2LEHA

Solution structure of the core smn-gemin2 complex
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
189
structure length
189
Chain Sequence
GYSPTLQWQQQQVAQFSTVRQNVNKHRSHWKSQQLDSNVTMPKSEDEEGWKKFCLGEKLCADGAVGPATNESPGIDYVQIGFPPLLSIVSRMNQATVTSVLEYLSNWFGERDFTPELGRWLYALLACLEKPLLPEAHSLIRQLARRCSEVRLLVDSKDDERVPALNLLICLVSRYFDQRDLADEPSLEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Survival of motor neuron protein-interacting protein 1
publication title Solution structure of the core SMN-Gemin2 complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 38
structure length 189
sequence length 189
ec nomenclature
pdb deposition date 2011-06-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1070 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2lehA00
2LEHA
chains in the Genus database with same CATH superfamily
1N36T 2JMKA 4P0AA 3PUWF 3UUMA 4E7SA 4TZ4C 1YXRA 5JTGA 3M3ZB 1IAPA 5IYZE 4X64T 2WM9A 4CI2B 2XQ7A 3RF1A 1NEKA 1SUMB 2VQET 2LLYA 2G0UA 4HFDA 3JC6C 2NW9A 2NP9A 2NTXA 5H6QB 2XZEA 2CXLA 2BS3A 4CI1B 2N9DA 2JRKA 2KXPB 5LYJE 5JDMA 4B3ST 3RPUA 4GKJT 2LRKA 3ESLA 4GKKT 3RYFE 4HWCA 2W63A 4DV2T 4UVAB 4YLHA 3I9YA 1D1BA 4QWNB 1OWAA 2D2SA 2AE9A 1YQ3A 3AXJA 2GK9A 2JQQA 4CN4A 5AQFB 2C5IT 3KVBA 5IHYA 4QX7B 1WLXA 3KV4A 3Q5XA 2UXBT 3N9PA 4O4HE 2WAUA 4DV7T 2PBIA 1YQ4A 3ZMZB 5HXRA 3PU8A 3HKEE 5L3EB 2CXDA 2BKOA 3ZCIA 1FIOA 4AKIA 5HEOA 2YEVC 3ZMVB 4CN6A 1UCUA 2X9WA 1BR0A 5KXJA 4GOUA 5LNKA 2KWHA 2XHEB 3KBTA 4LMLA 3HR0A 3KFWX 3UUXB 5AQGB 3JAFA 4U7YA 4NPPA 3AE7A 4HN9A 3CQCB 2BKNA 2PG8A 4GYRA 1CHUA 3P50A 2M6BA 4F8HA 3ZCJA 4U3CA 2ZLYA 1LRZA 4IL9A 1HTJF 5FMNA 3ZYLA 2ODUA 2CWYA 4Z8XA 3KDSE 2XTLA 4TV8E 3O9XA 2WWUA 2X0HA 3L39A 3VKHA 1LVFA 3SS1A 2HN2A 3N9QA 3PU3A 1ZV4X 3RIUC 4H9OC 4ZHQE 3BK9A 4G2AA 3LDQB 1R8IA 1MMDA 2ZM2A 4O4LE 3QOFA 3QK6A 3RLFF 2AXDS 2BZBA 4ISTA 2IIUA 5F3JA 5J2UE 4ZZCA 4JI3T 4PNIA 2FJAA 4YJ2E 4O4IE 4AQFC 5DABA 3AECA 4CZZB 1FEWA 4IDPA 2A9UA 5JDGA 3AEEA 2BVLA 2QYWA 3X1DA 2XQ3A 1ZEEA 4B6XA 2Q9QB 4MLKA 4TNWA 5HXCA 3B57A 3AE2A 1ZOYA 1WRDA 4H9QC 5FYMA 4JI5T 2MAWA 5IWAT 3FXDB 1M62A 2I59A 4X1YE 1U5PA 4PFOA 2XAJB 2DCFA 3R6NA 4U2YA 1VRBA 2BBJA 4KMCA 3IHRA 4DR1T 3K1SA 4WYVA 4AIUA 2HPJA 4YHJA 2HH7A 3H37A 4IE6A 2ES0A 2VKJA 4YHHT 4LF8T 2XJ7A 4C90A 1DU2A 5GONE 1WR0A 3PJAA 3MZKB 4L5GA 4DR3T 4P09A 5AQJB 4DNDA 4DMVA 5ETWA 3P4RA 3VRBA 5LBQB 4KBMB 4UXNB 3D0TA 1S35A 3GA8A 1MMGA 3O1IA 3MXZA 2LKGA 3CMLA 3L09A 5L47A 2CPTA 3N2GE 4TV9E 2YK0A 2V7MA 1VCTA 4HE8A 2ACZA 3ZT6A 4LF6T 2WU5A 4XZCA 2R6GF 5KMGP 3DP7A 5LA6E 4JI1T 2JPFA 2KNDA 2X67A 4K0UA 2RP4A 1KK7A 2YU2A 4X20E 2XQ9A 4UV9B 2UUCT 3QC9A 2WSSV 2B76A 5C2TA 2VL0A 5A1LA 3UU4A 1LVKA 1SE7A 2Y8DA 5KDMC 4HFVA 3AA6B 5AQSB 4TUYE 5F5WA 4K0KT 3EHZA 4U2ZA 2CWOA 2X0LB 2BBHA 2XAQB 2YKSA 3GN5A 2WDVA 2KZ7B 5FKYA 2X9HA 3B13A 5CJ5A 1IZNB 4AKGA 3M65A 2VKDA 3RRWA 3UU6A 1V9DA 5JDLA 3CWZB 2CHOA 4HKAA 4U74A 1XDOA 2VASA 1HG2A 4N78D 5AQIB 5J2TE 2F4VT 4L9IA 1KF6A 3FZFB 5AFUL 1OEDE 2ZM8A 2M67A 2X0YA 3HKDE 3AVSA 3AA7B 2NOXA 3DJBA 2D0TA 5JH7E 3KV6A 5FY1A 3ZPOA 4MBQA 2LHRA 3H3MA 4J2CA 4ZS2A 3N9LA 2WMNA 4P1NA 4JI6T 4HGAA 2I0MA 5FXZA 3JADA 4JI2T 4PK6A 4ZI2D 2IC9A 5H6RB 4O2AE 2BKPA 3AVRA 2CEAA 2XUEA 1HCIA 5BMVE 1S94A 3AAAB 5AQKB 5AQOB 3EABA 5ABFA 2BVMA 2XQ5A 1US7B 2Q9QC 2CCQA 4ILUA 4AKHA 3MA9A 1FMVA 3NRXA 2XQ6A 3UULA 2J62A 2H88A 4LF7T 4I0UA 4HWFA 3UT5E 3UQ7A 1EZ3A 3UQ4A 5CGMA 3PUSA 1HX8A 1SA0E 3ZSSA 3FZLB 1MIYA 2DHRA 3TLWA 1WYCA 1WFDA 4CQIA 2N1GA 2NWBA 2JQ9A 3E08A 3AA1B 4XAXB 2KT9A 4IE7A 4O4JE 3AE5A 2N2NA 4JBWF 2C5KT 3EDVA 3FZMB 1B7TA 5FXVA 2ZM0A 1W9RA 4TX5A 1N33T 2J47A 2MTQA 4ANJA 4YT0A 4EV6A 1N34T 2L8KA 3OYZA 2EHOD 3TLTA 4NUUA 3W15B 4IDOA 5L4EA 2UXNB 2K9AA 4OYKA 5LG3A 3CK6A 4CXWA 1KFYA 3IBPA 2LSGA 5LXTE 4X62T 2BS4A 2JIWA 3E22E 3R84B 4ILBA 3EAMA 4KI0F 4YFSA 1O3XA 3EDUA 3H3AA 4KHPT 3WAJA 2A72A 2DL1A 4EZHA 3J9X1 3I9WA 4TN7B 4LFBT 2X9YA 1MNDA 2VKHA 3HKCE 5HCJA 4BA9A 3AXJB 4LF4T 3NWIA 1KNPA 1D0ZA 3VR8A 4CXYA 2D5UA 2V26A 5AQRB 4PJNA 1W0BA 3OKQA 3C4ZA 2JQHA 2MYSA 3TLVA 1IBLT 2V6YA 5JDFA 4DV6T 1QLBA 2L9QA 1JNZA 2YN6A 3SFDA 2E9XD 1IJ6A 2W62A 5FVLA 3ANWA 4B3MT 2NW8A 4IREA 3AE1A 4QH4A 2V7KA 4DUZT 5CFBA 1MMAA 3Q5DA 2BG9A 4OYJA 2YU1A 2YDQA 3ZYKA 2CE7A 3CIRA 3AEFA 3CX6B 1HX1B 4I50E 3ZC1A 4PJJA 5ABEA 1G8XA 3TLSA 2K48A 3SWHA 3HI2A 5LCYA 4ZI3D 3FB2A 2LOSA 4BJMA 3O1HA 3O4XE 5HWXA 2X68A 2Z6EA 3P4SA 2L3LA 2EHOA 3ABVA 4NUVA 2QVAA 3K8PC 3AAIA 3ZJ2A 3RRCA 4WBOA 4NXMT 3VU7H 3EI0A 3QB5K 4DBRA 4YTPA 4NIQA 3ZJ1A 2MBGA 2ODVA 1OXZA 3JC6D 3PE0A 2E5LT 2WWVA 3U3IA 2V5CA 2CXFA 2UUBT 4ISSA 2IW5B 2SPCA 4JI8T 3PUAA 2WCAA 2UXCT 2DWKA 3RIAA 3LG7A 4LFAT 4GK0E 3T1YT 5LOVE 1L0VA 4IDQA 3UU8A 4P0BA 5JQGE 5L3CB 3K3NA 2E5VA 4AQGA 3FHNA 4C91A 2W2UA 1I94T 4IL4A 4AISA 4H9NC 2E9XA 5LMNT 5C3JA 5AQUB 4ZI7E 1QUUA 4YJ3E 4CN1A 5LGTB 3Q9DA 2IMLA 4EIWA 2LSKA 5JREA 3N2OA 4DR4T 2XPKA 3Q2MA 5AQHB 1E1HB 4HWIB 5DQVA 1XMOT 2J4GA 4EYUA 2NTYA 4TWDA 2WDQA 2CA5A 3QNUA 4ZOLE 3QB5A 2WQYA 4IIJE 4IE0A 2VL8A 3AEGA 4EOZB 1NWMX 3VHLA 3KBUA 2C0SA 3PUYF 4I4TE 3LJCA 3N9OA 1MIVA 3K3OA 2IUBA 2LHNA 5LHGB 2LT3A 4WZXA 3RYCE 1X9BA 3RX6A 4PAGA 2I6HA 4FI5A 2FBWA 3GWHA 3Q5WA 2K3WA 2K24A 4X66T 3Q5EA 4H9SE 4HTEA 3ZSTA 2LM2A 3F57A 2V7IA 1HNWT 4EEDA 4DR6T 2OLTA 4UV8B 4ASKA 1MMNA 3RYIE 3ZKRA 4BAYB 1BR1A 3QUJA 2V6XA 4I55E 1QSDA 3UU5A 2HHHT 5EK4A 2H7VC 5LGNB 4UIGA 3L3PA 4H63H 3GN5B 4G63A 4JI4T 1MIWA 2BG9C 4HFHA 2W67A 3J7Yq 2WS3A 3A7MA 5JDQA 1Z8UA 2W0GA 4DR7T 4CI3B 3SRZA 3AEBA 4JI7T 3PDYA 2QGSA 2KWIB 2QA7A 4LMKA 2VURA 3CQGB 2Y48B 3OYXA 2QRXA 5LJMA 1D1AA 2CHNA 2XAHB 4JUYA 1UURA 4ZEYA 2VKOA 5CA0E 5JRCA 3AE6A 4FJOA 4IDNA 1JNRA 4HFIA 1I6ZA 4QKNA 2WDRA 5JVDE 2C5JA 2XQAA 4X1IE 2IAKA 4KP3C 5JDNA 5BR8T 2XASB 3SFEA 3IEEA 5L2LA 4IHJE 4H9RC 4OHFA 2W00A 3ZLIA 2LKHA 3PJAJ 2V5DA 5TAOA 2BS2A 3P7IA 4WW0A 5LHHB 2X66A 2CLYB 2DNXA 4Z90A 3IA3A 4A5XA 1LKXA 1H7CA 2LJLA 2ACXA 3OVUA 2IHR1 2XSAA 3T8OA 2HN1A 3CQXC 3RHWA 3WAKA 5ABFB 2KLQA 1J5ET 3B5MA 4TWFA 2H3RA 4DV5T 2WB5A 3RIUA 5L4HA 3P4WA 5ADXL 3KINB 4MHCA 5EK2A 2VB6A 3PUGA 4OFZA 2V7LA 2P9BA 3MKDA 1FJGT 3AEDA 2PTFA 4E7ZA 3CKDA 5EK3A 4X65T 1T98A 2YOEA 2M6IA 2CBIA 5EZYE 5FY0A 3L8RA 3BQLA 2W66A 3RI5A 4GIWA 4B3TT 3I0QA 2WP9A 3VKGA 4MFRA 1T7SA 3MACA 2A2FX 1UX5A 2PFVA 4UF0A 1SHZC 1YKHB 2J1DG 3LFMA 4TNVA 4U72A 5J1GA 1HNXT 5JR9A 2WU2A 2H7OA 4CXXA 3U78A 4UVBB 2E8IA 3CPZA 3AE9A 5HEGA 4KHZF 1UX4A 5KX5E 3FXEB 3I0OA 3LK42 2JMHA 1IBKT 4X1KE 4O2BE 2JQKA 5FP3A 4ZI3C 4I43B 2CBJA 4YSYA 3JCFA 1Y64B 3LK2B 4BJNA 4IE4A 4EB6E 1UGOA 1ZHCA 2WZIA 1J1JA 4IDZA 1ZKEA 3EVYA 4ZXLA 4AI6A 2IDOB 3VRAA 4ZZBA 2VVSA 3NBXX 3NRYA 4PK5A 3RH3A 5HWYA 5ABHA 4O8SA 3PTRB 4B3RT 1T72A 4DV0T 3PUQA 2Q9QD 5HXEA 3AAEB 4IE5A 4KUMB 4EZ4A 1HG5A 3C50A 2V6YB 2FJBA 2VQFT 3UUNA 1NENA 1NAFA 3ZEFB 3ANWB 1VCSA 4PK4A 3C4XA 5HEJA 4XBFB 4V1Av 3RYHE 4TWHA 2MPKA 2BG9B 4GK5E 3SOLA 2OV9A 4HEAA 1KNZA 4YSXA 4F6RC 4ILCA 1UK5A 3LBXA 3LBXB 3ONLC 2WZHA 4LFCT 5LP6E 3FBZA 4PW8A 3UU3A 1CUNA 2KSRA 3LSVA 3KVAA 4ZS3A 5AQQB 4EYYR 3N5LA 3AEAA 3NKZA 5LGUB 5IUXA 2VWAA 5LBMA 1XDPA 1YKEB 4EXTA 2CLYC 2UXDT 3FBLA 5L3BB 2RPAA 4Q25A 1OEDA 2KINB 2A3DA 1OEDB 4QXBB 2EHOB 1Z0PA 4YY3T 1MNEA 3HKBE 3ZN1B 4DV3T 2B1EA 4AQYT 3CX7B 2PJQA 3KV9A 2YDSA 3ZMTB 4KX6A 4YTNA 1J5WA 2WY2A 2WMOA 1E7PA 2XY8B 3FZKB 5L3FB 2W4XA 5HXSA 5AQNB 5F8PA 3NZQA 5LB7B 4COFA 2NR4A 5FNVE 1U4QA 2VVNA 3P4PA 1ZP0A 2CRBA 2BDEA 2XQ8A 5AQMB 4JLEA 2LOPA 3HL6A 3BQIA 4QXCB 3UFEA 2XSBA 1G73A 2ZMAA 3F31A 3AB3B 5JDHA 1D0YA 1AJ3A 2HPLA 2Q9QA 4IGUA 1XNRT 3OJAA 5HCMA 1HNZT 3ZT5A 2WBLA 5L3DB 1N32T 5CB4E 1WYBA 3P4QA 3V5UA 5JR9C 3OTOT 3RC8A 2E9XB 2LRLA 5LHIB 4AKRB 3RQUA 5DQWA 2OA5A 4Z91A 3ZC0A 3AE8A 3KV5A 5AQTB 3FZHB 3UTKA 1GQEA 1XNQT 5M4YA 1XMQT 4HFCA 2LEHA 2IC6A 4EEBA 4HWHA 4H9PC 5E0OA 4GYSA 5FY7A 2XAFB 4IT4A 3G06A 2LSYA 4JYAT 2FJDA 4QX8B 3OPCA 3I1AA 1KNRA 4PJMA 2YINA 4U31A 2XQ4A 4A98A 3AA0B 3DTOA 4DMWA 3C51A 5HYAA 2D9DA 5AQPB 4ZI2C 1YD8G 3PUXF 3ZT7A 3PUVF 2UUAT 3A5XA 4YSZA 3AE4A 5AQVB 2DWGA 2FUPA 1D1CA 1FMWA 2YDRA 5L3GB 3HA4A 2XM1A 4U33A 4QH1A 5FVKA 1W09A 3RKOA 2V7JA 1BR4A 4AXPA 4DV4T 2D0UA 3RGLA 3ZMSB 1HFAA 2E2AA 4U7IA 5HEHA 3GMIA 3ZYMA 3ZN0B 1X79A 3ONJA 3TLUA 4DR2T 5C8YE 3ONXA 1E2AA 1HF8A 4UVCB 1BR2A 2BG9E 3MK7C 1KEYA 4DR5T 4X5TA 4NXNT 2NW7A 3S4UA 4EAHA 4ADZA 3NZPA 5FXXA 4OX9T 2K5BB 2LSJA 3MJXA 2XQYA 4LF5T 2UXXB 5LMUT 4PJLA 5FXWA 3VR9A 5CA1E 5DJQC 2DI4A 2V8SV 1IBMT 5JRCB 1M7KA 4PFPA 5AQLB 2DLRA 2X51A 4LF9T 4DBQA 4UR9A 1OEDC 3C98B 2EHOC 3RKGA 5ABGA 2CMRA 4LMJA 5FL0A 5HAXA 5LG4A 1VOMA 3V5SA 4DUYT 2MOZA 4JEUB 2CM0A 2LSIA 2X9XA 3UFGA 2ZM6T 4OK0A 4HWDA 3RC3A 4YXDA 4EGWA 3T1HT 4L0RA 4DVDA 2V1DB 1W0AA 3P8CD 3NVOA 2LE8A 3F2EA 4H63V 3OBVE 4A56A 4WBNE 4YTMA 3IF8B 3C4WA 1XWMA 3WI3A 4DO0A 5HEUA 5LJNA 4M1PA 3BQKA 2RA1A 3TKLB 1T8BA 4AKLA 2UU9T 3A8YC 3ETVA 4MALA 5FL1A 1UUSA 3ETUA 4DIDB 1WCRA 2LM9A 3CX8B 2XM2A 4UELA 3AE3A 4A97A 1Y01A 3ZMUB 4AQFA 4QH5A 1HR0T 4WNKA 4JI0T 4ERRA 4HFEA 1WR6A 2E9XC 2VK9A 2H89A 4JV5T 5J0ZA 3C64A 3EUHA 3PURA 1HS7A 3O1JA 1IJ5A 1D0XA 3E0ZA 3PV0F 4QHOA 3K3QC 4QXHB 4JEHB 3CVRA 4UF0B 3N9NA 3PUZF 4ILAA 2Y6XA 2XAGB 5JR9B 3N9MA 3JAEA 4HFBA 2W61A 3LK3B 2JJ9A 4UEMA 1YW0A 5HXHA 3N2KE 4DV1T 3RQWA 3UUBA 3RIFA 1XZYA 2FJEA 2KMFA
chains in the Genus database with same CATH topology
5LBMA 2JMKA 5DQVA 3KV6A 5FY1A 5JH7E 3ZPOA 4P0AA 3UUMA 4E7SA 1YKEB 4EYUA 4EXTA 2CLYC 4TZ4C 2NTYA 3FBLA 5L3BB 2CA5A 2KINB 4ZOLE 1IAPA 2A3DA 2LHRA 4IIJE 4IE0A 4MBQA 4QXBB 4J2CA 2VL8A 4EOZB 4ZS2A 5IYZE 1NWMX 2EHOB 3VHLA 3N9LA 3KBUA 2WMNA 2C0SA 1Z0PA 2WM9A 4CI2B 4I4TE 3LJCA 3N9OA 4HGAA 1MIVA 1MNEA 3K3OA 5FXZA 3HKBE 3ZN1B 2B1EA 2LHNA 5LHGB 4PK6A 4ZI2D 2LT3A 3RYCE 3CX7B 2IC9A 3RX6A 2PJQA 2G0UA 4PAGA 5H6RB 3KV9A 4O2AE 3ZMTB 3AVRA 2CEAA 3JC6C 4FI5A 2NW9A 2XUEA 2NP9A 1HCIA 3GWHA 2NTXA 5BMVE 3Q5WA 2WMOA 5H6QB 2K24A 1S94A 2CXLA 5L3FB 4H9SE 3AAAB 4HTEA 4CI1B 5HXSA 2N9DA 2JRKA 2BVMA 2KXPB 5F8PA 5LYJE 3F57A 5JDMA 3NZQA 3RPUA 3ESLA 2V7IA 1US7B 5FNVE 1U4QA 3RYFE 2Q9QC 4UV8B 4ASKA 2W63A 2CCQA 1MMNA 2BDEA 4ILUA 4JLEA 3RYIE 4AKHA 4UVAB 4YLHA 3MA9A 2LOPA 3I9YA 4BAYB 3HL6A 1D1BA 3BQIA 1BR1A 4QXCB 4QWNB 1OWAA 2D2SA 3UFEA 1G73A 3QUJA 4I55E 1FMVA 1QSDA 2ZMAA 2GK9A 3F31A 3AB3B 2JQQA 3NRXA 5EK4A 5JDHA 1D0YA 2H7VC 1AJ3A 3UULA 5LGNB 2HPLA 2C5IT 4UIGA 2Q9QA 3KVBA 4IGUA 5IHYA 3OJAA 3L3PA 4H63H 4QX7B 3GN5B 1WLXA 4G63A 3UT5E 1EZ3A 3KV4A 3PUSA 3Q5XA 1MIWA 1HX8A 2WBLA 1SA0E 3J7Yq 3N9PA 5L3DB 5JDQA 4O4HE 2WAUA 2W0GA 4CI3B 3SRZA 2PBIA 5CB4E 1WYBA 3ZMZB 3PDYA 1MIYA 2DHRA 1WYCA 3V5UA 5JR9C 2QGSA 5HXRA 3PU8A 3RC8A 2KWIB 2QA7A 4CQIA 3HKEE 2N1GA 2E9XB 5L3EB 3CQGB 2Y48B 2NWBA 5LHIB 2CXDA 3ZCIA 4AKRB 3E08A 1FIOA 3AA1B 5DQWA 3OYXA 5LJMA 4XAXB 4AKIA 2KT9A 4IE7A 1D1AA 2OA5A 2YEVC 3ZMVB 4O4JE 2XAHB 4JUYA 1UCUA 2N2NA 2X9WA 3ZC0A 3KV5A 2C5KT 2VKOA 1BR0A 5CA0E 3EDVA 5JRCA 1B7TA 4GOUA 5FXVA 5LNKA 2ZM0A 2KWHA 2XHEB 3UTKA 3KBTA 4FJOA 4TX5A 5M4YA 3HR0A 3KFWX 4QKNA 5JVDE 2MTQA 2LEHA 2IC6A 4ANJA 2C5JA 3UUXB 4H9PC 5E0OA 4GYSA 4X1IE 2IAKA 4KP3C 2L8KA 5JDNA 3OYZA 5FY7A 2XAFB 4HN9A 2EHOD 2LSYA 3CQCB 2PG8A 4GYRA 4NUUA 3W15B 2XASB 3IEEA 5L2LA 4IHJE 3ZCJA 2ZLYA 4H9RC 4QX8B 2UXNB 4OHFA 3I1AA 1LRZA 1HTJF 2W00A 4PJMA 2YINA 3ZLIA 2K9AA 5FMNA 3AA0B 3DTOA 4DMWA 3C51A 4OYKA 5TAOA 2ODUA 3ZYLA 5HYAA 3P7IA 4WW0A 2CWYA 4CXWA 4Z8XA 3IBPA 4ZI2C 1YD8G 3KDSE 2LSGA 2X66A 2XTLA 2WWUA 2CLYB 4TV8E 5LHHB 5LXTE 3O9XA 2DNXA 3VKHA 1LVFA 3SS1A 3E22E 3A5XA 3R84B 1LKXA 1H7CA 2LJLA 3N9QA 2ACXA 3PU3A 2DWGA 1ZV4X 4YFSA 4H9OC 1O3XA 3T8OA 1D1CA 4ZHQE 3BK9A 3CQXC 1FMWA 3EDUA 4G2AA 3H3AA 3WAJA 2A72A 5L3GB 3HA4A 1MMDA 4EZHA 3WAKA 2ZM2A 4O4LE 3J9X1 3I9WA 3QK6A 4TN7B 3RKOA 2KLQA 2BZBA 4ISTA 2X9YA 1MNDA 2V7JA 1BR4A 2VKHA 4AXPA 5F3JA 5J2UE 3HKCE 2H3RA 2D0UA 2VWAA 3ZMSB 1HFAA 4PNIA 4YJ2E 4O4IE 4AQFC 5DABA 4CZZB 4BA9A 1FEWA 5ADXL 3KINB 5JDGA 4MHCA 3GMIA 3ZYMA 5EK2A 1D0ZA 3ZN0B 2BVLA 2VB6A 4CXYA 3PUGA 2D5UA 1X79A 4OFZA 2V7LA 2P9BA 1ZEEA 2V26A 4B6XA 5C8YE 4PJNA 3ONXA 2Q9QB 3MKDA 3OKQA 4MLKA 3C4ZA 2MYSA 5HXCA 1HF8A 3B57A 4UVCB 1BR2A 5JDFA 1WRDA 3MK7C 4E7ZA 3CKDA 5EK3A 2L9QA 4H9QC 5FYMA 1T98A 5EZYE 5FY0A 2E9XD 3BQLA 1IJ6A 2W62A 2NW7A 3FXDB 2I59A 3ANWA 3S4UA 2NW8A 4X1YE 4GIWA 4EAHA 4ADZA 1U5PA 3NZPA 4PFOA 2XAJB 5FXXA 3I0QA 2DCFA 2V7KA 3R6NA 3VKGA 1VRBA 4KMCA 1MMAA 4MFRA 2K5BB 2LSJA 3IHRA 3MACA 2A2FX 3MJXA 2HPJA 4YHJA 4OYJA 2XQYA 2UXXB 1UX5A 2PFVA 2YU1A 4PJLA 4UF0A 1SHZC 1YKHB 2CE7A 3ZYKA 2J1DG 3CX6B 2HH7A 3LFMA 5FXWA 3H37A 4IE6A 2ES0A 4U72A 5J1GA 5CA1E 5DJQC 2DI4A 2VKJA 5JR9A 5JRCB 4I50E 2H7OA 4PFPA 4CXXA 3U78A 3ZC1A 4C90A 4UVBB 2E8IA 4PJJA 2DLRA 2X51A 5GONE 3CPZA 3MZKB 1G8XA 4L5GA 4DBQA 1UX4A 2K48A 5KX5E 3C98B 3FXEB 4P09A 3I0OA 3LK42 3SWHA 2JMHA 4DNDA 2EHOC 4DMVA 4X1KE 3HI2A 5LCYA 5ETWA 3FB2A 4O2BE 4ZI3D 2LOSA 5FP3A 2CMRA 5LBQB 4ZI3C 4KBMB 4I43B 4UXNB 1Y64B 3LK2B 5HAXA 1VOMA 4BJMA 5LG4A 4BJNA 3D0TA 3V5SA 1S35A 3GA8A 2MOZA 4IE4A 4JEUB 1MMGA 2CM0A 2LSIA 3O1HA 3O1IA 2X9XA 4EB6E 3MXZA 3O4XE 1ZHCA 5HWXA 2X68A 2Z6EA 3CMLA 2L3LA 3L09A 4OK0A 3N2GE 2EHOA 4NUVA 4TV9E 3RC3A 2YK0A 2V7MA 3K8PC 4IDZA 4L0RA 3AAIA 3ZJ2A 2V1DB 4DVDA 1ZKEA 3EVYA 3RRCA 4WBOA 3P8CD 3VU7H 4HE8A 4DBRA 2LE8A 3F2EA 4H63V 4XZCA 3ZJ1A 2MBGA 2ODVA 4AI6A 1OXZA 3NBXX 5KMGP 3OBVE 4A56A 3JC6D 4WBNE 3PE0A 3IF8B 3DP7A 3C4WA 3NRYA 3WI3A 4PK5A 3RH3A 3U3IA 4DO0A 5LA6E 5HWYA 2CXFA 5LJNA 4M1PA 3BQKA 2RA1A 2JPFA 2KNDA 4O8SA 3TKLB 2X67A 4ISSA 2IW5B 4AKLA 3PTRB 2RP4A 4K0UA 2SPCA 3ETVA 4MALA 1KK7A 2YU2A 3PUAA 3ETUA 3PUQA 2Q9QD 4X20E 2DWKA 4UV9B 5HXEA 3AAEB 3QC9A 2LM9A 2WSSV 3LG7A 3CX8B 4UELA 5A1LA 4GK0E 4IE5A 4KUMB 5LOVE 1LVKA 4EZ4A 1HG5A 3C50A 3ZMUB 2Y8DA 5KDMC 4HFVA 3AA6B 4TUYE 4P0BA 4AQFA 3UUNA 4WNKA 4ERRA 2CWOA 1NAFA 5JQGE 1WR6A 2X0LB 2E9XC 3ZEFB 2VK9A 5L3CB 3ANWB 3C64A 3EUHA 3PURA 2XAQB 4PK4A 3GN5A 1HS7A 3C4XA 3O1JA 1IJ5A 1D0XA 3K3NA 4XBFB 2KZ7B 4V1Av 3RYHE 2X9HA 3E0ZA 3FHNA 3B13A 4QHOA 4AQGA 1IZNB 3K3QC 4AKGA 4C91A 3M65A 4QXHB 4JEHB 2VKDA 3CVRA 4GK5E 3SOLA 4UF0B 3RRWA 1V9DA 5JDLA 3CWZB 4HEAA 3N9NA 4H9NC 4HKAA 2E9XA 4U74A 1KNZA 4F6RC 2Y6XA 2XAGB 5JR9B 4ZI7E 2VASA 3N9MA 1HG2A 4N78D 5J2TE 1QUUA 3LBXA 4L9IA 4YJ3E 3LBXB 5AFUL 2W61A 3LK3B 2JJ9A 3Q9DA 5LGTB 4UEMA 5LP6E 2ZM8A 4EIWA 2M67A 2LSKA 3FBZA 4PW8A 1CUNA 5JREA 3HKDE 3KVAA 4ZS3A 1YW0A 5HXHA 3N2OA 3N2KE 4EYYR 3N5LA 3AVSA 3AA7B 5LGUB 2NOXA 3Q2MA 3DJBA 1E1HB 2KMFA 2D0TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LEH A; 
#chains in the Genus database with same CATH topology
 1N36 T;  2JMK A;  4P0A A;  3PUW F;  3UUM A;  4E7S A;  4TZ4 C;  1YXR A;  5JTG A;  3M3Z B;  1IAP A;  5IYZ E;  4X64 T;  2WM9 A;  4CI2 B;  2XQ7 A;  3RF1 A;  1NEK A;  1SUM B;  2VQE T;  2LLY A;  2G0U A;  4HFD A;  3JC6 C;  2NW9 A;  2NP9 A;  2NTX A;  5H6Q B;  2XZE A;  2CXL A;  2BS3 A;  4CI1 B;  2N9D A;  2JRK A;  2KXP B;  5LYJ E;  5JDM A;  4B3S T;  3RPU A;  4GKJ T;  2LRK A;  3ESL A;  4GKK T;  3RYF E;  4HWC A;  2W63 A;  4DV2 T;  4UVA B;  4YLH A;  3I9Y A;  1D1B A;  4QWN B;  1OWA A;  2D2S A;  2AE9 A;  1YQ3 A;  3AXJ A;  2GK9 A;  2JQQ A;  4CN4 A;  5AQF B;  2C5I T;  3KVB A;  5IHY A;  4QX7 B;  1WLX A;  3KV4 A;  3Q5X A;  2UXB T;  3N9P A;  4O4H E;  2WAU A;  4DV7 T;  2PBI A;  1YQ4 A;  3ZMZ B;  5HXR A;  3PU8 A;  3HKE E;  5L3E B;  2CXD A;  2BKO A;  3ZCI A;  1FIO A;  4AKI A;  5HEO A;  2YEV C;  3ZMV B;  4CN6 A;  1UCU A;  2X9W A;  1BR0 A;  5KXJ A;  4GOU A;  5LNK A;  2KWH A;  2XHE B;  3KBT A;  4LML A;  3HR0 A;  3KFW X;  3UUX B;  5AQG B;  3JAF A;  4U7Y A;  4NPP A;  3AE7 A;  4HN9 A;  3CQC B;  2BKN A;  2PG8 A;  4GYR A;  1CHU A;  3P50 A;  2M6B A;  4F8H A;  3ZCJ A;  4U3C A;  2ZLY A;  1LRZ A;  4IL9 A;  1HTJ F;  5FMN A;  3ZYL A;  2ODU A;  2CWY A;  4Z8X A;  3KDS E;  2XTL A;  4TV8 E;  3O9X A;  2WWU A;  2X0H A;  3L39 A;  3VKH A;  1LVF A;  3SS1 A;  2HN2 A;  3N9Q A;  3PU3 A;  1ZV4 X;  3RIU C;  4H9O C;  4ZHQ E;  3BK9 A;  4G2A A;  3LDQ B;  1R8I A;  1MMD A;  2ZM2 A;  4O4L E;  3QOF A;  3QK6 A;  3RLF F;  2AXD S;  2BZB A;  4IST A;  2IIU A;  5F3J A;  5J2U E;  4ZZC A;  4JI3 T;  4PNI A;  2FJA A;  4YJ2 E;  4O4I E;  4AQF C;  5DAB A;  3AEC A;  4CZZ B;  1FEW A;  4IDP A;  2A9U A;  5JDG A;  3AEE A;  2BVL A;  2QYW A;  3X1D A;  2XQ3 A;  1ZEE A;  4B6X A;  2Q9Q B;  4MLK A;  4TNW A;  5HXC A;  3B57 A;  3AE2 A;  1ZOY A;  1WRD A;  4H9Q C;  5FYM A;  4JI5 T;  2MAW A;  5IWA T;  3FXD B;  1M62 A;  2I59 A;  4X1Y E;  1U5P A;  4PFO A;  2XAJ B;  2DCF A;  3R6N A;  4U2Y A;  1VRB A;  2BBJ A;  4KMC A;  3IHR A;  4DR1 T;  3K1S A;  4WYV A;  4AIU A;  2HPJ A;  4YHJ A;  2HH7 A;  3H37 A;  4IE6 A;  2ES0 A;  2VKJ A;  4YHH T;  4LF8 T;  2XJ7 A;  4C90 A;  1DU2 A;  5GON E;  1WR0 A;  3PJA A;  3MZK B;  4L5G A;  4DR3 T;  4P09 A;  5AQJ B;  4DND A;  4DMV A;  5ETW A;  3P4R A;  3VRB A;  5LBQ B;  4KBM B;  4UXN B;  3D0T A;  1S35 A;  3GA8 A;  1MMG A;  3O1I A;  3MXZ A;  2LKG A;  3CML A;  3L09 A;  5L47 A;  2CPT A;  3N2G E;  4TV9 E;  2YK0 A;  2V7M A;  1VCT A;  4HE8 A;  2ACZ A;  3ZT6 A;  4LF6 T;  2WU5 A;  4XZC A;  2R6G F;  5KMG P;  3DP7 A;  5LA6 E;  4JI1 T;  2JPF A;  2KND A;  2X67 A;  4K0U A;  2RP4 A;  1KK7 A;  2YU2 A;  4X20 E;  2XQ9 A;  4UV9 B;  2UUC T;  3QC9 A;  2WSS V;  2B76 A;  5C2T A;  2VL0 A;  5A1L A;  3UU4 A;  1LVK A;  1SE7 A;  2Y8D A;  5KDM C;  4HFV A;  3AA6 B;  5AQS B;  4TUY E;  5F5W A;  4K0K T;  3EHZ A;  4U2Z A;  2CWO A;  2X0L B;  2BBH A;  2XAQ B;  2YKS A;  3GN5 A;  2WDV A;  2KZ7 B;  5FKY A;  2X9H A;  3B13 A;  5CJ5 A;  1IZN B;  4AKG A;  3M65 A;  2VKD A;  3RRW A;  3UU6 A;  1V9D A;  5JDL A;  3CWZ B;  2CHO A;  4HKA A;  4U74 A;  1XDO A;  2VAS A;  1HG2 A;  4N78 D;  5AQI B;  5J2T E;  2F4V T;  4L9I A;  1KF6 A;  3FZF B;  5AFU L;  1OED E;  2ZM8 A;  2M67 A;  2X0Y A;  3HKD E;  3AVS A;  3AA7 B;  2NOX A;  3DJB A;  2D0T A;  5JH7 E;  3KV6 A;  5FY1 A;  3ZPO A;  4MBQ A;  2LHR A;  3H3M A;  4J2C A;  4ZS2 A;  3N9L A;  2WMN A;  4P1N A;  4JI6 T;  4HGA A;  2I0M A;  5FXZ A;  3JAD A;  4JI2 T;  4PK6 A;  4ZI2 D;  2IC9 A;  5H6R B;  4O2A E;  2BKP A;  3AVR A;  2CEA A;  2XUE A;  1HCI A;  5BMV E;  1S94 A;  3AAA B;  5AQK B;  5AQO B;  3EAB A;  5ABF A;  2BVM A;  2XQ5 A;  1US7 B;  2Q9Q C;  2CCQ A;  4ILU A;  4AKH A;  3MA9 A;  1FMV A;  3NRX A;  2XQ6 A;  3UUL A;  2J62 A;  2H88 A;  4LF7 T;  4I0U A;  4HWF A;  3UT5 E;  3UQ7 A;  1EZ3 A;  3UQ4 A;  5CGM A;  3PUS A;  1HX8 A;  1SA0 E;  3ZSS A;  3FZL B;  1MIY A;  2DHR A;  3TLW A;  1WYC A;  1WFD A;  4CQI A;  2N1G A;  2NWB A;  2JQ9 A;  3E08 A;  3AA1 B;  4XAX B;  2KT9 A;  4IE7 A;  4O4J E;  3AE5 A;  2N2N A;  4JBW F;  2C5K T;  3EDV A;  3FZM B;  1B7T A;  5FXV A;  2ZM0 A;  1W9R A;  4TX5 A;  1N33 T;  2J47 A;  2MTQ A;  4ANJ A;  4YT0 A;  4EV6 A;  1N34 T;  2L8K A;  3OYZ A;  2EHO D;  3TLT A;  4NUU A;  3W15 B;  4IDO A;  5L4E A;  2UXN B;  2K9A A;  4OYK A;  5LG3 A;  3CK6 A;  4CXW A;  1KFY A;  3IBP A;  2LSG A;  5LXT E;  4X62 T;  2BS4 A;  2JIW A;  3E22 E;  3R84 B;  4ILB A;  3EAM A;  4KI0 F;  4YFS A;  1O3X A;  3EDU A;  3H3A A;  4KHP T;  3WAJ A;  2A72 A;  2DL1 A;  4EZH A;  3J9X 1;  3I9W A;  4TN7 B;  4LFB T;  2X9Y A;  1MND A;  2VKH A;  3HKC E;  5HCJ A;  4BA9 A;  3AXJ B;  4LF4 T;  3NWI A;  1KNP A;  1D0Z A;  3VR8 A;  4CXY A;  2D5U A;  2V26 A;  5AQR B;  4PJN A;  1W0B A;  3OKQ A;  3C4Z A;  2JQH A;  2MYS A;  3TLV A;  1IBL T;  2V6Y A;  5JDF A;  4DV6 T;  1QLB A;  2L9Q A;  1JNZ A;  2YN6 A;  3SFD A;  2E9X D;  1IJ6 A;  2W62 A;  5FVL A;  3ANW A;  4B3M T;  2NW8 A;  4IRE A;  3AE1 A;  4QH4 A;  2V7K A;  4DUZ T;  5CFB A;  1MMA A;  3Q5D A;  2BG9 A;  4OYJ A;  2YU1 A;  2YDQ A;  3ZYK A;  2CE7 A;  3CIR A;  3AEF A;  3CX6 B;  1HX1 B;  4I50 E;  3ZC1 A;  4PJJ A;  5ABE A;  1G8X A;  3TLS A;  2K48 A;  3SWH A;  3HI2 A;  5LCY A;  4ZI3 D;  3FB2 A;  2LOS A;  4BJM A;  3O1H A;  3O4X E;  5HWX A;  2X68 A;  2Z6E A;  3P4S A;  2L3L A;  2EHO A;  3ABV A;  4NUV A;  2QVA A;  3K8P C;  3AAI A;  3ZJ2 A;  3RRC A;  4WBO A;  4NXM T;  3VU7 H;  3EI0 A;  3QB5 K;  4DBR A;  4YTP A;  4NIQ A;  3ZJ1 A;  2MBG A;  2ODV A;  1OXZ A;  3JC6 D;  3PE0 A;  2E5L T;  2WWV A;  3U3I A;  2V5C A;  2CXF A;  2UUB T;  4ISS A;  2IW5 B;  2SPC A;  4JI8 T;  3PUA A;  2WCA A;  2UXC T;  2DWK A;  3RIA A;  3LG7 A;  4LFA T;  4GK0 E;  3T1Y T;  5LOV E;  1L0V A;  4IDQ A;  3UU8 A;  4P0B A;  5JQG E;  5L3C B;  3K3N A;  2E5V A;  4AQG A;  3FHN A;  4C91 A;  2W2U A;  1I94 T;  4IL4 A;  4AIS A;  4H9N C;  2E9X A;  5LMN T;  5C3J A;  5AQU B;  4ZI7 E;  1QUU A;  4YJ3 E;  4CN1 A;  5LGT B;  3Q9D A;  2IML A;  4EIW A;  2LSK A;  5JRE A;  3N2O A;  4DR4 T;  2XPK A;  3Q2M A;  5AQH B;  1E1H B;  4HWI B;  5DQV A;  1XMO T;  2J4G A;  4EYU A;  2NTY A;  4TWD A;  2WDQ A;  2CA5 A;  3QNU A;  4ZOL E;  3QB5 A;  2WQY A;  4IIJ E;  4IE0 A;  2VL8 A;  3AEG A;  4EOZ B;  1NWM X;  3VHL A;  3KBU A;  2C0S A;  3PUY F;  4I4T E;  3LJC A;  3N9O A;  1MIV A;  3K3O A;  2IUB A;  2LHN A;  5LHG B;  2LT3 A;  4WZX A;  3RYC E;  1X9B A;  3RX6 A;  4PAG A;  2I6H A;  4FI5 A;  2FBW A;  3GWH A;  3Q5W A;  2K3W A;  2K24 A;  4X66 T;  3Q5E A;  4H9S E;  4HTE A;  3ZST A;  2LM2 A;  3F57 A;  2V7I A;  1HNW T;  4EED A;  4DR6 T;  2OLT A;  4UV8 B;  4ASK A;  1MMN A;  3RYI E;  3ZKR A;  4BAY B;  1BR1 A;  3QUJ A;  2V6X A;  4I55 E;  1QSD A;  3UU5 A;  2HHH T;  5EK4 A;  2H7V C;  5LGN B;  4UIG A;  3L3P A;  4H63 H;  3GN5 B;  4G63 A;  4JI4 T;  1MIW A;  2BG9 C;  4HFH A;  2W67 A;  3J7Y q;  2WS3 A;  3A7M A;  5JDQ A;  1Z8U A;  2W0G A;  4DR7 T;  4CI3 B;  3SRZ A;  3AEB A;  4JI7 T;  3PDY A;  2QGS A;  2KWI B;  2QA7 A;  4LMK A;  2VUR A;  3CQG B;  2Y48 B;  3OYX A;  2QRX A;  5LJM A;  1D1A A;  2CHN A;  2XAH B;  4JUY A;  1UUR A;  4ZEY A;  2VKO A;  5CA0 E;  5JRC A;  3AE6 A;  4FJO A;  4IDN A;  1JNR A;  4HFI A;  1I6Z A;  4QKN A;  2WDR A;  5JVD E;  2C5J A;  2XQA A;  4X1I E;  2IAK A;  4KP3 C;  5JDN A;  5BR8 T;  2XAS B;  3SFE A;  3IEE A;  5L2L A;  4IHJ E;  4H9R C;  4OHF A;  2W00 A;  3ZLI A;  2LKH A;  3PJA J;  2V5D A;  5TAO A;  2BS2 A;  3P7I A;  4WW0 A;  5LHH B;  2X66 A;  2CLY B;  2DNX A;  4Z90 A;  3IA3 A;  4A5X A;  1LKX A;  1H7C A;  2LJL A;  2ACX A;  3OVU A;  2IHR 1;  2XSA A;  3T8O A;  2HN1 A;  3CQX C;  3RHW A;  3WAK A;  5ABF B;  2KLQ A;  1J5E T;  3B5M A;  4TWF A;  2H3R A;  4DV5 T;  2WB5 A;  3RIU A;  5L4H A;  3P4W A;  5ADX L;  3KIN B;  4MHC A;  5EK2 A;  2VB6 A;  3PUG A;  4OFZ A;  2V7L A;  2P9B A;  3MKD A;  1FJG T;  3AED A;  2PTF A;  4E7Z A;  3CKD A;  5EK3 A;  4X65 T;  1T98 A;  2YOE A;  2M6I A;  2CBI A;  5EZY E;  5FY0 A;  3L8R A;  3BQL A;  2W66 A;  3RI5 A;  4GIW A;  4B3T T;  3I0Q A;  2WP9 A;  3VKG A;  4MFR A;  1T7S A;  3MAC A;  2A2F X;  1UX5 A;  2PFV A;  4UF0 A;  1SHZ C;  1YKH B;  2J1D G;  3LFM A;  4TNV A;  4U72 A;  5J1G A;  1HNX T;  5JR9 A;  2WU2 A;  2H7O A;  4CXX A;  3U78 A;  4UVB B;  2E8I A;  3CPZ A;  3AE9 A;  5HEG A;  4KHZ F;  1UX4 A;  5KX5 E;  3FXE B;  3I0O A;  3LK4 2;  2JMH A;  1IBK T;  4X1K E;  4O2B E;  2JQK A;  5FP3 A;  4ZI3 C;  4I43 B;  2CBJ A;  4YSY A;  3JCF A;  1Y64 B;  3LK2 B;  4BJN A;  4IE4 A;  4EB6 E;  1UGO A;  1ZHC A;  2WZI A;  1J1J A;  4IDZ A;  1ZKE A;  3EVY A;  4ZXL A;  4AI6 A;  2IDO B;  3VRA A;  4ZZB A;  2VVS A;  3NBX X;  3NRY A;  4PK5 A;  3RH3 A;  5HWY A;  5ABH A;  4O8S A;  3PTR B;  4B3R T;  1T72 A;  4DV0 T;  3PUQ A;  2Q9Q D;  5HXE A;  3AAE B;  4IE5 A;  4KUM B;  4EZ4 A;  1HG5 A;  3C50 A;  2V6Y B;  2FJB A;  2VQF T;  3UUN A;  1NEN A;  1NAF A;  3ZEF B;  3ANW B;  1VCS A;  4PK4 A;  3C4X A;  5HEJ A;  4XBF B;  4V1A v;  3RYH E;  4TWH A;  2MPK A;  2BG9 B;  4GK5 E;  3SOL A;  2OV9 A;  4HEA A;  1KNZ A;  4YSX A;  4F6R C;  4ILC A;  1UK5 A;  3LBX A;  3LBX B;  3ONL C;  2WZH A;  4LFC T;  5LP6 E;  3FBZ A;  4PW8 A;  3UU3 A;  1CUN A;  2KSR A;  3LSV A;  3KVA A;  4ZS3 A;  5AQQ B;  4EYY R;  3N5L A;  3AEA A;  3NKZ A;  5LGU B;  5IUX A;  2VWA A;  5LBM A;  1XDP A;  1YKE B;  4EXT A;  2CLY C;  2UXD T;  3FBL A;  5L3B B;  2RPA A;  4Q25 A;  1OED A;  2KIN B;  2A3D A;  1OED B;  4QXB B;  2EHO B;  1Z0P A;  4YY3 T;  1MNE A;  3HKB E;  3ZN1 B;  4DV3 T;  2B1E A;  4AQY T;  3CX7 B;  2PJQ A;  3KV9 A;  2YDS A;  3ZMT B;  4KX6 A;  4YTN A;  1J5W A;  2WY2 A;  2WMO A;  1E7P A;  2XY8 B;  3FZK B;  5L3F B;  2W4X A;  5HXS A;  5AQN B;  5F8P A;  3NZQ A;  5LB7 B;  4COF A;  2NR4 A;  5FNV E;  1U4Q A;  2VVN A;  3P4P A;  1ZP0 A;  2CRB A;  2BDE A;  2XQ8 A;  5AQM B;  4JLE A;  2LOP A;  3HL6 A;  3BQI A;  4QXC B;  3UFE A;  2XSB A;  1G73 A;  2ZMA A;  3F31 A;  3AB3 B;  5JDH A;  1D0Y A;  1AJ3 A;  2HPL A;  2Q9Q A;  4IGU A;  1XNR T;  3OJA A;  5HCM A;  1HNZ T;  3ZT5 A;  2WBL A;  5L3D B;  1N32 T;  5CB4 E;  1WYB A;  3P4Q A;  3V5U A;  5JR9 C;  3OTO T;  3RC8 A;  2E9X B;  2LRL A;  5LHI B;  4AKR B;  3RQU A;  5DQW A;  2OA5 A;  4Z91 A;  3ZC0 A;  3AE8 A;  3KV5 A;  5AQT B;  3FZH B;  3UTK A;  1GQE A;  1XNQ T;  5M4Y A;  1XMQ T;  4HFC A;  2LEH A;  2IC6 A;  4EEB A;  4HWH A;  4H9P C;  5E0O A;  4GYS A;  5FY7 A;  2XAF B;  4IT4 A;  3G06 A;  2LSY A;  4JYA T;  2FJD A;  4QX8 B;  3OPC A;  3I1A A;  1KNR A;  4PJM A;  2YIN A;  4U31 A;  2XQ4 A;  4A98 A;  3AA0 B;  3DTO A;  4DMW A;  3C51 A;  5HYA A;  2D9D A;  5AQP B;  4ZI2 C;  1YD8 G;  3PUX F;  3ZT7 A;  3PUV F;  2UUA T;  3A5X A;  4YSZ A;  3AE4 A;  5AQV B;  2DWG A;  2FUP A;  1D1C A;  1FMW A;  2YDR A;  5L3G B;  3HA4 A;  2XM1 A;  4U33 A;  4QH1 A;  5FVK A;  1W09 A;  3RKO A;  2V7J A;  1BR4 A;  4AXP A;  4DV4 T;  2D0U A;  3RGL A;  3ZMS B;  1HFA A;  2E2A A;  4U7I A;  5HEH A;  3GMI A;  3ZYM A;  3ZN0 B;  1X79 A;  3ONJ A;  3TLU A;  4DR2 T;  5C8Y E;  3ONX A;  1E2A A;  1HF8 A;  4UVC B;  1BR2 A;  2BG9 E;  3MK7 C;  1KEY A;  4DR5 T;  4X5T A;  4NXN T;  2NW7 A;  3S4U A;  4EAH A;  4ADZ A;  3NZP A;  5FXX A;  4OX9 T;  2K5B B;  2LSJ A;  3MJX A;  2XQY A;  4LF5 T;  2UXX B;  5LMU T;  4PJL A;  5FXW A;  3VR9 A;  5CA1 E;  5DJQ C;  2DI4 A;  2V8S V;  1IBM T;  5JRC B;  1M7K A;  4PFP A;  5AQL B;  2DLR A;  2X51 A;  4LF9 T;  4DBQ A;  4UR9 A;  1OED C;  3C98 B;  2EHO C;  3RKG A;  5ABG A;  2CMR A;  4LMJ A;  5FL0 A;  5HAX A;  5LG4 A;  1VOM A;  3V5S A;  4DUY T;  2MOZ A;  4JEU B;  2CM0 A;  2LSI A;  2X9X A;  3UFG A;  2ZM6 T;  4OK0 A;  4HWD A;  3RC3 A;  4YXD A;  4EGW A;  3T1H T;  4L0R A;  4DVD A;  2V1D B;  1W0A A;  3P8C D;  3NVO A;  2LE8 A;  3F2E A;  4H63 V;  3OBV E;  4A56 A;  4WBN E;  4YTM A;  3IF8 B;  3C4W A;  1XWM A;  3WI3 A;  4DO0 A;  5HEU A;  5LJN A;  4M1P A;  3BQK A;  2RA1 A;  3TKL B;  1T8B A;  4AKL A;  2UU9 T;  3A8Y C;  3ETV A;  4MAL A;  5FL1 A;  1UUS A;  3ETU A;  4DID B;  1WCR A;  2LM9 A;  3CX8 B;  2XM2 A;  4UEL A;  3AE3 A;  4A97 A;  1Y01 A;  3ZMU B;  4AQF A;  4QH5 A;  1HR0 T;  4WNK A;  4JI0 T;  4ERR A;  4HFE A;  1WR6 A;  2E9X C;  2VK9 A;  2H89 A;  4JV5 T;  5J0Z A;  3C64 A;  3EUH A;  3PUR A;  1HS7 A;  3O1J A;  1IJ5 A;  1D0X A;  3E0Z A;  3PV0 F;  4QHO A;  3K3Q C;  4QXH B;  4JEH B;  3CVR A;  4UF0 B;  3N9N A;  3PUZ F;  4ILA A;  2Y6X A;  2XAG B;  5JR9 B;  3N9M A;  3JAE A;  4HFB A;  2W61 A;  3LK3 B;  2JJ9 A;  4UEM A;  1YW0 A;  5HXH A;  3N2K E;  4DV1 T;  3RQW A;  3UUB A;  3RIF A;  1XZY A;  2FJE A;  2KMF A; 
#chains in the Genus database with same CATH homology
 5LBM A;  2JMK A;  5DQV A;  3KV6 A;  5FY1 A;  5JH7 E;  3ZPO A;  4P0A A;  3UUM A;  4E7S A;  1YKE B;  4EYU A;  4EXT A;  2CLY C;  4TZ4 C;  2NTY A;  3FBL A;  5L3B B;  2CA5 A;  2KIN B;  4ZOL E;  1IAP A;  2A3D A;  2LHR A;  4IIJ E;  4IE0 A;  4MBQ A;  4QXB B;  4J2C A;  2VL8 A;  4EOZ B;  4ZS2 A;  5IYZ E;  1NWM X;  2EHO B;  3VHL A;  3N9L A;  3KBU A;  2WMN A;  2C0S A;  1Z0P A;  2WM9 A;  4CI2 B;  4I4T E;  3LJC A;  3N9O A;  4HGA A;  1MIV A;  1MNE A;  3K3O A;  5FXZ A;  3HKB E;  3ZN1 B;  2B1E A;  2LHN A;  5LHG B;  4PK6 A;  4ZI2 D;  2LT3 A;  3RYC E;  3CX7 B;  2IC9 A;  3RX6 A;  2PJQ A;  2G0U A;  4PAG A;  5H6R B;  3KV9 A;  4O2A E;  3ZMT B;  3AVR A;  2CEA A;  3JC6 C;  4FI5 A;  2NW9 A;  2XUE A;  2NP9 A;  1HCI A;  3GWH A;  2NTX A;  5BMV E;  3Q5W A;  2WMO A;  5H6Q B;  2K24 A;  1S94 A;  2CXL A;  5L3F B;  4H9S E;  3AAA B;  4HTE A;  4CI1 B;  5HXS A;  2N9D A;  2JRK A;  2BVM A;  2KXP B;  5F8P A;  5LYJ E;  3F57 A;  5JDM A;  3NZQ A;  3RPU A;  3ESL A;  2V7I A;  1US7 B;  5FNV E;  1U4Q A;  3RYF E;  2Q9Q C;  4UV8 B;  4ASK A;  2W63 A;  2CCQ A;  1MMN A;  2BDE A;  4ILU A;  4JLE A;  3RYI E;  4AKH A;  4UVA B;  4YLH A;  3MA9 A;  2LOP A;  3I9Y A;  4BAY B;  3HL6 A;  1D1B A;  3BQI A;  1BR1 A;  4QXC B;  4QWN B;  1OWA A;  2D2S A;  3UFE A;  1G73 A;  3QUJ A;  4I55 E;  1FMV A;  1QSD A;  2ZMA A;  2GK9 A;  3F31 A;  3AB3 B;  2JQQ A;  3NRX A;  5EK4 A;  5JDH A;  1D0Y A;  2H7V C;  1AJ3 A;  3UUL A;  5LGN B;  2HPL A;  2C5I T;  4UIG A;  2Q9Q A;  3KVB A;  4IGU A;  5IHY A;  3OJA A;  3L3P A;  4H63 H;  4QX7 B;  3GN5 B;  1WLX A;  4G63 A;  3UT5 E;  1EZ3 A;  3KV4 A;  3PUS A;  3Q5X A;  1MIW A;  1HX8 A;  2WBL A;  1SA0 E;  3J7Y q;  3N9P A;  5L3D B;  5JDQ A;  4O4H E;  2WAU A;  2W0G A;  4CI3 B;  3SRZ A;  2PBI A;  5CB4 E;  1WYB A;  3ZMZ B;  3PDY A;  1MIY A;  2DHR A;  1WYC A;  3V5U A;  5JR9 C;  2QGS A;  5HXR A;  3PU8 A;  3RC8 A;  2KWI B;  2QA7 A;  4CQI A;  3HKE E;  2N1G A;  2E9X B;  5L3E B;  3CQG B;  2Y48 B;  2NWB A;  5LHI B;  2CXD A;  3ZCI A;  4AKR B;  3E08 A;  1FIO A;  3AA1 B;  5DQW A;  3OYX A;  5LJM A;  4XAX B;  4AKI A;  2KT9 A;  4IE7 A;  1D1A A;  2OA5 A;  2YEV C;  3ZMV B;  4O4J E;  2XAH B;  4JUY A;  1UCU A;  2N2N A;  2X9W A;  3ZC0 A;  3KV5 A;  2C5K T;  2VKO A;  1BR0 A;  5CA0 E;  3EDV A;  5JRC A;  1B7T A;  4GOU A;  5FXV A;  5LNK A;  2ZM0 A;  2KWH A;  2XHE B;  3UTK A;  3KBT A;  4FJO A;  4TX5 A;  5M4Y A;  3HR0 A;  3KFW X;  4QKN A;  5JVD E;  2MTQ A;  2LEH A;  2IC6 A;  4ANJ A;  2C5J A;  3UUX B;  4H9P C;  5E0O A;  4GYS A;  4X1I E;  2IAK A;  4KP3 C;  2L8K A;  5JDN A;  3OYZ A;  5FY7 A;  2XAF B;  4HN9 A;  2EHO D;  2LSY A;  3CQC B;  2PG8 A;  4GYR A;  4NUU A;  3W15 B;  2XAS B;  3IEE A;  5L2L A;  4IHJ E;  3ZCJ A;  2ZLY A;  4H9R C;  4QX8 B;  2UXN B;  4OHF A;  3I1A A;  1LRZ A;  1HTJ F;  2W00 A;  4PJM A;  2YIN A;  3ZLI A;  2K9A A;  5FMN A;  3AA0 B;  3DTO A;  4DMW A;  3C51 A;  4OYK A;  5TAO A;  2ODU A;  3ZYL A;  5HYA A;  3P7I A;  4WW0 A;  2CWY A;  4CXW A;  4Z8X A;  3IBP A;  4ZI2 C;  1YD8 G;  3KDS E;  2LSG A;  2X66 A;  2XTL A;  2WWU A;  2CLY B;  4TV8 E;  5LHH B;  5LXT E;  3O9X A;  2DNX A;  3VKH A;  1LVF A;  3SS1 A;  3E22 E;  3A5X A;  3R84 B;  1LKX A;  1H7C A;  2LJL A;  3N9Q A;  2ACX A;  3PU3 A;  2DWG A;  1ZV4 X;  4YFS A;  4H9O C;  1O3X A;  3T8O A;  1D1C A;  4ZHQ E;  3BK9 A;  3CQX C;  1FMW A;  3EDU A;  4G2A A;  3H3A A;  3WAJ A;  2A72 A;  5L3G B;  3HA4 A;  1MMD A;  4EZH A;  3WAK A;  2ZM2 A;  4O4L E;  3J9X 1;  3I9W A;  3QK6 A;  4TN7 B;  3RKO A;  2KLQ A;  2BZB A;  4IST A;  2X9Y A;  1MND A;  2V7J A;  1BR4 A;  2VKH A;  4AXP A;  5F3J A;  5J2U E;  3HKC E;  2H3R A;  2D0U A;  2VWA A;  3ZMS B;  1HFA A;  4PNI A;  4YJ2 E;  4O4I E;  4AQF C;  5DAB A;  4CZZ B;  4BA9 A;  1FEW A;  5ADX L;  3KIN B;  5JDG A;  4MHC A;  3GMI A;  3ZYM A;  5EK2 A;  1D0Z A;  3ZN0 B;  2BVL A;  2VB6 A;  4CXY A;  3PUG A;  2D5U A;  1X79 A;  4OFZ A;  2V7L A;  2P9B A;  1ZEE A;  2V26 A;  4B6X A;  5C8Y E;  4PJN A;  3ONX A;  2Q9Q B;  3MKD A;  3OKQ A;  4MLK A;  3C4Z A;  2MYS A;  5HXC A;  1HF8 A;  3B57 A;  4UVC B;  1BR2 A;  5JDF A;  1WRD A;  3MK7 C;  4E7Z A;  3CKD A;  5EK3 A;  2L9Q A;  4H9Q C;  5FYM A;  1T98 A;  5EZY E;  5FY0 A;  2E9X D;  3BQL A;  1IJ6 A;  2W62 A;  2NW7 A;  3FXD B;  2I59 A;  3ANW A;  3S4U A;  2NW8 A;  4X1Y E;  4GIW A;  4EAH A;  4ADZ A;  1U5P A;  3NZP A;  4PFO A;  2XAJ B;  5FXX A;  3I0Q A;  2DCF A;  2V7K A;  3R6N A;  3VKG A;  1VRB A;  4KMC A;  1MMA A;  4MFR A;  2K5B B;  2LSJ A;  3IHR A;  3MAC A;  2A2F X;  3MJX A;  2HPJ A;  4YHJ A;  4OYJ A;  2XQY A;  2UXX B;  1UX5 A;  2PFV A;  2YU1 A;  4PJL A;  4UF0 A;  1SHZ C;  1YKH B;  2CE7 A;  3ZYK A;  2J1D G;  3CX6 B;  2HH7 A;  3LFM A;  5FXW A;  3H37 A;  4IE6 A;  2ES0 A;  4U72 A;  5J1G A;  5CA1 E;  5DJQ C;  2DI4 A;  2VKJ A;  5JR9 A;  5JRC B;  4I50 E;  2H7O A;  4PFP A;  4CXX A;  3U78 A;  3ZC1 A;  4C90 A;  4UVB B;  2E8I A;  4PJJ A;  2DLR A;  2X51 A;  5GON E;  3CPZ A;  3MZK B;  1G8X A;  4L5G A;  4DBQ A;  1UX4 A;  2K48 A;  5KX5 E;  3C98 B;  3FXE B;  4P09 A;  3I0O A;  3LK4 2;  3SWH A;  2JMH A;  4DND A;  2EHO C;  4DMV A;  4X1K E;  3HI2 A;  5LCY A;  5ETW A;  3FB2 A;  4O2B E;  4ZI3 D;  2LOS A;  5FP3 A;  2CMR A;  5LBQ B;  4ZI3 C;  4KBM B;  4I43 B;  4UXN B;  1Y64 B;  3LK2 B;  5HAX A;  1VOM A;  4BJM A;  5LG4 A;  4BJN A;  3D0T A;  3V5S A;  1S35 A;  3GA8 A;  2MOZ A;  4IE4 A;  4JEU B;  1MMG A;  2CM0 A;  2LSI A;  3O1H A;  3O1I A;  2X9X A;  4EB6 E;  3MXZ A;  3O4X E;  1ZHC A;  5HWX A;  2X68 A;  2Z6E A;  3CML A;  2L3L A;  3L09 A;  4OK0 A;  3N2G E;  2EHO A;  4NUV A;  4TV9 E;  3RC3 A;  2YK0 A;  2V7M A;  3K8P C;  4IDZ A;  4L0R A;  3AAI A;  3ZJ2 A;  2V1D B;  4DVD A;  1ZKE A;  3EVY A;  3RRC A;  4WBO A;  3P8C D;  3VU7 H;  4HE8 A;  4DBR A;  2LE8 A;  3F2E A;  4H63 V;  4XZC A;  3ZJ1 A;  2MBG A;  2ODV A;  4AI6 A;  1OXZ A;  3NBX X;  5KMG P;  3OBV E;  4A56 A;  3JC6 D;  4WBN E;  3PE0 A;  3IF8 B;  3DP7 A;  3C4W A;  3NRY A;  3WI3 A;  4PK5 A;  3RH3 A;  3U3I A;  4DO0 A;  5LA6 E;  5HWY A;  2CXF A;  5LJN A;  4M1P A;  3BQK A;  2RA1 A;  2JPF A;  2KND A;  4O8S A;  3TKL B;  2X67 A;  4ISS A;  2IW5 B;  4AKL A;  3PTR B;  2RP4 A;  4K0U A;  2SPC A;  3ETV A;  4MAL A;  1KK7 A;  2YU2 A;  3PUA A;  3ETU A;  3PUQ A;  2Q9Q D;  4X20 E;  2DWK A;  4UV9 B;  5HXE A;  3AAE B;  3QC9 A;  2LM9 A;  2WSS V;  3LG7 A;  3CX8 B;  4UEL A;  5A1L A;  4GK0 E;  4IE5 A;  4KUM B;  5LOV E;  1LVK A;  4EZ4 A;  1HG5 A;  3C50 A;  3ZMU B;  2Y8D A;  5KDM C;  4HFV A;  3AA6 B;  4TUY E;  4P0B A;  4AQF A;  3UUN A;  4WNK A;  4ERR A;  2CWO A;  1NAF A;  5JQG E;  1WR6 A;  2X0L B;  2E9X C;  3ZEF B;  2VK9 A;  5L3C B;  3ANW B;  3C64 A;  3EUH A;  3PUR A;  2XAQ B;  4PK4 A;  3GN5 A;  1HS7 A;  3C4X A;  3O1J A;  1IJ5 A;  1D0X A;  3K3N A;  4XBF B;  2KZ7 B;  4V1A v;  3RYH E;  2X9H A;  3E0Z A;  3FHN A;  3B13 A;  4QHO A;  4AQG A;  1IZN B;  3K3Q C;  4AKG A;  4C91 A;  3M65 A;  4QXH B;  4JEH B;  2VKD A;  3CVR A;  4GK5 E;  3SOL A;  4UF0 B;  3RRW A;  1V9D A;  5JDL A;  3CWZ B;  4HEA A;  3N9N A;  4H9N C;  4HKA A;  2E9X A;  4U74 A;  1KNZ A;  4F6R C;  2Y6X A;  2XAG B;  5JR9 B;  4ZI7 E;  2VAS A;  3N9M A;  1HG2 A;  4N78 D;  5J2T E;  1QUU A;  3LBX A;  4L9I A;  4YJ3 E;  3LBX B;  5AFU L;  2W61 A;  3LK3 B;  2JJ9 A;  3Q9D A;  5LGT B;  4UEM A;  5LP6 E;  2ZM8 A;  4EIW A;  2M67 A;  2LSK A;  3FBZ A;  4PW8 A;  1CUN A;  5JRE A;  3HKD E;  3KVA A;  4ZS3 A;  1YW0 A;  5HXH A;  3N2O A;  3N2K E;  4EYY R;  3N5L A;  3AVS A;  3AA7 B;  5LGU B;  2NOX A;  3Q2M A;  3DJB A;  1E1H B;  2KMF A;  2D0T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...