  3ZT7 A;  3SFD A;  5AQO B;  2YDS A;  2DWG A;  5J2T E;  4AQY T;  2RA1 A;  4X66 T;  2Y8D A;  3RH3 A;  3MAC A;  3S4U A;  4PNI A;  3EDV A;  3CX8 B;  4HFH A;  5HEU A;  4KBM B;  4GOU A;  4IDZ A;  2VQF T;  1X79 A;  2A9U A;  3EHZ A;  3ZCJ A;  4X1Y E;  4ZXL A;  3RQU A;  4IE7 A;  1VCT A;  5CB4 E;  1W9R A;  4OYJ A;  4JI0 T;  3F2E A;  2C5J A;  2WP9 A;  3T1H T;  2MOZ A;  5HCJ A;  4H63 H;  4IL4 A;  2N9D A;  4CXY A;  3NBX X;  4HWC A;  1L0V A;  3KIN B;  2VKH A;  2XM1 A;  1UUS A;  5JDG A;  4DV5 T;  5KMG P;  1D1A A;  4U33 A;  1MNE A;  2DCF A;  4GIW A;  3V5S A;  4JEH B;  1D1C A;  4TUY E;  5JRC B;  5KX5 E;  3RC3 A;  2WDV A;  4UF0 B;  4A5X A;  5H6Q B;  5JRE A;  1KF6 A;  4DBR A;  4H63 V;  1KEY A;  3UFG A;  1W0B A;  2XQ6 A;  3ZJ1 A;  2XAQ B;  2YK0 A;  1Z8U A;  2JQK A;  3LDQ B;  2D0T A;  4JYA T;  1U4Q A;  3PJA J;  3I9W A;  2KZ7 B;  5FY1 A;  3DP7 A;  2MAW A;  3PUY F;  4HWH A;  1XDP A;  4IDQ A;  2X67 A;  2WAU A;  3A5X A;  2VAS A;  1H7C A;  4U2Y A;  2LHN A;  5AQQ B;  5LGT B;  4FJO A;  2NW7 A;  2R6G F;  4EEB A;  3M65 A;  2E9X D;  5JDQ A;  3MXZ A;  4HWI B;  3IA3 A;  3ONJ A;  3TLS A;  4LML A;  1NAF A;  4XAX B;  1OWA A;  2XSB A;  2ZM2 A;  3HA4 A;  3AE1 A;  3VKH A;  3VRA A;  4TX5 A;  1JNR A;  2XTL A;  2V8S V;  5HWX A;  4ERR A;  3AED A;  2XQ3 A;  3UU6 A;  5CA0 E;  3F57 A;  4UF0 A;  2L9Q A;  1UX4 A;  3RRW A;  3P4R A;  2LM9 A;  1VOM A;  4CI1 B;  4QXB B;  2QA7 A;  2VKJ A;  5HAX A;  2LOP A;  2JIW A;  5LJN A;  2BS3 A;  4TN7 B;  4ZI2 C;  3KVB A;  2H7V C;  2IW5 B;  2I59 A;  2XQ4 A;  4O4I E;  2WU5 A;  4X5T A;  5L3B B;  3UQ4 A;  3B5M A;  2E9X B;  2V7J A;  4MLK A;  3ZN0 B;  4DO0 A;  2LOS A;  3DTO A;  5LNK A;  3I1A A;  3ETU A;  3NZQ A;  4LFA T;  1QSD A;  4TWH A;  3SFE A;  4H9N C;  2BKO A;  1US7 B;  4EGW A;  2VK9 A;  3LSV A;  3K3N A;  3L3P A;  4HFB A;  2X0Y A;  2PFV A;  4Q25 A;  4DID B;  5L4H A;  2CM0 A;  4AKH A;  2V7K A;  2ZLY A;  4LF6 T;  3I0Q A;  3PUR A;  3RRC A;  2WZI A;  2LM2 A;  1WFD A;  3FZH B;  3CQG B;  2X51 A;  4H9P C;  1FIO A;  1NEK A;  4YSZ A;  2M6B A;  4ASK A;  3UUN A;  3GMI A;  2QVA A;  3OYZ A;  3UU4 A;  4UVC B;  4X1I E;  2CHO A;  1Z0P A;  3EDU A;  3Q2M A;  5F8P A;  4UV9 B;  3AA6 B;  2XQA A;  2V6Y B;  4U3C A;  3FZK B;  3AE3 A;  2LJL A;  2VB6 A;  4YTM A;  5JR9 A;  5LHH B;  1ZP0 A;  2E9X A;  3J7Y q;  2UUA T;  3N2G E;  3IEE A;  2H89 A;  2X0L B;  4I0U A;  4ADZ A;  4HKA A;  1FMV A;  3ZST A;  4AIU A;  1LRZ A;  4JI4 T;  3TKL B;  5LCY A;  2NW9 A;  3ZMU B;  2WCA A;  1I6Z A;  1HX1 B;  1J5W A;  4IST A;  5EK2 A;  1WLX A;  2XHE B;  3AAE B;  3VHL A;  4K0U A;  3ZMV B;  3C98 B;  4PAG A;  2CEA A;  4NUV A;  3WAK A;  4UVA B;  4X65 T;  3C4W A;  2X9Y A;  4TNV A;  2W67 A;  1IAP A;  5DQV A;  4JBW F;  4PJN A;  4ZOL E;  5H6R B;  3P4W A;  5AQF B;  3IHR A;  3KV6 A;  1XMO T;  5FXX A;  3NVO A;  1J1J A;  1UUR A;  5GON E;  2ZM6 T;  4O4H E;  4XZC A;  2FUP A;  2DHR A;  4I50 E;  2N1G A;  5HXC A;  2XQ9 A;  2V6Y A;  2PBI A;  5E0O A;  1MMN A;  3RIU A;  3O9X A;  3HL6 A;  4YSY A;  1O3X A;  4U72 A;  1VCS A;  2LRL A;  2XPK A;  1E2A A;  3M3Z B;  3CML A;  3I9Y A;  3P8C D;  2LSG A;  3RYF E;  1N34 T;  2X0H A;  4YFS A;  1D0X A;  5FY0 A;  2LRK A;  3T8O A;  3H3M A;  2XUE A;  3CX7 B;  2ZM8 A;  1YQ3 A;  3JC6 C;  3RC8 A;  5LXT E;  5AQL B;  2FBW A;  4PJJ A;  2YEV C;  4P1N A;  4DR7 T;  4HFI A;  2UXD T;  2XAS B;  4ILC A;  4I43 B;  4DR1 T;  1NWM X;  5TAO A;  4GK5 E;  3A8Y C;  3TLU A;  2DWK A;  1MIV A;  4ZEY A;  4U7Y A;  4PK6 A;  2V26 A;  4YHJ A;  2V6X A;  1HFA A;  3AE6 A;  5LB7 B;  4JI7 T;  2D9D A;  3AE5 A;  2BS2 A;  4IDN A;  4DR6 T;  1UX5 A;  2X68 A;  3MJX A;  2UXC T;  3AVS A;  1E1H B;  3AE4 A;  1T98 A;  2ZM0 A;  3C50 A;  1JNZ A;  3K8P C;  4DR4 T;  1QLB A;  3TLV A;  4AKR B;  4OHF A;  3KVA A;  3O1J A;  3ABV A;  2CA5 A;  1BR2 A;  4DV1 T;  4JI3 T;  2BS4 A;  3PUS A;  1MMA A;  3N9M A;  5AQN B;  5FMN A;  3ZYK A;  2PJQ A;  2GK9 A;  3LBX B;  3RKO A;  4G2A A;  4IE6 A;  2Z6E A;  4N78 D;  3EAB A;  5C8Y E;  1ZV4 X;  1XNQ T;  3GA8 A;  2NTX A;  1BR0 A;  2H3R A;  4ZI3 C;  5JQG E;  2NR4 A;  3JC6 D;  4BA9 A;  5DQW A;  2W62 A;  3O4X E;  3OJA A;  5M4Y A;  2OLT A;  2E5V A;  5FY7 A;  1IBL T;  3ANW B;  4DMV A;  2CXD A;  1R8I A;  2XQ7 A;  5FKY A;  5HXE A;  5LG4 A;  2JQ9 A;  5L47 A;  1HNZ T;  3VR9 A;  3ZN1 B;  2W61 A;  2EHO C;  1B7T A;  2Q9Q A;  1IJ5 A;  3PJA A;  3EUH A;  2YU2 A;  5JR9 C;  3B13 A;  3DJB A;  1N33 T;  3QB5 K;  4WYV A;  1WYB A;  4CN6 A;  5FYM A;  2VUR A;  5AQH B;  5HWY A;  2L8K A;  3ZJ2 A;  4ZI7 E;  3N9O A;  4BJN A;  3PUG A;  4HFE A;  3UU5 A;  3NWI A;  3ETV A;  3C51 A;  2WM9 A;  3OTO T;  4Z90 A;  5ABF B;  2CWO A;  3R6N A;  1KNR A;  3QUJ A;  5LGU B;  5AQI B;  3N5L A;  5FXW A;  2BBH A;  3H37 A;  2UXN B;  4GYS A;  3C4X A;  3SS1 A;  4PK4 A;  2G0U A;  3JAD A;  3ONX A;  5LBQ B;  2WDR A;  5A1L A;  3PV0 F;  2RP4 A;  2A72 A;  2QRX A;  5HEG A;  1FJG T;  4CI3 B;  4DV4 T;  4KUM B;  1ZKE A;  1HR0 T;  1MIY A;  5BR8 T;  4UV8 B;  3RPU A;  3ZKR A;  3AB3 B;  4YHH T;  1ZOY A;  1WCR A;  2K24 A;  4ZI3 D;  4B3S T;  4UIG A;  1HF8 A;  1S94 A;  3QB5 A;  1OED B;  3AEE A;  4JI1 T;  4ZS2 A;  5L3C B;  4LFC T;  4DV7 T;  2BVM A;  3KV5 A;  2P9B A;  2EHO D;  4Z91 A;  4IGU A;  1KFY A;  2YIN A;  1XNR T;  4JLE A;  2K48 A;  4LFB T;  4B3T T;  4QH5 A;  4H9S E;  3Q5W A;  5ABF A;  2WMO A;  3BK9 A;  3F31 A;  1AJ3 A;  2UUB T;  4IDO A;  5LMU T;  2E5L T;  5JRC A;  3AEF A;  2F4V T;  1W09 A;  4EED A;  2IHR 1;  4O4L E;  5KDM C;  2BG9 C;  3RIF A;  3N9L A;  5ABH A;  3GN5 B;  1KNZ A;  4WZX A;  4PK5 A;  3K3O A;  5ADX L;  5AQM B;  3A7M A;  2W4X A;  3ZLI A;  5HEJ A;  1I94 T;  2C0S A;  4QWN B;  5J1G A;  3P7I A;  3NKZ A;  3FB2 A;  4B6X A;  2IC6 A;  2CXL A;  3ZPO A;  5FNV E;  1OXZ A;  2BZB A;  3RX6 A;  5KXJ A;  2XQ5 A;  4MFR A;  4OK0 A;  4IL9 A;  2XZE A;  2LSJ A;  2CXF A;  3V5U A;  2BDE A;  4OX9 T;  2A2F X;  2UXB T;  5C2T A;  4JEU B;  2WMN A;  4J2C A;  3UU3 A;  2J62 A;  2EHO B;  5CFB A;  4AKG A;  1Y64 B;  4YTN A;  4TZ4 C;  3L8R A;  3MA9 A;  2K3W A;  1QUU A;  3PUZ F;  2N2N A;  4AQF C;  3RI5 A;  5F5W A;  1HX8 A;  5AQG B;  5DJQ C;  2CCQ A;  3AE2 A;  4MHC A;  1WR6 A;  4H9Q C;  5LBM A;  2E8I A;  3P4P A;  4QX7 B;  3FBL A;  2FJA A;  4DV3 T;  4B3M T;  1MND A;  3N2O A; 
#chains in the Genus database with same CATH homology
 4DV1 T;  4JI3 T;  4JYA T;  4AQY T;  4X66 T;  1N34 T;  5LMN T;  5IWA T;  2UUA T;  4X62 T;  1J5E T;  4DR5 T;  1I94 T;  4JI4 T;  2VQF T;  4JI8 T;  4YY3 T;  1XNQ T;  4DR7 T;  1HNW T;  1N32 T;  2UXD T;  1FJG T;  4DV4 T;  1HR0 T;  4LFA T;  4DR1 T;  5BR8 T;  4JI0 T;  3T1H T;  2VQE T;  4KHP T;  1IBL T;  4LF5 T;  4OX9 T;  2UXB T;  4YHH T;  4DUZ T;  4LF7 T;  4DUY T;  1IBM T;  2HHH T;  4NXM T;  4X65 T;  1HNZ T;  3T1Y T;  1IBK T;  4LF4 T;  4B3S T;  4DV0 T;  4JI7 T;  4DR2 T;  1N36 T;  4LF6 T;  4DR6 T;  4DV5 T;  1XMO T;  2UXC T;  4JI1 T;  1N33 T;  4NXN T;  4JI5 T;  4LFC T;  4DV7 T;  2ZM6 T;  4LF9 T;  4GKK T;  4JI6 T;  4LF8 T;  4B3R T;  4GKJ T;  4X64 T;  4K0K T;  4DR3 T;  4DR4 T;  1XMQ T;  1HNX T;  1XNR T;  4LFB T;  4B3T T;  2UU9 T;  2UUC T;  4DV2 T;  2UUB T;  4JI2 T;  2E5L T;  5LMU T;  4JV5 T;  2F4V T;  4DV3 T;  4B3M T;  3OTO T;  4DV6 T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...