2LEHA

Solution structure of the core smn-gemin2 complex
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
189
structure length
189
Chain Sequence
b'GYSPTLQWQQQQVAQFSTVRQNVNKHRSHWKSQQLDSNVTMPKSEDEEGWKKFCLGEKLCADGAVGPATNESPGIDYVQIGFPPLLSIVSRMNQATVTSVLEYLSNWFGERDFTPELGRWLYALLACLEKPLLPEAHSLIRQLARRCSEVRLLVDSKDDERVPALNLLICLVSRYFDQRDLADEPSLEY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Survival of motor neuron protein-interacting protein 1
publication title Solution structure of the core SMN-Gemin2 complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 38
structure length 189
sequence length 189
ec nomenclature
pdb deposition date 2011-06-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1070 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2lehA00
2LEHA
chains in the Genus database with same CATH superfamily
4KMCA 3ANWA 2LE8A 3NKZA 2XQAA 2Q9QA 4HKAA 5F5WA 2VKDA 1N34T 3RX6A 3NWIA 4YTMA 1W9RA 5EK3A 1MMDA 2QGSA 5HXCA 4UF0B 2B1EA 1NEKA 4IT4A 2CXFA 3RYFE 5JDMA 1IJ5A 4F8HA 2EHOD 4UVAB 3AXJA 5FVKA 1KF6A 2V6XA 4U7IA 2WAUA 4NIQA 3ZMZB 2FJDA 3GMIA 5L3FB 3PUGA 2KINB 2CLYC 2Y48B 1SHZC 1BR2A 4X20E 4JI7T 2XUEA 4DBQA 5AQOB 1V9DA 3LG7A 3AEGA 5L3EB 4DR5T 3OYXA 1QUUA 3LFMA 4DVDA 3RPUA 3OPCA 3UU3A 2XASB 1XWMA 4X1YE 5LB7B 2CA5A 4A5XA 1XMOT 1HCIA 2XZEA 4G2AA 3SFEA 2KSRA 3I9YA 4ILAA 1D1BA 3K3NA 2V26A 2NW8A 4JI2T 4DBRA 3RYIE 3GWHA 5LP6E 1I94T 4UR9A 2XQYA 1VRBA 5L4EA 4LF9T 1HG5A 3TKLB 2WB5A 2H7VC 4HFEA 2FUPA 3B5MA 4C90A 2XM2A 4DNDA 4ZI2D 1BR1A 2BDEA 4ZI7E 4YHJA 3QOFA 5DABA 4ZEYA 4MALA 4CI1B 5H6RB 2HH7A 3KINB 3AE7A 2ES0A 3O4XE 4N78D 2Y6XA 3K3QC 5CGMA 2XQ9A 5BR8T 3JAEA 4DO0A 1XDPA 2E9XA 2X9YA 2ACZA 3C51A 1NAFA 2EHOC 4ISTA 1IBMT 4O4IE 4EXTA 2ZM6T 3B13A 5IUXA 1J5WA 3PUXF 4CN6A 2JQHA 1W0BA 5FMNA 3SRZA 4X66T 4JV5T 3WI3A 4PNIA 1WLXA 3TLWA 2WBLA 5LXTE 5LMNT 2XM1A 4ZI3D 2V7KA 1SUMB 3QC9A 2BG9C 4YTNA 1MNDA 1Z0PA 3I0QA 4BAYB 5JDLA 4EGWA 4YJ2E 2LM2A 3KV6A 3CWZB 3L09A 3ZN0B 4AKRB 4PK4A 4L5GA 4H9NC 4DIDB 4YJ3E 2DLRA 5LA6E 5AQJB 1HTJF 3ZYKA 3VHLA 1VCTA 4O4JE 5HWYA 4JI8T 4AKGA 4CN4A 3JCFA 1HS7A 4AKIA 3P8CD 3AA1B 5CA1E 5KDMC 4QXBB 2A9UA 2R6GF 2D0TA 4I55E 2XJ7A 3CX6B 4A56A 3FZFB 2N2NA 3L39A 4CI3B 3AVRA 5AQRB 3UU4A 2PBIA 2RPAA 3RF1A 4YSXA 3UUMA 5ABHA 2KMFA 5TAOA 1FMWA 3LK42 2YK0A 1WR0A 5ETWA 3BK9A 3N2OA 4AIUA 2CHNA 4EV6A 4TN7B 4ILUA 1CUNA 4TX5A 3DP7A 3P4QA 2CLYB 3ONLC 3O1IA 3HKDE 1JNRA 2X9WA 4LF8T 3SS1A 1N36T 4ZI3C 3ZT7A 5HXEA 1T8BA 3ETVA 3PE0A 1H7CA 4B6XA 4I4TE 5FY1A 4PFOA 2YU2A 2RP4A 4ZOLE 1EZ3A 2CE7A 1T98A 2LSYA 4EZ4A 4IE5A 5JQGE 2OLTA 2IHR1 5LNKA 4TWFA 3UFGA 2LT3A 4P0AA 4DR7T 1M7KA 3VR9A 4LFAT 2UXNB 2I6HA 3UUXB 5DQWA 2LM9A 3FZHB 4OX9T 1KNRA 2LHNA 2K3WA 4X64T 4GOUA 4ISSA 5L3DB 3IEEA 2W00A 1OEDB 3J9X1 2VVNA 3QK6A 2QYWA 4LF5T 5L3CB 4CI2B 2LOPA 2V5DA 2EHOB 4LMJA 4WBOA 3HA4A 1YXRA 3RIFA 1XNQT 5HXHA 2IDOB 3RQWA 2Q9QB 4XZCA 2YEVC 4JI6T 4UV9B 2A2FX 3AEAA 2KLQA 5FL0A 3ZJ1A 2CM0A 2X0HA 3OBVE 2JQKA 3MJXA 2J47A 3JC6D 5LHHB 2CXLA 3G06A 1B7TA 1MIVA 3WAJA 3ZC1A 4B3MT 2WS3A 4TV9E 2V7JA 1LRZA 2LSIA 1LVKA 3W15B 3RHWA 2L9QA 4PAGA 1G8XA 5AQSB 3H3MA 3ONXA 2WDQA 2NP9A 5FXVA 2YU1A 2IUBA 4KUMB 4EEBA 2LSGA 2DL1A 2CWOA 3GN5B 3UUBA 5ABFA 4JI5T 4NXMT 3UQ7A 1G73A 3C4ZA 2C5KT 3RYCE 5JDQA 4UXNB 2NR4A 4WBNE 3T8OA 1IJ6A 4IGUA 2D5UA 4JI0T 2V7IA 1KNPA 3R84B 2RA1A 1T72A 2MPKA 3K3OA 3Q2MA 5JDHA 3LBXA 4WW0A 3NBXX 5LGNB 4ZZBA 3UU5A 3M3ZB 1YQ3A 3L8RA 4DMWA 3EABA 5LG4A 2XSBA 4TNVA 3C4XA 2JMHA 3EDVA 3N9OA 2WWVA 3CVRA 4PJNA 2DCFA 3AE3A 4IE4A 2K24A 1ZP0A 3JC6C 4O2BE 5FYMA 3CQXC 5KX5E 2LKHA 3ZMUB 4BJNA 2X67A 3S4UA 3RIUC 2I59A 5J1GA 4QWNB 2L8KA 4DV2T 1JNZA 2XAFB 3Q9DA 4Z8XA 2W63A 3ZC0A 4Z90A 1IAPA 3ZYMA 1D0YA 3F2EA 4UIGA 5HEOA 4LF7T 2ODVA 5HCMA 2D2SA 4KBMB 3CK6A 1D1AA 2X68A 3O1HA 3MACA 4U2YA 4L9IA 3IA3A 4YLHA 2CHOA 5LJMA 4Q25A 3CPZA 3HKEE 3KV4A 3ZLIA 4JLEA 5JTGA 3FXDB 3CQCB 2HHHT 2FJBA 4NPPA 2Q9QD 2BG9A 4IL4A 3V5SA 5EK4A 5AQUB 5IYZE 4DR6T 1S35A 5FP3A 4PK5A 2OA5A 4AQFC 3RRWA 2M6IA 3NRYA 3TLTA 1J5ET 4QXCB 4U31A 4ZS3A 5LCYA 1YD8G 3A7MA 4U74A 4TV8E 4X62T 5J0ZA 3DTOA 1W0AA 4ASKA 5LJNA 3JADA 5LHIB 2BBHA 2LKGA 5AQIB 3A5XA 2CCQA 2W62A 2LRLA 4ANJA 1QSDA 3UTKA 2BZBA 4PJLA 3RC3A 5C2TA 4DV3T 3KV5A 3N9PA 3PUAA 1N32T 1MIWA 2WSSV 2VL0A 4KX6A 3ONJA 1VOMA 3P4PA 1U5PA 4EYYR 3AAEB 4YSYA 1E2AA 4YY3T 3N9NA 4HWDA 2WDVA 5ADXL 3ZYLA 1YQ4A 1KK7A 3P4RA 3SFDA 3UULA 2C0SA 4HWCA 2VL8A 3RQUA 3C98B 3RYHE 5FXZA 5JR9A 3ZEFB 3RC8A 2DNXA 3ETUA 1OEDC 4A97A 3CQGB 4X65T 4TNWA 2J1DG 3X1DA 2V7LA 4YXDA 3FZMB 4UELA 5EZYE 2SPCA 2WWUA 3V5UA 4WZXA 5FY0A 2LEHA 4GKKT 4E7SA 2QRXA 4PW8A 4X1IE 2Q9QC 3B57A 4HFDA 2N9DA 5KMGP 4JUYA 4HFVA 4GKJT 3ESLA 4OYJA 3ZCJA 4CZZB 1U4QA 4DV6T 3PTRB 1HNZT 2BVMA 3VU7H 4DUYT 2E9XD 4L0RA 2DI4A 3NRXA 4CXYA 3KFWX 1OXZA 5M4YA 3RKGA 4COFA 4U72A 5LGTB 3IF8B 3U78A 4UF0A 4TWHA 3AE5A 4O4HE 3UU8A 3PU3A 2LRKA 1US7B 2VVSA 4H9QC 3ZCIA 5FL1A 2XHEB 5EK2A 4OYKA 2V6YA 5A1LA 3LK2B 3T1YT 1HNXT 3P7IA 4JEHB 2KT9A 2XAGB 3AB3B 4ZI2C 5LOVE 4HGAA 4JI1T 3CKDA 2X66A 4H9OC 2BG9E 4ILBA 1ZEEA 3FXEB 1IBKT 5HEHA 1HG2A 2WCAA 1WYCA 4YSZA 1QLBA 5H6QB 5KXJA 2PTFA 3MXZA 5ABGA 5ABFB 3SWHA 3N2KE 2WMNA 2LOSA 2VKOA 1HNWT 1Y01A 2CRBA 3EHZA 4O2AE 4UVBB 2I0MA 2Y8DA 3PUWF 1OWAA 2NW9A 3Q5WA 2XY8B 2D9DA 2E9XC 1ZHCA 2HPJA 2IAKA 2VWAA 4Z91A 4O8SA 1HF8A 2X9HA 1IBLT 1Y64B 1XDOA 4TWDA 4GIWA 5L3GB 5ABEA 3AEFA 1X9BA 4HFBA 3PV0F 2AXDS 4NUVA 5JRCB 3P4SA 2QVAA 1NENA 5L2LA 2XQ5A 3KDSE 3MA9A 5LHGB 4IDNA 4MHCA 1R8IA 2CPTA 3KVAA 4EEDA 4LF4T 1FMVA 1UK5A 3AAAB 3EAMA 3L3PA 5CB4E 2HN1A 3VR8A 4K0KT 2VURA 3ZMSB 2LJLA 4E7ZA 5FVLA 1VCSA 2VB6A 3ANWB 4GYSA 2OV9A 4AI6A 2VKJA 5AQKB 3ZSTA 3TLVA 3AE9A 5DQVA 3RLFF 3BQIA 2C5JA 2UXXB 3M65A 1XMQT 2WMOA 5AQLB 2YDSA 3UFEA 4QKNA 2FJAA 5AQTB 4P09A 4H9PC 2JJ9A 2XQ7A 4JBWF 2XAHB 3AXJB 5F3JA 1UGOA 4NXNT 4CQIA 3ZMTB 3PJAA 1BR4A 4AISA 2YDRA 3EDUA 2XQ8A 4TUYE 2W66A 1FEWA 2D0UA 2LHRA 3VKGA 3LK3B 3HI2A 3OJAA 3CIRA 4U33A 2KZ7B 3PUVF 3HKBE 3CMLA 2XAQB 1ZOYA 1D0ZA 3AE2A 1T7SA 1HR0T 1GQEA 2H89A 4LMLA 4AQFA 5AQHB 1SE7A 2V5CA 2CMRA 5JDGA 2DWGA 2MOZA 4ZS2A 3FZLB 4HTEA 3C50A 2V7MA 5BMVE 3F57A 3JAFA 5J2UE 2VKHA 3TLUA 4IDPA 3E08A 3HKCE 4B3ST 3VKHA 3H3AA 4JI4T 1MIYA 5JR9B 3LSVA 3OYZA 1WR6A 5AQMB 2AE9A 5FY7A 4I0UA 3ZKRA 3QB5K 2KWHA 2UUBT 4KHZF 1E7PA 2E9XB 4P1NA 5JDFA 3PUYF 4HFCA 5GONE 2IC6A 2JQ9A 3DJBA 4C91A 3LDQB 4DR4T 2ACXA 3E0ZA 2BVLA 4J2CA 2YDQA 3AEDA 3KBUA 2IMLA 1OEDA 1HX1B 2GK9A 3KVBA 4LFBT 2PG8A 2ZM8A 2MTQA 1UUSA 2EHOA 2CBIA 2G0UA 4HFIA 4IE6A 3BQKA 2NW7A 4U7YA 2JQQA 2M67A 3HL6A 4P0BA 3GA8A 4KP3C 3O1JA 1Z8UA 5E0OA 1YW0A 3C64A 2WQYA 2PFVA 1UX5A 1N33T 4MLKA 4QH1A 4ERRA 3LJCA 5LBMA 4F6RC 3UT5E 1AJ3A 4HWIB 2V6YB 3ZT6A 2A3DA 1FJGT 2A72A 4AKHA 4KHPT 2VQET 3PUQA 2M6BA 4UVCB 3QB5A 3P4WA 4DV4T 4GYRA 3BQLA 1UURA 3GN5A 3ZN1B 4YT0A 4OFZA 2XSAA 5LG3A 1LKXA 1WCRA 2H88A 3OKQA 1NWMX 1KFYA 3EVYA 1J1JA 4H9SE 1WRDA 4ZZCA 2DWKA 1O3XA 1S94A 4IREA 2W2UA 2X51A 2L3LA 4CXXA 3UU6A 2UXDT 2BS3A 4HFHA 4XAXB 3T1HT 4MBQA 3N9LA 5HEJA 5L47A 5LBQB 1LVFA 4AXPA 2YINA 4HWFA 2WU5A 2NTXA 4AKLA 4H9RC 4IDOA 3EUHA 2KWIB 4EZHA 4YHHT 3AA6B 4JYAT 3FBZA 2VQFT 3ZT5A 3P50A 3C4WA 4IL9A 4IDQA 3AECA 1BR0A 4DV7T 2ZM0A 1ZV4X 3E22E 1FIOA 4FJOA 5AQGB 3RGLA 4TZ4C 2YKSA 2JPFA 5FNVE 3ABVA 3Q5DA 3A8YC 2BS4A 2UUCT 4DMVA 4IHJE 3RI5A 2BKNA 2K5BB 2JIWA 4UEMA 3AVSA 4G63A 3OTOT 2K9AA 3N9MA 4EOZB 2WDRA 2XQ3A 3K1SA 3Q5XA 2CEAA 1M62A 5CFBA 2WP9A 4GK5E 2E5LT 5AQPB 1UX4A 2UU9T 1XZYA 4IDZA 5DJQC 1OEDE 2LLYA 4V1Av 3MK7C 3J7Yq 1E1HB 4PJJA 2VASA 3K8PC 4I43B 3FB2A 3CX7B 2KNDA 2B76A 2ZMAA 4QH4A 4ZHQE 3UUNA 1ZKEA 3VRBA 3PUZF 4YTPA 2CWYA 2BBJA 4H63H 3RH3A 3PURA 4DV1T 3I9WA 1HX8A 4CXWA 5AFUL 2HPLA 2E5VA 3AEEA 1MMAA 5JREA 5AQNB 3RRCA 2V1DB 2E8IA 5HWXA 2LSKA 2CXDA 1XNRT 3EI0A 2NOXA 2XTLA 2W67A 3N5LA 5C8YE 3ZJ2A 1WYBA 2NTYA 5JR9C 4QHOA 1I6ZA 4DR1T 5HXRA 5LMUT 4ZXLA 4K0UA 2XQ6A 3NZPA 4EAHA 4QX8B 3FHNA 2YOEA 4LMKA 2XQ4A 5JH7E 2HN2A 4U3CA 4O4LE 3LBXB 4MFRA 2XPKA 3QUJA 3O9XA 1YKEB 3AEBA 4QH5A 5LYJE 3F31A 2E2AA 2IC9A 4X1KE 3AE1A 3N2GE 3U3IA 4EYUA 4UV8B 4X5TA 2MAWA 2H7OA 4FI5A 3FZKB 4PFPA 3PJAJ 1KNZA 4M1PA 1W09A 2N1GA 3NZQA 3HR0A 5AQVB 2W61A 4DR3T 4OK0A 5IWAT 2WM9A 4CN1A 4HEAA 5C3JA 2DHRA 3AAIA 3AA7B 4H63V 1HFAA 5IHYA 4NUUA 3FBLA 2FBWA 1WFDA 3H37A 3R6NA 5HXSA 3UQ4A 4EB6E 4A98A 3VRAA 2KXPB 3TLSA 2CBJA 4GK0E 1MMNA 5CA0E 3N9QA 3SOLA 1DU2A 4QXHB 2QA7A 4LF6T 3RIUA 5LGUB 4HWHA 2J4GA 4DV5T 2F4VT 4ADZA 5JVDE 2UUAT 5FKYA 2V8SV 2X0LB 5HEGA 4JEUB 2W0GA 1YKHB 3AA0B 1CHUA 2BG9B 3ZPOA 2NWBA 4IIJE 2X0YA 4LFCT 3CX8B 5FXWA 3AE8A 2JMKA 4B3RT 2VK9A 2H3RA 3PUSA 5HAXA 3AE4A 2UXBT 5HEUA 1MMGA 5L4HA 4KI0F 2XAJB 4PK6A 2WZIA 5HYAA 3KV9A 2ZM2A 2J62A 2JRKA 3WAKA 3PU8A 4WNKA 2WY2A 1L0VA 3PDYA 4DUZT 5CJ5A 4BA9A 3QNUA 4XBFB 3D0TA 1D0XA 2K48A 2WU2A 3ZMVB 3I0OA 4AQYT 2Z6EA 1D1CA 2PJQA 3I1AA 5FXXA 3IHRA 2ODUA 4ILCA 2BS2A 4AQGA 2WZHA 2MBGA 4DR2T 3MKDA 5L3BB 4IE0A 2ZLYA 4I50E 4B3TT 1X79A 4DV0T 1UCUA 4JI3T 2LSJA 3AE6A 3NVOA 4BJMA 4HN9A 3KBTA 5AQQB 4PJMA 2IIUA 2C5IT 5JRCA 3MZKB 3OVUA 3RKOA 1MNEA 2BKPA 3IBPA 4WYVA 4EIWA 4U2ZA 2MYSA 4QX7B 5F8PA 2W4XA 4YFSA 4OHFA 1SA0E 3ZSSA 2P9BA 1KEYA 5AQFB 4HE8A 2UXCT 5HCJA 3Q5EA 5JDNA 4IE7A 3RIAA 2IW5B 2FJEA 5J2TE 2YN6A 2X9XA 2BKOA 1IZNB
chains in the Genus database with same CATH topology
1LRZA 2LSIA 4KMCA 3ANWA 2LE8A 1LVKA 3W15B 2ZM0A 1ZV4X 2L9QA 3E22E 1FIOA 4FJOA 4O2AE 4UVBB 4HKAA 2Q9QA 2VKDA 2Y8DA 4TZ4C 2JPFA 4PAGA 3RX6A 1G8XA 5FNVE 1OWAA 3ONXA 5EK3A 1MMDA 2QGSA 2NP9A 2NW9A 3Q5WA 5FXVA 4DMVA 4IHJE 2YU1A 2K5BB 4KUMB 2E9XC 1ZHCA 5HXCA 4UF0B 4UEMA 3AVSA 4G63A 2B1EA 2HPJA 2LSGA 2CWOA 2CXFA 2IAKA 2K9AA 3RYFE 5JDMA 3N9MA 3GN5B 1IJ5A 4EOZB 2VWAA 2EHOD 4UVAB 3Q5XA 4O8SA 1HF8A 2X9HA 2CEAA 1G73A 3C4ZA 2C5KT 1Y64B 3RYCE 5JDQA 4UXNB 4GIWA 4GK5E 5L3GB 1UX4A 2WAUA 3ZMZB 4WBNE 4IDZA 3T8OA 3GMIA 5L3FB 5DJQC 1IJ6A 4IGUA 2D5UA 3PUGA 2KINB 2CLYC 2Y48B 4NUVA 5JRCB 4V1Av 3MK7C 3J7Yq 1E1HB 4PJJA 2VASA 2V7IA 5L2LA 1SHZC 1BR2A 4X20E 3K8PC 3KDSE 3MA9A 3R84B 2RA1A 2XUEA 4DBQA 5LHGB 1V9DA 3LG7A 5L3EB 3K3OA 3Q2MA 4I43B 3OYXA 4MHCA 5JDHA 3FB2A 1QUUA 3LFMA 4DVDA 3LBXA 3KVAA 4WW0A 3CX7B 1FMVA 3RPUA 3NBXX 5LGNB 2KNDA 2XASB 2ZMAA 4X1YE 3AAAB 2CA5A 4ZHQE 3UUNA 4DMWA 1ZKEA 1HCIA 5LG4A 3L3PA 4G2AA 5CB4E 3I9YA 1D1BA 3ZMSB 3K3NA 2CWYA 2LJLA 2V26A 3C4XA 4E7ZA 2NW8A 2VB6A 3ANWB 1IZNB 4GYSA 4H63H 3RH3A 3RYIE 2JMHA 4DBRA 3GWHA 4AI6A 2VKJA 5LP6E 3EDVA 3N9OA 3CVRA 3PURA 2DCFA 4PJNA 5DQVA 2XQYA 3BQIA 1HX8A 3I9WA 4IE4A 2K24A 4CXWA 5AFUL 2HPLA 3JC6C 4O2BE 5FYMA 1VRBA 3CQXC 2C5JA 2UXXB 1MMAA 3M65A 5KX5E 1HG5A 3TKLB 5JREA 2H7VC 2WMOA 3RRCA 4C90A 2V1DB 4QKNA 3UFEA 2E8IA 3ZMUB 4BJNA 5HWXA 2LSKA 4P09A 4DNDA 2X67A 3S4UA 4ZI2D 2I59A 5J1GA 4QWNB 2CXDA 4H9PC 2L8KA 2JJ9A 1BR1A 2BDEA 2NOXA 2XTLA 4ZI7E 2XAHB 4YHJA 5F3JA 5DABA 2XAFB 3N5LA 3Q9DA 5C8YE 4MALA 3ZJ2A 5H6RB 4CI1B 1WYBA 2HH7A 2NTYA 3KINB 4Z8XA 4CQIA 2W63A 5JR9C 3ZC0A 4QHOA 1IAPA 3ZYMA 2ES0A 5HXRA 1D0YA 3F2EA 3O4XE 3ZMTB 4N78D 2Y6XA 4UIGA 3K3QC 1BR4A 4K0UA 3EDUA 2ODVA 4DO0A 2D2SA 4TUYE 2E9XA 2X9YA 4KBMB 1D1AA 2X68A 3O1HA 3C51A 3MACA 1NAFA 2EHOC 3NZPA 1FEWA 2D0UA 2LHRA 4L9IA 4ISTA 3VKGA 3LK3B 4QX8B 3FHNA 4EAHA 4O4IE 3HI2A 4EXTA 3OJAA 4YLHA 2KZ7B 3B13A 5JH7E 3HKBE 5LJMA 4O4LE 3LBXB 5FMNA 4MFRA 3CPZA 3HKEE 3KV4A 3SRZA 3CMLA 3QUJA 3O9XA 1YKEB 2XAQB 3WI3A 3ZLIA 4JLEA 1D0ZA 3FXDB 4PNIA 1WLXA 5LYJE 3F31A 3CQCB 2IC9A 4X1KE 2WBLA 5LXTE 2Q9QD 3V5SA 4ZI3D 5EK4A 5IYZE 4AQFA 2V7KA 1S35A 3N2GE 3QC9A 5FP3A 4PK5A 2OA5A 4AQFC 3U3IA 1MNDA 3RRWA 4EYUA 1Z0PA 4UV8B 3NRYA 3I0QA 4BAYB 5JDLA 2CMRA 4YJ2E 5JDGA 4QXCB 3KV6A 3CWZB 3L09A 3ZN0B 2DWGA 4ZS3A 2MOZA 4ZS2A 5LCYA 2H7OA 1YD8G 4PK4A 4AKRB 4FI5A 4U74A 4HTEA 4L5GA 4H9NC 4PFPA 4TV8E 4YJ3E 1KNZA 2DLRA 3C50A 3DTOA 2V7MA 5LA6E 4M1PA 4ASKA 5LJNA 1HTJF 5BMVE 3F57A 2N1GA 3NZQA 3HR0A 5J2UE 3ZYKA 3VHLA 2VKHA 4O4JE 5HWYA 5LHIB 4AKGA 3A5XA 2W61A 3E08A 3HKCE 4OK0A 2CCQA 2W62A 4ANJA 1QSDA 3UTKA 1HS7A 2BZBA 4PJLA 3VKHA 3RC3A 3H3AA 4AKIA 3P8CD 2WM9A 3KV5A 3AA1B 3N9PA 4HEAA 5CA1E 5KDMC 4QXBB 2DHRA 3AAIA 3AA7B 4H63V 1HFAA 5IHYA 3PUAA 1MIYA 4NUUA 3FBLA 1MIWA 2WSSV 2D0TA 3H37A 3OYZA 4I55E 5JR9B 1WR6A 3R6NA 5HXSA 4EB6E 5FY7A 1VOMA 2KXPB 1U5PA 3CX6B 4EYYR 2KWHA 4A56A 3AAEB 4GK0E 1MMNA 3N9NA 2E9XB 2N2NA 5CA0E 3N9QA 3SOLA 5JDFA 5ADXL 4CI3B 3AVRA 4QXHB 2QA7A 3ZYLA 5LGUB 5GONE 2IC6A 3DJBA 1KK7A 4C91A 2PBIA 3UULA 2ACXA 5JVDE 3E0ZA 2C0SA 3UUMA 2BVLA 2KMFA 4J2CA 5TAOA 4ADZA 2VL8A 3KBUA 1FMWA 3C98B 3RYHE 5FXZA 3LK42 2YK0A 5ETWA 2GK9A 3BK9A 5JR9A 3N2OA 3ZEFB 3KVBA 2X0LB 2DNXA 3ETUA 3RC8A 2PG8A 4JEUB 3CQGB 4TN7B 2ZM8A 2W0GA 2J1DG 1YKHB 2MTQA 3AA0B 4ILUA 1CUNA 4TX5A 3DP7A 2CLYB 2V7LA 3ZPOA 2NWBA 4IIJE 2EHOA 3O1IA 2G0UA 3HKDE 4IE6A 3CX8B 4UELA 3BQKA 5FXWA 2JMKA 2VK9A 5EZYE 2SPCA 2WWUA 2H3RA 2NW7A 2JQQA 3V5UA 2X9WA 2M67A 5FY0A 3HL6A 3PUSA 2LEHA 5HAXA 4E7SA 1MMGA 4PW8A 4P0BA 3GA8A 4X1IE 4KP3C 3SS1A 2Q9QC 2XAJB 4ZI3C 3O1JA 4PK6A 3B57A 5HYAA 5HXEA 3KV9A 2ZM2A 2N9DA 3ETVA 5E0OA 5KMGP 4JUYA 4HFVA 3ESLA 3PE0A 4OYJA 1H7CA 1YW0A 1U4QA 3ZCJA 4CZZB 3C64A 2PFVA 3PTRB 2JRKA 3WAKA 4B6XA 4I4TE 1UX5A 5FY1A 4PFOA 2YU2A 2RP4A 3PU8A 4WNKA 2BVMA 4MLKA 3VU7H 4ZOLE 1EZ3A 2CE7A 4ERRA 1T98A 3PDYA 2LSYA 2E9XD 3LJCA 4L0RA 2DI4A 5LBMA 4EZ4A 4IE5A 4BA9A 5JQGE 4XBFB 4F6RC 3D0TA 1D0XA 3UT5E 1AJ3A 2K48A 3NRXA 4CXYA 3KFWX 1OXZA 5LNKA 5M4YA 3ZMVB 2A3DA 3I0OA 2Z6EA 2LT3A 1D1CA 2A72A 2PJQA 3I1AA 4P0AA 5FXXA 3IHRA 4AKHA 2UXNB 3UUXB 3PUQA 5DQWA 2LM9A 4U72A 4UVCB 2ODUA 5LGTB 4AQGA 3IF8B 3U78A 4UF0A 2MBGA 2LHNA 3MKDA 4O4HE 5L3BB 4GYRA 4IE0A 2ZLYA 3BQLA 4I50E 3ZN1B 3GN5A 4GOUA 4ISSA 3PU3A 4OFZA 1LKXA 1US7B 4H9QC 3OKQA 3IEEA 5L3DB 3ZCIA 1NWMX 2W00A 1X79A 2XHEB 1UCUA 5EK2A 4OYKA 3EVYA 3J9X1 4H9SE 1WRDA 2LSJA 5A1LA 3LK2B 3QK6A 2DWKA 3P7IA 4JEHB 1O3XA 2KT9A 2XAGB 4BJMA 4HN9A 3KBTA 1S94A 5L3CB 4PJMA 2X51A 2LOPA 2L3LA 3AB3B 4CI2B 4CXXA 4ZI2C 2C5IT 2EHOB 5LOVE 4HGAA 4WBOA 3HA4A 5JRCA 3MZKB 5HXHA 3RKOA 3CKDA 4XAXB 1MNEA 4MBQA 2X66A 3N9LA 4H9OC 3IBPA 4EIWA 2MYSA 1ZEEA 5LBQB 2Q9QB 4QX7B 5F8PA 1LVFA 3FXEB 4AXPA 2YINA 4XZCA 2YEVC 4YFSA 4UV9B 4OHFA 1SA0E 2A2FX 2KLQA 1HG2A 2NTXA 2P9BA 4AKLA 3ZJ1A 4H9RC 3EUHA 1WYCA 2CM0A 2KWIB 3OBVE 4HE8A 4EZHA 3MJXA 3AA6B 5JDNA 3FBZA 4IE7A 3JC6D 5H6QB 5LHHB 2CXLA 2IW5B 1B7TA 1MIVA 5J2TE 3WAJA 3MXZA 3SWHA 3N2KE 3ZC1A 3C4WA 2WMNA 2X9XA 2LOSA 4TV9E 2VKOA 2V7JA 1BR0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LEH A; 
#chains in the Genus database with same CATH topology
 4KMC A;  3ANW A;  2LE8 A;  3NKZ A;  2XQA A;  2Q9Q A;  4HKA A;  5F5W A;  2VKD A;  1N34 T;  3RX6 A;  3NWI A;  4YTM A;  1W9R A;  5EK3 A;  1MMD A;  2QGS A;  5HXC A;  4UF0 B;  2B1E A;  1NEK A;  4IT4 A;  2CXF A;  3RYF E;  5JDM A;  1IJ5 A;  4F8H A;  2EHO D;  4UVA B;  3AXJ A;  5FVK A;  1KF6 A;  2V6X A;  4U7I A;  2WAU A;  4NIQ A;  3ZMZ B;  2FJD A;  3GMI A;  5L3F B;  3PUG A;  2KIN B;  2CLY C;  2Y48 B;  1SHZ C;  1BR2 A;  4X20 E;  4JI7 T;  2XUE A;  4DBQ A;  5AQO B;  1V9D A;  3LG7 A;  3AEG A;  5L3E B;  4DR5 T;  3OYX A;  1QUU A;  3LFM A;  4DVD A;  3RPU A;  3OPC A;  3UU3 A;  2XAS B;  1XWM A;  4X1Y E;  5LB7 B;  2CA5 A;  4A5X A;  1XMO T;  1HCI A;  2XZE A;  4G2A A;  3SFE A;  2KSR A;  3I9Y A;  4ILA A;  1D1B A;  3K3N A;  2V26 A;  2NW8 A;  4JI2 T;  4DBR A;  3RYI E;  3GWH A;  5LP6 E;  1I94 T;  4UR9 A;  2XQY A;  1VRB A;  5L4E A;  4LF9 T;  1HG5 A;  3TKL B;  2WB5 A;  2H7V C;  4HFE A;  2FUP A;  3B5M A;  4C90 A;  2XM2 A;  4DND A;  4ZI2 D;  1BR1 A;  2BDE A;  4ZI7 E;  4YHJ A;  3QOF A;  5DAB A;  4ZEY A;  4MAL A;  4CI1 B;  5H6R B;  2HH7 A;  3KIN B;  3AE7 A;  2ES0 A;  3O4X E;  4N78 D;  2Y6X A;  3K3Q C;  5CGM A;  2XQ9 A;  5BR8 T;  3JAE A;  4DO0 A;  1XDP A;  2E9X A;  2X9Y A;  2ACZ A;  3C51 A;  1NAF A;  2EHO C;  4IST A;  1IBM T;  4O4I E;  4EXT A;  2ZM6 T;  3B13 A;  5IUX A;  1J5W A;  3PUX F;  4CN6 A;  2JQH A;  1W0B A;  5FMN A;  3SRZ A;  4X66 T;  4JV5 T;  3WI3 A;  4PNI A;  1WLX A;  3TLW A;  2WBL A;  5LXT E;  5LMN T;  2XM1 A;  4ZI3 D;  2V7K A;  1SUM B;  3QC9 A;  2BG9 C;  4YTN A;  1MND A;  1Z0P A;  3I0Q A;  4BAY B;  5JDL A;  4EGW A;  4YJ2 E;  2LM2 A;  3KV6 A;  3CWZ B;  3L09 A;  3ZN0 B;  4AKR B;  4PK4 A;  4L5G A;  4H9N C;  4DID B;  4YJ3 E;  2DLR A;  5LA6 E;  5AQJ B;  1HTJ F;  3ZYK A;  3VHL A;  1VCT A;  4O4J E;  5HWY A;  4JI8 T;  4AKG A;  4CN4 A;  3JCF A;  1HS7 A;  4AKI A;  3P8C D;  3AA1 B;  5CA1 E;  5KDM C;  4QXB B;  2A9U A;  2R6G F;  2D0T A;  4I55 E;  2XJ7 A;  3CX6 B;  4A56 A;  3FZF B;  2N2N A;  3L39 A;  4CI3 B;  3AVR A;  5AQR B;  3UU4 A;  2PBI A;  2RPA A;  3RF1 A;  4YSX A;  3UUM A;  5ABH A;  2KMF A;  5TAO A;  1FMW A;  3LK4 2;  2YK0 A;  1WR0 A;  5ETW A;  3BK9 A;  3N2O A;  4AIU A;  2CHN A;  4EV6 A;  4TN7 B;  4ILU A;  1CUN A;  4TX5 A;  3DP7 A;  3P4Q A;  2CLY B;  3ONL C;  3O1I A;  3HKD E;  1JNR A;  2X9W A;  4LF8 T;  3SS1 A;  1N36 T;  4ZI3 C;  3ZT7 A;  5HXE A;  1T8B A;  3ETV A;  3PE0 A;  1H7C A;  4B6X A;  4I4T E;  5FY1 A;  4PFO A;  2YU2 A;  2RP4 A;  4ZOL E;  1EZ3 A;  2CE7 A;  1T98 A;  2LSY A;  4EZ4 A;  4IE5 A;  5JQG E;  2OLT A;  2IHR 1;  5LNK A;  4TWF A;  3UFG A;  2LT3 A;  4P0A A;  4DR7 T;  1M7K A;  3VR9 A;  4LFA T;  2UXN B;  2I6H A;  3UUX B;  5DQW A;  2LM9 A;  3FZH B;  4OX9 T;  1KNR A;  2LHN A;  2K3W A;  4X64 T;  4GOU A;  4ISS A;  5L3D B;  3IEE A;  2W00 A;  1OED B;  3J9X 1;  2VVN A;  3QK6 A;  2QYW A;  4LF5 T;  5L3C B;  4CI2 B;  2LOP A;  2V5D A;  2EHO B;  4LMJ A;  4WBO A;  3HA4 A;  1YXR A;  3RIF A;  1XNQ T;  5HXH A;  2IDO B;  3RQW A;  2Q9Q B;  4XZC A;  2YEV C;  4JI6 T;  4UV9 B;  2A2F X;  3AEA A;  2KLQ A;  5FL0 A;  3ZJ1 A;  2CM0 A;  2X0H A;  3OBV E;  2JQK A;  3MJX A;  2J47 A;  3JC6 D;  5LHH B;  2CXL A;  3G06 A;  1B7T A;  1MIV A;  3WAJ A;  3ZC1 A;  4B3M T;  2WS3 A;  4TV9 E;  2V7J A;  1LRZ A;  2LSI A;  1LVK A;  3W15 B;  3RHW A;  2L9Q A;  4PAG A;  1G8X A;  5AQS B;  3H3M A;  3ONX A;  2WDQ A;  2NP9 A;  5FXV A;  2YU1 A;  2IUB A;  4KUM B;  4EEB A;  2LSG A;  2DL1 A;  2CWO A;  3GN5 B;  3UUB A;  5ABF A;  4JI5 T;  4NXM T;  3UQ7 A;  1G73 A;  3C4Z A;  2C5K T;  3RYC E;  5JDQ A;  4UXN B;  2NR4 A;  4WBN E;  3T8O A;  1IJ6 A;  4IGU A;  2D5U A;  4JI0 T;  2V7I A;  1KNP A;  3R84 B;  2RA1 A;  1T72 A;  2MPK A;  3K3O A;  3Q2M A;  5JDH A;  3LBX A;  4WW0 A;  3NBX X;  5LGN B;  4ZZB A;  3UU5 A;  3M3Z B;  1YQ3 A;  3L8R A;  4DMW A;  3EAB A;  5LG4 A;  2XSB A;  4TNV A;  3C4X A;  2JMH A;  3EDV A;  3N9O A;  2WWV A;  3CVR A;  4PJN A;  2DCF A;  3AE3 A;  4IE4 A;  2K24 A;  1ZP0 A;  3JC6 C;  4O2B E;  5FYM A;  3CQX C;  5KX5 E;  2LKH A;  3ZMU B;  4BJN A;  2X67 A;  3S4U A;  3RIU C;  2I59 A;  5J1G A;  4QWN B;  2L8K A;  4DV2 T;  1JNZ A;  2XAF B;  3Q9D A;  4Z8X A;  2W63 A;  3ZC0 A;  4Z90 A;  1IAP A;  3ZYM A;  1D0Y A;  3F2E A;  4UIG A;  5HEO A;  4LF7 T;  2ODV A;  5HCM A;  2D2S A;  4KBM B;  3CK6 A;  1D1A A;  2X68 A;  3O1H A;  3MAC A;  4U2Y A;  4L9I A;  3IA3 A;  4YLH A;  2CHO A;  5LJM A;  4Q25 A;  3CPZ A;  3HKE E;  3KV4 A;  3ZLI A;  4JLE A;  5JTG A;  3FXD B;  3CQC B;  2HHH T;  2FJB A;  4NPP A;  2Q9Q D;  2BG9 A;  4IL4 A;  3V5S A;  5EK4 A;  5AQU B;  5IYZ E;  4DR6 T;  1S35 A;  5FP3 A;  4PK5 A;  2OA5 A;  4AQF C;  3RRW A;  2M6I A;  3NRY A;  3TLT A;  1J5E T;  4QXC B;  4U31 A;  4ZS3 A;  5LCY A;  1YD8 G;  3A7M A;  4U74 A;  4TV8 E;  4X62 T;  5J0Z A;  3DTO A;  1W0A A;  4ASK A;  5LJN A;  3JAD A;  5LHI B;  2BBH A;  2LKG A;  5AQI B;  3A5X A;  2CCQ A;  2W62 A;  2LRL A;  4ANJ A;  1QSD A;  3UTK A;  2BZB A;  4PJL A;  3RC3 A;  5C2T A;  4DV3 T;  3KV5 A;  3N9P A;  3PUA A;  1N32 T;  1MIW A;  2WSS V;  2VL0 A;  4KX6 A;  3ONJ A;  1VOM A;  3P4P A;  1U5P A;  4EYY R;  3AAE B;  4YSY A;  1E2A A;  4YY3 T;  3N9N A;  4HWD A;  2WDV A;  5ADX L;  3ZYL A;  1YQ4 A;  1KK7 A;  3P4R A;  3SFD A;  3UUL A;  2C0S A;  4HWC A;  2VL8 A;  3RQU A;  3C98 B;  3RYH E;  5FXZ A;  5JR9 A;  3ZEF B;  3RC8 A;  2DNX A;  3ETU A;  1OED C;  4A97 A;  3CQG B;  4X65 T;  4TNW A;  2J1D G;  3X1D A;  2V7L A;  4YXD A;  3FZM B;  4UEL A;  5EZY E;  2SPC A;  2WWU A;  3V5U A;  4WZX A;  5FY0 A;  2LEH A;  4GKK T;  4E7S A;  2QRX A;  4PW8 A;  4X1I E;  2Q9Q C;  3B57 A;  4HFD A;  2N9D A;  5KMG P;  4JUY A;  4HFV A;  4GKJ T;  3ESL A;  4OYJ A;  3ZCJ A;  4CZZ B;  1U4Q A;  4DV6 T;  3PTR B;  1HNZ T;  2BVM A;  3VU7 H;  4DUY T;  2E9X D;  4L0R A;  2DI4 A;  3NRX A;  4CXY A;  3KFW X;  1OXZ A;  5M4Y A;  3RKG A;  4COF A;  4U72 A;  5LGT B;  3IF8 B;  3U78 A;  4UF0 A;  4TWH A;  3AE5 A;  4O4H E;  3UU8 A;  3PU3 A;  2LRK A;  1US7 B;  2VVS A;  4H9Q C;  3ZCI A;  5FL1 A;  2XHE B;  5EK2 A;  4OYK A;  2V6Y A;  5A1L A;  3LK2 B;  3T1Y T;  1HNX T;  3P7I A;  4JEH B;  2KT9 A;  2XAG B;  3AB3 B;  4ZI2 C;  5LOV E;  4HGA A;  4JI1 T;  3CKD A;  2X66 A;  4H9O C;  2BG9 E;  4ILB A;  1ZEE A;  3FXE B;  1IBK T;  5HEH A;  1HG2 A;  2WCA A;  1WYC A;  4YSZ A;  1QLB A;  5H6Q B;  5KXJ A;  2PTF A;  3MXZ A;  5ABG A;  5ABF B;  3SWH A;  3N2K E;  2WMN A;  2LOS A;  2VKO A;  1HNW T;  1Y01 A;  2CRB A;  3EHZ A;  4O2A E;  4UVB B;  2I0M A;  2Y8D A;  3PUW F;  1OWA A;  2NW9 A;  3Q5W A;  2XY8 B;  2D9D A;  2E9X C;  1ZHC A;  2HPJ A;  2IAK A;  2VWA A;  4Z91 A;  4O8S A;  1HF8 A;  2X9H A;  1IBL T;  1Y64 B;  1XDO A;  4TWD A;  4GIW A;  5L3G B;  5ABE A;  3AEF A;  1X9B A;  4HFB A;  3PV0 F;  2AXD S;  4NUV A;  5JRC B;  3P4S A;  2QVA A;  1NEN A;  5L2L A;  2XQ5 A;  3KDS E;  3MA9 A;  5LHG B;  4IDN A;  4MHC A;  1R8I A;  2CPT A;  3KVA A;  4EED A;  4LF4 T;  1FMV A;  1UK5 A;  3AAA B;  3EAM A;  3L3P A;  5CB4 E;  2HN1 A;  3VR8 A;  4K0K T;  2VUR A;  3ZMS B;  2LJL A;  4E7Z A;  5FVL A;  1VCS A;  2VB6 A;  3ANW B;  4GYS A;  2OV9 A;  4AI6 A;  2VKJ A;  5AQK B;  3ZST A;  3TLV A;  3AE9 A;  5DQV A;  3RLF F;  3BQI A;  2C5J A;  2UXX B;  3M65 A;  1XMQ T;  2WMO A;  5AQL B;  2YDS A;  3UFE A;  4QKN A;  2FJA A;  5AQT B;  4P09 A;  4H9P C;  2JJ9 A;  2XQ7 A;  4JBW F;  2XAH B;  3AXJ B;  5F3J A;  1UGO A;  4NXN T;  4CQI A;  3ZMT B;  3PJA A;  1BR4 A;  4AIS A;  2YDR A;  3EDU A;  2XQ8 A;  4TUY E;  2W66 A;  1FEW A;  2D0U A;  2LHR A;  3VKG A;  3LK3 B;  3HI2 A;  3OJA A;  3CIR A;  4U33 A;  2KZ7 B;  3PUV F;  3HKB E;  3CML A;  2XAQ B;  1ZOY A;  1D0Z A;  3AE2 A;  1T7S A;  1HR0 T;  1GQE A;  2H89 A;  4LML A;  4AQF A;  5AQH B;  1SE7 A;  2V5C A;  2CMR A;  5JDG A;  2DWG A;  2MOZ A;  4ZS2 A;  3FZL B;  4HTE A;  3C50 A;  2V7M A;  5BMV E;  3F57 A;  3JAF A;  5J2U E;  2VKH A;  3TLU A;  4IDP A;  3E08 A;  3HKC E;  4B3S T;  3VKH A;  3H3A A;  4JI4 T;  1MIY A;  5JR9 B;  3LSV A;  3OYZ A;  1WR6 A;  5AQM B;  2AE9 A;  5FY7 A;  4I0U A;  3ZKR A;  3QB5 K;  2KWH A;  2UUB T;  4KHZ F;  1E7P A;  2E9X B;  4P1N A;  5JDF A;  3PUY F;  4HFC A;  5GON E;  2IC6 A;  2JQ9 A;  3DJB A;  4C91 A;  3LDQ B;  4DR4 T;  2ACX A;  3E0Z A;  2BVL A;  4J2C A;  2YDQ A;  3AED A;  3KBU A;  2IML A;  1OED A;  1HX1 B;  2GK9 A;  3KVB A;  4LFB T;  2PG8 A;  2ZM8 A;  2MTQ A;  1UUS A;  2EHO A;  2CBI A;  2G0U A;  4HFI A;  4IE6 A;  3BQK A;  2NW7 A;  4U7Y A;  2JQQ A;  2M67 A;  3HL6 A;  4P0B A;  3GA8 A;  4KP3 C;  3O1J A;  1Z8U A;  5E0O A;  1YW0 A;  3C64 A;  2WQY A;  2PFV A;  1UX5 A;  1N33 T;  4MLK A;  4QH1 A;  4ERR A;  3LJC A;  5LBM A;  4F6R C;  3UT5 E;  1AJ3 A;  4HWI B;  2V6Y B;  3ZT6 A;  2A3D A;  1FJG T;  2A72 A;  4AKH A;  4KHP T;  2VQE T;  3PUQ A;  2M6B A;  4UVC B;  3QB5 A;  3P4W A;  4DV4 T;  4GYR A;  3BQL A;  1UUR A;  3GN5 A;  3ZN1 B;  4YT0 A;  4OFZ A;  2XSA A;  5LG3 A;  1LKX A;  1WCR A;  2H88 A;  3OKQ A;  1NWM X;  1KFY A;  3EVY A;  1J1J A;  4H9S E;  1WRD A;  4ZZC A;  2DWK A;  1O3X A;  1S94 A;  4IRE A;  2W2U A;  2X51 A;  2L3L A;  4CXX A;  3UU6 A;  2UXD T;  2BS3 A;  4HFH A;  4XAX B;  3T1H T;  4MBQ A;  3N9L A;  5HEJ A;  5L47 A;  5LBQ B;  1LVF A;  4AXP A;  2YIN A;  4HWF A;  2WU5 A;  2NTX A;  4AKL A;  4H9R C;  4IDO A;  3EUH A;  2KWI B;  4EZH A;  4YHH T;  3AA6 B;  4JYA T;  3FBZ A;  2VQF T;  3ZT5 A;  3P50 A;  3C4W A;  4IL9 A;  4IDQ A;  3AEC A;  1BR0 A;  4DV7 T;  2ZM0 A;  1ZV4 X;  3E22 E;  1FIO A;  4FJO A;  5AQG B;  3RGL A;  4TZ4 C;  2YKS A;  2JPF A;  5FNV E;  3ABV A;  3Q5D A;  3A8Y C;  2BS4 A;  2UUC T;  4DMV A;  4IHJ E;  3RI5 A;  2BKN A;  2K5B B;  2JIW A;  4UEM A;  3AVS A;  4G63 A;  3OTO T;  2K9A A;  3N9M A;  4EOZ B;  2WDR A;  2XQ3 A;  3K1S A;  3Q5X A;  2CEA A;  1M62 A;  5CFB A;  2WP9 A;  4GK5 E;  2E5L T;  5AQP B;  1UX4 A;  2UU9 T;  1XZY A;  4IDZ A;  5DJQ C;  1OED E;  2LLY A;  4V1A v;  3MK7 C;  3J7Y q;  1E1H B;  4PJJ A;  2VAS A;  3K8P C;  4I43 B;  3FB2 A;  3CX7 B;  2KND A;  2B76 A;  2ZMA A;  4QH4 A;  4ZHQ E;  3UUN A;  1ZKE A;  3VRB A;  3PUZ F;  4YTP A;  2CWY A;  2BBJ A;  4H63 H;  3RH3 A;  3PUR A;  4DV1 T;  3I9W A;  1HX8 A;  4CXW A;  5AFU L;  2HPL A;  2E5V A;  3AEE A;  1MMA A;  5JRE A;  5AQN B;  3RRC A;  2V1D B;  2E8I A;  5HWX A;  2LSK A;  2CXD A;  1XNR T;  3EI0 A;  2NOX A;  2XTL A;  2W67 A;  3N5L A;  5C8Y E;  3ZJ2 A;  1WYB A;  2NTY A;  5JR9 C;  4QHO A;  1I6Z A;  4DR1 T;  5HXR A;  5LMU T;  4ZXL A;  4K0U A;  2XQ6 A;  3NZP A;  4EAH A;  4QX8 B;  3FHN A;  2YOE A;  4LMK A;  2XQ4 A;  5JH7 E;  2HN2 A;  4U3C A;  4O4L E;  3LBX B;  4MFR A;  2XPK A;  3QUJ A;  3O9X A;  1YKE B;  3AEB A;  4QH5 A;  5LYJ E;  3F31 A;  2E2A A;  2IC9 A;  4X1K E;  3AE1 A;  3N2G E;  3U3I A;  4EYU A;  4UV8 B;  4X5T A;  2MAW A;  2H7O A;  4FI5 A;  3FZK B;  4PFP A;  3PJA J;  1KNZ A;  4M1P A;  1W09 A;  2N1G A;  3NZQ A;  3HR0 A;  5AQV B;  2W61 A;  4DR3 T;  4OK0 A;  5IWA T;  2WM9 A;  4CN1 A;  4HEA A;  5C3J A;  2DHR A;  3AAI A;  3AA7 B;  4H63 V;  1HFA A;  5IHY A;  4NUU A;  3FBL A;  2FBW A;  1WFD A;  3H37 A;  3R6N A;  5HXS A;  3UQ4 A;  4EB6 E;  4A98 A;  3VRA A;  2KXP B;  3TLS A;  2CBJ A;  4GK0 E;  1MMN A;  5CA0 E;  3N9Q A;  3SOL A;  1DU2 A;  4QXH B;  2QA7 A;  4LF6 T;  3RIU A;  5LGU B;  4HWH A;  2J4G A;  4DV5 T;  2F4V T;  4ADZ A;  5JVD E;  2UUA T;  5FKY A;  2V8S V;  2X0L B;  5HEG A;  4JEU B;  2W0G A;  1YKH B;  3AA0 B;  1CHU A;  2BG9 B;  3ZPO A;  2NWB A;  4IIJ E;  2X0Y A;  4LFC T;  3CX8 B;  5FXW A;  3AE8 A;  2JMK A;  4B3R T;  2VK9 A;  2H3R A;  3PUS A;  5HAX A;  3AE4 A;  2UXB T;  5HEU A;  1MMG A;  5L4H A;  4KI0 F;  2XAJ B;  4PK6 A;  2WZI A;  5HYA A;  3KV9 A;  2ZM2 A;  2J62 A;  2JRK A;  3WAK A;  3PU8 A;  4WNK A;  2WY2 A;  1L0V A;  3PDY A;  4DUZ T;  5CJ5 A;  4BA9 A;  3QNU A;  4XBF B;  3D0T A;  1D0X A;  2K48 A;  2WU2 A;  3ZMV B;  3I0O A;  4AQY T;  2Z6E A;  1D1C A;  2PJQ A;  3I1A A;  5FXX A;  3IHR A;  2ODU A;  4ILC A;  2BS2 A;  4AQG A;  2WZH A;  2MBG A;  4DR2 T;  3MKD A;  5L3B B;  4IE0 A;  2ZLY A;  4I50 E;  4B3T T;  1X79 A;  4DV0 T;  1UCU A;  4JI3 T;  2LSJ A;  3AE6 A;  3NVO A;  4BJM A;  4HN9 A;  3KBT A;  5AQQ B;  4PJM A;  2IIU A;  2C5I T;  5JRC A;  3MZK B;  3OVU A;  3RKO A;  1MNE A;  2BKP A;  3IBP A;  4WYV A;  4EIW A;  4U2Z A;  2MYS A;  4QX7 B;  5F8P A;  2W4X A;  4YFS A;  4OHF A;  1SA0 E;  3ZSS A;  2P9B A;  1KEY A;  5AQF B;  4HE8 A;  2UXC T;  5HCJ A;  3Q5E A;  5JDN A;  4IE7 A;  3RIA A;  2IW5 B;  2FJE A;  5J2T E;  2YN6 A;  2X9X A;  2BKO A;  1IZN B; 
#chains in the Genus database with same CATH homology
 1LRZ A;  2LSI A;  4KMC A;  3ANW A;  2LE8 A;  1LVK A;  3W15 B;  2ZM0 A;  1ZV4 X;  2L9Q A;  3E22 E;  1FIO A;  4FJO A;  4O2A E;  4UVB B;  4HKA A;  2Q9Q A;  2VKD A;  2Y8D A;  4TZ4 C;  2JPF A;  4PAG A;  3RX6 A;  1G8X A;  5FNV E;  1OWA A;  3ONX A;  5EK3 A;  1MMD A;  2QGS A;  2NP9 A;  2NW9 A;  3Q5W A;  5FXV A;  4DMV A;  4IHJ E;  2YU1 A;  2K5B B;  4KUM B;  2E9X C;  1ZHC A;  5HXC A;  4UF0 B;  4UEM A;  3AVS A;  4G63 A;  2B1E A;  2HPJ A;  2LSG A;  2CWO A;  2CXF A;  2IAK A;  2K9A A;  3RYF E;  5JDM A;  3N9M A;  3GN5 B;  1IJ5 A;  4EOZ B;  2VWA A;  2EHO D;  4UVA B;  3Q5X A;  4O8S A;  1HF8 A;  2X9H A;  2CEA A;  1G73 A;  3C4Z A;  2C5K T;  1Y64 B;  3RYC E;  5JDQ A;  4UXN B;  4GIW A;  4GK5 E;  5L3G B;  1UX4 A;  2WAU A;  3ZMZ B;  4WBN E;  4IDZ A;  3T8O A;  3GMI A;  5L3F B;  5DJQ C;  1IJ6 A;  4IGU A;  2D5U A;  3PUG A;  2KIN B;  2CLY C;  2Y48 B;  4NUV A;  5JRC B;  4V1A v;  3MK7 C;  3J7Y q;  1E1H B;  4PJJ A;  2VAS A;  2V7I A;  5L2L A;  1SHZ C;  1BR2 A;  4X20 E;  3K8P C;  3KDS E;  3MA9 A;  3R84 B;  2RA1 A;  2XUE A;  4DBQ A;  5LHG B;  1V9D A;  3LG7 A;  5L3E B;  3K3O A;  3Q2M A;  4I43 B;  3OYX A;  4MHC A;  5JDH A;  3FB2 A;  1QUU A;  3LFM A;  4DVD A;  3LBX A;  3KVA A;  4WW0 A;  3CX7 B;  1FMV A;  3RPU A;  3NBX X;  5LGN B;  2KND A;  2XAS B;  2ZMA A;  4X1Y E;  3AAA B;  2CA5 A;  4ZHQ E;  3UUN A;  4DMW A;  1ZKE A;  1HCI A;  5LG4 A;  3L3P A;  4G2A A;  5CB4 E;  3I9Y A;  1D1B A;  3ZMS B;  3K3N A;  2CWY A;  2LJL A;  2V26 A;  3C4X A;  4E7Z A;  2NW8 A;  2VB6 A;  3ANW B;  1IZN B;  4GYS A;  4H63 H;  3RH3 A;  3RYI E;  2JMH A;  4DBR A;  3GWH A;  4AI6 A;  2VKJ A;  5LP6 E;  3EDV A;  3N9O A;  3CVR A;  3PUR A;  2DCF A;  4PJN A;  5DQV A;  2XQY A;  3BQI A;  1HX8 A;  3I9W A;  4IE4 A;  2K24 A;  4CXW A;  5AFU L;  2HPL A;  3JC6 C;  4O2B E;  5FYM A;  1VRB A;  3CQX C;  2C5J A;  2UXX B;  1MMA A;  3M65 A;  5KX5 E;  1HG5 A;  3TKL B;  5JRE A;  2H7V C;  2WMO A;  3RRC A;  4C90 A;  2V1D B;  4QKN A;  3UFE A;  2E8I A;  3ZMU B;  4BJN A;  5HWX A;  2LSK A;  4P09 A;  4DND A;  2X67 A;  3S4U A;  4ZI2 D;  2I59 A;  5J1G A;  4QWN B;  2CXD A;  4H9P C;  2L8K A;  2JJ9 A;  1BR1 A;  2BDE A;  2NOX A;  2XTL A;  4ZI7 E;  2XAH B;  4YHJ A;  5F3J A;  5DAB A;  2XAF B;  3N5L A;  3Q9D A;  5C8Y E;  4MAL A;  3ZJ2 A;  5H6R B;  4CI1 B;  1WYB A;  2HH7 A;  2NTY A;  3KIN B;  4Z8X A;  4CQI A;  2W63 A;  5JR9 C;  3ZC0 A;  4QHO A;  1IAP A;  3ZYM A;  2ES0 A;  5HXR A;  1D0Y A;  3F2E A;  3O4X E;  3ZMT B;  4N78 D;  2Y6X A;  4UIG A;  3K3Q C;  1BR4 A;  4K0U A;  3EDU A;  2ODV A;  4DO0 A;  2D2S A;  4TUY E;  2E9X A;  2X9Y A;  4KBM B;  1D1A A;  2X68 A;  3O1H A;  3C51 A;  3MAC A;  1NAF A;  2EHO C;  3NZP A;  1FEW A;  2D0U A;  2LHR A;  4L9I A;  4IST A;  3VKG A;  3LK3 B;  4QX8 B;  3FHN A;  4EAH A;  4O4I E;  3HI2 A;  4EXT A;  3OJA A;  4YLH A;  2KZ7 B;  3B13 A;  5JH7 E;  3HKB E;  5LJM A;  4O4L E;  3LBX B;  5FMN A;  4MFR A;  3CPZ A;  3HKE E;  3KV4 A;  3SRZ A;  3CML A;  3QUJ A;  3O9X A;  1YKE B;  2XAQ B;  3WI3 A;  3ZLI A;  4JLE A;  1D0Z A;  3FXD B;  4PNI A;  1WLX A;  5LYJ E;  3F31 A;  3CQC B;  2IC9 A;  4X1K E;  2WBL A;  5LXT E;  2Q9Q D;  3V5S A;  4ZI3 D;  5EK4 A;  5IYZ E;  4AQF A;  2V7K A;  1S35 A;  3N2G E;  3QC9 A;  5FP3 A;  4PK5 A;  2OA5 A;  4AQF C;  3U3I A;  1MND A;  3RRW A;  4EYU A;  1Z0P A;  4UV8 B;  3NRY A;  3I0Q A;  4BAY B;  5JDL A;  2CMR A;  4YJ2 E;  5JDG A;  4QXC B;  3KV6 A;  3CWZ B;  3L09 A;  3ZN0 B;  2DWG A;  4ZS3 A;  2MOZ A;  4ZS2 A;  5LCY A;  2H7O A;  1YD8 G;  4PK4 A;  4AKR B;  4FI5 A;  4U74 A;  4HTE A;  4L5G A;  4H9N C;  4PFP A;  4TV8 E;  4YJ3 E;  1KNZ A;  2DLR A;  3C50 A;  3DTO A;  2V7M A;  5LA6 E;  4M1P A;  4ASK A;  5LJN A;  1HTJ F;  5BMV E;  3F57 A;  2N1G A;  3NZQ A;  3HR0 A;  5J2U E;  3ZYK A;  3VHL A;  2VKH A;  4O4J E;  5HWY A;  5LHI B;  4AKG A;  3A5X A;  2W61 A;  3E08 A;  3HKC E;  4OK0 A;  2CCQ A;  2W62 A;  4ANJ A;  1QSD A;  3UTK A;  1HS7 A;  2BZB A;  4PJL A;  3VKH A;  3RC3 A;  3H3A A;  4AKI A;  3P8C D;  2WM9 A;  3KV5 A;  3AA1 B;  3N9P A;  4HEA A;  5CA1 E;  5KDM C;  4QXB B;  2DHR A;  3AAI A;  3AA7 B;  4H63 V;  1HFA A;  5IHY A;  3PUA A;  1MIY A;  4NUU A;  3FBL A;  1MIW A;  2WSS V;  2D0T A;  3H37 A;  3OYZ A;  4I55 E;  5JR9 B;  1WR6 A;  3R6N A;  5HXS A;  4EB6 E;  5FY7 A;  1VOM A;  2KXP B;  1U5P A;  3CX6 B;  4EYY R;  2KWH A;  4A56 A;  3AAE B;  4GK0 E;  1MMN A;  3N9N A;  2E9X B;  2N2N A;  5CA0 E;  3N9Q A;  3SOL A;  5JDF A;  5ADX L;  4CI3 B;  3AVR A;  4QXH B;  2QA7 A;  3ZYL A;  5LGU B;  5GON E;  2IC6 A;  3DJB A;  1KK7 A;  4C91 A;  2PBI A;  3UUL A;  2ACX A;  5JVD E;  3E0Z A;  2C0S A;  3UUM A;  2BVL A;  2KMF A;  4J2C A;  5TAO A;  4ADZ A;  2VL8 A;  3KBU A;  1FMW A;  3C98 B;  3RYH E;  5FXZ A;  3LK4 2;  2YK0 A;  5ETW A;  2GK9 A;  3BK9 A;  5JR9 A;  3N2O A;  3ZEF B;  3KVB A;  2X0L B;  2DNX A;  3ETU A;  3RC8 A;  2PG8 A;  4JEU B;  3CQG B;  4TN7 B;  2ZM8 A;  2W0G A;  2J1D G;  1YKH B;  2MTQ A;  3AA0 B;  4ILU A;  1CUN A;  4TX5 A;  3DP7 A;  2CLY B;  2V7L A;  3ZPO A;  2NWB A;  4IIJ E;  2EHO A;  3O1I A;  2G0U A;  3HKD E;  4IE6 A;  3CX8 B;  4UEL A;  3BQK A;  5FXW A;  2JMK A;  2VK9 A;  5EZY E;  2SPC A;  2WWU A;  2H3R A;  2NW7 A;  2JQQ A;  3V5U A;  2X9W A;  2M67 A;  5FY0 A;  3HL6 A;  3PUS A;  2LEH A;  5HAX A;  4E7S A;  1MMG A;  4PW8 A;  4P0B A;  3GA8 A;  4X1I E;  4KP3 C;  3SS1 A;  2Q9Q C;  2XAJ B;  4ZI3 C;  3O1J A;  4PK6 A;  3B57 A;  5HYA A;  5HXE A;  3KV9 A;  2ZM2 A;  2N9D A;  3ETV A;  5E0O A;  5KMG P;  4JUY A;  4HFV A;  3ESL A;  3PE0 A;  4OYJ A;  1H7C A;  1YW0 A;  1U4Q A;  3ZCJ A;  4CZZ B;  3C64 A;  2PFV A;  3PTR B;  2JRK A;  3WAK A;  4B6X A;  4I4T E;  1UX5 A;  5FY1 A;  4PFO A;  2YU2 A;  2RP4 A;  3PU8 A;  4WNK A;  2BVM A;  4MLK A;  3VU7 H;  4ZOL E;  1EZ3 A;  2CE7 A;  4ERR A;  1T98 A;  3PDY A;  2LSY A;  2E9X D;  3LJC A;  4L0R A;  2DI4 A;  5LBM A;  4EZ4 A;  4IE5 A;  4BA9 A;  5JQG E;  4XBF B;  4F6R C;  3D0T A;  1D0X A;  3UT5 E;  1AJ3 A;  2K48 A;  3NRX A;  4CXY A;  3KFW X;  1OXZ A;  5LNK A;  5M4Y A;  3ZMV B;  2A3D A;  3I0O A;  2Z6E A;  2LT3 A;  1D1C A;  2A72 A;  2PJQ A;  3I1A A;  4P0A A;  5FXX A;  3IHR A;  4AKH A;  2UXN B;  3UUX B;  3PUQ A;  5DQW A;  2LM9 A;  4U72 A;  4UVC B;  2ODU A;  5LGT B;  4AQG A;  3IF8 B;  3U78 A;  4UF0 A;  2MBG A;  2LHN A;  3MKD A;  4O4H E;  5L3B B;  4GYR A;  4IE0 A;  2ZLY A;  3BQL A;  4I50 E;  3ZN1 B;  3GN5 A;  4GOU A;  4ISS A;  3PU3 A;  4OFZ A;  1LKX A;  1US7 B;  4H9Q C;  3OKQ A;  3IEE A;  5L3D B;  3ZCI A;  1NWM X;  2W00 A;  1X79 A;  2XHE B;  1UCU A;  5EK2 A;  4OYK A;  3EVY A;  3J9X 1;  4H9S E;  1WRD A;  2LSJ A;  5A1L A;  3LK2 B;  3QK6 A;  2DWK A;  3P7I A;  4JEH B;  1O3X A;  2KT9 A;  2XAG B;  4BJM A;  4HN9 A;  3KBT A;  1S94 A;  5L3C B;  4PJM A;  2X51 A;  2LOP A;  2L3L A;  3AB3 B;  4CI2 B;  4CXX A;  4ZI2 C;  2C5I T;  2EHO B;  5LOV E;  4HGA A;  4WBO A;  3HA4 A;  5JRC A;  3MZK B;  5HXH A;  3RKO A;  3CKD A;  4XAX B;  1MNE A;  4MBQ A;  2X66 A;  3N9L A;  4H9O C;  3IBP A;  4EIW A;  2MYS A;  1ZEE A;  5LBQ B;  2Q9Q B;  4QX7 B;  5F8P A;  1LVF A;  3FXE B;  4AXP A;  2YIN A;  4XZC A;  2YEV C;  4YFS A;  4UV9 B;  4OHF A;  1SA0 E;  2A2F X;  2KLQ A;  1HG2 A;  2NTX A;  2P9B A;  4AKL A;  3ZJ1 A;  4H9R C;  3EUH A;  1WYC A;  2CM0 A;  2KWI B;  3OBV E;  4HE8 A;  4EZH A;  3MJX A;  3AA6 B;  5JDN A;  3FBZ A;  4IE7 A;  3JC6 D;  5H6Q B;  5LHH B;  2CXL A;  2IW5 B;  1B7T A;  1MIV A;  5J2T E;  3WAJ A;  3MXZ A;  3SWH A;  3N2K E;  3ZC1 A;  3C4W A;  2WMN A;  2X9X A;  2LOS A;  4TV9 E;  2VKO A;  2V7J A;  1BR0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...