2LEHA

Solution structure of the core smn-gemin2 complex
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
189
structure length
189
Chain Sequence
GYSPTLQWQQQQVAQFSTVRQNVNKHRSHWKSQQLDSNVTMPKSEDEEGWKKFCLGEKLCADGAVGPATNESPGIDYVQIGFPPLLSIVSRMNQATVTSVLEYLSNWFGERDFTPELGRWLYALLACLEKPLLPEAHSLIRQLARRCSEVRLLVDSKDDERVPALNLLICLVSRYFDQRDLADEPSLEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Survival of motor neuron protein-interacting protein 1
publication title Solution structure of the core SMN-Gemin2 complex.
pubmed doi rcsb
source organism Homo sapiens
total genus 38
structure length 189
sequence length 189
ec nomenclature
pdb deposition date 2011-06-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1070 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2lehA00
2LEHA
chains in the Genus database with same CATH superfamily
4GYSA 1Y01A 3A5XA 2XSBA 3K3NA 3PUAA 2WWVA 5HYAA 5AQRB 2VQET 5KX5E 4UEMA 5EK3A 3N2OA 5HXRA 2BZBA 2LOSA 3K3QC 2LHNA 3VHLA 5AQHB 1Z0PA 4U2YA 4AQGA 1YQ4A 1CUNA 2WMOA 3C50A 5LCYA 4UELA 5CB4E 2QGSA 3UU4A 3KV6A 4FI5A 5LHHB 4ZI2D 2ACXA 2XTLA 3OYZA 2K5BB 2WCAA 3UUMA 3ZPOA 3QB5A 3BQLA 4JI2T 4UVBB 4DV6T 3P8CD 2D0TA 5H6RB 2X68A 2WDRA 4JI1T 5FL1A 4QH1A 3PTRB 5LOVE 2IUBA 1US7B 1D0XA 2ZM8A 1KFYA 4H9OC 4HGAA 3V5SA 4QXCB 3VU7H 3VRAA 5L4EA 2CHOA 3JC6D 5AQLB 4KP3C 2X9WA 2LRLA 2ODVA 2X9XA 3FZFB 3KBUA 1WR6A 4B3RT 2WSSV 3B5MA 4TZ4C 2J4GA 2VQFT 4HFIA 4QKNA 5LMUT 4KBMB 5LYJE 4PFOA 4P0AA 4ZOLE 2W66A 2E9XA 3S4UA 4P1NA 5AQQB 4UIGA 4HFHA 1I94T 2NW7A 3RRCA 3MACA 5JVDE 3CX6B 3FZLB 2BG9E 4DV2T 3FBLA 4WBNE 5EK2A 4DO0A 3ONXA 1WCRA 2FJAA 4DNDA 4ZI7E 1BR4A 5LP6E 2CXFA 2LKHA 2W61A 1KNZA 3NRYA 4DV7T 5L47A 2WMNA 4HWCA 4GKKT 1WR0A 3ZN0B 3ZMTB 5LXTE 4AKLA 2CBIA 2KINB 1D1CA 5C8YE 4TNWA 4EZHA 2YOEA 2YDRA 4COFA 3QUJA 3RI5A 4ZS3A 3PDYA 4IE6A 1LVKA 2UXDT 5FXZA 3LSVA 1N36T 5LMNT 4BJMA 5BR8T 1WRDA 5AQOB 5LA6E 5J0ZA 3P4RA 1X79A 2X51A 4DR6T 2JIWA 3KV9A 2VURA 3ZT5A 4ZZCA 4EYUA 3ZMVB 4EEBA 2XQAA 2RPAA 2IMLA 3OVUA 4YTPA 5LBMA 1JNRA 2LEHA 2C5JA 4DUYT 2V26A 3UULA 3SRZA 4EGWA 2L3LA 1WFDA 3QB5K 4C91A 4UV9B 1IJ6A 4CZZB 4ZZBA 5HXHA 4OHFA 4A5XA 3ETUA 3GMIA 3ZJ1A 5E0OA 3K3OA 5GONE 5JDLA 2KLQA 2LJLA 2SPCA 2LSIA 1CHUA 3KVAA 4DV4T 3AEGA 2KT9A 5JR9A 2I6HA 1MNDA 3J9X1 3AAEB 5L3FB 3PUZF 1KF6A 3ZSSA 2NTXA 2MPKA 3TLSA 4WBOA 1VOMA 4AQFC 3EUHA 3Q5EA 5LNKA 2WP9A 5FP3A 3PJAJ 5LBQB 3PURA 4UV8B 4ASKA 1Z8UA 4Z90A 5LHIB 2UUAT 2JMHA 2NW9A 2N9DA 2DCFA 2B1EA 4DMWA 3P50A 1KK7A 3CPZA 5JDMA 2UXNB 3O4XE 4XZCA 2KXPB 2XQ9A 3FZMB 5AQMB 2JQHA 3E0ZA 4HWIB 3GA8A 2OV9A 4EZ4A 5M4YA 2C0SA 4O4IE 2F4VT 2V6XA 3AEDA 1IZNB 1MIYA 5TAOA 3RIFA 1BR0A 1S35A 1J5WA 5JREA 2VKHA 1H7CA 1T98A 2XPKA 1UK5A 1UX4A 1UCUA 4IDPA 4DV0T 3UQ7A 5DQWA 4IT4A 3NZPA 5FKYA 4U72A 5FNVE 4M1PA 4BAYB 2CXLA 3RYFE 4E7SA 3R84B 3PUSA 3ZT6A 4TV9E 1MMAA 3EHZA 4ILCA 5AFUL 1MMGA 3N2KE 4IE7A 2CM0A 4YLHA 4DUZT 4ILUA 5L3BB 2LOPA 4U31A 2V5CA 4OK0A 3H37A 2X0YA 3ZSTA 5AQKB 4LF4T 3FZKB 5H6QB 4X62T 3AE3A 4IREA 4OYKA 2Z6EA 3NWIA 3ONLC 3VR9A 3O1HA 4O2AE 2YDQA 3M65A 4OFZA 4PJLA 2BS4A 4H63H 2XQ4A 4YFSA 4A97A 2VASA 4CI2B 3UUNA 3N9MA 2LRKA 2PTFA 3CVRA 2IW5B 2LM9A 2RA1A 2DLRA 3C4ZA 2C5KT 5HWYA 2BKOA 2WB5A 5AQPB 4IL4A 5EZYE 3AEBA 4LFCT 3CIRA 1LKXA 3ZJ2A 1OEDB 1XWMA 1OEDA 2V7IA 4G63A 1YKHB 1QLBA 1XNRT 2XQ5A 3QK6A 4MFRA 4U3CA 1EZ3A 3AE7A 3BK9A 2H89A 1NENA 3GN5B 2H3RA 3G06A 4JEHB 5DABA 4MLKA 3U3IA 4H9NC 4I0UA 4QH5A 3BQIA 4X1YE 3ONJA 1BR2A 3J7Yq 2CBJA 5LHGB 1R8IA 5CA1E 3AE2A 3UU5A 2C5IT 2BG9C 5HCJA 4F8HA 2V5DA 3JCFA 4NUUA 2YINA 4CN1A 5IWAT 4YXDA 4X20E 5AQIB 2N1GA 3C51A 3KVBA 3H3AA 2LT3A 4PAGA 4QXBB 1DU2A 4B3ST 3RKOA 3AE9A 4YSZA 1MNEA 3W15B 2NWBA 4Z8XA 4AIUA 2JQQA 2V1DB 3IEEA 3PJAA 3C98B 3O1JA 3ZLIA 2ZM2A 1SUMB 3I9YA 4NXMT 2HH7A 2KNDA 1YKEB 5J1GA 4GIWA 3TKLB 1ZKEA 2ACZA 1FMWA 3ESLA 1SE7A 3PU3A 4QX7B 2BKPA 4B3TT 2JPFA 2ZM6T 5FVLA 1ZP0A 2UU9T 4DIDB 3SOLA 3UT5E 4A56A 5JDGA 3M3ZB 1SA0E 2H7OA 4CXYA 3EDUA 3LK42 3RHWA 4DR1T 3U78A 3ZMSB 4ERRA 5EK4A 4KHPT 4JI5T 3ZT7A 3C4WA 1OXZA 2WQYA 4PK6A 4AKRB 4HFVA 5CJ5A 2LSKA 3KV5A 3ZC1A 3AE5A 5JDFA 5FXXA 1N32T 2BDEA 5JRCB 4GYRA 3Q2MA 5JRCA 2E9XB 3P7IA 3EAMA 3ZKRA 2Q9QC 1OWAA 4JV5T 1HCIA 1YXRA 1IBMT 2NTYA 3SWHA 2W2UA 2NR4A 5HEOA 5HXCA 3HL6A 3BQKA 5DJQC 4ANJA 4EB6E 3I1AA 2WDQA 2X9YA 2EHOB 4L0RA 3LK3B 2I59A 2EHOA 3RQWA 4KMCA 4ZXLA 1E7PA 2CWOA 4DV3T 2DWKA 3FXEB 5ABGA 1ZV4X 2Y48B 2JJ9A 2IC6A 1VRBA 2LSYA 3DJBA 3N9NA 3NKZA 3PUQA 5FL0A 2H7VC 3OBVE 1HF8A 2R6GF 2FJBA 5FY0A 1KEYA 4EAHA 3UUXB 2CLYB 2X0HA 4QX8B 2KSRA 1J1JA 1XMQT 3KFWX 4ZEYA 2MBGA 4AKHA 4IDZA 4JYAT 4XAXB 4KX6A 2Q9QD 2K3WA 2E5LT 4EIWA 3R6NA 4LF7T 3HKCE 3UUBA 4YY3T 4EYYR 4HE8A 4QXHB 1WYBA 2JMKA 2E5VA 4IDQA 2YU1A 3MJXA 3RIUC 3PUGA 2BS3A 3EI0A 4JI0T 4Q25A 2HN2A 2A2FX 2W62A 4AQYT 1HNWT 4AXPA 4YSXA 2QVAA 4WNKA 4TNVA 2DHRA 5L2LA 3CQGB 5AQUB 5JR9B 2V8SV 4EOZB 1XDOA 4NIQA 5IUXA 5ADXL 1UUSA 3HKEE 3P4SA 4F6RC 4G2AA 2UUBT 1OEDE 4UXNB 2MOZA 2LKGA 3F57A 3ZN1B 5C2TA 2CRBA 4HN9A 4DMVA 4JUYA 4I50E 3AA7B 4QHOA 5BMVE 4H9QC 3AE1A 5L3CB 3TLTA 3AE8A 4GK5E 4U74A 1NEKA 4C90A 1XNQT 5LGTB 2FJDA 1B7TA 2VWAA 3LBXA 2PG8A 4DVDA 3FB2A 5CFBA 3KBTA 3AEEA 3LDQB 1IBLT 5FXWA 4U2ZA 4J2CA 4IGUA 3N9PA 3SFDA 5IHYA 5ABFB 5ABFA 5HEHA 3RH3A 4UR9A 3B57A 3FZHB 3RPUA 5DQVA 1O3XA 5HCMA 3ZYMA 4HWDA 2XZEA 4B6XA 4PJMA 1D0ZA 2J62A 3D0TA 2G0UA 4PJJA 2BBHA 2W4XA 4ILAA 2XAQB 2UXBT 2IHR1 2B76A 4CXWA 3QC9A 3LK2B 2Y8DA 4V1Av 3E08A 4DV1T 5J2UE 1U5PA 1XMOT 4IE5A 3EDVA 2V7JA 4JLEA 1HS7A 2HN1A 2MYSA 3Q5WA 4EV6A 3LJCA 2WU5A 2D2SA 4DR7T 2M6IA 2D9DA 5LG3A 4CN6A 2PJQA 2VL0A 5FY1A 4H63V 3N9OA 4ZS2A 1BR1A 2M67A 5HEUA 2CLYC 2QRXA 4QH4A 2Y6XA 3RIAA 2OLTA 2UUCT 4I4TE 1W0BA 4ZI3C 3AECA 3ZEFB 1LVFA 2WS3A 2W00A 3AA0B 1ZEEA 3SS1A 3NBXX 3C64A 2ZLYA 3AA6B 4UF0A 2FJEA 4XBFB 2HHHT 5FXVA 3RYHE 4K0KT 4KI0F 4X65T 3O9XA 4N78D 4CXXA 3V5UA 2KWIB 4PFPA 4LF5T 1FEWA 3MA9A 4DR4T 3HKBE 2ES0A 3RYIE 3IBPA 3F2EA 4JI6T 1MMNA 2UXXB 1D1BA 1G73A 4X1IE 2X9HA 3HKDE 3OKQA 4CI1B 3A7MA 3PUVF 3P4PA 4WYVA 3RC8A 5LJNA 5C3JA 1YW0A 1J5ET 1S94A 2CA5A 2XQ8A 3ZMZB 2BVMA 1D0YA 2W63A 4OYJA 2CMRA 5ABEA 4ZI3D 3CX7B 3UU6A 5KDMC 2W67A 2ZMAA 2GK9A 3RQUA 3MK7C 4IHJE 4GKJT 2A9UA 4IL9A 1FIOA 3AE4A 1Y64B 4LF6T 2V6YA 4JEUB 3I0OA 3QNUA 3IF8B 4O4HE 5HEGA 3P4WA 4LMJA 2D5UA 5LB7B 1E2AA 4AKIA 1T72A 4LMLA 3QOFA 4MALA 1D1AA 4DR5T 5AQTB 3T8OA 4OX9T 2VKOA 3B13A 2LSGA 4KUMB 2YEVC 5IYZE 4E7ZA 3NZQA 2ODUA 3H3MA 1T7SA 4U7IA 4UVCB 5CA0E 4YSYA 3K1SA 3RIUA 2NOXA 2BS2A 4DV5T 4LF8T 5HXEA 3RRWA 2FBWA 1NAFA 4TWDA 4P0BA 2WY2A 3FHNA 2K48A 4HFEA 3OJAA 3N9LA 1W9RA 5HXSA 2ZM0A 1HNZT 3DP7A 5AQJB 2WU2A 2IIUA 3T1HT 2X0LB 3ETVA 2YK0A 4ZHQE 2CXDA 3AXJB 3N2GE 3CK6A 3AXJA 4TUYE 5AQNB 4LFBT 4AQFA 4TWHA 1KNRA 1WLXA 5F5WA 5FY7A 2KWHA 3PV0F 2V7LA 2WZHA 4H9SE 2LM2A 1UX5A 1IAPA 4HWFA 3CQXC 2XHEB 5KXJA 4O2BE 3KV4A 4GOUA 4BJNA 1AJ3A 4ADZA 2VK9A 5LJMA 3RC3A 2QYWA 3AAAB 5JTGA 5L4HA 3WAKA 3NRXA 2X66A 3X1DA 2XAGB 2YN6A 3WI3A 3L8RA 4WZXA 2K24A 4QWNB 1GQEA 1OEDC 3HI2A 3AAIA 3VKGA 3RLFF 2AE9A 4L9IA 3ZMUB 4YHJA 4LF9T 4L5GA 2P9BA 2MAWA 3KINB 4X66T 2CE7A 3LG7A 5ETWA 2KMFA 1WYCA 2XQ7A 3N5LA 4TX5A 3ZC0A 5AQFB 5HWXA 4X64T 4X1KE 2N2NA 2E2AA 3MZKB 4IIJE 4DBRA 3LFMA 3I0QA 5L3GB 3K8PC 4NXNT 1N34T 4HFDA 3EVYA 3E22E 3PUWF 5FMNA 1QUUA 2XAFB 4HFCA 3HR0A 2CWYA 4FJOA 1V9DA 2CHNA 3RGLA 3OTOT 2YU2A 5LGNB 1MMDA 2JQKA 2JRKA 4PW8A 1I6ZA 3TLWA 2K9AA 2LHRA 3VR8A 3IHRA 2DWGA 3O1IA 1HFAA 3UTKA 5J2TE 1L0VA 2DNXA 2VKJA 2A72A 5HEJA 4YJ3E 4ISTA 1XZYA 5KMGP 3PU8A 2WM9A 3TLUA 3CX8B 2OA5A 4CI3B 2BKNA 3TLVA 5AQSB 1XDPA 2QA7A 3CKDA 3JAFA 4DR2T 2BVLA 4PNIA 4YJ2E 2LLYA 3Q5XA 4EEDA 4X5TA 3MKDA 3UFEA 4K0UA 1SHZC 4BA9A 4NUVA 4ILBA 4O4JE 3OPCA 3CWZB 4JI4T 3UU8A 4HKAA 3JADA 4AKGA 5JDQA 4UVAB 4JI7T 4WW0A 3PE0A 4HFBA 3P4QA 1HG5A 3JAEA 4IE0A 2CEAA 3C4XA 2HPLA 4Z91A 4A98A 3VRBA 3WAJA 1M7KA 3RKGA 1YD8G 2YDSA 2LSJA 3LBXB 2W0GA 3L39A 4DR3T 2I0MA 1N33T 3VKHA 4MBQA 1MIVA 3UQ4A 2XM1A 2XASB 3F31A 4LMKA 2BG9B 1UURA 4CN4A 1VCTA 2XAJB 1HTJF 2BG9A 3AEFA 4YT0A 2PBIA 1ZHCA 2XQYA 1KNPA 5HAXA 3PUXF 3SFEA 4H9PC 2E9XC 3ANWB 2YKSA 3I9WA 2VVSA 4P09A 3ANWA 3AVSA 3AE6A 3UFGA 4NPPA 5JDHA 2XY8B 1T8BA 3Q9DA 2UXCT 1W0AA 5F3JA 4ISSA 4YTNA 2V7MA 2MTQA 4PK4A 2L9QA 2WAUA 2XJ7A 3ZCIA 4JI3T 5ABHA 2A3DA 1UGOA 1NWMX 3ZYLA 3AA1B 2EHOC 3RX6A 2RP4A 2IAKA 1U4QA 4DBQA 2D0UA 2XM2A 4H9RC 1HX1B 3UU3A 2HPJA 4O8SA 3ZCJA 5F8PA 1HX8A 4IDNA 1E1HB 5FVKA 1X9BA 4LFAT 1HG2A 5A1LA 4CQIA 1IBKT 2KZ7B 2CCQA 3EABA 3L3PA 1ZOYA 2XQ6A 2XUEA 3L09A 2WWUA 5AQGB 1FMVA 2E9XD 1QSDA 4PJNA 1IJ5A 4UF0B 4TV8E 3Q5DA 3PUYF 3CQCB 2AXDS 2M6BA 3MXZA 5AQVB 1JNZA 2JQ9A 4HTEA 2H88A 4MHCA 1HR0T 3CMLA 2XQ3A 4YTMA 3N9QA 2EHOD 2Q9QB 4AISA 2V7KA 2Q9QA 5L3DB 2LE8A 1MIWA 5FYMA 2PFVA 4EXTA 2J47A 1LRZA 3FBZA 3AVRA 4GK0E 3ABVA 2IC9A 5JQGE 4U7YA 2XSAA 5LG4A 3HA4A 3A8YC 5JR9C 2VVNA 4KHZF 1M62A 2VKDA 2E8IA 2WDVA 2NP9A 1HNXT 3GWHA 3OYXA 2BBJA 2FUPA 4TWFA 2L8KA 3AEAA 3NVOA 3RYCE 3AB3B 2XAHB 2DL1A 4IE4A 4I43B 3FXDB 4YHHT 4PK5A 3RF1A 2VB6A 3GN5A 3IA3A 2V6YB 3DTOA 5JH7E 2VL8A 2WZIA 4ZI2C 1G8XA 4IDOA 1W09A 2DI4A 5JDNA 5L3EB 4AI6A 2WBLA 3KDSE 4JI8T 2X67A 4HEAA 5CGMA 4HWHA 4B3MT 2NW8A 4I55E 4JBWF 4O4LE 1FJGT 2IDOB 5LGUB 1VCSA 2CPTA 3ZYKA 1YQ3A 4TN7B 4U33A 2J1DG 3T1YT 3JC6C
chains in the Genus database with same CATH topology
2VASA 4HN9A 4DMVA 4JUYA 4GYSA 4I50E 4CI2B 4X1KE 3A5XA 3AA7B 2N2NA 4QHOA 3UUNA 3K3NA 3N9MA 3PUAA 5BMVE 5HYAA 3CVRA 4H9QC 2IW5B 5KX5E 4UEMA 2LM9A 5L3CB 2RA1A 2DLRA 3C4ZA 2C5KT 5EK3A 5HWYA 3MZKB 4GK5E 4IIJE 4U74A 4DBRA 4C90A 3LFMA 5LGTB 3N2OA 3I0QA 5HXRA 2BZBA 2LOSA 1B7TA 2VWAA 5EZYE 3K8PC 3K3QC 5L3GB 3LBXA 2PG8A 2LHNA 4DVDA 3FB2A 1LKXA 3KBTA 3VHLA 3EVYA 3E22E 3ZJ2A 1Z0PA 5FMNA 5FXWA 4AQGA 1CUNA 1QUUA 2WMOA 3C50A 4J2CA 5LCYA 2XAFB 4IGUA 4UELA 5CB4E 2V7IA 2QGSA 3HR0A 3KV6A 3N9PA 4G63A 4FI5A 5LHHB 2CWYA 5IHYA 1YKHB 4FJOA 4ZI2D 2ACXA 1V9DA 2XTLA 3OYZA 2K5BB 3QK6A 2YU2A 3RH3A 5LGNB 3UUMA 3B57A 1MMDA 3ZPOA 3BQLA 3RPUA 4UVBB 2JRKA 5DQVA 1O3XA 4PW8A 3ZYMA 4MFRA 1EZ3A 4B6XA 2K9AA 2LHRA 3P8CD 4PJMA 2D0TA 1D0ZA 3IHRA 5H6RB 2DWGA 2X68A 3D0TA 3O1IA 2G0UA 4PJJA 1HFAA 3UTKA 5J2TE 3PTRB 3BK9A 5LOVE 2DNXA 2VKJA 3GN5B 2H3RA 2A72A 4YJ3E 4JEHB 1US7B 1D0XA 2ZM8A 4ISTA 4H9OC 3V5SA 4HGAA 2XAQB 4QXCB 3VU7H 5KMGP 3PU8A 5DABA 2WM9A 4MLKA 3U3IA 4H9NC 3QC9A 4CXWA 3LK2B 2Y8DA 3CX8B 4V1Av 2OA5A 3BQIA 4CI3B 3JC6D 3E08A 5J2UE 1U5PA 4X1YE 2QA7A 4KP3C 2X9WA 3CKDA 3EDVA 4IE5A 2V7JA 2ODVA 2X9XA 2BVLA 1BR2A 3KBUA 3J7Yq 1WR6A 4JLEA 4PNIA 4YJ2E 2WSSV 5LHGB 1HS7A 3Q5XA 4TZ4C 3MKDA 4QKNA 2MYSA 3UFEA 3Q5WA 4K0UA 5CA1E 3LJCA 1SHZC 2C5IT 2D2SA 4KBMB 4BA9A 4NUVA 5LYJE 4PFOA 4P0AA 4ZOLE 4O4JE 2E9XA 2YINA 4NUUA 3CWZB 3S4UA 4X20E 2PJQA 4HKAA 4UIGA 4H63V 5FY1A 3N9OA 4ZS2A 1BR1A 2N1GA 2NW7A 3C51A 3RRCA 3MACA 4AKGA 5JDQA 2M67A 3KVBA 4UVAB 5JVDE 3H3AA 4WW0A 2LT3A 3PE0A 2CLYC 3CX6B 4PAGA 4QXBB 2Y6XA 3FBLA 4WBNE 5EK2A 1HG5A 4I4TE 3RKOA 4IE0A 4DO0A 3ONXA 4DNDA 2CEAA 4ZI7E 3C4XA 4ZI3C 3ZEFB 2HPLA 1BR4A 1LVFA 5LP6E 2CXFA 1MNEA 3W15B 2W00A 2NWBA 2W61A 3AA0B 4Z8XA 3WAJA 1ZEEA 1KNZA 3SS1A 3NRYA 2JQQA 3NBXX 2V1DB 3C64A 2ZLYA 2WMNA 1YD8G 3AA6B 3IEEA 2LSJA 3LBXB 3C98B 3O1JA 3ZN0B 2W0GA 3ZLIA 4UF0A 2ZM2A 3ZMTB 3I9YA 4XBFB 5LXTE 4AKLA 2KINB 1D1CA 5FXVA 3RYHE 3VKHA 2HH7A 4MBQA 1MIVA 3O9XA 2KNDA 4N78D 4CXXA 1YKEB 5J1GA 5C8YE 3V5UA 2XASB 4GIWA 3F31A 2KWIB 3TKLB 1ZKEA 2XAJB 4EZHA 1FMWA 3ESLA 1HTJF 4PFPA 3PU3A 4QX7B 1FEWA 3MA9A 3QUJA 3HKBE 2JPFA 2PBIA 2ES0A 4ZS3A 3RYIE 1ZHCA 2XQYA 3IBPA 3F2EA 3PDYA 3SOLA 4IE6A 5HAXA 3UT5E 4H9PC 1LVKA 2E9XC 4A56A 5FXZA 5JDGA 1MMNA 2UXXB 1D1BA 1G73A 4X1IE 2X9HA 1SA0E 2H7OA 4CXYA 3ANWB 4BJMA 3EDUA 3HKDE 3I9WA 1WRDA 3OKQA 4P09A 4CI1B 3ANWA 3AVSA 3LK42 5LA6E 5JDHA 3RC8A 5LJNA 3Q9DA 1X79A 2X51A 3U78A 1YW0A 1S94A 2CA5A 3KV9A 3ZMZB 3ZMSB 5F3JA 2BVMA 4ISSA 4ERRA 5EK4A 2V7MA 1D0YA 2MTQA 4PK4A 2L9QA 2WAUA 3ZCIA 3C4WA 2W63A 2A3DA 4EYUA 1NWMX 4OYJA 3ZYLA 1OXZA 2CMRA 3AA1B 2EHOC 3RX6A 3ZMVB 4PK6A 4AKRB 4HFVA 2RP4A 4ZI3D 2IAKA 3CX7B 1U4QA 5KDMC 2LSKA 3KV5A 5LBMA 2ZMAA 2GK9A 2LEHA 4DBQA 2C5JA 3ZC1A 2V26A 2D0UA 5JDFA 3MK7C 5FXXA 3UULA 4IHJE 3SRZA 2L3LA 2BDEA 1FIOA 5JRCB 4C91A 4UV9B 1IJ6A 4GYRA 4H9RC 1Y64B 3Q2MA 4CZZB 5HXHA 5JRCA 2E9XB 2HPJA 3P7IA 4O8SA 3ZCJA 5F8PA 4JEUB 1HX8A 4OHFA 3ETUA 3I0OA 3IF8B 4O4HE 3GMIA 1E1HB 3ZJ1A 5E0OA 3K3OA 5GONE 5JDLA 2Q9QC 2KLQA 2LJLA 2SPCA 2LSIA 3KVAA 1HG2A 2D5UA 1OWAA 4AKIA 5A1LA 1HCIA 4CQIA 2KT9A 5JR9A 2KZ7B 2NTYA 1MNDA 3SWHA 2CCQA 3J9X1 3AAEB 3L3PA 5HXCA 4MALA 5L3FB 2XUEA 1D1AA 3L09A 2WWUA 3HL6A 3BQKA 5DJQC 4ANJA 1FMVA 2E9XD 1QSDA 4EB6E 4PJNA 2NTXA 1IJ5A 3I1AA 3T8OA 2X9YA 2EHOB 4L0RA 4WBOA 1VOMA 4AQFC 2VKOA 3B13A 2LSGA 3EUHA 5LNKA 3LK3B 2I59A 4KUMB 2EHOA 2YEVC 4UF0B 5IYZE 4KMCA 4TV8E 2CWOA 5FP3A 4E7ZA 3CQCB 3NZQA 2DWKA 5LBQB 2ODUA 3FXEB 3PURA 1ZV4X 3MXZA 4UV8B 4ASKA 4UVCB 2Y48B 2JJ9A 2IC6A 4HTEA 5CA0E 5LHIB 1VRBA 2LSYA 2JMHA 3DJBA 4MHCA 2NOXA 3N9NA 2NW9A 3PUQA 3CMLA 2H7VC 2N9DA 5HXEA 2DCFA 2B1EA 3OBVE 1HF8A 3N9QA 3RRWA 4DMWA 2EHOD 1KK7A 1NAFA 2Q9QB 4P0BA 3CPZA 5JDMA 2UXNB 3FHNA 2K48A 3O4XE 3OJAA 2V7KA 2Q9QA 3N9LA 4XZCA 5L3DB 5FY0A 2LE8A 4EAHA 1MIWA 3UUXB 5FYMA 2KXPB 2CLYB 2PFVA 4EXTA 3E0ZA 1LRZA 3FBZA 4QX8B 3AVRA 2ZM0A 5HXSA 3DP7A 3GA8A 4GK0E 2IC9A 5JQGE 4EZ4A 5M4YA 2C0SA 3KFWX 5LG4A 4O4IE 2X0LB 3ETVA 3HA4A 2MBGA 2YK0A 4ZHQE 5JR9C 2CXDA 2VKDA 4AKHA 2E8IA 3N2GE 1IZNB 1MIYA 5TAOA 4IDZA 4XAXB 2NP9A 4TUYE 1BR0A 1S35A 2Q9QD 5JREA 2VKHA 1H7CA 3GWHA 1T98A 4AQFA 1UX4A 4EIWA 3OYXA 3R6NA 1UCUA 1WLXA 2L8KA 3RYCE 3AB3B 5FY7A 2KWHA 2XAHB 3HKCE 5DQWA 2V7LA 4EYYR 4IE4A 4HE8A 3NZPA 4QXHB 4I43B 1WYBA 4U72A 5FNVE 3FXDB 4M1PA 4PK5A 2JMKA 4BAYB 4H9SE 2CXLA 1UX5A 3RYFE 1IAPA 2VB6A 4E7SA 3CQXC 3GN5A 2XHEB 3R84B 4O2BE 3KV4A 2YU1A 4GOUA 4BJNA 3MJXA 1AJ3A 3PUGA 3PUSA 4ADZA 4TV9E 1MMAA 2VK9A 3DTOA 5JH7E 2VL8A 3RC3A 5AFUL 2A2FX 1MMGA 5LJMA 3N2KE 2W62A 4IE7A 2CM0A 3AAAB 4AXPA 4YLHA 4WNKA 4ILUA 4ZI2C 3WAKA 3NRXA 1G8XA 2LOPA 2X66A 5L3BB 2DHRA 5L2LA 3CQGB 4OK0A 3H37A 2XAGB 2DI4A 3WI3A 5JDNA 5L3EB 5JR9B 2K24A 4AI6A 4QWNB 4EOZB 2WBLA 3KDSE 3HI2A 2X67A 3AAIA 4HEAA 3VKGA 5ADXL 5H6QB 2NW8A 4L9IA 3HKEE 3ZMUB 4OYKA 2Z6EA 4I55E 4YHJA 4L5GA 2P9BA 3KINB 4F6RC 2CE7A 4O4LE 3O1HA 4O2AE 3M65A 3LG7A 5ETWA 4G2AA 5LGUB 1WYCA 2KMFA 4OFZA 4PJLA 3N5LA 4TX5A 4UXNB 3ZYKA 2MOZA 4H63H 3ZC0A 5HWXA 4TN7B 2J1DG 3F57A 4YFSA 3ZN1B 3JC6C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LEH A; 
#chains in the Genus database with same CATH topology
 4GYS A;  1Y01 A;  3A5X A;  2XSB A;  3K3N A;  3PUA A;  2WWV A;  5HYA A;  5AQR B;  2VQE T;  5KX5 E;  4UEM A;  5EK3 A;  3N2O A;  5HXR A;  2BZB A;  2LOS A;  3K3Q C;  2LHN A;  3VHL A;  5AQH B;  1Z0P A;  4U2Y A;  4AQG A;  1YQ4 A;  1CUN A;  2WMO A;  3C50 A;  5LCY A;  4UEL A;  5CB4 E;  2QGS A;  3UU4 A;  3KV6 A;  4FI5 A;  5LHH B;  4ZI2 D;  2ACX A;  2XTL A;  3OYZ A;  2K5B B;  2WCA A;  3UUM A;  3ZPO A;  3QB5 A;  3BQL A;  4JI2 T;  4UVB B;  4DV6 T;  3P8C D;  2D0T A;  5H6R B;  2X68 A;  2WDR A;  4JI1 T;  5FL1 A;  4QH1 A;  3PTR B;  5LOV E;  2IUB A;  1US7 B;  1D0X A;  2ZM8 A;  1KFY A;  4H9O C;  4HGA A;  3V5S A;  4QXC B;  3VU7 H;  3VRA A;  5L4E A;  2CHO A;  3JC6 D;  5AQL B;  4KP3 C;  2X9W A;  2LRL A;  2ODV A;  2X9X A;  3FZF B;  3KBU A;  1WR6 A;  4B3R T;  2WSS V;  3B5M A;  4TZ4 C;  2J4G A;  2VQF T;  4HFI A;  4QKN A;  5LMU T;  4KBM B;  5LYJ E;  4PFO A;  4P0A A;  4ZOL E;  2W66 A;  2E9X A;  3S4U A;  4P1N A;  5AQQ B;  4UIG A;  4HFH A;  1I94 T;  2NW7 A;  3RRC A;  3MAC A;  5JVD E;  3CX6 B;  3FZL B;  2BG9 E;  4DV2 T;  3FBL A;  4WBN E;  5EK2 A;  4DO0 A;  3ONX A;  1WCR A;  2FJA A;  4DND A;  4ZI7 E;  1BR4 A;  5LP6 E;  2CXF A;  2LKH A;  2W61 A;  1KNZ A;  3NRY A;  4DV7 T;  5L47 A;  2WMN A;  4HWC A;  4GKK T;  1WR0 A;  3ZN0 B;  3ZMT B;  5LXT E;  4AKL A;  2CBI A;  2KIN B;  1D1C A;  5C8Y E;  4TNW A;  4EZH A;  2YOE A;  2YDR A;  4COF A;  3QUJ A;  3RI5 A;  4ZS3 A;  3PDY A;  4IE6 A;  1LVK A;  2UXD T;  5FXZ A;  3LSV A;  1N36 T;  5LMN T;  4BJM A;  5BR8 T;  1WRD A;  5AQO B;  5LA6 E;  5J0Z A;  3P4R A;  1X79 A;  2X51 A;  4DR6 T;  2JIW A;  3KV9 A;  2VUR A;  3ZT5 A;  4ZZC A;  4EYU A;  3ZMV B;  4EEB A;  2XQA A;  2RPA A;  2IML A;  3OVU A;  4YTP A;  5LBM A;  1JNR A;  2LEH A;  2C5J A;  4DUY T;  2V26 A;  3UUL A;  3SRZ A;  4EGW A;  2L3L A;  1WFD A;  3QB5 K;  4C91 A;  4UV9 B;  1IJ6 A;  4CZZ B;  4ZZB A;  5HXH A;  4OHF A;  4A5X A;  3ETU A;  3GMI A;  3ZJ1 A;  5E0O A;  3K3O A;  5GON E;  5JDL A;  2KLQ A;  2LJL A;  2SPC A;  2LSI A;  1CHU A;  3KVA A;  4DV4 T;  3AEG A;  2KT9 A;  5JR9 A;  2I6H A;  1MND A;  3J9X 1;  3AAE B;  5L3F B;  3PUZ F;  1KF6 A;  3ZSS A;  2NTX A;  2MPK A;  3TLS A;  4WBO A;  1VOM A;  4AQF C;  3EUH A;  3Q5E A;  5LNK A;  2WP9 A;  5FP3 A;  3PJA J;  5LBQ B;  3PUR A;  4UV8 B;  4ASK A;  1Z8U A;  4Z90 A;  5LHI B;  2UUA T;  2JMH A;  2NW9 A;  2N9D A;  2DCF A;  2B1E A;  4DMW A;  3P50 A;  1KK7 A;  3CPZ A;  5JDM A;  2UXN B;  3O4X E;  4XZC A;  2KXP B;  2XQ9 A;  3FZM B;  5AQM B;  2JQH A;  3E0Z A;  4HWI B;  3GA8 A;  2OV9 A;  4EZ4 A;  5M4Y A;  2C0S A;  4O4I E;  2F4V T;  2V6X A;  3AED A;  1IZN B;  1MIY A;  5TAO A;  3RIF A;  1BR0 A;  1S35 A;  1J5W A;  5JRE A;  2VKH A;  1H7C A;  1T98 A;  2XPK A;  1UK5 A;  1UX4 A;  1UCU A;  4IDP A;  4DV0 T;  3UQ7 A;  5DQW A;  4IT4 A;  3NZP A;  5FKY A;  4U72 A;  5FNV E;  4M1P A;  4BAY B;  2CXL A;  3RYF E;  4E7S A;  3R84 B;  3PUS A;  3ZT6 A;  4TV9 E;  1MMA A;  3EHZ A;  4ILC A;  5AFU L;  1MMG A;  3N2K E;  4IE7 A;  2CM0 A;  4YLH A;  4DUZ T;  4ILU A;  5L3B B;  2LOP A;  4U31 A;  2V5C A;  4OK0 A;  3H37 A;  2X0Y A;  3ZST A;  5AQK B;  4LF4 T;  3FZK B;  5H6Q B;  4X62 T;  3AE3 A;  4IRE A;  4OYK A;  2Z6E A;  3NWI A;  3ONL C;  3VR9 A;  3O1H A;  4O2A E;  2YDQ A;  3M65 A;  4OFZ A;  4PJL A;  2BS4 A;  4H63 H;  2XQ4 A;  4YFS A;  4A97 A;  2VAS A;  4CI2 B;  3UUN A;  3N9M A;  2LRK A;  2PTF A;  3CVR A;  2IW5 B;  2LM9 A;  2RA1 A;  2DLR A;  3C4Z A;  2C5K T;  5HWY A;  2BKO A;  2WB5 A;  5AQP B;  4IL4 A;  5EZY E;  3AEB A;  4LFC T;  3CIR A;  1LKX A;  3ZJ2 A;  1OED B;  1XWM A;  1OED A;  2V7I A;  4G63 A;  1YKH B;  1QLB A;  1XNR T;  2XQ5 A;  3QK6 A;  4MFR A;  4U3C A;  1EZ3 A;  3AE7 A;  3BK9 A;  2H89 A;  1NEN A;  3GN5 B;  2H3R A;  3G06 A;  4JEH B;  5DAB A;  4MLK A;  3U3I A;  4H9N C;  4I0U A;  4QH5 A;  3BQI A;  4X1Y E;  3ONJ A;  1BR2 A;  3J7Y q;  2CBJ A;  5LHG B;  1R8I A;  5CA1 E;  3AE2 A;  3UU5 A;  2C5I T;  2BG9 C;  5HCJ A;  4F8H A;  2V5D A;  3JCF A;  4NUU A;  2YIN A;  4CN1 A;  5IWA T;  4YXD A;  4X20 E;  5AQI B;  2N1G A;  3C51 A;  3KVB A;  3H3A A;  2LT3 A;  4PAG A;  4QXB B;  1DU2 A;  4B3S T;  3RKO A;  3AE9 A;  4YSZ A;  1MNE A;  3W15 B;  2NWB A;  4Z8X A;  4AIU A;  2JQQ A;  2V1D B;  3IEE A;  3PJA A;  3C98 B;  3O1J A;  3ZLI A;  2ZM2 A;  1SUM B;  3I9Y A;  4NXM T;  2HH7 A;  2KND A;  1YKE B;  5J1G A;  4GIW A;  3TKL B;  1ZKE A;  2ACZ A;  1FMW A;  3ESL A;  1SE7 A;  3PU3 A;  4QX7 B;  2BKP A;  4B3T T;  2JPF A;  2ZM6 T;  5FVL A;  1ZP0 A;  2UU9 T;  4DID B;  3SOL A;  3UT5 E;  4A56 A;  5JDG A;  3M3Z B;  1SA0 E;  2H7O A;  4CXY A;  3EDU A;  3LK4 2;  3RHW A;  4DR1 T;  3U78 A;  3ZMS B;  4ERR A;  5EK4 A;  4KHP T;  4JI5 T;  3ZT7 A;  3C4W A;  1OXZ A;  2WQY A;  4PK6 A;  4AKR B;  4HFV A;  5CJ5 A;  2LSK A;  3KV5 A;  3ZC1 A;  3AE5 A;  5JDF A;  5FXX A;  1N32 T;  2BDE A;  5JRC B;  4GYR A;  3Q2M A;  5JRC A;  2E9X B;  3P7I A;  3EAM A;  3ZKR A;  2Q9Q C;  1OWA A;  4JV5 T;  1HCI A;  1YXR A;  1IBM T;  2NTY A;  3SWH A;  2W2U A;  2NR4 A;  5HEO A;  5HXC A;  3HL6 A;  3BQK A;  5DJQ C;  4ANJ A;  4EB6 E;  3I1A A;  2WDQ A;  2X9Y A;  2EHO B;  4L0R A;  3LK3 B;  2I59 A;  2EHO A;  3RQW A;  4KMC A;  4ZXL A;  1E7P A;  2CWO A;  4DV3 T;  2DWK A;  3FXE B;  5ABG A;  1ZV4 X;  2Y48 B;  2JJ9 A;  2IC6 A;  1VRB A;  2LSY A;  3DJB A;  3N9N A;  3NKZ A;  3PUQ A;  5FL0 A;  2H7V C;  3OBV E;  1HF8 A;  2R6G F;  2FJB A;  5FY0 A;  1KEY A;  4EAH A;  3UUX B;  2CLY B;  2X0H A;  4QX8 B;  2KSR A;  1J1J A;  1XMQ T;  3KFW X;  4ZEY A;  2MBG A;  4AKH A;  4IDZ A;  4JYA T;  4XAX B;  4KX6 A;  2Q9Q D;  2K3W A;  2E5L T;  4EIW A;  3R6N A;  4LF7 T;  3HKC E;  3UUB A;  4YY3 T;  4EYY R;  4HE8 A;  4QXH B;  1WYB A;  2JMK A;  2E5V A;  4IDQ A;  2YU1 A;  3MJX A;  3RIU C;  3PUG A;  2BS3 A;  3EI0 A;  4JI0 T;  4Q25 A;  2HN2 A;  2A2F X;  2W62 A;  4AQY T;  1HNW T;  4AXP A;  4YSX A;  2QVA A;  4WNK A;  4TNV A;  2DHR A;  5L2L A;  3CQG B;  5AQU B;  5JR9 B;  2V8S V;  4EOZ B;  1XDO A;  4NIQ A;  5IUX A;  5ADX L;  1UUS A;  3HKE E;  3P4S A;  4F6R C;  4G2A A;  2UUB T;  1OED E;  4UXN B;  2MOZ A;  2LKG A;  3F57 A;  3ZN1 B;  5C2T A;  2CRB A;  4HN9 A;  4DMV A;  4JUY A;  4I50 E;  3AA7 B;  4QHO A;  5BMV E;  4H9Q C;  3AE1 A;  5L3C B;  3TLT A;  3AE8 A;  4GK5 E;  4U74 A;  1NEK A;  4C90 A;  1XNQ T;  5LGT B;  2FJD A;  1B7T A;  2VWA A;  3LBX A;  2PG8 A;  4DVD A;  3FB2 A;  5CFB A;  3KBT A;  3AEE A;  3LDQ B;  1IBL T;  5FXW A;  4U2Z A;  4J2C A;  4IGU A;  3N9P A;  3SFD A;  5IHY A;  5ABF B;  5ABF A;  5HEH A;  3RH3 A;  4UR9 A;  3B57 A;  3FZH B;  3RPU A;  5DQV A;  1O3X A;  5HCM A;  3ZYM A;  4HWD A;  2XZE A;  4B6X A;  4PJM A;  1D0Z A;  2J62 A;  3D0T A;  2G0U A;  4PJJ A;  2BBH A;  2W4X A;  4ILA A;  2XAQ B;  2UXB T;  2IHR 1;  2B76 A;  4CXW A;  3QC9 A;  3LK2 B;  2Y8D A;  4V1A v;  3E08 A;  4DV1 T;  5J2U E;  1U5P A;  1XMO T;  4IE5 A;  3EDV A;  2V7J A;  4JLE A;  1HS7 A;  2HN1 A;  2MYS A;  3Q5W A;  4EV6 A;  3LJC A;  2WU5 A;  2D2S A;  4DR7 T;  2M6I A;  2D9D A;  5LG3 A;  4CN6 A;  2PJQ A;  2VL0 A;  5FY1 A;  4H63 V;  3N9O A;  4ZS2 A;  1BR1 A;  2M67 A;  5HEU A;  2CLY C;  2QRX A;  4QH4 A;  2Y6X A;  3RIA A;  2OLT A;  2UUC T;  4I4T E;  1W0B A;  4ZI3 C;  3AEC A;  3ZEF B;  1LVF A;  2WS3 A;  2W00 A;  3AA0 B;  1ZEE A;  3SS1 A;  3NBX X;  3C64 A;  2ZLY A;  3AA6 B;  4UF0 A;  2FJE A;  4XBF B;  2HHH T;  5FXV A;  3RYH E;  4K0K T;  4KI0 F;  4X65 T;  3O9X A;  4N78 D;  4CXX A;  3V5U A;  2KWI B;  4PFP A;  4LF5 T;  1FEW A;  3MA9 A;  4DR4 T;  3HKB E;  2ES0 A;  3RYI E;  3IBP A;  3F2E A;  4JI6 T;  1MMN A;  2UXX B;  1D1B A;  1G73 A;  4X1I E;  2X9H A;  3HKD E;  3OKQ A;  4CI1 B;  3A7M A;  3PUV F;  3P4P A;  4WYV A;  3RC8 A;  5LJN A;  5C3J A;  1YW0 A;  1J5E T;  1S94 A;  2CA5 A;  2XQ8 A;  3ZMZ B;  2BVM A;  1D0Y A;  2W63 A;  4OYJ A;  2CMR A;  5ABE A;  4ZI3 D;  3CX7 B;  3UU6 A;  5KDM C;  2W67 A;  2ZMA A;  2GK9 A;  3RQU A;  3MK7 C;  4IHJ E;  4GKJ T;  2A9U A;  4IL9 A;  1FIO A;  3AE4 A;  1Y64 B;  4LF6 T;  2V6Y A;  4JEU B;  3I0O A;  3QNU A;  3IF8 B;  4O4H E;  5HEG A;  3P4W A;  4LMJ A;  2D5U A;  5LB7 B;  1E2A A;  4AKI A;  1T72 A;  4LML A;  3QOF A;  4MAL A;  1D1A A;  4DR5 T;  5AQT B;  3T8O A;  4OX9 T;  2VKO A;  3B13 A;  2LSG A;  4KUM B;  2YEV C;  5IYZ E;  4E7Z A;  3NZQ A;  2ODU A;  3H3M A;  1T7S A;  4U7I A;  4UVC B;  5CA0 E;  4YSY A;  3K1S A;  3RIU A;  2NOX A;  2BS2 A;  4DV5 T;  4LF8 T;  5HXE A;  3RRW A;  2FBW A;  1NAF A;  4TWD A;  4P0B A;  2WY2 A;  3FHN A;  2K48 A;  4HFE A;  3OJA A;  3N9L A;  1W9R A;  5HXS A;  2ZM0 A;  1HNZ T;  3DP7 A;  5AQJ B;  2WU2 A;  2IIU A;  3T1H T;  2X0L B;  3ETV A;  2YK0 A;  4ZHQ E;  2CXD A;  3AXJ B;  3N2G E;  3CK6 A;  3AXJ A;  4TUY E;  5AQN B;  4LFB T;  4AQF A;  4TWH A;  1KNR A;  1WLX A;  5F5W A;  5FY7 A;  2KWH A;  3PV0 F;  2V7L A;  2WZH A;  4H9S E;  2LM2 A;  1UX5 A;  1IAP A;  4HWF A;  3CQX C;  2XHE B;  5KXJ A;  4O2B E;  3KV4 A;  4GOU A;  4BJN A;  1AJ3 A;  4ADZ A;  2VK9 A;  5LJM A;  3RC3 A;  2QYW A;  3AAA B;  5JTG A;  5L4H A;  3WAK A;  3NRX A;  2X66 A;  3X1D A;  2XAG B;  2YN6 A;  3WI3 A;  3L8R A;  4WZX A;  2K24 A;  4QWN B;  1GQE A;  1OED C;  3HI2 A;  3AAI A;  3VKG A;  3RLF F;  2AE9 A;  4L9I A;  3ZMU B;  4YHJ A;  4LF9 T;  4L5G A;  2P9B A;  2MAW A;  3KIN B;  4X66 T;  2CE7 A;  3LG7 A;  5ETW A;  2KMF A;  1WYC A;  2XQ7 A;  3N5L A;  4TX5 A;  3ZC0 A;  5AQF B;  5HWX A;  4X64 T;  4X1K E;  2N2N A;  2E2A A;  3MZK B;  4IIJ E;  4DBR A;  3LFM A;  3I0Q A;  5L3G B;  3K8P C;  4NXN T;  1N34 T;  4HFD A;  3EVY A;  3E22 E;  3PUW F;  5FMN A;  1QUU A;  2XAF B;  4HFC A;  3HR0 A;  2CWY A;  4FJO A;  1V9D A;  2CHN A;  3RGL A;  3OTO T;  2YU2 A;  5LGN B;  1MMD A;  2JQK A;  2JRK A;  4PW8 A;  1I6Z A;  3TLW A;  2K9A A;  2LHR A;  3VR8 A;  3IHR A;  2DWG A;  3O1I A;  1HFA A;  3UTK A;  5J2T E;  1L0V A;  2DNX A;  2VKJ A;  2A72 A;  5HEJ A;  4YJ3 E;  4IST A;  1XZY A;  5KMG P;  3PU8 A;  2WM9 A;  3TLU A;  3CX8 B;  2OA5 A;  4CI3 B;  2BKN A;  3TLV A;  5AQS B;  1XDP A;  2QA7 A;  3CKD A;  3JAF A;  4DR2 T;  2BVL A;  4PNI A;  4YJ2 E;  2LLY A;  3Q5X A;  4EED A;  4X5T A;  3MKD A;  3UFE A;  4K0U A;  1SHZ C;  4BA9 A;  4NUV A;  4ILB A;  4O4J E;  3OPC A;  3CWZ B;  4JI4 T;  3UU8 A;  4HKA A;  3JAD A;  4AKG A;  5JDQ A;  4UVA B;  4JI7 T;  4WW0 A;  3PE0 A;  4HFB A;  3P4Q A;  1HG5 A;  3JAE A;  4IE0 A;  2CEA A;  3C4X A;  2HPL A;  4Z91 A;  4A98 A;  3VRB A;  3WAJ A;  1M7K A;  3RKG A;  1YD8 G;  2YDS A;  2LSJ A;  3LBX B;  2W0G A;  3L39 A;  4DR3 T;  2I0M A;  1N33 T;  3VKH A;  4MBQ A;  1MIV A;  3UQ4 A;  2XM1 A;  2XAS B;  3F31 A;  4LMK A;  2BG9 B;  1UUR A;  4CN4 A;  1VCT A;  2XAJ B;  1HTJ F;  2BG9 A;  3AEF A;  4YT0 A;  2PBI A;  1ZHC A;  2XQY A;  1KNP A;  5HAX A;  3PUX F;  3SFE A;  4H9P C;  2E9X C;  3ANW B;  2YKS A;  3I9W A;  2VVS A;  4P09 A;  3ANW A;  3AVS A;  3AE6 A;  3UFG A;  4NPP A;  5JDH A;  2XY8 B;  1T8B A;  3Q9D A;  2UXC T;  1W0A A;  5F3J A;  4ISS A;  4YTN A;  2V7M A;  2MTQ A;  4PK4 A;  2L9Q A;  2WAU A;  2XJ7 A;  3ZCI A;  4JI3 T;  5ABH A;  2A3D A;  1UGO A;  1NWM X;  3ZYL A;  3AA1 B;  2EHO C;  3RX6 A;  2RP4 A;  2IAK A;  1U4Q A;  4DBQ A;  2D0U A;  2XM2 A;  4H9R C;  1HX1 B;  3UU3 A;  2HPJ A;  4O8S A;  3ZCJ A;  5F8P A;  1HX8 A;  4IDN A;  1E1H B;  5FVK A;  1X9B A;  4LFA T;  1HG2 A;  5A1L A;  4CQI A;  1IBK T;  2KZ7 B;  2CCQ A;  3EAB A;  3L3P A;  1ZOY A;  2XQ6 A;  2XUE A;  3L09 A;  2WWU A;  5AQG B;  1FMV A;  2E9X D;  1QSD A;  4PJN A;  1IJ5 A;  4UF0 B;  4TV8 E;  3Q5D A;  3PUY F;  3CQC B;  2AXD S;  2M6B A;  3MXZ A;  5AQV B;  1JNZ A;  2JQ9 A;  4HTE A;  2H88 A;  4MHC A;  1HR0 T;  3CML A;  2XQ3 A;  4YTM A;  3N9Q A;  2EHO D;  2Q9Q B;  4AIS A;  2V7K A;  2Q9Q A;  5L3D B;  2LE8 A;  1MIW A;  5FYM A;  2PFV A;  4EXT A;  2J47 A;  1LRZ A;  3FBZ A;  3AVR A;  4GK0 E;  3ABV A;  2IC9 A;  5JQG E;  4U7Y A;  2XSA A;  5LG4 A;  3HA4 A;  3A8Y C;  5JR9 C;  2VVN A;  4KHZ F;  1M62 A;  2VKD A;  2E8I A;  2WDV A;  2NP9 A;  1HNX T;  3GWH A;  3OYX A;  2BBJ A;  2FUP A;  4TWF A;  2L8K A;  3AEA A;  3NVO A;  3RYC E;  3AB3 B;  2XAH B;  2DL1 A;  4IE4 A;  4I43 B;  3FXD B;  4YHH T;  4PK5 A;  3RF1 A;  2VB6 A;  3GN5 A;  3IA3 A;  2V6Y B;  3DTO A;  5JH7 E;  2VL8 A;  2WZI A;  4ZI2 C;  1G8X A;  4IDO A;  1W09 A;  2DI4 A;  5JDN A;  5L3E B;  4AI6 A;  2WBL A;  3KDS E;  4JI8 T;  2X67 A;  4HEA A;  5CGM A;  4HWH A;  4B3M T;  2NW8 A;  4I55 E;  4JBW F;  4O4L E;  1FJG T;  2IDO B;  5LGU B;  1VCS A;  2CPT A;  3ZYK A;  1YQ3 A;  4TN7 B;  4U33 A;  2J1D G;  3T1Y T;  3JC6 C; 
#chains in the Genus database with same CATH homology
 2VAS A;  4HN9 A;  4DMV A;  4JUY A;  4GYS A;  4I50 E;  4CI2 B;  4X1K E;  3A5X A;  3AA7 B;  2N2N A;  4QHO A;  3UUN A;  3K3N A;  3N9M A;  3PUA A;  5BMV E;  5HYA A;  3CVR A;  4H9Q C;  2IW5 B;  5KX5 E;  4UEM A;  2LM9 A;  5L3C B;  2RA1 A;  2DLR A;  3C4Z A;  2C5K T;  5EK3 A;  5HWY A;  3MZK B;  4GK5 E;  4IIJ E;  4U74 A;  4DBR A;  4C90 A;  3LFM A;  5LGT B;  3N2O A;  3I0Q A;  5HXR A;  2BZB A;  2LOS A;  1B7T A;  2VWA A;  5EZY E;  3K8P C;  3K3Q C;  5L3G B;  3LBX A;  2PG8 A;  2LHN A;  4DVD A;  3FB2 A;  1LKX A;  3KBT A;  3VHL A;  3EVY A;  3E22 E;  3ZJ2 A;  1Z0P A;  5FMN A;  5FXW A;  4AQG A;  1CUN A;  1QUU A;  2WMO A;  3C50 A;  4J2C A;  5LCY A;  2XAF B;  4IGU A;  4UEL A;  5CB4 E;  2V7I A;  2QGS A;  3HR0 A;  3KV6 A;  3N9P A;  4G63 A;  4FI5 A;  5LHH B;  2CWY A;  5IHY A;  1YKH B;  4FJO A;  4ZI2 D;  2ACX A;  1V9D A;  2XTL A;  3OYZ A;  2K5B B;  3QK6 A;  2YU2 A;  3RH3 A;  5LGN B;  3UUM A;  3B57 A;  1MMD A;  3ZPO A;  3BQL A;  3RPU A;  4UVB B;  2JRK A;  5DQV A;  1O3X A;  4PW8 A;  3ZYM A;  4MFR A;  1EZ3 A;  4B6X A;  2K9A A;  2LHR A;  3P8C D;  4PJM A;  2D0T A;  1D0Z A;  3IHR A;  5H6R B;  2DWG A;  2X68 A;  3D0T A;  3O1I A;  2G0U A;  4PJJ A;  1HFA A;  3UTK A;  5J2T E;  3PTR B;  3BK9 A;  5LOV E;  2DNX A;  2VKJ A;  3GN5 B;  2H3R A;  2A72 A;  4YJ3 E;  4JEH B;  1US7 B;  1D0X A;  2ZM8 A;  4IST A;  4H9O C;  3V5S A;  4HGA A;  2XAQ B;  4QXC B;  3VU7 H;  5KMG P;  3PU8 A;  5DAB A;  2WM9 A;  4MLK A;  3U3I A;  4H9N C;  3QC9 A;  4CXW A;  3LK2 B;  2Y8D A;  3CX8 B;  4V1A v;  2OA5 A;  3BQI A;  4CI3 B;  3JC6 D;  3E08 A;  5J2U E;  1U5P A;  4X1Y E;  2QA7 A;  4KP3 C;  2X9W A;  3CKD A;  3EDV A;  4IE5 A;  2V7J A;  2ODV A;  2X9X A;  2BVL A;  1BR2 A;  3KBU A;  3J7Y q;  1WR6 A;  4JLE A;  4PNI A;  4YJ2 E;  2WSS V;  5LHG B;  1HS7 A;  3Q5X A;  4TZ4 C;  3MKD A;  4QKN A;  2MYS A;  3UFE A;  3Q5W A;  4K0U A;  5CA1 E;  3LJC A;  1SHZ C;  2C5I T;  2D2S A;  4KBM B;  4BA9 A;  4NUV A;  5LYJ E;  4PFO A;  4P0A A;  4ZOL E;  4O4J E;  2E9X A;  2YIN A;  4NUU A;  3CWZ B;  3S4U A;  4X20 E;  2PJQ A;  4HKA A;  4UIG A;  4H63 V;  5FY1 A;  3N9O A;  4ZS2 A;  1BR1 A;  2N1G A;  2NW7 A;  3C51 A;  3RRC A;  3MAC A;  4AKG A;  5JDQ A;  2M67 A;  3KVB A;  4UVA B;  5JVD E;  3H3A A;  4WW0 A;  2LT3 A;  3PE0 A;  2CLY C;  3CX6 B;  4PAG A;  4QXB B;  2Y6X A;  3FBL A;  4WBN E;  5EK2 A;  1HG5 A;  4I4T E;  3RKO A;  4IE0 A;  4DO0 A;  3ONX A;  4DND A;  2CEA A;  4ZI7 E;  3C4X A;  4ZI3 C;  3ZEF B;  2HPL A;  1BR4 A;  1LVF A;  5LP6 E;  2CXF A;  1MNE A;  3W15 B;  2W00 A;  2NWB A;  2W61 A;  3AA0 B;  4Z8X A;  3WAJ A;  1ZEE A;  1KNZ A;  3SS1 A;  3NRY A;  2JQQ A;  3NBX X;  2V1D B;  3C64 A;  2ZLY A;  2WMN A;  1YD8 G;  3AA6 B;  3IEE A;  2LSJ A;  3LBX B;  3C98 B;  3O1J A;  3ZN0 B;  2W0G A;  3ZLI A;  4UF0 A;  2ZM2 A;  3ZMT B;  3I9Y A;  4XBF B;  5LXT E;  4AKL A;  2KIN B;  1D1C A;  5FXV A;  3RYH E;  3VKH A;  2HH7 A;  4MBQ A;  1MIV A;  3O9X A;  2KND A;  4N78 D;  4CXX A;  1YKE B;  5J1G A;  5C8Y E;  3V5U A;  2XAS B;  4GIW A;  3F31 A;  2KWI B;  3TKL B;  1ZKE A;  2XAJ B;  4EZH A;  1FMW A;  3ESL A;  1HTJ F;  4PFP A;  3PU3 A;  4QX7 B;  1FEW A;  3MA9 A;  3QUJ A;  3HKB E;  2JPF A;  2PBI A;  2ES0 A;  4ZS3 A;  3RYI E;  1ZHC A;  2XQY A;  3IBP A;  3F2E A;  3PDY A;  3SOL A;  4IE6 A;  5HAX A;  3UT5 E;  4H9P C;  1LVK A;  2E9X C;  4A56 A;  5FXZ A;  5JDG A;  1MMN A;  2UXX B;  1D1B A;  1G73 A;  4X1I E;  2X9H A;  1SA0 E;  2H7O A;  4CXY A;  3ANW B;  4BJM A;  3EDU A;  3HKD E;  3I9W A;  1WRD A;  3OKQ A;  4P09 A;  4CI1 B;  3ANW A;  3AVS A;  3LK4 2;  5LA6 E;  5JDH A;  3RC8 A;  5LJN A;  3Q9D A;  1X79 A;  2X51 A;  3U78 A;  1YW0 A;  1S94 A;  2CA5 A;  3KV9 A;  3ZMZ B;  3ZMS B;  5F3J A;  2BVM A;  4ISS A;  4ERR A;  5EK4 A;  2V7M A;  1D0Y A;  2MTQ A;  4PK4 A;  2L9Q A;  2WAU A;  3ZCI A;  3C4W A;  2W63 A;  2A3D A;  4EYU A;  1NWM X;  4OYJ A;  3ZYL A;  1OXZ A;  2CMR A;  3AA1 B;  2EHO C;  3RX6 A;  3ZMV B;  4PK6 A;  4AKR B;  4HFV A;  2RP4 A;  4ZI3 D;  2IAK A;  3CX7 B;  1U4Q A;  5KDM C;  2LSK A;  3KV5 A;  5LBM A;  2ZMA A;  2GK9 A;  2LEH A;  4DBQ A;  2C5J A;  3ZC1 A;  2V26 A;  2D0U A;  5JDF A;  3MK7 C;  5FXX A;  3UUL A;  4IHJ E;  3SRZ A;  2L3L A;  2BDE A;  1FIO A;  5JRC B;  4C91 A;  4UV9 B;  1IJ6 A;  4GYR A;  4H9R C;  1Y64 B;  3Q2M A;  4CZZ B;  5HXH A;  5JRC A;  2E9X B;  2HPJ A;  3P7I A;  4O8S A;  3ZCJ A;  5F8P A;  4JEU B;  1HX8 A;  4OHF A;  3ETU A;  3I0O A;  3IF8 B;  4O4H E;  3GMI A;  1E1H B;  3ZJ1 A;  5E0O A;  3K3O A;  5GON E;  5JDL A;  2Q9Q C;  2KLQ A;  2LJL A;  2SPC A;  2LSI A;  3KVA A;  1HG2 A;  2D5U A;  1OWA A;  4AKI A;  5A1L A;  1HCI A;  4CQI A;  2KT9 A;  5JR9 A;  2KZ7 B;  2NTY A;  1MND A;  3SWH A;  2CCQ A;  3J9X 1;  3AAE B;  3L3P A;  5HXC A;  4MAL A;  5L3F B;  2XUE A;  1D1A A;  3L09 A;  2WWU A;  3HL6 A;  3BQK A;  5DJQ C;  4ANJ A;  1FMV A;  2E9X D;  1QSD A;  4EB6 E;  4PJN A;  2NTX A;  1IJ5 A;  3I1A A;  3T8O A;  2X9Y A;  2EHO B;  4L0R A;  4WBO A;  1VOM A;  4AQF C;  2VKO A;  3B13 A;  2LSG A;  3EUH A;  5LNK A;  3LK3 B;  2I59 A;  4KUM B;  2EHO A;  2YEV C;  4UF0 B;  5IYZ E;  4KMC A;  4TV8 E;  2CWO A;  5FP3 A;  4E7Z A;  3CQC B;  3NZQ A;  2DWK A;  5LBQ B;  2ODU A;  3FXE B;  3PUR A;  1ZV4 X;  3MXZ A;  4UV8 B;  4ASK A;  4UVC B;  2Y48 B;  2JJ9 A;  2IC6 A;  4HTE A;  5CA0 E;  5LHI B;  1VRB A;  2LSY A;  2JMH A;  3DJB A;  4MHC A;  2NOX A;  3N9N A;  2NW9 A;  3PUQ A;  3CML A;  2H7V C;  2N9D A;  5HXE A;  2DCF A;  2B1E A;  3OBV E;  1HF8 A;  3N9Q A;  3RRW A;  4DMW A;  2EHO D;  1KK7 A;  1NAF A;  2Q9Q B;  4P0B A;  3CPZ A;  5JDM A;  2UXN B;  3FHN A;  2K48 A;  3O4X E;  3OJA A;  2V7K A;  2Q9Q A;  3N9L A;  4XZC A;  5L3D B;  5FY0 A;  2LE8 A;  4EAH A;  1MIW A;  3UUX B;  5FYM A;  2KXP B;  2CLY B;  2PFV A;  4EXT A;  3E0Z A;  1LRZ A;  3FBZ A;  4QX8 B;  3AVR A;  2ZM0 A;  5HXS A;  3DP7 A;  3GA8 A;  4GK0 E;  2IC9 A;  5JQG E;  4EZ4 A;  5M4Y A;  2C0S A;  3KFW X;  5LG4 A;  4O4I E;  2X0L B;  3ETV A;  3HA4 A;  2MBG A;  2YK0 A;  4ZHQ E;  5JR9 C;  2CXD A;  2VKD A;  4AKH A;  2E8I A;  3N2G E;  1IZN B;  1MIY A;  5TAO A;  4IDZ A;  4XAX B;  2NP9 A;  4TUY E;  1BR0 A;  1S35 A;  2Q9Q D;  5JRE A;  2VKH A;  1H7C A;  3GWH A;  1T98 A;  4AQF A;  1UX4 A;  4EIW A;  3OYX A;  3R6N A;  1UCU A;  1WLX A;  2L8K A;  3RYC E;  3AB3 B;  5FY7 A;  2KWH A;  2XAH B;  3HKC E;  5DQW A;  2V7L A;  4EYY R;  4IE4 A;  4HE8 A;  3NZP A;  4QXH B;  4I43 B;  1WYB A;  4U72 A;  5FNV E;  3FXD B;  4M1P A;  4PK5 A;  2JMK A;  4BAY B;  4H9S E;  2CXL A;  1UX5 A;  3RYF E;  1IAP A;  2VB6 A;  4E7S A;  3CQX C;  3GN5 A;  2XHE B;  3R84 B;  4O2B E;  3KV4 A;  2YU1 A;  4GOU A;  4BJN A;  3MJX A;  1AJ3 A;  3PUG A;  3PUS A;  4ADZ A;  4TV9 E;  1MMA A;  2VK9 A;  3DTO A;  5JH7 E;  2VL8 A;  3RC3 A;  5AFU L;  2A2F X;  1MMG A;  5LJM A;  3N2K E;  2W62 A;  4IE7 A;  2CM0 A;  3AAA B;  4AXP A;  4YLH A;  4WNK A;  4ILU A;  4ZI2 C;  3WAK A;  3NRX A;  1G8X A;  2LOP A;  2X66 A;  5L3B B;  2DHR A;  5L2L A;  3CQG B;  4OK0 A;  3H37 A;  2XAG B;  2DI4 A;  3WI3 A;  5JDN A;  5L3E B;  5JR9 B;  2K24 A;  4AI6 A;  4QWN B;  4EOZ B;  2WBL A;  3KDS E;  3HI2 A;  2X67 A;  3AAI A;  4HEA A;  3VKG A;  5ADX L;  5H6Q B;  2NW8 A;  4L9I A;  3HKE E;  3ZMU B;  4OYK A;  2Z6E A;  4I55 E;  4YHJ A;  4L5G A;  2P9B A;  3KIN B;  4F6R C;  2CE7 A;  4O4L E;  3O1H A;  4O2A E;  3M65 A;  3LG7 A;  5ETW A;  4G2A A;  5LGU B;  1WYC A;  2KMF A;  4OFZ A;  4PJL A;  3N5L A;  4TX5 A;  4UXN B;  3ZYK A;  2MOZ A;  4H63 H;  3ZC0 A;  5HWX A;  4TN7 B;  2J1D G;  3F57 A;  4YFS A;  3ZN1 B;  3JC6 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...