2LEHA

Solution structure of the core smn-gemin2 complex
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
189
structure length
189
Chain Sequence
GYSPTLQWQQQQVAQFSTVRQNVNKHRSHWKSQQLDSNVTMPKSEDEEGWKKFCLGEKLCADGAVGPATNESPGIDYVQIGFPPLLSIVSRMNQATVTSVLEYLSNWFGERDFTPELGRWLYALLACLEKPLLPEAHSLIRQLARRCSEVRLLVDSKDDERVPALNLLICLVSRYFDQRDLADEPSLEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the core SMN-Gemin2 complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords Survival of motor neuron protein-interacting protein 1
total genus 38
structure length 189
sequence length 189
ec nomenclature
pdb deposition date 2011-06-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1070 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2lehA00
2LEHA
chains in the Genus database with same CATH superfamily
3QB5K 1UK5A 2E9XD 2YDSA 2IC9A 2QRXA 1BR4A 3VR8A 4COFA 5JRCA 4HFBA 4KHPT 2V7IA 4PW8A 5AQTB 4F8HA 3ZYMA 2J62A 4Z8XA 3RX6A 4WBNE 3F57A 3IF8B 3LJCA 4NUVA 2RPAA 3ZEFB 2WBLA 1ZOYA 2W63A 3FHNA 3UU3A 1NAFA 5JQGE 5LP6E 4DR5T 1OWAA 5JDNA 2JQKA 1MMDA 2VASA 4LMKA 5ADXL 3HA4A 5IWAT 1VOMA 5HEJA 4DV3T 4UXNB 4HWIB 5DABA 2IMLA 3QUJA 2E5VA 3ZMZB 2OA5A 1WRDA 3SRZA 3ZN1B 5LMUT 3JAEA 4IDPA 4HWDA 4K0UA 5LHIB 3CQXC 3OYXA 3UFGA 3NZPA 3SFEA 2UXBT 4U2ZA 4MLKA 2A72A 4IDZA 3QNUA 5IUXA 1QLBA 3AE4A 1WCRA 1XDOA 3HKCE 2KWHA 4YHJA 4OYJA 3ZMTB 4EOZB 2H3RA 3TLTA 1HTJF 4ZOLE 1YQ4A 1CHUA 4KX6A 4O4JE 3RIUA 3AECA 2BG9B 2YKSA 2YINA 4WYVA 4DMVA 5AQGB 1T7SA 5HEHA 1OEDC 3Q5EA 2WZIA 2WMOA 3N2GE 4H9OC 2XZEA 3W15B 5KDMC 3UFEA 3U3IA 4X66T 4H9RC 3RKGA 2BVLA 2XY8B 5AQLB 3EAMA 4LF8T 2K48A 4X1YE 1B7TA 4PK6A 5HWYA 2JPFA 5FVLA 2K5BB 1S35A 3UUXB 3LBXB 3ZMVB 5AQFB 2Q9QC 3FZHB 2LKHA 3GA8A 4UF0B 5AQHB 2ODUA 3N9MA 5AQMB 3EUHA 5FY1A 4JI5T 4Q25A 5HWXA 5LG3A 4DMWA 4P0AA 4LMLA 1LVKA 2VVNA 2W0GA 3CX7B 2WMNA 2WAUA 4CZZB 3MK7C 2XUEA 4AQFA 4U31A 2JMKA 2Y8DA 1D0YA 2PJQA 4QXBB 4A97A 4JEHB 4EIWA 3T1HT 2KZ7B 1T98A 3OBVE 4M1PA 2UXCT 1BR0A 3UULA 2CLYC 3BQIA 3KBTA 2FUPA 4UV9B 5ABGA 4EGWA 1I6ZA 3RI5A 4IT4A 5HXCA 1WR6A 2BBHA 3KDSE 2MAWA 2EHOD 3P4SA 2FJDA 1WFDA 4OYKA 4ZI2C 2VKDA 1CUNA 2FJAA 4PJLA 2CBIA 3T8OA 4C90A 2DCFA 2FJBA 2C5KT 1KNRA 2MPKA 3HI2A 3O9XA 2VKOA 4TWFA 2BG9E 1YQ3A 2HPJA 3MZKB 3N9LA 5DQWA 4GK0E 4QX8B 2XAFB 3EHZA 5AQPB 3O1IA 1XZYA 5LB7B 4E7ZA 3M65A 4B3ST 4H9QC 2YU2A 2V7KA 2WDVA 4H9SE 1YKHB 2UU9T 4OHFA 2XJ7A 3RKOA 2V7MA 3P4QA 4KBMB 4FI5A 2UUCT 1HFAA 1Y64B 4G2AA 2ES0A 4DBRA 3RQWA 4GK5E 1DU2A 2DWKA 2RP4A 5L3FB 1IJ6A 3ZCJA 4O8SA 2LSKA 1OEDE 2CHNA 2LJLA 4KUMB 1SHZC 4HTEA 5DQVA 2ZM8A 5E0OA 2NW9A 1G8XA 3RIFA 3UT5E 4A5XA 4DBQA 1VCSA 2M6BA 4LF6T 4LFAT 3EABA 3ZPOA 2WY2A 3PUXF 4DNDA 2L8KA 3OTOT 5C2TA 2BS3A 1N34T 1R8IA 4PK4A 4KP3C 1OXZA 4IE4A 2WB5A 4YSZA 4ZZBA 3HR0A 2K9AA 5HAXA 5JR9A 4EB6E 5HXHA 3ANWB 1HNXT 2NTXA 2QGSA 4TN7B 4L9IA 2NTYA 4TZ4C 3ZT5A 4EXTA 2M6IA 1FEWA 4AKGA 2I0MA 4ZS2A 1WYCA 4HWFA 4X62T 5LNKA 4JI1T 2CMRA 4PJJA 1VCTA 2JQHA 3ZN0B 5LHHB 2BKOA 2DWGA 3PDYA 5C8YE 3JCFA 3C98B 4GKKT 1H7CA 2VK9A 4YTMA 1OEDA 2V8SV 3MXZA 2MTQA 2VL8A 2B76A 4EEDA 5JDMA 4YFSA 2YEVC 5TAOA 3ZCIA 2X9WA 3PUZF 2C0SA 2XASB 2ZMAA 4I55E 3R84B 2C5JA 2WZHA 3ZSSA 3ZLIA 2LRLA 3N2KE 1W09A 2N9DA 2XTLA 3I0QA 2ZM2A 4HFCA 3L3PA 4QKNA 3TKLB 4DR3T 3T1YT 2K3WA 3Q5XA 2A2FX 3B57A 2VVSA 3E08A 4PNIA 5LBMA 1U5PA 2WS3A 3AE7A 4ILCA 2YU1A 3CVRA 4UIGA 2HPLA 1IAPA 2E8IA 5LYJE 5IHYA 1WLXA 3CKDA 4ILAA 1FMWA 4X20E 4YHHT 2LSIA 1J5WA 2KMFA 3JC6C 4TWHA 3RYIE 5JDQA 1IZNB 4L0RA 5JDGA 2ZM6T 2VQFT 1XMQT 3LSVA 3TLUA 5CFBA 4CXWA 4X1IE 4CN4A 2QA7A 2WM9A 5IYZE 3ETUA 5ABHA 5JVDE 2ACZA 3CX6B 1WYBA 3H3AA 3RQUA 5J0ZA 1LVFA 4LF7T 3C64A 3VRAA 4A98A 1E1HB 3B13A 3C50A 4LMJA 4QWNB 4XAXB 2XAHB 2KT9A 2XQ6A 4CI3B 3AE2A 3CQCB 3AE3A 3KV6A 3V5UA 2I6HA 4IREA 4YSYA 4HFEA 5J2TE 1N33T 3CIRA 3RRWA 2X9XA 5FXXA 1JNZA 1ZHCA 1KNZA 1W0BA 3L39A 3RC3A 3C51A 3RIAA 3J9X1 2PFVA 3ZC1A 2KLQA 1D1CA 4P09A 2FBWA 2GK9A 2VB6A 4PK5A 2L9QA 2R6GF 4E7SA 2X0YA 4U72A 5EK2A 4ZI2D 4HFIA 4DR1T 2YDQA 3X1DA 2D5UA 4WW0A 2DLRA 5HXRA 2XQ5A 2MBGA 2XSBA 3FB2A 3Q5DA 4CXXA 3RYHE 1VRBA 5JR9C 3ANWA 2LOSA 3C4WA 2M67A 2BVMA 2Q9QB 1MMGA 2E9XB 4HFHA 1US7B 1IBMT 1MIVA 2CWOA 2OV9A 4U2YA 4IHJE 1L0VA 4X1KE 5KMGP 2IDOB 2I59A 4DUZT 2DL1A 2G0UA 3PUGA 3HKEE 4AISA 3OJAA 4AIUA 3BQKA 3AB3B 3PJAA 5JDHA 2LSYA 2XAGB 4IE0A 2ODVA 2IW5B 3ESLA 1D0XA 2ZM0A 3RYFE 1XNRT 1ZP0A 4I0UA 1QSDA 4N78D 2PTFA 2XQ8A 3TLSA 3VR9A 3ZKRA 5F3JA 2VWAA 3AEGA 4JI8T 2NW8A 3IBPA 2NP9A 2WU2A 2MYSA 1SE7A 4UVAB 3UQ4A 3Q9DA 1HCIA 1HR0T 3WI3A 4IE7A 1MNEA 3EDUA 3G06A 5H6QB 2WQYA 5F8PA 5EK3A 3PUYF 2BZBA 2EHOA 4IGUA 4KI0F 3AEDA 5LCYA 3IEEA 3AE6A 3CMLA 3UU5A 3VKGA 5AQJB 1KFYA 5L3DB 3H3MA 5L4HA 3AAAB 4AKLA 3OYZA 2JMHA 2BG9C 4HFVA 2DNXA 4F6RC 3LFMA 5KXJA 3S4UA 1OEDB 3UQ7A 4HFDA 1O3XA 4L5GA 4UV8B 5EZYE 4TNVA 2V1DB 3ONXA 1KEYA 5AQRB 4ZXLA 3H37A 4MBQA 4GKJT 2XQ4A 2JQQA 4I4TE 2XM2A 2KINB 4HE8A 5HEGA 2V7JA 4MHCA 3NWIA 4EEBA 4EAHA 2H7OA 5L4EA 3AXJB 3SOLA 3RC8A 2HN2A 2XQ9A 5DJQC 4JEUB 2P9BA 2IUBA 4DV6T 2LEHA 3F2EA 3ETVA 3ZT7A 5AQUB 1T72A 2RA1A 3FZFB 4TWDA 3IHRA 2KXPB 3AE5A 3RYCE 2KNDA 4GOUA 3I9WA 4ZI7E 4X64T 4QH1A 2LHNA 2W67A 2V7LA 5JDFA 1S94A 2LSJA 3NRXA 3AEAA 4UF0A 4ADZA 3E0ZA 1BR1A 3UU4A 4YJ2E 5L3CB 3C4ZA 2L3LA 2W61A 3AE9A 4DV5T 1D0ZA 3RPUA 5ETWA 2BS2A 3JADA 2YDRA 3AA6B 4ZS3A 4DV4T 5LBQB 2LSGA 4DIDB 4O2AE 2Q9QD 4YXDA 3DJBA 3FZKB 2CEAA 1YD8G 4NXMT 2CXLA 3ZMSB 4PJNA 2A3DA 4B3TT 3N9OA 3E22E 1KNPA 5AQNB 3A5XA 4HKAA 2D0TA 3LBXA 4TX5A 4QHOA 1N36T 4PFPA 2X9YA 5F5WA 4JI0T 4FJOA 4XBFB 1XWMA 4ZHQE 5JDLA 1HG5A 2CXFA 3IA3A 1AJ3A 3NBXX 3OVUA 1MMNA 2EHOB 3NVOA 1FMVA 2XQAA 4EYYR 2IHR1 4ASKA 4DR4T 2BG9A 4O4IE 2K24A 3CK6A 2Y6XA 3EI0A 1JNRA 1UX5A 3NKZA 2CHOA 1V9DA 4U74A 4EYUA 4AKHA 3AVRA 4AI6A 3AEFA 4HN9A 4AKRB 1Y01A 3P4WA 5LHGB 4GYRA 5CJ5A 5AQQB 4A56A 4AKIA 5FP3A 4IL9A 2A9UA 5AQSB 2ZLYA 2CM0A 4H63H 1EZ3A 4P1NA 5FVKA 1HX8A 5FL1A 2QVAA 4J2CA 2VQET 3ZYKA 4B3MT 1N32T 2JQ9A 3LK2B 3ZJ1A 4QH4A 4XZCA 3PTRB 2NW7A 2H88A 3PU8A 1SUMB 2LOPA 4HWCA 4ILUA 2PBIA 4JUYA 4CI2B 5LGNB 3I1AA 3L8RA 1HS7A 4YT0A 2DHRA 1FIOA 2CA5A 4PJMA 3ZMUB 5FY0A 2LLYA 2WSSV 3HL6A 3PE0A 4GYSA 3KINB 4OK0A 5HCJA 2XQ3A 4UEMA 2JJ9A 2C5IT 1Z0PA 4PFOA 2V5DA 4I50E 4U7YA 4YTPA 5HEOA 5AQKB 4NIQA 3AEEA 1U4QA 5FXVA 5HEUA 2WWUA 4YY3T 5JREA 2LRKA 4B3RT 2HH7A 4U33A 2J1DG 4UVBB 4YSXA 4UR9A 1M7KA 1X79A 4ILBA 3U78A 2X0HA 3M3ZB 1ZEEA 2DI4A 1E2AA 1YXRA 4H9NC 5LG4A 3WAJA 3VRBA 4CN1A 1HX1B 2X67A 3GN5A 2CWYA 3BQLA 3K3OA 3TLVA 5C3JA 1UURA 1IBKT 4H9PC 4BJMA 1T8BA 1MNDA 2X51A 3RLFF 5HCMA 2NWBA 3ZSTA 4BAYB 5LJNA 3PUAA 3L09A 3TLWA 2QYWA 2YK0A 5A1LA 4YLHA 3K8PC 2CRBA 4BA9A 5JR9B 5L3EB 3KVAA 2CE7A 3FZMB 3ZT6A 5LGUB 3N9QA 5FKYA 2E9XC 3FZLB 2WDRA 2UUAT 3MA9A 4U3CA 4Z90A 3O4XE 3OPCA 3PUSA 3P7IA 2PG8A 2HN1A 4CQIA 4AXPA 2CCQA 1BR2A 4IDNA 5M4YA 1XNQT 3QC9A 5FXWA 4O4HE 3N9PA 4EV6A 3D0TA 2Z6EA 3DP7A 1MMAA 3VU7H 4C91A 1LKXA 2ACXA 4JI4T 5AFUL 4QXCB 2X68A 2Q9QA 4IDQA 5CB4E 3I0OA 2UXXB 4QXHB 2UXDT 1YW0A 1IBLT 4TV8E 2WU5A 2CLYB 2XAJB 3RGLA 5BMVE 4TNWA 2XQ7A 3N2OA 4OX9T 2KWIB 2BKPA 1UUSA 4QX7B 3UUNA 4JI7T 4DR7T 4K0KT 4CXYA 4OFZA 1HNZT 5ABFA 4TV9E 3UU8A 5J2UE 2W62A 2LM9A 4X65T 2AXDS 4DVDA 2LT3A 1D1BA 4JBWF 3KV5A 4U7IA 3OKQA 4HWHA 4ERRA 4LFBT 4H63V 4DR6T 5LXTE 4WZXA 3FBZA 3JAFA 4Z91A 3RRCA 2CXDA 4LF5T 3KV4A 3PJAJ 2IAKA 2IIUA 2XPKA 4UVCB 4ZI3C 1IJ5A 3K3QC 1YKEB 2V26A 4JI6T 3B5MA 4DV2T 2XSAA 5FYMA 5HXSA 2W2UA 5AQOB 3AA1B 3KFWX 3AAEB 5GONE 3N5LA 4JI3T 4LF9T 4MFRA 1HNWT 2V6XA 5HXEA 2H7VC 5L3BB 2YN6A 3FXDB 5EK4A 1Z8UA 4BJNA 5LMNT 1E7PA 4KMCA 5JRCB 2IC6A 5KX5E 5L47A 2V6YA 3LK42 2OLTA 3MACA 3PUQA 3QOFA 2H89A 4DO0A 3HKBE 4DUYT 3PURA 2NOXA 2LHRA 3AEBA 3FBLA 3PUWF 2CPTA 2V6YB 4CN6A 3AXJA 1NWMX 2D2SA 3MJXA 4V1Av 2E9XA 2UUBT 3AVSA 5H6RB 3SS1A 3UUMA 3UTKA 3J7Yq 4AQYT 2UXNB 3A8YC 3N9NA 3AAIA 4ZZCA 4YJ3E 2E5LT 1G73A 3RF1A 2W66A 4QH5A 3I9YA 4WBOA 3JC6D 2F4VT 4EZ4A 4LF4T 3FXEB 2BKNA 4JI2T 3PUVF 3A7MA 3AA7B 4AQFC 1UCUA 2VURA 3UUBA 1UX4A 3PU3A 5LOVE 5FXZA 1SA0E 2D9DA 2VL0A 3NZQA 1NEKA 1QUUA 1FJGT 4JYAT 2JIWA 3CX8B 4IIJE 3RH3A 4PAGA 3C4XA 4P0BA 5JTGA 1XMOT 2XQYA 3LG7A 3GN5B 3HKDE 1J5ET 2N1GA 5HYAA 4MALA 2WDQA 1HF8A 2NR4A 4DR2T 2X66A 1XDPA 2WWVA 4X5TA 4DV7T 3GWHA 5CGMA 3ONJA 4YTNA 3SFDA 2EHOC 3K3NA 5FY7A 3V5SA 2XM1A 1HG2A 3CPZA 3EVYA 3WAKA 5BR8T 4JV5T 2J4GA 4HEAA 2FJEA 1J1JA 3DTOA 4I43B 1ZV4X 2KSRA 4AQGA 1I94T 4DV0T 3P8CD 3QK6A 3K1SA 4G63A 3NRYA 1KF6A 2AE9A 4NUUA 2BDEA 2WCAA 4HGAA 2VKJA 3P4PA 5FNVE 5JH7E 1WR0A 2D0UA 2J47A 5CA1E 2B1EA 3ABVA 3RHWA 2LM2A 2V5CA 3O1JA 3R6NA 1MIYA 1GQEA 2X9HA 1D1AA 3Q5WA 2MOZA 3F31A 3ZC0A 2XAQB 2N2NA 4O2BE 3SWHA 5AQVB 3KBUA 3KVBA 5J1GA 1UGOA 5LA6E 3ZYLA 4ZEYA 1MIWA 4ZI3D 3P4RA 2LKGA 2VKHA 3P50A 3GMIA 5FL0A 1LRZA 2YOEA 3UU6A 2W4XA 4GIWA 1ZKEA 4CI1B 1M62A 3VHLA 3VKHA 4JLEA 2CBJA 4EZHA 1NENA 2Y48B 3LK3B 2LE8A 5FMNA 3ZJ2A 4B6XA 3LDQB 4UELA 2XHEB 4ISSA 2SPCA 3AA0B 4TUYE 5L2LA 5ABEA 3Q2MA 1W9RA 5CA0E 3BK9A 3QB5A 4IE6A 2E2AA 2X0LB 4WNKA 4ANJA 4IE5A 4IL4A 2BS4A 4DV1T 2BBJA 2WP9A 3KV9A 3AE8A 3EDVA 2W00A 1W0AA 4ISTA 4O4LE 3CQGB 5LJMA 5ABFB 5L3GB 5AQIB 4KHZF 3RIUC 4LFCT 4NXNT 4NPPA 2JRKA 1X9BA 3O1HA 1KK7A 3MKDA 4IDOA 3AE1A 5LGTB 2HHHT 3PV0F 3ONLC 3CWZB
chains in the Genus database with same CATH topology
2E9XD 2IC9A 1BR4A 5JRCA 2V7IA 4PW8A 3ZYMA 4Z8XA 3RX6A 4WBNE 3F57A 3IF8B 3LJCA 4NUVA 3ZEFB 2WBLA 5JQGE 2W63A 3FHNA 5LP6E 1NAFA 1KNZA 1OWAA 5JDNA 1MMDA 2VASA 5ADXL 3HA4A 1VOMA 4UXNB 5DABA 3QUJA 3ZMZB 2OA5A 1WRDA 3SRZA 3ZN1B 4K0UA 5LHIB 3CQXC 3OYXA 3NZPA 4MLKA 2A72A 4IDZA 3ZMTB 5HXEA 3HKCE 2KWHA 4YHJA 4OYJA 4EOZB 2H3RA 1HTJF 4ZOLE 4O4JE 2YINA 4DMVA 3N2GE 2WMOA 4H9OC 3W15B 5KDMC 3UFEA 3U3IA 4H9RC 2BVLA 2K48A 4X1YE 1B7TA 4PK6A 5HWYA 2JPFA 2K5BB 1S35A 3UUXB 3LBXB 3ZMVB 3WAJA 2Q9QC 3GA8A 4UF0B 2ODUA 3N9MA 5FY1A 3EUHA 5HWXA 4DMWA 4P0AA 1LVKA 3CX7B 2W0GA 2WMNA 2WAUA 4CZZB 3MK7C 2XUEA 4AQFA 2JMKA 2Y8DA 1D0YA 2PJQA 4QXBB 4EIWA 4JEHB 1BR0A 2KZ7B 1T98A 3OBVE 4M1PA 3UULA 2CLYC 3BQIA 3KBTA 4UV9B 5HXCA 1WR6A 3KDSE 2EHOD 4OYKA 4ZI2C 2VKDA 1CUNA 4PJLA 3T8OA 4C90A 2DCFA 2C5KT 3HI2A 3O9XA 2VKOA 2HPJA 3MZKB 3N9LA 5DQWA 4GK0E 4QX8B 2XAFB 3O1IA 4E7ZA 3M65A 4H9QC 2YU2A 2V7KA 4H9SE 1YKHB 4OHFA 3RKOA 2V7MA 4KBMB 4FI5A 1HFAA 1Y64B 4G2AA 2ES0A 4DBRA 4GK5E 2DWKA 2RP4A 5L3FB 1IJ6A 3ZCJA 4O8SA 2LSKA 2LJLA 4KUMB 5DQVA 1SHZC 4HTEA 2NW9A 2ZM8A 5E0OA 3UT5E 1G8XA 4DBQA 3ZPOA 4DNDA 2L8KA 4PK4A 4KP3C 1OXZA 4IE4A 3HR0A 2K9AA 5HAXA 5JR9A 4EB6E 5HXHA 3ANWB 2NTXA 2QGSA 4TN7B 4L9IA 2NTYA 4TZ4C 4EXTA 1FEWA 4ZS2A 1WYCA 5LNKA 2CMRA 4PJJA 3ZN0B 5LHHB 3PDYA 2DWGA 5C8YE 3C98B 1H7CA 2VK9A 3MXZA 2MTQA 2VL8A 5JDMA 4YFSA 2YEVC 5TAOA 3ZCIA 2X9WA 2C0SA 2XASB 2ZMAA 4I55E 3R84B 2C5JA 3ZLIA 3N2KE 2N9DA 2XTLA 3I0QA 2ZM2A 3L3PA 4QKNA 3TKLB 3Q5XA 2A2FX 3B57A 3E08A 4PNIA 5LBMA 1U5PA 2YU1A 3CVRA 4UIGA 2HPLA 1IAPA 2E8IA 5LYJE 5IHYA 1WLXA 3CKDA 4X20E 1FMWA 2LSIA 2KMFA 3JC6C 3RYIE 5JDQA 1IZNB 4L0RA 5JDGA 4CXWA 4X1IE 2QA7A 2WM9A 5IYZE 3ETUA 5JVDE 3CX6B 3H3AA 1WYBA 1LVFA 3C64A 1E1HB 3B13A 3C50A 4QWNB 4XAXB 2XAHB 2KT9A 4CI3B 3CQCB 3KV6A 3V5UA 5J2TE 3RRWA 2X9XA 5FXXA 1ZHCA 3RC3A 3C51A 3J9X1 2PFVA 3ZC1A 2KLQA 1D1CA 4P09A 2GK9A 4PK5A 2VB6A 2L9QA 4E7SA 5EK2A 4U72A 4ZI2D 2D5UA 4WW0A 2DLRA 5HXRA 2MBGA 4CXXA 3FB2A 3RYHE 1VRBA 5JR9C 3ANWA 2LOSA 3C4WA 2M67A 2BVMA 2Q9QB 1MMGA 2E9XB 1US7B 1MIVA 2CWOA 4IHJE 4X1KE 5KMGP 2I59A 2G0UA 3PUGA 3HKEE 5JREA 3OJAA 3BQKA 3AB3B 5JDHA 4AKGA 2LSYA 2XAGB 4IE0A 2ODVA 2IW5B 3ESLA 1D0XA 2ZM0A 3RYFE 4N78D 1QSDA 5F3JA 2VWAA 2NW8A 3IBPA 2NP9A 4UVAB 2MYSA 3Q9DA 1HCIA 3WI3A 4IE7A 1MNEA 3EDUA 5H6QB 5F8PA 5EK3A 2BZBA 2EHOA 4IGUA 3VKGA 5LCYA 3IEEA 3CMLA 5L3DB 3AAAB 4AKLA 3OYZA 2JMHA 4HFVA 2DNXA 4F6RC 3LFMA 3S4UA 4L5GA 1O3XA 4UV8B 5EZYE 2V1DB 3ONXA 3H37A 4MBQA 2JQQA 4I4TE 4HE8A 2KINB 2V7JA 4MHCA 4EAHA 2H7OA 3SOLA 3RC8A 5DJQC 4JEUB 2P9BA 2LEHA 3F2EA 3ETVA 2RA1A 3IHRA 2KXPB 3RYCE 4ZI7E 2KNDA 4GOUA 3I9WA 2LHNA 2V7LA 5JDFA 1S94A 2LSJA 3NRXA 4UF0A 4ADZA 3E0ZA 1BR1A 5L3CB 3C4ZA 2L3LA 2W61A 1D0ZA 3RPUA 5ETWA 3AA6B 4ZS3A 5LBQB 2LSGA 4O2AE 2Q9QD 3DJBA 2CEAA 1YD8G 2CXLA 3ZMSB 4PJNA 2A3DA 3N9OA 3E22E 3A5XA 4HKAA 2D0TA 3LBXA 4TX5A 4QHOA 4PFPA 2X9YA 4FJOA 4XBFB 4ZHQE 5JDLA 1HG5A 2CXFA 1AJ3A 3NBXX 1MMNA 2EHOB 1FMVA 4EYYR 4ASKA 4O4IE 2K24A 2Y6XA 4EYUA 4AKHA 1UX5A 4U74A 1V9DA 3AVRA 4AI6A 4HN9A 4AKRB 5LHGB 4GYRA 4A56A 4AKIA 5FP3A 2ZLYA 2CM0A 4H63H 1EZ3A 1HX8A 4J2CA 3ZYKA 3LK2B 3ZJ1A 4XZCA 3PTRB 2NW7A 4ILUA 3PU8A 2LOPA 4JUYA 4CI2B 2PBIA 5LGNB 3I1AA 1HS7A 2DHRA 1FIOA 2CA5A 4PJMA 3ZMUB 5FY0A 2WSSV 3HL6A 3PE0A 4GYSA 3KINB 4OK0A 4UEMA 2JJ9A 2C5IT 1Z0PA 4PFOA 4I50E 5FXVA 1U4QA 2WWUA 2HH7A 2J1DG 4UVBB 3U78A 1X79A 1ZEEA 2DI4A 4H9NC 5LG4A 2X67A 3GN5A 2CWYA 3BQLA 3K3OA 4H9PC 4BJMA 1MNDA 2X51A 5LJNA 4BAYB 2NWBA 3PUAA 3L09A 2YK0A 5A1LA 4YLHA 3K8PC 5JR9B 4BA9A 5L3EB 3KVAA 2CE7A 5LGUB 3N9QA 2E9XC 3MA9A 3O4XE 3PUSA 3P7IA 2PG8A 4CQIA 4AXPA 2CCQA 1BR2A 5M4YA 3QC9A 5FXWA 4O4HE 3N9PA 3D0TA 2Z6EA 3DP7A 1MMAA 3VU7H 4C91A 1LKXA 2ACXA 5AFUL 4QXCB 2X68A 2Q9QA 5CB4E 3I0OA 2UXXB 4QXHB 1YW0A 4TV8E 2XAJB 2CLYB 5BMVE 3N2OA 2KWIB 4QX7B 3UUNA 4CXYA 4OFZA 4TV9E 5J2UE 2W62A 2LM9A 4DVDA 2LT3A 1D1BA 3KV5A 3OKQA 4ERRA 4H63V 3FBZA 3RRCA 2CXDA 3KV4A 2IAKA 4ZI3C 4UVCB 1IJ5A 3K3QC 1YKEB 2V26A 5FYMA 5HXSA 3AA1B 3KFWX 3AAEB 5GONE 3N5LA 4MFRA 2H7VC 5L3BB 3FXDB 5EK4A 4BJNA 5JRCB 4KMCA 2IC6A 5KX5E 3LK42 3PUQA 3MACA 4DO0A 3HKBE 3PURA 2NOXA 2LHRA 3FBLA 3MJXA 1NWMX 2D2SA 4V1Av 2E9XA 3AVSA 5H6RB 3SS1A 3UUMA 3UTKA 3J7Yq 2UXNB 3N9NA 3AAIA 4YJ3E 1G73A 3I9YA 4WBOA 3JC6D 4EZ4A 3FXEB 3AA7B 4AQFC 1UCUA 1UX4A 3PU3A 5LOVE 5FXZA 1SA0E 3NZQA 1QUUA 4IIJE 3CX8B 3RH3A 4PAGA 3C4XA 4P0BA 2XQYA 3LG7A 3GN5B 3HKDE 2N1GA 5HYAA 4MALA 1HF8A 2X66A 3GWHA 5LXTE 2EHOC 3K3NA 5FY7A 3V5SA 3CPZA 1HG2A 3EVYA 3WAKA 4HEAA 3DTOA 4I43B 1ZV4X 4AQGA 3P8CD 3QK6A 4G63A 3NRYA 4NUUA 2BDEA 5JH7E 4HGAA 2VKJA 5FNVE 2D0UA 5CA1E 2B1EA 3O1JA 3R6NA 1MIYA 2X9HA 3Q5WA 1D1AA 2MOZA 3F31A 3ZC0A 2XAQB 2N2NA 4O2BE 3SWHA 3KBUA 3KVBA 5J1GA 5LA6E 3ZYLA 1MIWA 4ZI3D 2VKHA 4CI1B 3GMIA 1LRZA 4GIWA 1ZKEA 3VHLA 3VKHA 4JLEA 4EZHA 2Y48B 3LK3B 2LE8A 5FMNA 3ZJ2A 4B6XA 4UELA 2XHEB 4ISSA 2SPCA 3AA0B 4TUYE 5L2LA 3Q2MA 5CA0E 3BK9A 4IE6A 2X0LB 4WNKA 4ANJA 4IE5A 3KV9A 4O4LE 3EDVA 2W00A 4ISTA 5LJMA 3CQGB 5L3GB 2JRKA 3O1HA 5LGTB 1KK7A 3MKDA 4YJ2E 3CWZB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LEH A; 
#chains in the Genus database with same CATH topology
 3QB5 K;  1UK5 A;  2E9X D;  2YDS A;  2IC9 A;  2QRX A;  1BR4 A;  3VR8 A;  4COF A;  5JRC A;  4HFB A;  4KHP T;  2V7I A;  4PW8 A;  5AQT B;  4F8H A;  3ZYM A;  2J62 A;  4Z8X A;  3RX6 A;  4WBN E;  3F57 A;  3IF8 B;  3LJC A;  4NUV A;  2RPA A;  3ZEF B;  2WBL A;  1ZOY A;  2W63 A;  3FHN A;  3UU3 A;  1NAF A;  5JQG E;  5LP6 E;  4DR5 T;  1OWA A;  5JDN A;  2JQK A;  1MMD A;  2VAS A;  4LMK A;  5ADX L;  3HA4 A;  5IWA T;  1VOM A;  5HEJ A;  4DV3 T;  4UXN B;  4HWI B;  5DAB A;  2IML A;  3QUJ A;  2E5V A;  3ZMZ B;  2OA5 A;  1WRD A;  3SRZ A;  3ZN1 B;  5LMU T;  3JAE A;  4IDP A;  4HWD A;  4K0U A;  5LHI B;  3CQX C;  3OYX A;  3UFG A;  3NZP A;  3SFE A;  2UXB T;  4U2Z A;  4MLK A;  2A72 A;  4IDZ A;  3QNU A;  5IUX A;  1QLB A;  3AE4 A;  1WCR A;  1XDO A;  3HKC E;  2KWH A;  4YHJ A;  4OYJ A;  3ZMT B;  4EOZ B;  2H3R A;  3TLT A;  1HTJ F;  4ZOL E;  1YQ4 A;  1CHU A;  4KX6 A;  4O4J E;  3RIU A;  3AEC A;  2BG9 B;  2YKS A;  2YIN A;  4WYV A;  4DMV A;  5AQG B;  1T7S A;  5HEH A;  1OED C;  3Q5E A;  2WZI A;  2WMO A;  3N2G E;  4H9O C;  2XZE A;  3W15 B;  5KDM C;  3UFE A;  3U3I A;  4X66 T;  4H9R C;  3RKG A;  2BVL A;  2XY8 B;  5AQL B;  3EAM A;  4LF8 T;  2K48 A;  4X1Y E;  1B7T A;  4PK6 A;  5HWY A;  2JPF A;  5FVL A;  2K5B B;  1S35 A;  3UUX B;  3LBX B;  3ZMV B;  5AQF B;  2Q9Q C;  3FZH B;  2LKH A;  3GA8 A;  4UF0 B;  5AQH B;  2ODU A;  3N9M A;  5AQM B;  3EUH A;  5FY1 A;  4JI5 T;  4Q25 A;  5HWX A;  5LG3 A;  4DMW A;  4P0A A;  4LML A;  1LVK A;  2VVN A;  2W0G A;  3CX7 B;  2WMN A;  2WAU A;  4CZZ B;  3MK7 C;  2XUE A;  4AQF A;  4U31 A;  2JMK A;  2Y8D A;  1D0Y A;  2PJQ A;  4QXB B;  4A97 A;  4JEH B;  4EIW A;  3T1H T;  2KZ7 B;  1T98 A;  3OBV E;  4M1P A;  2UXC T;  1BR0 A;  3UUL A;  2CLY C;  3BQI A;  3KBT A;  2FUP A;  4UV9 B;  5ABG A;  4EGW A;  1I6Z A;  3RI5 A;  4IT4 A;  5HXC A;  1WR6 A;  2BBH A;  3KDS E;  2MAW A;  2EHO D;  3P4S A;  2FJD A;  1WFD A;  4OYK A;  4ZI2 C;  2VKD A;  1CUN A;  2FJA A;  4PJL A;  2CBI A;  3T8O A;  4C90 A;  2DCF A;  2FJB A;  2C5K T;  1KNR A;  2MPK A;  3HI2 A;  3O9X A;  2VKO A;  4TWF A;  2BG9 E;  1YQ3 A;  2HPJ A;  3MZK B;  3N9L A;  5DQW A;  4GK0 E;  4QX8 B;  2XAF B;  3EHZ A;  5AQP B;  3O1I A;  1XZY A;  5LB7 B;  4E7Z A;  3M65 A;  4B3S T;  4H9Q C;  2YU2 A;  2V7K A;  2WDV A;  4H9S E;  1YKH B;  2UU9 T;  4OHF A;  2XJ7 A;  3RKO A;  2V7M A;  3P4Q A;  4KBM B;  4FI5 A;  2UUC T;  1HFA A;  1Y64 B;  4G2A A;  2ES0 A;  4DBR A;  3RQW A;  4GK5 E;  1DU2 A;  2DWK A;  2RP4 A;  5L3F B;  1IJ6 A;  3ZCJ A;  4O8S A;  2LSK A;  1OED E;  2CHN A;  2LJL A;  4KUM B;  1SHZ C;  4HTE A;  5DQV A;  2ZM8 A;  5E0O A;  2NW9 A;  1G8X A;  3RIF A;  3UT5 E;  4A5X A;  4DBQ A;  1VCS A;  2M6B A;  4LF6 T;  4LFA T;  3EAB A;  3ZPO A;  2WY2 A;  3PUX F;  4DND A;  2L8K A;  3OTO T;  5C2T A;  2BS3 A;  1N34 T;  1R8I A;  4PK4 A;  4KP3 C;  1OXZ A;  4IE4 A;  2WB5 A;  4YSZ A;  4ZZB A;  3HR0 A;  2K9A A;  5HAX A;  5JR9 A;  4EB6 E;  5HXH A;  3ANW B;  1HNX T;  2NTX A;  2QGS A;  4TN7 B;  4L9I A;  2NTY A;  4TZ4 C;  3ZT5 A;  4EXT A;  2M6I A;  1FEW A;  4AKG A;  2I0M A;  4ZS2 A;  1WYC A;  4HWF A;  4X62 T;  5LNK A;  4JI1 T;  2CMR A;  4PJJ A;  1VCT A;  2JQH A;  3ZN0 B;  5LHH B;  2BKO A;  2DWG A;  3PDY A;  5C8Y E;  3JCF A;  3C98 B;  4GKK T;  1H7C A;  2VK9 A;  4YTM A;  1OED A;  2V8S V;  3MXZ A;  2MTQ A;  2VL8 A;  2B76 A;  4EED A;  5JDM A;  4YFS A;  2YEV C;  5TAO A;  3ZCI A;  2X9W A;  3PUZ F;  2C0S A;  2XAS B;  2ZMA A;  4I55 E;  3R84 B;  2C5J A;  2WZH A;  3ZSS A;  3ZLI A;  2LRL A;  3N2K E;  1W09 A;  2N9D A;  2XTL A;  3I0Q A;  2ZM2 A;  4HFC A;  3L3P A;  4QKN A;  3TKL B;  4DR3 T;  3T1Y T;  2K3W A;  3Q5X A;  2A2F X;  3B57 A;  2VVS A;  3E08 A;  4PNI A;  5LBM A;  1U5P A;  2WS3 A;  3AE7 A;  4ILC A;  2YU1 A;  3CVR A;  4UIG A;  2HPL A;  1IAP A;  2E8I A;  5LYJ E;  5IHY A;  1WLX A;  3CKD A;  4ILA A;  1FMW A;  4X20 E;  4YHH T;  2LSI A;  1J5W A;  2KMF A;  3JC6 C;  4TWH A;  3RYI E;  5JDQ A;  1IZN B;  4L0R A;  5JDG A;  2ZM6 T;  2VQF T;  1XMQ T;  3LSV A;  3TLU A;  5CFB A;  4CXW A;  4X1I E;  4CN4 A;  2QA7 A;  2WM9 A;  5IYZ E;  3ETU A;  5ABH A;  5JVD E;  2ACZ A;  3CX6 B;  1WYB A;  3H3A A;  3RQU A;  5J0Z A;  1LVF A;  4LF7 T;  3C64 A;  3VRA A;  4A98 A;  1E1H B;  3B13 A;  3C50 A;  4LMJ A;  4QWN B;  4XAX B;  2XAH B;  2KT9 A;  2XQ6 A;  4CI3 B;  3AE2 A;  3CQC B;  3AE3 A;  3KV6 A;  3V5U A;  2I6H A;  4IRE A;  4YSY A;  4HFE A;  5J2T E;  1N33 T;  3CIR A;  3RRW A;  2X9X A;  5FXX A;  1JNZ A;  1ZHC A;  1KNZ A;  1W0B A;  3L39 A;  3RC3 A;  3C51 A;  3RIA A;  3J9X 1;  2PFV A;  3ZC1 A;  2KLQ A;  1D1C A;  4P09 A;  2FBW A;  2GK9 A;  2VB6 A;  4PK5 A;  2L9Q A;  2R6G F;  4E7S A;  2X0Y A;  4U72 A;  5EK2 A;  4ZI2 D;  4HFI A;  4DR1 T;  2YDQ A;  3X1D A;  2D5U A;  4WW0 A;  2DLR A;  5HXR A;  2XQ5 A;  2MBG A;  2XSB A;  3FB2 A;  3Q5D A;  4CXX A;  3RYH E;  1VRB A;  5JR9 C;  3ANW A;  2LOS A;  3C4W A;  2M67 A;  2BVM A;  2Q9Q B;  1MMG A;  2E9X B;  4HFH A;  1US7 B;  1IBM T;  1MIV A;  2CWO A;  2OV9 A;  4U2Y A;  4IHJ E;  1L0V A;  4X1K E;  5KMG P;  2IDO B;  2I59 A;  4DUZ T;  2DL1 A;  2G0U A;  3PUG A;  3HKE E;  4AIS A;  3OJA A;  4AIU A;  3BQK A;  3AB3 B;  3PJA A;  5JDH A;  2LSY A;  2XAG B;  4IE0 A;  2ODV A;  2IW5 B;  3ESL A;  1D0X A;  2ZM0 A;  3RYF E;  1XNR T;  1ZP0 A;  4I0U A;  1QSD A;  4N78 D;  2PTF A;  2XQ8 A;  3TLS A;  3VR9 A;  3ZKR A;  5F3J A;  2VWA A;  3AEG A;  4JI8 T;  2NW8 A;  3IBP A;  2NP9 A;  2WU2 A;  2MYS A;  1SE7 A;  4UVA B;  3UQ4 A;  3Q9D A;  1HCI A;  1HR0 T;  3WI3 A;  4IE7 A;  1MNE A;  3EDU A;  3G06 A;  5H6Q B;  2WQY A;  5F8P A;  5EK3 A;  3PUY F;  2BZB A;  2EHO A;  4IGU A;  4KI0 F;  3AED A;  5LCY A;  3IEE A;  3AE6 A;  3CML A;  3UU5 A;  3VKG A;  5AQJ B;  1KFY A;  5L3D B;  3H3M A;  5L4H A;  3AAA B;  4AKL A;  3OYZ A;  2JMH A;  2BG9 C;  4HFV A;  2DNX A;  4F6R C;  3LFM A;  5KXJ A;  3S4U A;  1OED B;  3UQ7 A;  4HFD A;  1O3X A;  4L5G A;  4UV8 B;  5EZY E;  4TNV A;  2V1D B;  3ONX A;  1KEY A;  5AQR B;  4ZXL A;  3H37 A;  4MBQ A;  4GKJ T;  2XQ4 A;  2JQQ A;  4I4T E;  2XM2 A;  2KIN B;  4HE8 A;  5HEG A;  2V7J A;  4MHC A;  3NWI A;  4EEB A;  4EAH A;  2H7O A;  5L4E A;  3AXJ B;  3SOL A;  3RC8 A;  2HN2 A;  2XQ9 A;  5DJQ C;  4JEU B;  2P9B A;  2IUB A;  4DV6 T;  2LEH A;  3F2E A;  3ETV A;  3ZT7 A;  5AQU B;  1T72 A;  2RA1 A;  3FZF B;  4TWD A;  3IHR A;  2KXP B;  3AE5 A;  3RYC E;  2KND A;  4GOU A;  3I9W A;  4ZI7 E;  4X64 T;  4QH1 A;  2LHN A;  2W67 A;  2V7L A;  5JDF A;  1S94 A;  2LSJ A;  3NRX A;  3AEA A;  4UF0 A;  4ADZ A;  3E0Z A;  1BR1 A;  3UU4 A;  4YJ2 E;  5L3C B;  3C4Z A;  2L3L A;  2W61 A;  3AE9 A;  4DV5 T;  1D0Z A;  3RPU A;  5ETW A;  2BS2 A;  3JAD A;  2YDR A;  3AA6 B;  4ZS3 A;  4DV4 T;  5LBQ B;  2LSG A;  4DID B;  4O2A E;  2Q9Q D;  4YXD A;  3DJB A;  3FZK B;  2CEA A;  1YD8 G;  4NXM T;  2CXL A;  3ZMS B;  4PJN A;  2A3D A;  4B3T T;  3N9O A;  3E22 E;  1KNP A;  5AQN B;  3A5X A;  4HKA A;  2D0T A;  3LBX A;  4TX5 A;  4QHO A;  1N36 T;  4PFP A;  2X9Y A;  5F5W A;  4JI0 T;  4FJO A;  4XBF B;  1XWM A;  4ZHQ E;  5JDL A;  1HG5 A;  2CXF A;  3IA3 A;  1AJ3 A;  3NBX X;  3OVU A;  1MMN A;  2EHO B;  3NVO A;  1FMV A;  2XQA A;  4EYY R;  2IHR 1;  4ASK A;  4DR4 T;  2BG9 A;  4O4I E;  2K24 A;  3CK6 A;  2Y6X A;  3EI0 A;  1JNR A;  1UX5 A;  3NKZ A;  2CHO A;  1V9D A;  4U74 A;  4EYU A;  4AKH A;  3AVR A;  4AI6 A;  3AEF A;  4HN9 A;  4AKR B;  1Y01 A;  3P4W A;  5LHG B;  4GYR A;  5CJ5 A;  5AQQ B;  4A56 A;  4AKI A;  5FP3 A;  4IL9 A;  2A9U A;  5AQS B;  2ZLY A;  2CM0 A;  4H63 H;  1EZ3 A;  4P1N A;  5FVK A;  1HX8 A;  5FL1 A;  2QVA A;  4J2C A;  2VQE T;  3ZYK A;  4B3M T;  1N32 T;  2JQ9 A;  3LK2 B;  3ZJ1 A;  4QH4 A;  4XZC A;  3PTR B;  2NW7 A;  2H88 A;  3PU8 A;  1SUM B;  2LOP A;  4HWC A;  4ILU A;  2PBI A;  4JUY A;  4CI2 B;  5LGN B;  3I1A A;  3L8R A;  1HS7 A;  4YT0 A;  2DHR A;  1FIO A;  2CA5 A;  4PJM A;  3ZMU B;  5FY0 A;  2LLY A;  2WSS V;  3HL6 A;  3PE0 A;  4GYS A;  3KIN B;  4OK0 A;  5HCJ A;  2XQ3 A;  4UEM A;  2JJ9 A;  2C5I T;  1Z0P A;  4PFO A;  2V5D A;  4I50 E;  4U7Y A;  4YTP A;  5HEO A;  5AQK B;  4NIQ A;  3AEE A;  1U4Q A;  5FXV A;  5HEU A;  2WWU A;  4YY3 T;  5JRE A;  2LRK A;  4B3R T;  2HH7 A;  4U33 A;  2J1D G;  4UVB B;  4YSX A;  4UR9 A;  1M7K A;  1X79 A;  4ILB A;  3U78 A;  2X0H A;  3M3Z B;  1ZEE A;  2DI4 A;  1E2A A;  1YXR A;  4H9N C;  5LG4 A;  3WAJ A;  3VRB A;  4CN1 A;  1HX1 B;  2X67 A;  3GN5 A;  2CWY A;  3BQL A;  3K3O A;  3TLV A;  5C3J A;  1UUR A;  1IBK T;  4H9P C;  4BJM A;  1T8B A;  1MND A;  2X51 A;  3RLF F;  5HCM A;  2NWB A;  3ZST A;  4BAY B;  5LJN A;  3PUA A;  3L09 A;  3TLW A;  2QYW A;  2YK0 A;  5A1L A;  4YLH A;  3K8P C;  2CRB A;  4BA9 A;  5JR9 B;  5L3E B;  3KVA A;  2CE7 A;  3FZM B;  3ZT6 A;  5LGU B;  3N9Q A;  5FKY A;  2E9X C;  3FZL B;  2WDR A;  2UUA T;  3MA9 A;  4U3C A;  4Z90 A;  3O4X E;  3OPC A;  3PUS A;  3P7I A;  2PG8 A;  2HN1 A;  4CQI A;  4AXP A;  2CCQ A;  1BR2 A;  4IDN A;  5M4Y A;  1XNQ T;  3QC9 A;  5FXW A;  4O4H E;  3N9P A;  4EV6 A;  3D0T A;  2Z6E A;  3DP7 A;  1MMA A;  3VU7 H;  4C91 A;  1LKX A;  2ACX A;  4JI4 T;  5AFU L;  4QXC B;  2X68 A;  2Q9Q A;  4IDQ A;  5CB4 E;  3I0O A;  2UXX B;  4QXH B;  2UXD T;  1YW0 A;  1IBL T;  4TV8 E;  2WU5 A;  2CLY B;  2XAJ B;  3RGL A;  5BMV E;  4TNW A;  2XQ7 A;  3N2O A;  4OX9 T;  2KWI B;  2BKP A;  1UUS A;  4QX7 B;  3UUN A;  4JI7 T;  4DR7 T;  4K0K T;  4CXY A;  4OFZ A;  1HNZ T;  5ABF A;  4TV9 E;  3UU8 A;  5J2U E;  2W62 A;  2LM9 A;  4X65 T;  2AXD S;  4DVD A;  2LT3 A;  1D1B A;  4JBW F;  3KV5 A;  4U7I A;  3OKQ A;  4HWH A;  4ERR A;  4LFB T;  4H63 V;  4DR6 T;  5LXT E;  4WZX A;  3FBZ A;  3JAF A;  4Z91 A;  3RRC A;  2CXD A;  4LF5 T;  3KV4 A;  3PJA J;  2IAK A;  2IIU A;  2XPK A;  4UVC B;  4ZI3 C;  1IJ5 A;  3K3Q C;  1YKE B;  2V26 A;  4JI6 T;  3B5M A;  4DV2 T;  2XSA A;  5FYM A;  5HXS A;  2W2U A;  5AQO B;  3AA1 B;  3KFW X;  3AAE B;  5GON E;  3N5L A;  4JI3 T;  4LF9 T;  4MFR A;  1HNW T;  2V6X A;  5HXE A;  2H7V C;  5L3B B;  2YN6 A;  3FXD B;  5EK4 A;  1Z8U A;  4BJN A;  5LMN T;  1E7P A;  4KMC A;  5JRC B;  2IC6 A;  5KX5 E;  5L47 A;  2V6Y A;  3LK4 2;  2OLT A;  3MAC A;  3PUQ A;  3QOF A;  2H89 A;  4DO0 A;  3HKB E;  4DUY T;  3PUR A;  2NOX A;  2LHR A;  3AEB A;  3FBL A;  3PUW F;  2CPT A;  2V6Y B;  4CN6 A;  3AXJ A;  1NWM X;  2D2S A;  3MJX A;  4V1A v;  2E9X A;  2UUB T;  3AVS A;  5H6R B;  3SS1 A;  3UUM A;  3UTK A;  3J7Y q;  4AQY T;  2UXN B;  3A8Y C;  3N9N A;  3AAI A;  4ZZC A;  4YJ3 E;  2E5L T;  1G73 A;  3RF1 A;  2W66 A;  4QH5 A;  3I9Y A;  4WBO A;  3JC6 D;  2F4V T;  4EZ4 A;  4LF4 T;  3FXE B;  2BKN A;  4JI2 T;  3PUV F;  3A7M A;  3AA7 B;  4AQF C;  1UCU A;  2VUR A;  3UUB A;  1UX4 A;  3PU3 A;  5LOV E;  5FXZ A;  1SA0 E;  2D9D A;  2VL0 A;  3NZQ A;  1NEK A;  1QUU A;  1FJG T;  4JYA T;  2JIW A;  3CX8 B;  4IIJ E;  3RH3 A;  4PAG A;  3C4X A;  4P0B A;  5JTG A;  1XMO T;  2XQY A;  3LG7 A;  3GN5 B;  3HKD E;  1J5E T;  2N1G A;  5HYA A;  4MAL A;  2WDQ A;  1HF8 A;  2NR4 A;  4DR2 T;  2X66 A;  1XDP A;  2WWV A;  4X5T A;  4DV7 T;  3GWH A;  5CGM A;  3ONJ A;  4YTN A;  3SFD A;  2EHO C;  3K3N A;  5FY7 A;  3V5S A;  2XM1 A;  1HG2 A;  3CPZ A;  3EVY A;  3WAK A;  5BR8 T;  4JV5 T;  2J4G A;  4HEA A;  2FJE A;  1J1J A;  3DTO A;  4I43 B;  1ZV4 X;  2KSR A;  4AQG A;  1I94 T;  4DV0 T;  3P8C D;  3QK6 A;  3K1S A;  4G63 A;  3NRY A;  1KF6 A;  2AE9 A;  4NUU A;  2BDE A;  2WCA A;  4HGA A;  2VKJ A;  3P4P A;  5FNV E;  5JH7 E;  1WR0 A;  2D0U A;  2J47 A;  5CA1 E;  2B1E A;  3ABV A;  3RHW A;  2LM2 A;  2V5C A;  3O1J A;  3R6N A;  1MIY A;  1GQE A;  2X9H A;  1D1A A;  3Q5W A;  2MOZ A;  3F31 A;  3ZC0 A;  2XAQ B;  2N2N A;  4O2B E;  3SWH A;  5AQV B;  3KBU A;  3KVB A;  5J1G A;  1UGO A;  5LA6 E;  3ZYL A;  4ZEY A;  1MIW A;  4ZI3 D;  3P4R A;  2LKG A;  2VKH A;  3P50 A;  3GMI A;  5FL0 A;  1LRZ A;  2YOE A;  3UU6 A;  2W4X A;  4GIW A;  1ZKE A;  4CI1 B;  1M62 A;  3VHL A;  3VKH A;  4JLE A;  2CBJ A;  4EZH A;  1NEN A;  2Y48 B;  3LK3 B;  2LE8 A;  5FMN A;  3ZJ2 A;  4B6X A;  3LDQ B;  4UEL A;  2XHE B;  4ISS A;  2SPC A;  3AA0 B;  4TUY E;  5L2L A;  5ABE A;  3Q2M A;  1W9R A;  5CA0 E;  3BK9 A;  3QB5 A;  4IE6 A;  2E2A A;  2X0L B;  4WNK A;  4ANJ A;  4IE5 A;  4IL4 A;  2BS4 A;  4DV1 T;  2BBJ A;  2WP9 A;  3KV9 A;  3AE8 A;  3EDV A;  2W00 A;  1W0A A;  4IST A;  4O4L E;  3CQG B;  5LJM A;  5ABF B;  5L3G B;  5AQI B;  4KHZ F;  3RIU C;  4LFC T;  4NXN T;  4NPP A;  2JRK A;  1X9B A;  3O1H A;  1KK7 A;  3MKD A;  4IDO A;  3AE1 A;  5LGT B;  2HHH T;  3PV0 F;  3ONL C;  3CWZ B; 
#chains in the Genus database with same CATH homology
 2E9X D;  2IC9 A;  1BR4 A;  5JRC A;  2V7I A;  4PW8 A;  3ZYM A;  4Z8X A;  3RX6 A;  4WBN E;  3F57 A;  3IF8 B;  3LJC A;  4NUV A;  3ZEF B;  2WBL A;  5JQG E;  2W63 A;  3FHN A;  5LP6 E;  1NAF A;  1KNZ A;  1OWA A;  5JDN A;  1MMD A;  2VAS A;  5ADX L;  3HA4 A;  1VOM A;  4UXN B;  5DAB A;  3QUJ A;  3ZMZ B;  2OA5 A;  1WRD A;  3SRZ A;  3ZN1 B;  4K0U A;  5LHI B;  3CQX C;  3OYX A;  3NZP A;  4MLK A;  2A72 A;  4IDZ A;  3ZMT B;  5HXE A;  3HKC E;  2KWH A;  4YHJ A;  4OYJ A;  4EOZ B;  2H3R A;  1HTJ F;  4ZOL E;  4O4J E;  2YIN A;  4DMV A;  3N2G E;  2WMO A;  4H9O C;  3W15 B;  5KDM C;  3UFE A;  3U3I A;  4H9R C;  2BVL A;  2K48 A;  4X1Y E;  1B7T A;  4PK6 A;  5HWY A;  2JPF A;  2K5B B;  1S35 A;  3UUX B;  3LBX B;  3ZMV B;  3WAJ A;  2Q9Q C;  3GA8 A;  4UF0 B;  2ODU A;  3N9M A;  5FY1 A;  3EUH A;  5HWX A;  4DMW A;  4P0A A;  1LVK A;  3CX7 B;  2W0G A;  2WMN A;  2WAU A;  4CZZ B;  3MK7 C;  2XUE A;  4AQF A;  2JMK A;  2Y8D A;  1D0Y A;  2PJQ A;  4QXB B;  4EIW A;  4JEH B;  1BR0 A;  2KZ7 B;  1T98 A;  3OBV E;  4M1P A;  3UUL A;  2CLY C;  3BQI A;  3KBT A;  4UV9 B;  5HXC A;  1WR6 A;  3KDS E;  2EHO D;  4OYK A;  4ZI2 C;  2VKD A;  1CUN A;  4PJL A;  3T8O A;  4C90 A;  2DCF A;  2C5K T;  3HI2 A;  3O9X A;  2VKO A;  2HPJ A;  3MZK B;  3N9L A;  5DQW A;  4GK0 E;  4QX8 B;  2XAF B;  3O1I A;  4E7Z A;  3M65 A;  4H9Q C;  2YU2 A;  2V7K A;  4H9S E;  1YKH B;  4OHF A;  3RKO A;  2V7M A;  4KBM B;  4FI5 A;  1HFA A;  1Y64 B;  4G2A A;  2ES0 A;  4DBR A;  4GK5 E;  2DWK A;  2RP4 A;  5L3F B;  1IJ6 A;  3ZCJ A;  4O8S A;  2LSK A;  2LJL A;  4KUM B;  5DQV A;  1SHZ C;  4HTE A;  2NW9 A;  2ZM8 A;  5E0O A;  3UT5 E;  1G8X A;  4DBQ A;  3ZPO A;  4DND A;  2L8K A;  4PK4 A;  4KP3 C;  1OXZ A;  4IE4 A;  3HR0 A;  2K9A A;  5HAX A;  5JR9 A;  4EB6 E;  5HXH A;  3ANW B;  2NTX A;  2QGS A;  4TN7 B;  4L9I A;  2NTY A;  4TZ4 C;  4EXT A;  1FEW A;  4ZS2 A;  1WYC A;  5LNK A;  2CMR A;  4PJJ A;  3ZN0 B;  5LHH B;  3PDY A;  2DWG A;  5C8Y E;  3C98 B;  1H7C A;  2VK9 A;  3MXZ A;  2MTQ A;  2VL8 A;  5JDM A;  4YFS A;  2YEV C;  5TAO A;  3ZCI A;  2X9W A;  2C0S A;  2XAS B;  2ZMA A;  4I55 E;  3R84 B;  2C5J A;  3ZLI A;  3N2K E;  2N9D A;  2XTL A;  3I0Q A;  2ZM2 A;  3L3P A;  4QKN A;  3TKL B;  3Q5X A;  2A2F X;  3B57 A;  3E08 A;  4PNI A;  5LBM A;  1U5P A;  2YU1 A;  3CVR A;  4UIG A;  2HPL A;  1IAP A;  2E8I A;  5LYJ E;  5IHY A;  1WLX A;  3CKD A;  4X20 E;  1FMW A;  2LSI A;  2KMF A;  3JC6 C;  3RYI E;  5JDQ A;  1IZN B;  4L0R A;  5JDG A;  4CXW A;  4X1I E;  2QA7 A;  2WM9 A;  5IYZ E;  3ETU A;  5JVD E;  3CX6 B;  3H3A A;  1WYB A;  1LVF A;  3C64 A;  1E1H B;  3B13 A;  3C50 A;  4QWN B;  4XAX B;  2XAH B;  2KT9 A;  4CI3 B;  3CQC B;  3KV6 A;  3V5U A;  5J2T E;  3RRW A;  2X9X A;  5FXX A;  1ZHC A;  3RC3 A;  3C51 A;  3J9X 1;  2PFV A;  3ZC1 A;  2KLQ A;  1D1C A;  4P09 A;  2GK9 A;  4PK5 A;  2VB6 A;  2L9Q A;  4E7S A;  5EK2 A;  4U72 A;  4ZI2 D;  2D5U A;  4WW0 A;  2DLR A;  5HXR A;  2MBG A;  4CXX A;  3FB2 A;  3RYH E;  1VRB A;  5JR9 C;  3ANW A;  2LOS A;  3C4W A;  2M67 A;  2BVM A;  2Q9Q B;  1MMG A;  2E9X B;  1US7 B;  1MIV A;  2CWO A;  4IHJ E;  4X1K E;  5KMG P;  2I59 A;  2G0U A;  3PUG A;  3HKE E;  5JRE A;  3OJA A;  3BQK A;  3AB3 B;  5JDH A;  4AKG A;  2LSY A;  2XAG B;  4IE0 A;  2ODV A;  2IW5 B;  3ESL A;  1D0X A;  2ZM0 A;  3RYF E;  4N78 D;  1QSD A;  5F3J A;  2VWA A;  2NW8 A;  3IBP A;  2NP9 A;  4UVA B;  2MYS A;  3Q9D A;  1HCI A;  3WI3 A;  4IE7 A;  1MNE A;  3EDU A;  5H6Q B;  5F8P A;  5EK3 A;  2BZB A;  2EHO A;  4IGU A;  3VKG A;  5LCY A;  3IEE A;  3CML A;  5L3D B;  3AAA B;  4AKL A;  3OYZ A;  2JMH A;  4HFV A;  2DNX A;  4F6R C;  3LFM A;  3S4U A;  4L5G A;  1O3X A;  4UV8 B;  5EZY E;  2V1D B;  3ONX A;  3H37 A;  4MBQ A;  2JQQ A;  4I4T E;  4HE8 A;  2KIN B;  2V7J A;  4MHC A;  4EAH A;  2H7O A;  3SOL A;  3RC8 A;  5DJQ C;  4JEU B;  2P9B A;  2LEH A;  3F2E A;  3ETV A;  2RA1 A;  3IHR A;  2KXP B;  3RYC E;  4ZI7 E;  2KND A;  4GOU A;  3I9W A;  2LHN A;  2V7L A;  5JDF A;  1S94 A;  2LSJ A;  3NRX A;  4UF0 A;  4ADZ A;  3E0Z A;  1BR1 A;  5L3C B;  3C4Z A;  2L3L A;  2W61 A;  1D0Z A;  3RPU A;  5ETW A;  3AA6 B;  4ZS3 A;  5LBQ B;  2LSG A;  4O2A E;  2Q9Q D;  3DJB A;  2CEA A;  1YD8 G;  2CXL A;  3ZMS B;  4PJN A;  2A3D A;  3N9O A;  3E22 E;  3A5X A;  4HKA A;  2D0T A;  3LBX A;  4TX5 A;  4QHO A;  4PFP A;  2X9Y A;  4FJO A;  4XBF B;  4ZHQ E;  5JDL A;  1HG5 A;  2CXF A;  1AJ3 A;  3NBX X;  1MMN A;  2EHO B;  1FMV A;  4EYY R;  4ASK A;  4O4I E;  2K24 A;  2Y6X A;  4EYU A;  4AKH A;  1UX5 A;  4U74 A;  1V9D A;  3AVR A;  4AI6 A;  4HN9 A;  4AKR B;  5LHG B;  4GYR A;  4A56 A;  4AKI A;  5FP3 A;  2ZLY A;  2CM0 A;  4H63 H;  1EZ3 A;  1HX8 A;  4J2C A;  3ZYK A;  3LK2 B;  3ZJ1 A;  4XZC A;  3PTR B;  2NW7 A;  4ILU A;  3PU8 A;  2LOP A;  4JUY A;  4CI2 B;  2PBI A;  5LGN B;  3I1A A;  1HS7 A;  2DHR A;  1FIO A;  2CA5 A;  4PJM A;  3ZMU B;  5FY0 A;  2WSS V;  3HL6 A;  3PE0 A;  4GYS A;  3KIN B;  4OK0 A;  4UEM A;  2JJ9 A;  2C5I T;  1Z0P A;  4PFO A;  4I50 E;  5FXV A;  1U4Q A;  2WWU A;  2HH7 A;  2J1D G;  4UVB B;  3U78 A;  1X79 A;  1ZEE A;  2DI4 A;  4H9N C;  5LG4 A;  2X67 A;  3GN5 A;  2CWY A;  3BQL A;  3K3O A;  4H9P C;  4BJM A;  1MND A;  2X51 A;  5LJN A;  4BAY B;  2NWB A;  3PUA A;  3L09 A;  2YK0 A;  5A1L A;  4YLH A;  3K8P C;  5JR9 B;  4BA9 A;  5L3E B;  3KVA A;  2CE7 A;  5LGU B;  3N9Q A;  2E9X C;  3MA9 A;  3O4X E;  3PUS A;  3P7I A;  2PG8 A;  4CQI A;  4AXP A;  2CCQ A;  1BR2 A;  5M4Y A;  3QC9 A;  5FXW A;  4O4H E;  3N9P A;  3D0T A;  2Z6E A;  3DP7 A;  1MMA A;  3VU7 H;  4C91 A;  1LKX A;  2ACX A;  5AFU L;  4QXC B;  2X68 A;  2Q9Q A;  5CB4 E;  3I0O A;  2UXX B;  4QXH B;  1YW0 A;  4TV8 E;  2XAJ B;  2CLY B;  5BMV E;  3N2O A;  2KWI B;  4QX7 B;  3UUN A;  4CXY A;  4OFZ A;  4TV9 E;  5J2U E;  2W62 A;  2LM9 A;  4DVD A;  2LT3 A;  1D1B A;  3KV5 A;  3OKQ A;  4ERR A;  4H63 V;  3FBZ A;  3RRC A;  2CXD A;  3KV4 A;  2IAK A;  4ZI3 C;  4UVC B;  1IJ5 A;  3K3Q C;  1YKE B;  2V26 A;  5FYM A;  5HXS A;  3AA1 B;  3KFW X;  3AAE B;  5GON E;  3N5L A;  4MFR A;  2H7V C;  5L3B B;  3FXD B;  5EK4 A;  4BJN A;  5JRC B;  4KMC A;  2IC6 A;  5KX5 E;  3LK4 2;  3PUQ A;  3MAC A;  4DO0 A;  3HKB E;  3PUR A;  2NOX A;  2LHR A;  3FBL A;  3MJX A;  1NWM X;  2D2S A;  4V1A v;  2E9X A;  3AVS A;  5H6R B;  3SS1 A;  3UUM A;  3UTK A;  3J7Y q;  2UXN B;  3N9N A;  3AAI A;  4YJ3 E;  1G73 A;  3I9Y A;  4WBO A;  3JC6 D;  4EZ4 A;  3FXE B;  3AA7 B;  4AQF C;  1UCU A;  1UX4 A;  3PU3 A;  5LOV E;  5FXZ A;  1SA0 E;  3NZQ A;  1QUU A;  4IIJ E;  3CX8 B;  3RH3 A;  4PAG A;  3C4X A;  4P0B A;  2XQY A;  3LG7 A;  3GN5 B;  3HKD E;  2N1G A;  5HYA A;  4MAL A;  1HF8 A;  2X66 A;  3GWH A;  5LXT E;  2EHO C;  3K3N A;  5FY7 A;  3V5S A;  3CPZ A;  1HG2 A;  3EVY A;  3WAK A;  4HEA A;  3DTO A;  4I43 B;  1ZV4 X;  4AQG A;  3P8C D;  3QK6 A;  4G63 A;  3NRY A;  4NUU A;  2BDE A;  5JH7 E;  4HGA A;  2VKJ A;  5FNV E;  2D0U A;  5CA1 E;  2B1E A;  3O1J A;  3R6N A;  1MIY A;  2X9H A;  3Q5W A;  1D1A A;  2MOZ A;  3F31 A;  3ZC0 A;  2XAQ B;  2N2N A;  4O2B E;  3SWH A;  3KBU A;  3KVB A;  5J1G A;  5LA6 E;  3ZYL A;  1MIW A;  4ZI3 D;  2VKH A;  4CI1 B;  3GMI A;  1LRZ A;  4GIW A;  1ZKE A;  3VHL A;  3VKH A;  4JLE A;  4EZH A;  2Y48 B;  3LK3 B;  2LE8 A;  5FMN A;  3ZJ2 A;  4B6X A;  4UEL A;  2XHE B;  4ISS A;  2SPC A;  3AA0 B;  4TUY E;  5L2L A;  3Q2M A;  5CA0 E;  3BK9 A;  4IE6 A;  2X0L B;  4WNK A;  4ANJ A;  4IE5 A;  3KV9 A;  4O4L E;  3EDV A;  2W00 A;  4IST A;  5LJM A;  3CQG B;  5L3G B;  2JRK A;  3O1H A;  5LGT B;  1KK7 A;  3MKD A;  4YJ2 E;  3CWZ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...