2VQET

Modified uridines with c5-methylene substituents at the first position of the trna anticodon stabilize u-g wobble pairing during decoding
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAVQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Modified Uridines with C5-Methylene Substituents at the First Position of the tRNA Anticodon Stabilize U.G Wobble Pairing During Decoding.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RRNA
total genus 34
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2008-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 2vqeT00
4DV6T 4X62T 1XNQT 4B3ST 4DUYT 1HNZT 1IBMT 1HNWT 4DR2T 4B3TT 1HR0T 4JYAT 4JI2T 4GKKT 4LF9T 4DR4T 5LMUT 1IBLT 4DR7T 4NXMT 2VQET 3T1HT 4X65T 4DR1T 4JI1T 4KHPT 4JI0T 4B3RT 2VQFT 2UUCT 4JV5T 1FJGT 2ZM6T 4AQYT 4JI8T 4NXNT 4JI5T 4LF4T 4DV7T 1J5ET 1N34T 4DV2T 2UXBT 4LF6T 4YY3T 1I94T 2F4VT 4LFBT 4DR5T 4B3MT 5BR8T 2UUAT 2UXDT 4JI4T 4DUZT 4DV1T 5LMNT 4X64T 1IBKT 5IWAT 2HHHT 4LF7T 2E5LT 3T1YT 4GKJT 4DV5T 4DR3T 4JI7T 1XMQT 4LFAT 2UUBT 4X66T 4JI3T 4YHHT 1HNXT 3OTOT 4DV4T 4JI6T 4K0KT 1N33T 2UU9T 1N32T 4DV0T 1N36T 4LF8T 1XMOT 1XNRT 4DR6T 4DV3T 4LFCT 4OX9T 4LF5T 2UXCT
chains in the Genus database with same CATH superfamily
2Q9QC 4BJMA 2E2AA 2XAQB 4U2YA 2I0MA 2JRKA 4EIWA 4HFBA 2H3RA 4UVBB 2WP9A 5HCJA 2B1EA 2IW5B 5ABFA 2K24A 5DJQC 5AQMB 4DUYT 1IBMT 4HTEA 4PNIA 3PUXF 1HNWT 2XQ9A 2WAUA 2YDRA 2X66A 1HR0T 3MA9A 3BQIA 4H9PC 3RIAA 2BBJA 3RYIE 5LG3A 2VASA 5LYJE 5F8PA 2NWBA 5F5WA 5LNKA 5HXRA 4PFPA 2AE9A 4AISA 4O4HE 2E9XA 1UGOA 4GKKT 3JC6D 2PJQA 2X51A 3H37A 2XQ3A 3HA4A 4P0BA 4WW0A 5HAXA 4LF9T 4DR4T 2V6YA 5CJ5A 4KX6A 2NOXA 3JAFA 3TLVA 3ABVA 1HTJF 2EHOB 4H9RC 1HX1B 1Y64B 3J9X1 3WAJA 3OJAA 3KV6A 5AQSB 1MMNA 1FMWA 4TWFA 2C5KT 5ABGA 1KFYA 2BBHA 4X65T 4DR1T 1YKEB 3CWZB 1S35A 1US7B 2UXXB 2D5UA 2XAHB 1YXRA 3LSVA 3CKDA 3N2GE 2JPFA 4XAXB 3ZYKA 2VQFT 1R8IA 4GK5E 4CN6A 2CWYA 2V6XA 2VL8A 4IHJE 5ABHA 3ZJ1A 2WMNA 1T7SA 2BKOA 3CQGB 4O2AE 4WYVA 1WLXA 2QA7A 3HKDE 3KFWX 3P4QA 3AE6A 2V5CA 1E7PA 2W67A 4NXNT 1MIWA 3DTOA 4HWCA 4A56A 3HL6A 5GONE 4DV7T 4EV6A 2J47A 3ZN1B 5AFUL 3HKCE 4U2ZA 3ZCJA 2NTXA 3JADA 4EEBA 3RHWA 5HEGA 4ZHQE 3AEFA 4XZCA 3ETUA 3NBXX 3EHZA 4LF6T 3OYXA 2W0GA 1BR2A 3ZYLA 2BKPA 2VB6A 3ZN0B 4MLKA 2F4VT 4LFBT 2BG9B 4IE5A 4B3TT 1V9DA 3HI2A 3N9OA 2X9WA 2YDQA 2HN2A 2LE8A 3LFMA 3N2OA 3CIRA 5L2LA 2J1DG 3IF8B 2BS3A 3QNUA 4ADZA 2W00A 2D9DA 3PURA 4OYJA 2DHRA 3RIUA 4HFVA 5C2TA 2FBWA 2W62A 1WRDA 4JI4T 4AKGA 3A8YC 3QK6A 2X9XA 2HH7A 3KVBA 1D1BA 4HFIA 4TZ4C 4X1IE 4YJ3E 5AQKB 2ACXA 3ONLC 5IYZE 5LMNT 3GN5A 3NRYA 4TUYE 4YHJA 3CX7B 1O3XA 3AA0B 3LK42 2BG9A 4MFRA 4CXYA 4ILAA 4IE6A 2X67A 4IE0A 5FXWA 3CX8B 3H3AA 4NUVA 4Q25A 4QH5A 4ZEYA 3FZKB 3PUAA 4QKNA 2DLRA 2IMLA 2LHNA 4TWDA 2YEVC 3UUBA 4GKJT 1MMGA 3KV5A 4JI7T 2LEHA 2XSAA 4H9SE 4UEMA 3U78A 3GMIA 2UUBT 1HNXT 4JI1T 1YKHB 2D0UA 5L3BB 4ZI2D 2NTYA 1ZHCA 2V26A 4ERRA 4JV5T 2RA1A 2QYWA 3AA1B 4JEHB 4LMLA 2FJBA 3ZC1A 4LMJA 5DQWA 3ZSSA 5C3JA 3O1IA 3PUZF 3I0QA 4ZZCA 3O4XE 3CX6B 2WB5A 3IA3A 1N36T 5J0ZA 1X79A 4LF8T 2KINB 2WWVA 1UK5A 1UURA 3VU7H 3UT5E 2MBGA 2I59A 4YSXA 4DR6T 2XTLA 4H63V 4H9QC 3UU8A 1JNRA 5HWYA 4IDPA 1D1CA 1IJ6A 3AEBA 2X9YA 3AA6B 2WBLA 2X0YA 2JQ9A 3FZHB 4N78D 5FKYA 2VKOA 3L3PA 5J1GA 5HXEA 2YU2A 3LK3B 3RGLA 5ABEA 2IC9A 3K8PC 2V7MA 4CN4A 5L3EB 5M4YA 2KWHA 5FVLA 4X62T 2YK0A 3I0OA 3M3ZB 2V7IA 3QB5K 4KI0F 5EK2A 4ANJA 5AQRB 5LGTB 4KBMB 3PU3A 4O4LE 2JMHA 3LBXA 4O8SA 1VOMA 4DBQA 4F6RC 5JH7E 5J2TE 1HNZT 5KDMC 1WFDA 5LBQB 3G06A 5CA0E 1W9RA 3AAIA 3AB3B 3JAEA 2K5BB 3VR8A 3X1DA 5KX5E 5LHGB 1IJ5A 4H9NC 4WZXA 4OHFA 5HXSA 3B57A 2KWIB 2IDOB 2L9QA 5DQVA 1HF8A 1SA0E 3Q2MA 3RKGA 5JRCA 3F31A 2C5IT 2XQ4A 5JDGA 4DMWA 2H7VC 2Y8DA 1LRZA 1FMVA 1W0AA 4QH4A 4UV9B 3U3IA 4QWNB 1VRBA 5FXXA 3UFEA 2BS2A 5LBMA 3EUHA 3FZMB 4U7IA 2H89A 3ZMZB 4YTPA 1T72A 4JUYA 4EZ4A 5HXHA 4DR7T 1HG2A 4NXMT 3AXJB 5IUXA 2CLYC 5LHHB 3ZT6A 3UFGA 3AEEA 3O1HA 3AEAA 4MHCA 3T1HT 3ZMVB 1KEYA 1E2AA 3P4RA 2HPJA 3CQCB 4YTMA 2QVAA 3ESLA 3MK7C 3Q5DA 3ZKRA 3LK2B 4MBQA 4PW8A 3TLWA 4PFOA 4HWHA 1UUSA 1OEDB 3R6NA 3ZYMA 3KV4A 4GIWA 2D2SA 5JTGA 2Y48B 3VKGA 3SFEA 4B6XA 1YQ4A 5L47A 4UV8B 3OYZA 4UVAB 3W15B 1ZEEA 2ZM0A 1YQ3A 2PTFA 2XZEA 4LF4T 1BR4A 2MTQA 2PFVA 3L39A 5ABFB 2BVMA 2VKJA 3ZPOA 5AQVB 1CUNA 2JQKA 5JDMA 3JCFA 3ZEFB 3OPCA 4P09A 2LM9A 3RLFF 4IDOA 2K9AA 5F3JA 2L3LA 2WDRA 4QHOA 3DJBA 4Z91A 2GK9A 2WU2A 4IE4A 4J2CA 2XHEB 5LA6E 2NW9A 4GYSA 4K0UA 4HFEA 1HX8A 4HFHA 3V5UA 2D0TA 5LJMA 4DR5T 5H6QB 4IREA 1XZYA 4TNVA 4TWHA 3RRCA 3KVAA 4DNDA 4YY3T 4A5XA 3C4ZA 1M62A 3CQXC 5FL1A 3P50A 3PE0A 5BR8T 3NVOA 3IEEA 1QSDA 1KNPA 3K1SA 5HEUA 2UXDT 3WAKA 1GQEA 3IHRA 5L3FB 3ONXA 2ES0A 1FEWA 4DUZT 4B3MT 2QGSA 4TV9E 3VKHA 1M7KA 1DU2A 2MOZA 2OA5A 4NPPA 3AA7B 3C98B 4IT4A 4QXHB 4UR9A 1E1HB 1D0YA 3N5LA 2HHHT 3EABA 2DI4A 4IL9A 3P4WA 4QH1A 3EAMA 2JQQA 2ODVA 3MZKB 4G63A 1MMDA 3WI3A 4QXCB 1MIVA 4GK0E 4MALA 2VKDA 3C51A 1IAPA 1XMQT 3S4UA 2W61A 2M6IA 2H88A 2XQ7A 3UU4A 4IIJE 1VCTA 2B76A 4P1NA 2VK9A 2WS3A 3AE1A 3AVSA 3JC6C 4ZS2A 3UULA 4ZI7E 5LP6E 4DV4T 3NKZA 2CHOA 3EVYA 5FP3A 4EXTA 2VVSA 3RRWA 3UTKA 3ZT5A 2M67A 3ZSTA 2XY8B 3NRXA 4X1KE 4ZI3D 2XSBA 1X9BA 2EHOA 1J5WA 1H7CA 2FUPA 3E08A 4QXBB 4YLHA 4ZS3A 5ETWA 5AQFB 2LJLA 1NEKA 5LCYA 2Z6EA 2VL0A 4U3CA 3ZMSB 2XQAA 3PU8A 3ANWA 2CXDA 4TN7B 2PBIA 3F57A 5HEHA 4HWDA 3FHNA 1MMAA 3PUSA 2YDSA 2WQYA 3Q5XA 1T8BA 5L3DB 4HWFA 5A1LA 4OX9T 1WYBA 2ZMAA 1OXZA 1BR1A 5JRCB 3PUQA 2LSGA 2E9XD 4DIDB 2FJAA 4PJNA 4EEDA 4DV6T 2LOPA 4AXPA 4CXWA 1HG5A 2CMRA 2WY2A 3AEGA 2P9BA 2NP9A 4UXNB 2KMFA 2E8IA 4BAYB 4UF0A 3I1AA 2V7JA 3GN5B 1S94A 2NR4A 3N9PA 2JQHA 3P7IA 4YFSA 2RPAA 1LVKA 3C50A 4IDZA 4B3ST 2WWUA 1KNZA 1UCUA 2LT3A 3VHLA 4DR2T 3OVUA 4UELA 2V8SV 2J4GA 4I43B 2CE7A 1LKXA 3VRAA 2FJDA 1UX4A 3AEDA 5LOVE 2KXPB 1KF6A 1D0XA 3Q9DA 5JDQA 3RC8A 5AQUB 5CGMA 1ZOYA 2ZLYA 4EOZB 2HN1A 2BVLA 5AQOB 3ZJ2A 2LRKA 4HKAA 3K3OA 2LKHA 4YJ2E 2W2UA 3MACA 1YD8G 3F2EA 3LDQB 3AE2A 1IBLT 5AQLB 2WM9A 2IIUA 2EHOD 3RYHE 1U4QA 2BS4A 2DNXA 4FJOA 5CFBA 2C5JA 2IC6A 1KNRA 4ISTA 3VRBA 4DVDA 5HWXA 2XASB 3PV0F 1W0BA 3H3MA 2WDVA 3PTRB 5FY1A 2A9UA 2FJEA 4CZZB 3QB5A 4KHPT 4PK4A 4OFZA 4AI6A 4JEUB 4WNKA 2ODUA 4PK6A 4TX5A 4U7YA 2CHNA 2BZBA 4ASKA 3BK9A 2E9XC 1FJGT 2XQYA 4ZOLE 5LB7B 1XDPA 2Q9QD 3RYFE 2YKSA 3RF1A 3RX6A 4E7ZA 3CMLA 4JI8T 3N9NA 1W09A 2MPKA 2ZM2A 3EI0A 4UIGA 4JI5T 5JR9C 5KXJA 3FZFB 2XPKA 4I0UA 5JR9B 3LG7A 4JBWF 1N34T 1QLBA 2MYSA 5FYMA 3RQUA 4KMCA 2VVNA 4KP3C 3TLUA 3RQWA 4C91A 5JDLA 5AQJB 4NIQA 2J62A 3AAEB 4KUMB 4O4JE 3RYCE 2W4XA 1MNDA 2YOEA 4EB6E 2UXBT 4LMKA 5JQGE 3UQ7A 4AQFA 5IHYA 3GA8A 3MKDA 3SFDA 4DBRA 3O1JA 3AVRA 3AE3A 2KT9A 4QX7B 4V1Av 5HYAA 4COFA 5AQIB 1T98A 2BKNA 3HKEE 3K3NA 3NWIA 5TAOA 5CA1E 3OKQA 5EK3A 3QOFA 2UUAT 2WSSV 4E7SA 2WDQA 3PJAA 3RI5A 4O2BE 4HN9A 4X5TA 2NW7A 4X1YE 1N32T 2SPCA 3HR0A 3AE7A 5IWAT 4XBFB 2CXLA 3AECA 1BR0A 5HXCA 4M1PA 4WBOA 2X68A 4PK5A 3TLTA 4CI1B 2KNDA 2HPLA 3T1YT 5LG4A 2CCQA 2DL1A 2XJ7A 1WR6A 3NZQA 3KINB 1Z0PA 5L4HA 1SUMB 2KSRA 2XM1A 3RKOA 4GYRA 1OWAA 4DR3T 3O9XA 1IZNB 4LFAT 2LKGA 2EHOC 1JNZA 2A72A 2V5DA 3PDYA 3AE8A 4YSYA 5LHIB 3FBLA 1QUUA 2XM2A 2XAJB 3UUMA 3QUJA 2E5VA 5JDHA 2WMOA 3OTOT 3UUXB 4AKHA 2KZ7B 3AE5A 1NAFA 4UF0B 5AQNB 4ZI3C 2LSJA 4DV0T 2UXNB 2CA5A 2CM0A 4U72A 5L3CB 1XMOT 1Y01A 3N9LA 2WZHA 4YSZA 5AQPB 2OLTA 4I55E 2JMKA 4ZI2C 2W63A 4IGUA 4OYKA 4DV3T 5HCMA 2N9DA 3R84B 2X9HA 3C4XA 3ZC0A 1AJ3A 1KK7A 5H6RB 2X0HA 5AQQB 2I6HA 2V7LA 4AKLA 3AE9A 5LJNA 1I6ZA 4JLEA 4BA9A 2UXCT 4FI5A 5CB4E 4EYYR 2K48A 5EZYE 4ZXLA 2A3DA 2IAKA 3BQLA 4L0RA 2YN6A 3CVRA 1Z8UA 5FVKA 2IHR1 2Q9QB 3RIFA 2WZIA 4CQIA 1XNQT 2NW8A 2VURA 2V1DB 3A5XA 4HGAA 3RH3A 1WR0A 3DP7A 3LBXB 3P8CD 3N9MA 3PUWF 3ZLIA 2PG8A 3EDVA 4QX8B 2V7KA 5FY0A 1NENA 3FXDB 5JDFA 2DWKA 2CBIA 2VKHA 3CPZA 3MJXA 4HFCA 4IE7A 2CPTA 4ILUA 4AQFC 2XAFB 1L0VA 3NZPA 3L8RA 3P4SA 2QRXA 1MIYA 1B7TA 3LJCA 2XQ5A 2ACZA 3ZCIA 4ISSA 5AQHB 4JYAT 4JI2T 2LSKA 3L09A 2Q9QA 3N9QA 2YINA 5FY7A 3UU5A 5LMUT 3A7MA 2W66A 5E0OA 2LHRA 2H7OA 3SRZA 3ZMUB 3ZT7A 4HFDA 2LSIA 2N1GA 3Q5WA 3B13A 2RP4A 3M65A 4H9OC 4TNWA 4JI0T 3KBTA 5FNVE 4PJLA 2CLYB 3J7Yq 2VQET 5FXVA 2UU9T 4AKRB 2KLQA 5KMGP 2M6BA 4ILBA 3T8OA 4YTNA 3ANWB 2N2NA 1ZV4X 3ONJA 2CWOA 3P4PA 3C64A 1OEDA 3RPUA 3C4WA 2AXDS 4AIUA 4P0AA 3KDSE 4G2AA 2UUCT 4B3RT 4U33A 4PJMA 4AQGA 3FZLB 5LGNB 2ZM6T 4AQYT 4L9IA 4U31A 1J1JA 2G0UA 1ZP0A 4O4IE 4DO0A 5FL0A 2XQ6A 2DCFA 1HS7A 5JVDE 2R6GF 2XAGB 4EAHA 4YXDA 3N2KE 3UU6A 1J5ET 1VCSA 2XQ8A 4C90A 1EZ3A 2CRBA 4I50E 1HCIA 1XDOA 4CXXA 1YW0A 4IL4A 1D0ZA 2CEAA 5FXZA 3TKLB 3FXEB 3PJAJ 2CBJA 3E0ZA 4DV2T 2LLYA 4AKIA 4YT0A 1HFAA 1OEDC 4KHZF 1I94T 4H63H 4GOUA 3PUVF 5FMNA 3FBZA 3BQKA 3B5MA 2YU1A 4NUUA 4BJNA 5LXTE 4X20E 4HEAA 3UUNA 4EYUA 4EZHA 4F8HA 4PJJA 5ADXL 3IBPA 4L5GA 3EDUA 3QC9A 2IUBA 4EGWA 2A2FX 1WYCA 4CI3B 1G73A 3KBUA 3ETVA 4UVCB 4DV1T 5L4EA 2MAWA 4X64T 1IBKT 3I9WA 1XWMA 3PUGA 5AQGB 2K3WA 4A98A 4LF7T 2BDEA 1OEDE 5JDNA 2OV9A 3Q5EA 3HKBE 5HEOA 2E5LT 1XNRT 4HE8A 1LVFA 3RIUC 4U74A 4A97A 2CXFA 4Z8XA 5DABA 3PUYF 3CK6A 3SOLA 5LGUB 3UU3A 5C8YE 3FB2A 4DV5T 5HEJA 2V6YB 4IDNA 3E22E 4PAGA 4X66T 4JI3T 5EK4A 3SWHA 5JR9A 4YHHT 4Z90A 2BG9E 2X0LB 2LM2A 3D0TA 4CN1A 1G8XA 1MNEA 1U5PA 3AAAB 1NWMX 1WCRA 2L8KA 5JREA 2JIWA 4JI6T 4K0KT 4ILCA 1N33T 5AQTB 1SE7A 2LOSA 2ZM8A 3AXJA 3ZMTB 2WCAA 3RC3A 4IDQA 3K3QC 1D1AA 2VWAA 3MXZA 3OBVE 2C0SA 1CHUA 4OK0A 4DMVA 5L3GB 4ZZBA 4HWIB 2DWGA 3TLSA 5J2UE 4I4TE 1ZKEA 3I9YA 2Y6XA 4LFCT 4TV8E 1SHZC 2LSYA 3VR9A 2JJ9A 4LF5T 2E9XB 3KV9A 5BMVE 1FIOA 2LRLA 1UX5A 3AE4A 3SS1A 3UQ4A 3V5SA 2BG9C 4WBNE 4CI2B 2WU5A 3GWHA 2XUEA
chains in the Genus database with same CATH topology
4DV6T 4X62T 1XNQT 4B3ST 4DUYT 1HNZT 1IBMT 1HNWT 4DR2T 4B3TT 1HR0T 4JYAT 4JI2T 4GKKT 4LF9T 4DR4T 5LMUT 1IBLT 4DR7T 4NXMT 2VQET 3T1HT 4X65T 4DR1T 4JI1T 4KHPT 4JI0T 4B3RT 2VQFT 2UUCT 4JV5T 1FJGT 2ZM6T 4AQYT 4JI8T 4NXNT 4JI5T 4LF4T 4DV7T 1J5ET 1N34T 4DV2T 2UXBT 4LF6T 4YY3T 1I94T 2F4VT 4LFBT 4DR5T 4B3MT 5BR8T 2UUAT 2UXDT 4JI4T 4DUZT 4DV1T 5LMNT 4X64T 1IBKT 5IWAT 2HHHT 4LF7T 2E5LT 3T1YT 4GKJT 4DV5T 4DR3T 4JI7T 1XMQT 4LFAT 2UUBT 4X66T 4JI3T 4YHHT 1HNXT 3OTOT 4DV4T 4JI6T 4K0KT 1N33T 2UU9T 1N32T 4DV0T 1N36T 4LF8T 1XMOT 1XNRT 4DR6T 4DV3T 4LFCT 4OX9T 4LF5T 2UXCT
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV6 T;  4X62 T;  1XNQ T;  4B3S T;  4DUY T;  1HNZ T;  1IBM T;  1HNW T;  4DR2 T;  4B3T T;  1HR0 T;  4JYA T;  4JI2 T;  4GKK T;  4LF9 T;  4DR4 T;  5LMU T;  1IBL T;  4DR7 T;  4NXM T;  2VQE T;  3T1H T;  4X65 T;  4DR1 T;  4JI1 T;  4KHP T;  4JI0 T;  4B3R T;  2VQF T;  2UUC T;  4JV5 T;  1FJG T;  2ZM6 T;  4AQY T;  4JI8 T;  4NXN T;  4JI5 T;  4LF4 T;  4DV7 T;  1J5E T;  1N34 T;  4DV2 T;  2UXB T;  4LF6 T;  4YY3 T;  1I94 T;  2F4V T;  4LFB T;  4DR5 T;  4B3M T;  5BR8 T;  2UUA T;  2UXD T;  4JI4 T;  4DUZ T;  4DV1 T;  5LMN T;  4X64 T;  1IBK T;  5IWA T;  2HHH T;  4LF7 T;  2E5L T;  3T1Y T;  4GKJ T;  4DV5 T;  4DR3 T;  4JI7 T;  1XMQ T;  4LFA T;  2UUB T;  4X66 T;  4JI3 T;  4YHH T;  1HNX T;  3OTO T;  4DV4 T;  4JI6 T;  4K0K T;  1N33 T;  2UU9 T;  1N32 T;  4DV0 T;  1N36 T;  4LF8 T;  1XMO T;  1XNR T;  4DR6 T;  4DV3 T;  4LFC T;  4OX9 T;  4LF5 T;  2UXC T; 
#chains in the Genus database with same CATH topology
 2Q9Q C;  4BJM A;  2E2A A;  2XAQ B;  4U2Y A;  2I0M A;  2JRK A;  4EIW A;  4HFB A;  2H3R A;  4UVB B;  2WP9 A;  5HCJ A;  2B1E A;  2IW5 B;  5ABF A;  2K24 A;  5DJQ C;  5AQM B;  4DUY T;  1IBM T;  4HTE A;  4PNI A;  3PUX F;  1HNW T;  2XQ9 A;  2WAU A;  2YDR A;  2X66 A;  1HR0 T;  3MA9 A;  3BQI A;  4H9P C;  3RIA A;  2BBJ A;  3RYI E;  5LG3 A;  2VAS A;  5LYJ E;  5F8P A;  2NWB A;  5F5W A;  5LNK A;  5HXR A;  4PFP A;  2AE9 A;  4AIS A;  4O4H E;  2E9X A;  1UGO A;  4GKK T;  3JC6 D;  2PJQ A;  2X51 A;  3H37 A;  2XQ3 A;  3HA4 A;  4P0B A;  4WW0 A;  5HAX A;  4LF9 T;  4DR4 T;  2V6Y A;  5CJ5 A;  4KX6 A;  2NOX A;  3JAF A;  3TLV A;  3ABV A;  1HTJ F;  2EHO B;  4H9R C;  1HX1 B;  1Y64 B;  3J9X 1;  3WAJ A;  3OJA A;  3KV6 A;  5AQS B;  1MMN A;  1FMW A;  4TWF A;  2C5K T;  5ABG A;  1KFY A;  2BBH A;  4X65 T;  4DR1 T;  1YKE B;  3CWZ B;  1S35 A;  1US7 B;  2UXX B;  2D5U A;  2XAH B;  1YXR A;  3LSV A;  3CKD A;  3N2G E;  2JPF A;  4XAX B;  3ZYK A;  2VQF T;  1R8I A;  4GK5 E;  4CN6 A;  2CWY A;  2V6X A;  2VL8 A;  4IHJ E;  5ABH A;  3ZJ1 A;  2WMN A;  1T7S A;  2BKO A;  3CQG B;  4O2A E;  4WYV A;  1WLX A;  2QA7 A;  3HKD E;  3KFW X;  3P4Q A;  3AE6 A;  2V5C A;  1E7P A;  2W67 A;  4NXN T;  1MIW A;  3DTO A;  4HWC A;  4A56 A;  3HL6 A;  5GON E;  4DV7 T;  4EV6 A;  2J47 A;  3ZN1 B;  5AFU L;  3HKC E;  4U2Z A;  3ZCJ A;  2NTX A;  3JAD A;  4EEB A;  3RHW A;  5HEG A;  4ZHQ E;  3AEF A;  4XZC A;  3ETU A;  3NBX X;  3EHZ A;  4LF6 T;  3OYX A;  2W0G A;  1BR2 A;  3ZYL A;  2BKP A;  2VB6 A;  3ZN0 B;  4MLK A;  2F4V T;  4LFB T;  2BG9 B;  4IE5 A;  4B3T T;  1V9D A;  3HI2 A;  3N9O A;  2X9W A;  2YDQ A;  2HN2 A;  2LE8 A;  3LFM A;  3N2O A;  3CIR A;  5L2L A;  2J1D G;  3IF8 B;  2BS3 A;  3QNU A;  4ADZ A;  2W00 A;  2D9D A;  3PUR A;  4OYJ A;  2DHR A;  3RIU A;  4HFV A;  5C2T A;  2FBW A;  2W62 A;  1WRD A;  4JI4 T;  4AKG A;  3A8Y C;  3QK6 A;  2X9X A;  2HH7 A;  3KVB A;  1D1B A;  4HFI A;  4TZ4 C;  4X1I E;  4YJ3 E;  5AQK B;  2ACX A;  3ONL C;  5IYZ E;  5LMN T;  3GN5 A;  3NRY A;  4TUY E;  4YHJ A;  3CX7 B;  1O3X A;  3AA0 B;  3LK4 2;  2BG9 A;  4MFR A;  4CXY A;  4ILA A;  4IE6 A;  2X67 A;  4IE0 A;  5FXW A;  3CX8 B;  3H3A A;  4NUV A;  4Q25 A;  4QH5 A;  4ZEY A;  3FZK B;  3PUA A;  4QKN A;  2DLR A;  2IML A;  2LHN A;  4TWD A;  2YEV C;  3UUB A;  4GKJ T;  1MMG A;  3KV5 A;  4JI7 T;  2LEH A;  2XSA A;  4H9S E;  4UEM A;  3U78 A;  3GMI A;  2UUB T;  1HNX T;  4JI1 T;  1YKH B;  2D0U A;  5L3B B;  4ZI2 D;  2NTY A;  1ZHC A;  2V26 A;  4ERR A;  4JV5 T;  2RA1 A;  2QYW A;  3AA1 B;  4JEH B;  4LML A;  2FJB A;  3ZC1 A;  4LMJ A;  5DQW A;  3ZSS A;  5C3J A;  3O1I A;  3PUZ F;  3I0Q A;  4ZZC A;  3O4X E;  3CX6 B;  2WB5 A;  3IA3 A;  1N36 T;  5J0Z A;  1X79 A;  4LF8 T;  2KIN B;  2WWV A;  1UK5 A;  1UUR A;  3VU7 H;  3UT5 E;  2MBG A;  2I59 A;  4YSX A;  4DR6 T;  2XTL A;  4H63 V;  4H9Q C;  3UU8 A;  1JNR A;  5HWY A;  4IDP A;  1D1C A;  1IJ6 A;  3AEB A;  2X9Y A;  3AA6 B;  2WBL A;  2X0Y A;  2JQ9 A;  3FZH B;  4N78 D;  5FKY A;  2VKO A;  3L3P A;  5J1G A;  5HXE A;  2YU2 A;  3LK3 B;  3RGL A;  5ABE A;  2IC9 A;  3K8P C;  2V7M A;  4CN4 A;  5L3E B;  5M4Y A;  2KWH A;  5FVL A;  4X62 T;  2YK0 A;  3I0O A;  3M3Z B;  2V7I A;  3QB5 K;  4KI0 F;  5EK2 A;  4ANJ A;  5AQR B;  5LGT B;  4KBM B;  3PU3 A;  4O4L E;  2JMH A;  3LBX A;  4O8S A;  1VOM A;  4DBQ A;  4F6R C;  5JH7 E;  5J2T E;  1HNZ T;  5KDM C;  1WFD A;  5LBQ B;  3G06 A;  5CA0 E;  1W9R A;  3AAI A;  3AB3 B;  3JAE A;  2K5B B;  3VR8 A;  3X1D A;  5KX5 E;  5LHG B;  1IJ5 A;  4H9N C;  4WZX A;  4OHF A;  5HXS A;  3B57 A;  2KWI B;  2IDO B;  2L9Q A;  5DQV A;  1HF8 A;  1SA0 E;  3Q2M A;  3RKG A;  5JRC A;  3F31 A;  2C5I T;  2XQ4 A;  5JDG A;  4DMW A;  2H7V C;  2Y8D A;  1LRZ A;  1FMV A;  1W0A A;  4QH4 A;  4UV9 B;  3U3I A;  4QWN B;  1VRB A;  5FXX A;  3UFE A;  2BS2 A;  5LBM A;  3EUH A;  3FZM B;  4U7I A;  2H89 A;  3ZMZ B;  4YTP A;  1T72 A;  4JUY A;  4EZ4 A;  5HXH A;  4DR7 T;  1HG2 A;  4NXM T;  3AXJ B;  5IUX A;  2CLY C;  5LHH B;  3ZT6 A;  3UFG A;  3AEE A;  3O1H A;  3AEA A;  4MHC A;  3T1H T;  3ZMV B;  1KEY A;  1E2A A;  3P4R A;  2HPJ A;  3CQC B;  4YTM A;  2QVA A;  3ESL A;  3MK7 C;  3Q5D A;  3ZKR A;  3LK2 B;  4MBQ A;  4PW8 A;  3TLW A;  4PFO A;  4HWH A;  1UUS A;  1OED B;  3R6N A;  3ZYM A;  3KV4 A;  4GIW A;  2D2S A;  5JTG A;  2Y48 B;  3VKG A;  3SFE A;  4B6X A;  1YQ4 A;  5L47 A;  4UV8 B;  3OYZ A;  4UVA B;  3W15 B;  1ZEE A;  2ZM0 A;  1YQ3 A;  2PTF A;  2XZE A;  4LF4 T;  1BR4 A;  2MTQ A;  2PFV A;  3L39 A;  5ABF B;  2BVM A;  2VKJ A;  3ZPO A;  5AQV B;  1CUN A;  2JQK A;  5JDM A;  3JCF A;  3ZEF B;  3OPC A;  4P09 A;  2LM9 A;  3RLF F;  4IDO A;  2K9A A;  5F3J A;  2L3L A;  2WDR A;  4QHO A;  3DJB A;  4Z91 A;  2GK9 A;  2WU2 A;  4IE4 A;  4J2C A;  2XHE B;  5LA6 E;  2NW9 A;  4GYS A;  4K0U A;  4HFE A;  1HX8 A;  4HFH A;  3V5U A;  2D0T A;  5LJM A;  4DR5 T;  5H6Q B;  4IRE A;  1XZY A;  4TNV A;  4TWH A;  3RRC A;  3KVA A;  4DND A;  4YY3 T;  4A5X A;  3C4Z A;  1M62 A;  3CQX C;  5FL1 A;  3P50 A;  3PE0 A;  5BR8 T;  3NVO A;  3IEE A;  1QSD A;  1KNP A;  3K1S A;  5HEU A;  2UXD T;  3WAK A;  1GQE A;  3IHR A;  5L3F B;  3ONX A;  2ES0 A;  1FEW A;  4DUZ T;  4B3M T;  2QGS A;  4TV9 E;  3VKH A;  1M7K A;  1DU2 A;  2MOZ A;  2OA5 A;  4NPP A;  3AA7 B;  3C98 B;  4IT4 A;  4QXH B;  4UR9 A;  1E1H B;  1D0Y A;  3N5L A;  2HHH T;  3EAB A;  2DI4 A;  4IL9 A;  3P4W A;  4QH1 A;  3EAM A;  2JQQ A;  2ODV A;  3MZK B;  4G63 A;  1MMD A;  3WI3 A;  4QXC B;  1MIV A;  4GK0 E;  4MAL A;  2VKD A;  3C51 A;  1IAP A;  1XMQ T;  3S4U A;  2W61 A;  2M6I A;  2H88 A;  2XQ7 A;  3UU4 A;  4IIJ E;  1VCT A;  2B76 A;  4P1N A;  2VK9 A;  2WS3 A;  3AE1 A;  3AVS A;  3JC6 C;  4ZS2 A;  3UUL A;  4ZI7 E;  5LP6 E;  4DV4 T;  3NKZ A;  2CHO A;  3EVY A;  5FP3 A;  4EXT A;  2VVS A;  3RRW A;  3UTK A;  3ZT5 A;  2M67 A;  3ZST A;  2XY8 B;  3NRX A;  4X1K E;  4ZI3 D;  2XSB A;  1X9B A;  2EHO A;  1J5W A;  1H7C A;  2FUP A;  3E08 A;  4QXB B;  4YLH A;  4ZS3 A;  5ETW A;  5AQF B;  2LJL A;  1NEK A;  5LCY A;  2Z6E A;  2VL0 A;  4U3C A;  3ZMS B;  2XQA A;  3PU8 A;  3ANW A;  2CXD A;  4TN7 B;  2PBI A;  3F57 A;  5HEH A;  4HWD A;  3FHN A;  1MMA A;  3PUS A;  2YDS A;  2WQY A;  3Q5X A;  1T8B A;  5L3D B;  4HWF A;  5A1L A;  4OX9 T;  1WYB A;  2ZMA A;  1OXZ A;  1BR1 A;  5JRC B;  3PUQ A;  2LSG A;  2E9X D;  4DID B;  2FJA A;  4PJN A;  4EED A;  4DV6 T;  2LOP A;  4AXP A;  4CXW A;  1HG5 A;  2CMR A;  2WY2 A;  3AEG A;  2P9B A;  2NP9 A;  4UXN B;  2KMF A;  2E8I A;  4BAY B;  4UF0 A;  3I1A A;  2V7J A;  3GN5 B;  1S94 A;  2NR4 A;  3N9P A;  2JQH A;  3P7I A;  4YFS A;  2RPA A;  1LVK A;  3C50 A;  4IDZ A;  4B3S T;  2WWU A;  1KNZ A;  1UCU A;  2LT3 A;  3VHL A;  4DR2 T;  3OVU A;  4UEL A;  2V8S V;  2J4G A;  4I43 B;  2CE7 A;  1LKX A;  3VRA A;  2FJD A;  1UX4 A;  3AED A;  5LOV E;  2KXP B;  1KF6 A;  1D0X A;  3Q9D A;  5JDQ A;  3RC8 A;  5AQU B;  5CGM A;  1ZOY A;  2ZLY A;  4EOZ B;  2HN1 A;  2BVL A;  5AQO B;  3ZJ2 A;  2LRK A;  4HKA A;  3K3O A;  2LKH A;  4YJ2 E;  2W2U A;  3MAC A;  1YD8 G;  3F2E A;  3LDQ B;  3AE2 A;  1IBL T;  5AQL B;  2WM9 A;  2IIU A;  2EHO D;  3RYH E;  1U4Q A;  2BS4 A;  2DNX A;  4FJO A;  5CFB A;  2C5J A;  2IC6 A;  1KNR A;  4IST A;  3VRB A;  4DVD A;  5HWX A;  2XAS B;  3PV0 F;  1W0B A;  3H3M A;  2WDV A;  3PTR B;  5FY1 A;  2A9U A;  2FJE A;  4CZZ B;  3QB5 A;  4KHP T;  4PK4 A;  4OFZ A;  4AI6 A;  4JEU B;  4WNK A;  2ODU A;  4PK6 A;  4TX5 A;  4U7Y A;  2CHN A;  2BZB A;  4ASK A;  3BK9 A;  2E9X C;  1FJG T;  2XQY A;  4ZOL E;  5LB7 B;  1XDP A;  2Q9Q D;  3RYF E;  2YKS A;  3RF1 A;  3RX6 A;  4E7Z A;  3CML A;  4JI8 T;  3N9N A;  1W09 A;  2MPK A;  2ZM2 A;  3EI0 A;  4UIG A;  4JI5 T;  5JR9 C;  5KXJ A;  3FZF B;  2XPK A;  4I0U A;  5JR9 B;  3LG7 A;  4JBW F;  1N34 T;  1QLB A;  2MYS A;  5FYM A;  3RQU A;  4KMC A;  2VVN A;  4KP3 C;  3TLU A;  3RQW A;  4C91 A;  5JDL A;  5AQJ B;  4NIQ A;  2J62 A;  3AAE B;  4KUM B;  4O4J E;  3RYC E;  2W4X A;  1MND A;  2YOE A;  4EB6 E;  2UXB T;  4LMK A;  5JQG E;  3UQ7 A;  4AQF A;  5IHY A;  3GA8 A;  3MKD A;  3SFD A;  4DBR A;  3O1J A;  3AVR A;  3AE3 A;  2KT9 A;  4QX7 B;  4V1A v;  5HYA A;  4COF A;  5AQI B;  1T98 A;  2BKN A;  3HKE E;  3K3N A;  3NWI A;  5TAO A;  5CA1 E;  3OKQ A;  5EK3 A;  3QOF A;  2UUA T;  2WSS V;  4E7S A;  2WDQ A;  3PJA A;  3RI5 A;  4O2B E;  4HN9 A;  4X5T A;  2NW7 A;  4X1Y E;  1N32 T;  2SPC A;  3HR0 A;  3AE7 A;  5IWA T;  4XBF B;  2CXL A;  3AEC A;  1BR0 A;  5HXC A;  4M1P A;  4WBO A;  2X68 A;  4PK5 A;  3TLT A;  4CI1 B;  2KND A;  2HPL A;  3T1Y T;  5LG4 A;  2CCQ A;  2DL1 A;  2XJ7 A;  1WR6 A;  3NZQ A;  3KIN B;  1Z0P A;  5L4H A;  1SUM B;  2KSR A;  2XM1 A;  3RKO A;  4GYR A;  1OWA A;  4DR3 T;  3O9X A;  1IZN B;  4LFA T;  2LKG A;  2EHO C;  1JNZ A;  2A72 A;  2V5D A;  3PDY A;  3AE8 A;  4YSY A;  5LHI B;  3FBL A;  1QUU A;  2XM2 A;  2XAJ B;  3UUM A;  3QUJ A;  2E5V A;  5JDH A;  2WMO A;  3OTO T;  3UUX B;  4AKH A;  2KZ7 B;  3AE5 A;  1NAF A;  4UF0 B;  5AQN B;  4ZI3 C;  2LSJ A;  4DV0 T;  2UXN B;  2CA5 A;  2CM0 A;  4U72 A;  5L3C B;  1XMO T;  1Y01 A;  3N9L A;  2WZH A;  4YSZ A;  5AQP B;  2OLT A;  4I55 E;  2JMK A;  4ZI2 C;  2W63 A;  4IGU A;  4OYK A;  4DV3 T;  5HCM A;  2N9D A;  3R84 B;  2X9H A;  3C4X A;  3ZC0 A;  1AJ3 A;  1KK7 A;  5H6R B;  2X0H A;  5AQQ B;  2I6H A;  2V7L A;  4AKL A;  3AE9 A;  5LJN A;  1I6Z A;  4JLE A;  4BA9 A;  2UXC T;  4FI5 A;  5CB4 E;  4EYY R;  2K48 A;  5EZY E;  4ZXL A;  2A3D A;  2IAK A;  3BQL A;  4L0R A;  2YN6 A;  3CVR A;  1Z8U A;  5FVK A;  2IHR 1;  2Q9Q B;  3RIF A;  2WZI A;  4CQI A;  1XNQ T;  2NW8 A;  2VUR A;  2V1D B;  3A5X A;  4HGA A;  3RH3 A;  1WR0 A;  3DP7 A;  3LBX B;  3P8C D;  3N9M A;  3PUW F;  3ZLI A;  2PG8 A;  3EDV A;  4QX8 B;  2V7K A;  5FY0 A;  1NEN A;  3FXD B;  5JDF A;  2DWK A;  2CBI A;  2VKH A;  3CPZ A;  3MJX A;  4HFC A;  4IE7 A;  2CPT A;  4ILU A;  4AQF C;  2XAF B;  1L0V A;  3NZP A;  3L8R A;  3P4S A;  2QRX A;  1MIY A;  1B7T A;  3LJC A;  2XQ5 A;  2ACZ A;  3ZCI A;  4ISS A;  5AQH B;  4JYA T;  4JI2 T;  2LSK A;  3L09 A;  2Q9Q A;  3N9Q A;  2YIN A;  5FY7 A;  3UU5 A;  5LMU T;  3A7M A;  2W66 A;  5E0O A;  2LHR A;  2H7O A;  3SRZ A;  3ZMU B;  3ZT7 A;  4HFD A;  2LSI A;  2N1G A;  3Q5W A;  3B13 A;  2RP4 A;  3M65 A;  4H9O C;  4TNW A;  4JI0 T;  3KBT A;  5FNV E;  4PJL A;  2CLY B;  3J7Y q;  2VQE T;  5FXV A;  2UU9 T;  4AKR B;  2KLQ A;  5KMG P;  2M6B A;  4ILB A;  3T8O A;  4YTN A;  3ANW B;  2N2N A;  1ZV4 X;  3ONJ A;  2CWO A;  3P4P A;  3C64 A;  1OED A;  3RPU A;  3C4W A;  2AXD S;  4AIU A;  4P0A A;  3KDS E;  4G2A A;  2UUC T;  4B3R T;  4U33 A;  4PJM A;  4AQG A;  3FZL B;  5LGN B;  2ZM6 T;  4AQY T;  4L9I A;  4U31 A;  1J1J A;  2G0U A;  1ZP0 A;  4O4I E;  4DO0 A;  5FL0 A;  2XQ6 A;  2DCF A;  1HS7 A;  5JVD E;  2R6G F;  2XAG B;  4EAH A;  4YXD A;  3N2K E;  3UU6 A;  1J5E T;  1VCS A;  2XQ8 A;  4C90 A;  1EZ3 A;  2CRB A;  4I50 E;  1HCI A;  1XDO A;  4CXX A;  1YW0 A;  4IL4 A;  1D0Z A;  2CEA A;  5FXZ A;  3TKL B;  3FXE B;  3PJA J;  2CBJ A;  3E0Z A;  4DV2 T;  2LLY A;  4AKI A;  4YT0 A;  1HFA A;  1OED C;  4KHZ F;  1I94 T;  4H63 H;  4GOU A;  3PUV F;  5FMN A;  3FBZ A;  3BQK A;  3B5M A;  2YU1 A;  4NUU A;  4BJN A;  5LXT E;  4X20 E;  4HEA A;  3UUN A;  4EYU A;  4EZH A;  4F8H A;  4PJJ A;  5ADX L;  3IBP A;  4L5G A;  3EDU A;  3QC9 A;  2IUB A;  4EGW A;  2A2F X;  1WYC A;  4CI3 B;  1G73 A;  3KBU A;  3ETV A;  4UVC B;  4DV1 T;  5L4E A;  2MAW A;  4X64 T;  1IBK T;  3I9W A;  1XWM A;  3PUG A;  5AQG B;  2K3W A;  4A98 A;  4LF7 T;  2BDE A;  1OED E;  5JDN A;  2OV9 A;  3Q5E A;  3HKB E;  5HEO A;  2E5L T;  1XNR T;  4HE8 A;  1LVF A;  3RIU C;  4U74 A;  4A97 A;  2CXF A;  4Z8X A;  5DAB A;  3PUY F;  3CK6 A;  3SOL A;  5LGU B;  3UU3 A;  5C8Y E;  3FB2 A;  4DV5 T;  5HEJ A;  2V6Y B;  4IDN A;  3E22 E;  4PAG A;  4X66 T;  4JI3 T;  5EK4 A;  3SWH A;  5JR9 A;  4YHH T;  4Z90 A;  2BG9 E;  2X0L B;  2LM2 A;  3D0T A;  4CN1 A;  1G8X A;  1MNE A;  1U5P A;  3AAA B;  1NWM X;  1WCR A;  2L8K A;  5JRE A;  2JIW A;  4JI6 T;  4K0K T;  4ILC A;  1N33 T;  5AQT B;  1SE7 A;  2LOS A;  2ZM8 A;  3AXJ A;  3ZMT B;  2WCA A;  3RC3 A;  4IDQ A;  3K3Q C;  1D1A A;  2VWA A;  3MXZ A;  3OBV E;  2C0S A;  1CHU A;  4OK0 A;  4DMV A;  5L3G B;  4ZZB A;  4HWI B;  2DWG A;  3TLS A;  5J2U E;  4I4T E;  1ZKE A;  3I9Y A;  2Y6X A;  4LFC T;  4TV8 E;  1SHZ C;  2LSY A;  3VR9 A;  2JJ9 A;  4LF5 T;  2E9X B;  3KV9 A;  5BMV E;  1FIO A;  2LRL A;  1UX5 A;  3AE4 A;  3SS1 A;  3UQ4 A;  3V5S A;  2BG9 C;  4WBN E;  4CI2 B;  2WU5 A;  3GWH A;  2XUE A; 
#chains in the Genus database with same CATH homology
 4DV6 T;  4X62 T;  1XNQ T;  4B3S T;  4DUY T;  1HNZ T;  1IBM T;  1HNW T;  4DR2 T;  4B3T T;  1HR0 T;  4JYA T;  4JI2 T;  4GKK T;  4LF9 T;  4DR4 T;  5LMU T;  1IBL T;  4DR7 T;  4NXM T;  2VQE T;  3T1H T;  4X65 T;  4DR1 T;  4JI1 T;  4KHP T;  4JI0 T;  4B3R T;  2VQF T;  2UUC T;  4JV5 T;  1FJG T;  2ZM6 T;  4AQY T;  4JI8 T;  4NXN T;  4JI5 T;  4LF4 T;  4DV7 T;  1J5E T;  1N34 T;  4DV2 T;  2UXB T;  4LF6 T;  4YY3 T;  1I94 T;  2F4V T;  4LFB T;  4DR5 T;  4B3M T;  5BR8 T;  2UUA T;  2UXD T;  4JI4 T;  4DUZ T;  4DV1 T;  5LMN T;  4X64 T;  1IBK T;  5IWA T;  2HHH T;  4LF7 T;  2E5L T;  3T1Y T;  4GKJ T;  4DV5 T;  4DR3 T;  4JI7 T;  1XMQ T;  4LFA T;  2UUB T;  4X66 T;  4JI3 T;  4YHH T;  1HNX T;  3OTO T;  4DV4 T;  4JI6 T;  4K0K T;  1N33 T;  2UU9 T;  1N32 T;  4DV0 T;  1N36 T;  4LF8 T;  1XMO T;  1XNR T;  4DR6 T;  4DV3 T;  4LFC T;  4OX9 T;  4LF5 T;  2UXC T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...