5AQRB

Fragment-based screening of hsp70 sheds light on the functional role of atp-binding site residues
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
112
structure length
112
Chain Sequence
b'GSNSPQEEVELKKLKHLEKSVEKIADQLEELNKELTGIQQGFLPKDLQAEALCKLDRRVKATIEQFMKILEEIDTLILPENFKDSRLKRKGLVKKVQAFLAECDTVEQNICQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords HEAT SHOCK COGNATE 71 KDA PROTEIN
publication title A fragment-based approach applied to a highly flexible target: Insights and challenges towards the inhibition of HSP70 isoforms.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chaperone
total genus 45
structure length 112
sequence length 112
chains with identical sequence D, F
ec nomenclature
pdb deposition date 2015-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02179 BAG BAG domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.120 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 BAG domain 5aqrB00
5AQSB 5AQIB 1M62A 3LDQB 5AQMB 5AQLB 1T7SA 3FZMB 5AQGB 1UK5A 5AQHB 3FZLB 4HWCA 5AQPB 4HWDA 5AQRB 4HWIB 5AQVB 5AQTB 5AQKB 1I6ZA 1HX1B 5AQNB 3FZHB 3M3ZB 3FZKB 3FZFB 5AQQB 5AQFB 5AQUB 2D9DA 5AQJB 5AQOB 4HWFA 1M7KA 4HWHA 3A8YC 1UGOA
chains in the Genus database with same CATH superfamily
3E22E 3PUYF 2MYSA 3Q5EA 5KMGP 3UFEA 2FJEA 4F8HA 3KVBA 2JMKA 4YTPA 2FJBA 4N78D 2YDQA 3RQWA 4YSZA 3VRBA 5JDFA 2RP4A 4P1NA 4G2AA 1MIWA 3LK2B 1MIYA 2K3WA 2V8SV 5JR9C 3LBXB 4EAHA 4IDOA 4YHHT 3UFGA 3QB5A 3GWHA 1MNDA 3HA4A 3FZHB 4DVDA 4AKGA 4HFCA 3AAEB 4NXNT 3ZMZB 3ZLIA 1LRZA 5ETWA 2YN6A 1YD8G 3AEAA 2LKHA 5HWXA 2A9UA 3ZMUB 2E2AA 3B57A 3C51A 2KSRA 2CLYC 4A97A 2ODVA 3MACA 2BBJA 5LGTB 4YJ3E 1FMWA 5FMNA 3QUJA 2WDQA 2CA5A 2WP9A 3RF1A 2KNDA 3CWZB 3VR8A 2RPAA 2Y6XA 2NR4A 4FI5A 2NWBA 2IAKA 3JCFA 5HXRA 1BR0A 3PJAJ 4IDNA 3HKEE 1N36T 3Q2MA 3RIUC 2AXDS 3AE4A 4DV4T 1T98A 2IC6A 5C8YE 3UQ4A 4TWHA 3ZN1B 4TNVA 3ZPOA 2V6XA 3B13A 3N2OA 3ZJ1A 4B3TT 4KP3C 3C50A 4EXTA 4HFBA 2I59A 4PJLA 3P50A 2XHEB 4Q25A 4MFRA 5AQJB 3TLWA 2L9QA 4GYSA 4BAYB 3DP7A 2X9XA 4MBQA 1U4QA 4QHOA 3AE2A 4B6XA 3TKLB 4O2AE 2XJ7A 4IE6A 4NXMT 4DV0T 3RI5A 4ILAA 2C5JA 3PUQA 3HKCE 1XDPA 3O4XE 2K24A 4KHZF 4COFA 3BK9A 1HNWT 3KV9A 1W09A 5L3EB 3PU3A 2Q9QD 3PUZF 3L3PA 4M1PA 4U72A 4JI4T 1W9RA 4IIJE 3KV4A 3A8YC 3K1SA 3NKZA 1WCRA 3J7Yq 2NW9A 5HEUA 1WR6A 2VURA 3JC6C 4H9QC 2VWAA 2JIWA 1VOMA 1GQEA 1XNRT 5FL0A 2BKNA 3ZC1A 2ZM2A 2UXBT 2ZM0A 5ABEA 1LVFA 3UUBA 4JBWF 2PJQA 4DR1T 1LKXA 4YTMA 4Z90A 4EOZB 4X66T 5JRCA 4MALA 5JR9A 4P0AA 1UCUA 5ABFA 3T1YT 2EHOD 3R6NA 4ASKA 3QB5K 5LHGB 3Q5XA 2MOZA 3AEFA 4E7SA 2V26A 2V7JA 3IF8B 3ZCIA 3LSVA 3LJCA 2WWUA 3L09A 4EB6E 4OFZA 4HWDA 4HFVA 2MPKA 3ANWB 4BJMA 1HF8A 2PTFA 2X9HA 3S4UA 3ETUA 2WWVA 4ZI2C 5F3JA 4GIWA 2XTLA 3ZT5A 5J2TE 4PK5A 2CE7A 2OV9A 3JADA 4HWCA 5JRCB 2F4VT 4ZI2D 3RLFF 2XM2A 2X67A 3PJAA 5JR9B 2K48A 5ABFB 2E5VA 3EVYA 5J2UE 2WZHA 4ZZCA 4QH5A 4LF9T 3AXJA 3RPUA 4LF8T 1KF6A 2LSJA 4QH1A 4AKIA 4ILCA 4DV6T 4E7ZA 2G0UA 2CLYB 4WBOA 3HR0A 3CX8B 4L0RA 1T7SA 1WYCA 3OKQA 2ES0A 4X1YE 3KVAA 3AA7B 1KFYA 5GONE 4PAGA 2XQYA 3NZQA 5ADXL 4I50E 2KLQA 5L47A 4OX9T 2XQ6A 1SUMB 3EHZA 1D1AA 4YFSA 2I6HA 2Q9QA 3BQKA 3AE3A 5AQPB 4U3CA 5LP6E 1HTJF 3ZCJA 3SRZA 3N2GE 4K0UA 3T1HT 5FP3A 3C4ZA 3I0QA 3FZMB 2BS2A 3AVSA 2WB5A 2UXXB 1N33T 2QYWA 1QUUA 2Z6EA 3RIAA 2X9YA 3WI3A 3L39A 3N9PA 5LG4A 2CWOA 1JNZA 4IHJE 4ERRA 3ZN0B 3F57A 1WRDA 5AQHB 5C3JA 4LF6T 4I0UA 3TLSA 1CHUA 1MNEA 2EHOA 2Q9QB 2QA7A 5LHHB 2ACZA 1IBMT 2HN1A 4EGWA 2CHNA 3FBZA 4EYUA 2DHRA 4IL9A 3I0OA 4WZXA 2BBHA 2N9DA 4IDPA 3PDYA 1WFDA 3N2KE 5FXWA 1N34T 4Z8XA 2D2SA 1ZEEA 3N5LA 2XAJB 4CZZB 2WMOA 5AQQB 4IDZA 1X9BA 1HNZT 3UUNA 4YTNA 2NW7A 1H7CA 2VQFT 3CQGB 4HTEA 3UTKA 3K3OA 4H9OC 5HXEA 2YK0A 1WYBA 5AQKB 4JI3T 3AEBA 3AECA 3WAJA 2EHOB 3U78A 2XSBA 5HXCA 3PURA 1T72A 4UF0B 2NTXA 3P4SA 2W4XA 3ABVA 4TV8E 5L3CB 3N9OA 3VHLA 1Z8UA 3LK42 5FY1A 5AQTB 2UUBT 3KFWX 2XM1A 3P4PA 3A7MA 4CXWA 5JQGE 4KUMB 3O1HA 3PUSA 4YXDA 4AQGA 3AE6A 4DR5T 3CKDA 3M65A 2LSKA 2ZMAA 3G06A 1XZYA 2YKSA 2WM9A 4H63H 5LJNA 4ZI3C 4MLKA 4DUZT 4ILBA 3K3QC 3TLTA 2J62A 4ZI3D 2D0UA 1D1CA 1KNPA 5AQVB 2N1GA 3N9QA 3HI2A 1IBLT 5BR8T 4IDQA 2XAFB 3SS1A 1KNRA 3AVRA 2CBIA 3HL6A 3I9YA 1Y64B 3H3MA 2IIUA 2HPLA 4IE4A 4DIDB 3RH3A 1DU2A 3T8OA 1HCIA 4ANJA 3I1AA 2KINB 2ZLYA 3V5SA 1MMDA 2M67A 2YINA 4PJNA 4QH4A 3DJBA 4DUYT 4X20E 4BJNA 2V7LA 2LKGA 1G73A 1CUNA 2KWHA 2CCQA 2CEAA 4DR3T 5FNVE 2V5CA 3UUXB 4GOUA 1UX5A 3AA0B 2ZM8A 3FXEB 5EK2A 1SE7A 4V1Av 4DR4T 3L8RA 3AEEA 2XAHB 1YKEB 2I0MA 2A72A 1XNQT 1SHZC 3EABA 1UURA 2XQ8A 3SFEA 3RC3A 5HCJA 1D0ZA 5JDLA 3AEGA 1VRBA 3U3IA 2VVSA 2CBJA 4LF4T 5JDQA 4P09A 5FKYA 3EI0A 4I55E 4HEAA 3AE9A 3AEDA 2DWKA 2H7OA 3HKDE 3OVUA 4Z91A 2LSGA 4TV9E 2LSIA 2XQ9A 4CN4A 3AB3B 2B76A 1X79A 1AJ3A 4EZ4A 3NBXX 4TX5A 3KBTA 4QXBB 2BG9C 3OPCA 2XY8B 3RRCA 1BR1A 4UR9A 5LBMA 5LG3A 2LT3A 3N9NA 3AAIA 5DABA 4UVCB 1Z0PA 4J2CA 3ZMTB 4H63V 5JDHA 3M3ZB 3OYXA 4O4JE 4UV9B 3ZMVB 4JEUB 3ZYLA 2HPJA 3UU8A 3ZSTA 4JI8T 5IHYA 2H89A 4L5GA 4CN1A 1OEDC 3PV0F 3ETVA 5LMUT 2N2NA 1QSDA 4LMJA 2NW8A 2LLYA 4KI0F 3VRAA 4PK4A 5H6QB 1ZP0A 3O9XA 4H9PC 2V6YB 2LEHA 5M4YA 2HN2A 5AQGB 3ANWA 3ONLC 3H37A 5TAOA 2CPTA 5HYAA 4NUUA 3JC6D 5ABHA 4YSXA 2JQ9A 1HFAA 4PNIA 1XMQT 4GKKT 2KMFA 4QKNA 5JVDE 4PFOA 3ZYKA 5AQRB 2X9WA 4HWIB 5HEHA 4L9IA 4U74A 2LSYA 5L2LA 2L8KA 3R84B 4ZEYA 2FJAA 2UUCT 3OTOT 3ZKRA 1D0YA 4LF5T 4DV3T 2LOSA 3NVOA 4DMWA 4YSYA 4OYKA 1W0BA 5CGMA 3N9MA 5HXSA 3ZT6A 4GK0E 2V7KA 5HCMA 4U33A 1S94A 2VB6A 3LDQB 1V9DA 2BDEA 4AKLA 1UK5A 4QWNB 2X68A 2CRBA 4JI1T 5DJQC 1Y01A 2VK9A 1HS7A 2WQYA 2JMHA 3KDSE 3FZFB 2NP9A 3RIUA 1N32T 5JDNA 4CI2B 4DO0A 2C5IT 4WYVA 5HXHA 1NWMX 4DV2T 5AQNB 2ODUA 2BG9A 3VU7H 4LF7T 3B5MA 2YDSA 3A5XA 4KHPT 5AQSB 1M62A 5J0ZA 4A5XA 3ZYMA 4LMLA 4NUVA 3PUVF 2C0SA 4PJMA 5F8PA 5LGNB 4G63A 4U7IA 2E8IA 2XQ4A 4KX6A 5CB4E 4FJOA 2BG9E 3BQIA 2KXPB 3UULA 4UXNB 4H9SE 5FY7A 2VKDA 3UU4A 4DMVA 2XSAA 3FZLB 3CQCB 2IMLA 2W61A 2BG9B 4X62T 2H3RA 4HWHA 3PUXF 5L3DB 2YOEA 4IT4A 4HKAA 2UU9T 4PJJA 4U2YA 3PUGA 3RGLA 1NAFA 3FHNA 1OEDE 4EV6A 1D1BA 4ISSA 4WW0A 5AQOB 5KXJA 2VASA 4PW8A 4AQYT 4CXYA 4IE7A 4YY3T 2ZM6T 2BZBA 4JI7T 2DWGA 3K8PC 2X0LB 3ZJ2A 4AISA 4UEMA 1OEDB 4NPPA 4P0BA 4UF0A 3O1JA 2J4GA 3ZEFB 5LCYA 5LMNT 5IYZE 3MZKB 2IHR1 4CI3B 3PU8A 2XQ3A 3F31A 3MA9A 4DV1T 1WR0A 2XAGB 3MXZA 1HX1B 3VKHA 3WAKA 2K5BB 4O4LE 1KEYA 4TWFA 2BVMA 3P4RA 5HEOA 3OYZA 2C5KT 3UU6A 4YJ2E 5HAXA 2QGSA 2DCFA 2ACXA 5EZYE 3QK6A 4JI2T 2D0TA 3RIFA 4AKHA 4HFEA 2UXDT 4OHFA 2CXDA 3ONXA 3F2EA 1J5ET 1R8IA 1ZV4X 2XPKA 4UELA 3ZSSA 1E7PA 1LVKA 3QC9A 5HEJA 2X66A 2WZIA 4DBRA 4HFHA 4WNKA 4X1KE 1M7KA 5LHIB 3UUMA 5FXVA 3AA6B 2DI4A 4IREA 3QOFA 5CA0E 3W15B 2CXLA 4XBFB 3P4QA 4EIWA 5FXXA 4HWFA 3FB2A 2A3DA 4GKJT 4YT0A 3CPZA 2JRKA 4GYRA 2BS4A 2H88A 3V5UA 4B3RT 5EK3A 2JQQA 3K3NA 3CIRA 1HG2A 3P4WA 3CQXC 1L0VA 3FXDB 5L3FB 4ZHQE 4ISTA 4ZXLA 4ZI7E 5KX5E 2E9XC 3CVRA 5JTGA 4XAXB 3CK6A 4JV5T 3AAAB 4OK0A 1MMGA 4TNWA 2UXCT 4AIUA 3E0ZA 3H3AA 2E9XD 2Y48B 3MK7C 2YU1A 2W67A 2JQHA 2X51A 2JQKA 3OBVE 4QX7B 1YKHB 3TLUA 4CXXA 3PUAA 4JI0T 4JLEA 5FVLA 4QXHB 1ZHCA 2WBLA 2J47A 2LRLA 3BQLA 2MAWA 2W63A 3IA3A 2HH7A 3AE7A 1E1HB 2XQAA 4JI5T 4CQIA 2RA1A 4O8SA 5JREA 4U31A 4JI6T 4X1IE 4NIQA 1T8BA 3AE1A 2KT9A 4O4HE 3NRYA 3SOLA 1I6ZA 2WDRA 2XUEA 4GK5E 2BKOA 4DV7T 3TLVA 3SFDA 2X0HA 4QX8B 3ZMSB 3J9X1 2W0GA 4WBNE 4IE0A 3IEEA 1J5WA 2UUAT 1SA0E 5LNKA 3GN5A 2M6BA 3PE0A 4HFDA 5L4HA 4ZOLE 5L4EA 4TN7B 3X1DA 1HNXT 2WY2A 3EDUA 1VCTA 1UX4A 2DNXA 3HKBE 3KINB 1HG5A 1MMAA 2YU2A 2W66A 4UV8B 1I94T 3CMLA 5JH7E 1MMNA 2J1DG 2V6YA 3UU3A 1VCSA 2CWYA 4HE8A 5LB7B 2CM0A 3RYCE 1US7B 2XQ5A 4DV5T 3GMIA 2P9BA 1UUSA 3GN5B 4TWDA 2FBWA 2XASB 3UT5E 4IE5A 1IBKT 3D0TA 3RX6A 4EEDA 5DQVA 5C2TA 1YQ4A 4JYAT 4LFAT 2XQ7A 3VR9A 1JNRA 3QNUA 4HGAA 5LYJE 4DNDA 3PUWF 3LG7A 3Q5WA 2B1EA 2V7IA 4KMCA 2AE9A 2OA5A 1B7TA 2DL1A 4OYJA 1KK7A 2L3LA 1FMVA 2Q9QC 2LHRA 1S35A 2NTYA 1NEKA 2DLRA 4C91A 1IZNB 4UIGA 4X64T 4A98A 1FJGT 1G8XA 2VQET 1YW0A 2E9XA 3AA1B 2VL0A 1EZ3A 2BKPA 5HWYA 3MJXA 2SPCA 4IGUA 3RRWA 2LOPA 3UU5A 1XDOA 3LK3B 5F5WA 2WU5A 4A56A 2LM9A 4DBQA 1BR2A 4BA9A 1HX8A 1IAPA 5LJMA 1YQ3A 4H9NC 2EHOC 5AQLB 2CMRA 5JDMA 2LM2A 2IW5B 1WLXA 1ZKEA 4YHJA 5EK4A 5HEGA 2E9XB 4UVBB 3FZKB 2FJDA 1J1JA 4ILUA 4IL4A 4AXPA 2E5LT 3NRXA 2VKJA 4C90A 3EDVA 2K9AA 4LFBT 2YDRA 4ZS2A 3MKDA 4ZZBA 3AE8A 1XWMA 1KNZA 4EYYR 3PTRB 4U2ZA 4AI6A 3N9LA 5AQFB 3IBPA 2X0YA 2V1DB 4B3MT 4AKRB 3RYHE 1IJ5A 3LFMA 2VVNA 5FL1A 2WDVA 2KWIB 4YLHA 5LXTE 2WAUA 3KBUA 2H7VC 2OLTA 1UGOA 2NOXA 4UVAB 2A2FX 3RYFE 3FBLA 3ONJA 2W00A 2W62A 4ZS3A 3CX6B 2QVAA 2D5UA 2LRKA 2WMNA 3P7IA 4LMKA 3JAEA 5AQUB 1IJ6A 2D9DA 4CN6A 1XMOT 4I4TE 4LFCT 4X65T 2VKHA 3ESLA 1OEDA 1NENA 1O3XA 2JJ9A 4O2BE 5BMVE 4DR2T 2UXNB 4EZHA 3DTOA 3RC8A 4I43B 3C98B 1MIVA 5KDMC 3AXJB 3EAMA 4AQFC 3GA8A 4K0KT 5FYMA 4DR7T 2HHHT 4JUYA 5LA6E 2IC9A 4PFPA 3RYIE 2WU2A 3C4WA 5L3GB 4KBMB 1W0AA 3ZT7A 2JPFA 5J1GA 2GK9A 4JEHB 5L3BB 4F6RC 2QRXA 3VKGA 2IUBA 2IDOB 4EEBA 5FY0A 3RQUA 2W2UA 2CHOA 2MTQA 4MHCA 2LHNA 2KZ7B 5A1LA 1HR0T 5LGUB 1U5PA 4QXCB 1ZOYA 3JAFA 3AE5A 5CA1E 2VL8A 3NZPA 2FUPA 3O1IA 5AFUL 3RHWA 4DR6T 1YXRA 5JDGA 2CXFA 1E2AA 1FEWA 5CJ5A 2PFVA 3I9WA 2WS3A 1OXZA 3RKGA 4O4IE 2VKOA 3CX7B 4X5TA 5IUXA 2XZEA 4CI1B 2BVLA 4B3ST 3EUHA 1OWAA 4H9RC 4XZCA 5H6RB 5FXZA 3NWIA 1FIOA 2YEVC 5FVKA 3IHRA 5IWAT 3UQ7A 4HN9A 4TZ4C 5E0OA 4PK6A 5DQWA 2LE8A 2Y8DA 2MBGA 5AQMB 3ZC0A 2BS3A 2M6IA 2XAQB 2PG8A 5LOVE 3C64A 3Q9DA 3C4XA 1D0XA 3OJAA 2V5DA 2LJLA 3KV6A 3LBXA 4U7YA 5AQIB 3Q5DA 3SWHA 5LBQB 3E08A 5CFBA 2WCAA 2PBIA 3KV5A 2WSSV 1BR4A 3P8CD 4ADZA 1QLBA 5ABGA 2R6GF 4AQFA 4TUYE 2V7MA 3RKOA 4HFIA
chains in the Genus database with same CATH topology
5AQSB 5AQIB 1M62A 3LDQB 5AQMB 5AQLB 1T7SA 3FZMB 5AQGB 1UK5A 5AQHB 3FZLB 4HWCA 5AQPB 4HWDA 5AQRB 4HWIB 5AQVB 5AQTB 5AQKB 1I6ZA 1HX1B 5AQNB 3FZHB 3M3ZB 3FZKB 3FZFB 5AQQB 5AQFB 5AQUB 2D9DA 5AQJB 5AQOB 4HWFA 1M7KA 4HWHA 3A8YC 1UGOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AQS B;  5AQI B;  1M62 A;  3LDQ B;  5AQM B;  5AQL B;  1T7S A;  3FZM B;  5AQG B;  1UK5 A;  5AQH B;  3FZL B;  4HWC A;  5AQP B;  4HWD A;  5AQR B;  4HWI B;  5AQV B;  5AQT B;  5AQK B;  1I6Z A;  1HX1 B;  5AQN B;  3FZH B;  3M3Z B;  3FZK B;  3FZF B;  5AQQ B;  5AQF B;  5AQU B;  2D9D A;  5AQJ B;  5AQO B;  4HWF A;  1M7K A;  4HWH A;  3A8Y C;  1UGO A; 
#chains in the Genus database with same CATH topology
 3E22 E;  3PUY F;  2MYS A;  3Q5E A;  5KMG P;  3UFE A;  2FJE A;  4F8H A;  3KVB A;  2JMK A;  4YTP A;  2FJB A;  4N78 D;  2YDQ A;  3RQW A;  4YSZ A;  3VRB A;  5JDF A;  2RP4 A;  4P1N A;  4G2A A;  1MIW A;  3LK2 B;  1MIY A;  2K3W A;  2V8S V;  5JR9 C;  3LBX B;  4EAH A;  4IDO A;  4YHH T;  3UFG A;  3QB5 A;  3GWH A;  1MND A;  3HA4 A;  3FZH B;  4DVD A;  4AKG A;  4HFC A;  3AAE B;  4NXN T;  3ZMZ B;  3ZLI A;  1LRZ A;  5ETW A;  2YN6 A;  1YD8 G;  3AEA A;  2LKH A;  5HWX A;  2A9U A;  3ZMU B;  2E2A A;  3B57 A;  3C51 A;  2KSR A;  2CLY C;  4A97 A;  2ODV A;  3MAC A;  2BBJ A;  5LGT B;  4YJ3 E;  1FMW A;  5FMN A;  3QUJ A;  2WDQ A;  2CA5 A;  2WP9 A;  3RF1 A;  2KND A;  3CWZ B;  3VR8 A;  2RPA A;  2Y6X A;  2NR4 A;  4FI5 A;  2NWB A;  2IAK A;  3JCF A;  5HXR A;  1BR0 A;  3PJA J;  4IDN A;  3HKE E;  1N36 T;  3Q2M A;  3RIU C;  2AXD S;  3AE4 A;  4DV4 T;  1T98 A;  2IC6 A;  5C8Y E;  3UQ4 A;  4TWH A;  3ZN1 B;  4TNV A;  3ZPO A;  2V6X A;  3B13 A;  3N2O A;  3ZJ1 A;  4B3T T;  4KP3 C;  3C50 A;  4EXT A;  4HFB A;  2I59 A;  4PJL A;  3P50 A;  2XHE B;  4Q25 A;  4MFR A;  5AQJ B;  3TLW A;  2L9Q A;  4GYS A;  4BAY B;  3DP7 A;  2X9X A;  4MBQ A;  1U4Q A;  4QHO A;  3AE2 A;  4B6X A;  3TKL B;  4O2A E;  2XJ7 A;  4IE6 A;  4NXM T;  4DV0 T;  3RI5 A;  4ILA A;  2C5J A;  3PUQ A;  3HKC E;  1XDP A;  3O4X E;  2K24 A;  4KHZ F;  4COF A;  3BK9 A;  1HNW T;  3KV9 A;  1W09 A;  5L3E B;  3PU3 A;  2Q9Q D;  3PUZ F;  3L3P A;  4M1P A;  4U72 A;  4JI4 T;  1W9R A;  4IIJ E;  3KV4 A;  3A8Y C;  3K1S A;  3NKZ A;  1WCR A;  3J7Y q;  2NW9 A;  5HEU A;  1WR6 A;  2VUR A;  3JC6 C;  4H9Q C;  2VWA A;  2JIW A;  1VOM A;  1GQE A;  1XNR T;  5FL0 A;  2BKN A;  3ZC1 A;  2ZM2 A;  2UXB T;  2ZM0 A;  5ABE A;  1LVF A;  3UUB A;  4JBW F;  2PJQ A;  4DR1 T;  1LKX A;  4YTM A;  4Z90 A;  4EOZ B;  4X66 T;  5JRC A;  4MAL A;  5JR9 A;  4P0A A;  1UCU A;  5ABF A;  3T1Y T;  2EHO D;  3R6N A;  4ASK A;  3QB5 K;  5LHG B;  3Q5X A;  2MOZ A;  3AEF A;  4E7S A;  2V26 A;  2V7J A;  3IF8 B;  3ZCI A;  3LSV A;  3LJC A;  2WWU A;  3L09 A;  4EB6 E;  4OFZ A;  4HWD A;  4HFV A;  2MPK A;  3ANW B;  4BJM A;  1HF8 A;  2PTF A;  2X9H A;  3S4U A;  3ETU A;  2WWV A;  4ZI2 C;  5F3J A;  4GIW A;  2XTL A;  3ZT5 A;  5J2T E;  4PK5 A;  2CE7 A;  2OV9 A;  3JAD A;  4HWC A;  5JRC B;  2F4V T;  4ZI2 D;  3RLF F;  2XM2 A;  2X67 A;  3PJA A;  5JR9 B;  2K48 A;  5ABF B;  2E5V A;  3EVY A;  5J2U E;  2WZH A;  4ZZC A;  4QH5 A;  4LF9 T;  3AXJ A;  3RPU A;  4LF8 T;  1KF6 A;  2LSJ A;  4QH1 A;  4AKI A;  4ILC A;  4DV6 T;  4E7Z A;  2G0U A;  2CLY B;  4WBO A;  3HR0 A;  3CX8 B;  4L0R A;  1T7S A;  1WYC A;  3OKQ A;  2ES0 A;  4X1Y E;  3KVA A;  3AA7 B;  1KFY A;  5GON E;  4PAG A;  2XQY A;  3NZQ A;  5ADX L;  4I50 E;  2KLQ A;  5L47 A;  4OX9 T;  2XQ6 A;  1SUM B;  3EHZ A;  1D1A A;  4YFS A;  2I6H A;  2Q9Q A;  3BQK A;  3AE3 A;  5AQP B;  4U3C A;  5LP6 E;  1HTJ F;  3ZCJ A;  3SRZ A;  3N2G E;  4K0U A;  3T1H T;  5FP3 A;  3C4Z A;  3I0Q A;  3FZM B;  2BS2 A;  3AVS A;  2WB5 A;  2UXX B;  1N33 T;  2QYW A;  1QUU A;  2Z6E A;  3RIA A;  2X9Y A;  3WI3 A;  3L39 A;  3N9P A;  5LG4 A;  2CWO A;  1JNZ A;  4IHJ E;  4ERR A;  3ZN0 B;  3F57 A;  1WRD A;  5AQH B;  5C3J A;  4LF6 T;  4I0U A;  3TLS A;  1CHU A;  1MNE A;  2EHO A;  2Q9Q B;  2QA7 A;  5LHH B;  2ACZ A;  1IBM T;  2HN1 A;  4EGW A;  2CHN A;  3FBZ A;  4EYU A;  2DHR A;  4IL9 A;  3I0O A;  4WZX A;  2BBH A;  2N9D A;  4IDP A;  3PDY A;  1WFD A;  3N2K E;  5FXW A;  1N34 T;  4Z8X A;  2D2S A;  1ZEE A;  3N5L A;  2XAJ B;  4CZZ B;  2WMO A;  5AQQ B;  4IDZ A;  1X9B A;  1HNZ T;  3UUN A;  4YTN A;  2NW7 A;  1H7C A;  2VQF T;  3CQG B;  4HTE A;  3UTK A;  3K3O A;  4H9O C;  5HXE A;  2YK0 A;  1WYB A;  5AQK B;  4JI3 T;  3AEB A;  3AEC A;  3WAJ A;  2EHO B;  3U78 A;  2XSB A;  5HXC A;  3PUR A;  1T72 A;  4UF0 B;  2NTX A;  3P4S A;  2W4X A;  3ABV A;  4TV8 E;  5L3C B;  3N9O A;  3VHL A;  1Z8U A;  3LK4 2;  5FY1 A;  5AQT B;  2UUB T;  3KFW X;  2XM1 A;  3P4P A;  3A7M A;  4CXW A;  5JQG E;  4KUM B;  3O1H A;  3PUS A;  4YXD A;  4AQG A;  3AE6 A;  4DR5 T;  3CKD A;  3M65 A;  2LSK A;  2ZMA A;  3G06 A;  1XZY A;  2YKS A;  2WM9 A;  4H63 H;  5LJN A;  4ZI3 C;  4MLK A;  4DUZ T;  4ILB A;  3K3Q C;  3TLT A;  2J62 A;  4ZI3 D;  2D0U A;  1D1C A;  1KNP A;  5AQV B;  2N1G A;  3N9Q A;  3HI2 A;  1IBL T;  5BR8 T;  4IDQ A;  2XAF B;  3SS1 A;  1KNR A;  3AVR A;  2CBI A;  3HL6 A;  3I9Y A;  1Y64 B;  3H3M A;  2IIU A;  2HPL A;  4IE4 A;  4DID B;  3RH3 A;  1DU2 A;  3T8O A;  1HCI A;  4ANJ A;  3I1A A;  2KIN B;  2ZLY A;  3V5S A;  1MMD A;  2M67 A;  2YIN A;  4PJN A;  4QH4 A;  3DJB A;  4DUY T;  4X20 E;  4BJN A;  2V7L A;  2LKG A;  1G73 A;  1CUN A;  2KWH A;  2CCQ A;  2CEA A;  4DR3 T;  5FNV E;  2V5C A;  3UUX B;  4GOU A;  1UX5 A;  3AA0 B;  2ZM8 A;  3FXE B;  5EK2 A;  1SE7 A;  4V1A v;  4DR4 T;  3L8R A;  3AEE A;  2XAH B;  1YKE B;  2I0M A;  2A72 A;  1XNQ T;  1SHZ C;  3EAB A;  1UUR A;  2XQ8 A;  3SFE A;  3RC3 A;  5HCJ A;  1D0Z A;  5JDL A;  3AEG A;  1VRB A;  3U3I A;  2VVS A;  2CBJ A;  4LF4 T;  5JDQ A;  4P09 A;  5FKY A;  3EI0 A;  4I55 E;  4HEA A;  3AE9 A;  3AED A;  2DWK A;  2H7O A;  3HKD E;  3OVU A;  4Z91 A;  2LSG A;  4TV9 E;  2LSI A;  2XQ9 A;  4CN4 A;  3AB3 B;  2B76 A;  1X79 A;  1AJ3 A;  4EZ4 A;  3NBX X;  4TX5 A;  3KBT A;  4QXB B;  2BG9 C;  3OPC A;  2XY8 B;  3RRC A;  1BR1 A;  4UR9 A;  5LBM A;  5LG3 A;  2LT3 A;  3N9N A;  3AAI A;  5DAB A;  4UVC B;  1Z0P A;  4J2C A;  3ZMT B;  4H63 V;  5JDH A;  3M3Z B;  3OYX A;  4O4J E;  4UV9 B;  3ZMV B;  4JEU B;  3ZYL A;  2HPJ A;  3UU8 A;  3ZST A;  4JI8 T;  5IHY A;  2H89 A;  4L5G A;  4CN1 A;  1OED C;  3PV0 F;  3ETV A;  5LMU T;  2N2N A;  1QSD A;  4LMJ A;  2NW8 A;  2LLY A;  4KI0 F;  3VRA A;  4PK4 A;  5H6Q B;  1ZP0 A;  3O9X A;  4H9P C;  2V6Y B;  2LEH A;  5M4Y A;  2HN2 A;  5AQG B;  3ANW A;  3ONL C;  3H37 A;  5TAO A;  2CPT A;  5HYA A;  4NUU A;  3JC6 D;  5ABH A;  4YSX A;  2JQ9 A;  1HFA A;  4PNI A;  1XMQ T;  4GKK T;  2KMF A;  4QKN A;  5JVD E;  4PFO A;  3ZYK A;  5AQR B;  2X9W A;  4HWI B;  5HEH A;  4L9I A;  4U74 A;  2LSY A;  5L2L A;  2L8K A;  3R84 B;  4ZEY A;  2FJA A;  2UUC T;  3OTO T;  3ZKR A;  1D0Y A;  4LF5 T;  4DV3 T;  2LOS A;  3NVO A;  4DMW A;  4YSY A;  4OYK A;  1W0B A;  5CGM A;  3N9M A;  5HXS A;  3ZT6 A;  4GK0 E;  2V7K A;  5HCM A;  4U33 A;  1S94 A;  2VB6 A;  3LDQ B;  1V9D A;  2BDE A;  4AKL A;  1UK5 A;  4QWN B;  2X68 A;  2CRB A;  4JI1 T;  5DJQ C;  1Y01 A;  2VK9 A;  1HS7 A;  2WQY A;  2JMH A;  3KDS E;  3FZF B;  2NP9 A;  3RIU A;  1N32 T;  5JDN A;  4CI2 B;  4DO0 A;  2C5I T;  4WYV A;  5HXH A;  1NWM X;  4DV2 T;  5AQN B;  2ODU A;  2BG9 A;  3VU7 H;  4LF7 T;  3B5M A;  2YDS A;  3A5X A;  4KHP T;  5AQS B;  1M62 A;  5J0Z A;  4A5X A;  3ZYM A;  4LML A;  4NUV A;  3PUV F;  2C0S A;  4PJM A;  5F8P A;  5LGN B;  4G63 A;  4U7I A;  2E8I A;  2XQ4 A;  4KX6 A;  5CB4 E;  4FJO A;  2BG9 E;  3BQI A;  2KXP B;  3UUL A;  4UXN B;  4H9S E;  5FY7 A;  2VKD A;  3UU4 A;  4DMV A;  2XSA A;  3FZL B;  3CQC B;  2IML A;  2W61 A;  2BG9 B;  4X62 T;  2H3R A;  4HWH A;  3PUX F;  5L3D B;  2YOE A;  4IT4 A;  4HKA A;  2UU9 T;  4PJJ A;  4U2Y A;  3PUG A;  3RGL A;  1NAF A;  3FHN A;  1OED E;  4EV6 A;  1D1B A;  4ISS A;  4WW0 A;  5AQO B;  5KXJ A;  2VAS A;  4PW8 A;  4AQY T;  4CXY A;  4IE7 A;  4YY3 T;  2ZM6 T;  2BZB A;  4JI7 T;  2DWG A;  3K8P C;  2X0L B;  3ZJ2 A;  4AIS A;  4UEM A;  1OED B;  4NPP A;  4P0B A;  4UF0 A;  3O1J A;  2J4G A;  3ZEF B;  5LCY A;  5LMN T;  5IYZ E;  3MZK B;  2IHR 1;  4CI3 B;  3PU8 A;  2XQ3 A;  3F31 A;  3MA9 A;  4DV1 T;  1WR0 A;  2XAG B;  3MXZ A;  1HX1 B;  3VKH A;  3WAK A;  2K5B B;  4O4L E;  1KEY A;  4TWF A;  2BVM A;  3P4R A;  5HEO A;  3OYZ A;  2C5K T;  3UU6 A;  4YJ2 E;  5HAX A;  2QGS A;  2DCF A;  2ACX A;  5EZY E;  3QK6 A;  4JI2 T;  2D0T A;  3RIF A;  4AKH A;  4HFE A;  2UXD T;  4OHF A;  2CXD A;  3ONX A;  3F2E A;  1J5E T;  1R8I A;  1ZV4 X;  2XPK A;  4UEL A;  3ZSS A;  1E7P A;  1LVK A;  3QC9 A;  5HEJ A;  2X66 A;  2WZI A;  4DBR A;  4HFH A;  4WNK A;  4X1K E;  1M7K A;  5LHI B;  3UUM A;  5FXV A;  3AA6 B;  2DI4 A;  4IRE A;  3QOF A;  5CA0 E;  3W15 B;  2CXL A;  4XBF B;  3P4Q A;  4EIW A;  5FXX A;  4HWF A;  3FB2 A;  2A3D A;  4GKJ T;  4YT0 A;  3CPZ A;  2JRK A;  4GYR A;  2BS4 A;  2H88 A;  3V5U A;  4B3R T;  5EK3 A;  2JQQ A;  3K3N A;  3CIR A;  1HG2 A;  3P4W A;  3CQX C;  1L0V A;  3FXD B;  5L3F B;  4ZHQ E;  4IST A;  4ZXL A;  4ZI7 E;  5KX5 E;  2E9X C;  3CVR A;  5JTG A;  4XAX B;  3CK6 A;  4JV5 T;  3AAA B;  4OK0 A;  1MMG A;  4TNW A;  2UXC T;  4AIU A;  3E0Z A;  3H3A A;  2E9X D;  2Y48 B;  3MK7 C;  2YU1 A;  2W67 A;  2JQH A;  2X51 A;  2JQK A;  3OBV E;  4QX7 B;  1YKH B;  3TLU A;  4CXX A;  3PUA A;  4JI0 T;  4JLE A;  5FVL A;  4QXH B;  1ZHC A;  2WBL A;  2J47 A;  2LRL A;  3BQL A;  2MAW A;  2W63 A;  3IA3 A;  2HH7 A;  3AE7 A;  1E1H B;  2XQA A;  4JI5 T;  4CQI A;  2RA1 A;  4O8S A;  5JRE A;  4U31 A;  4JI6 T;  4X1I E;  4NIQ A;  1T8B A;  3AE1 A;  2KT9 A;  4O4H E;  3NRY A;  3SOL A;  1I6Z A;  2WDR A;  2XUE A;  4GK5 E;  2BKO A;  4DV7 T;  3TLV A;  3SFD A;  2X0H A;  4QX8 B;  3ZMS B;  3J9X 1;  2W0G A;  4WBN E;  4IE0 A;  3IEE A;  1J5W A;  2UUA T;  1SA0 E;  5LNK A;  3GN5 A;  2M6B A;  3PE0 A;  4HFD A;  5L4H A;  4ZOL E;  5L4E A;  4TN7 B;  3X1D A;  1HNX T;  2WY2 A;  3EDU A;  1VCT A;  1UX4 A;  2DNX A;  3HKB E;  3KIN B;  1HG5 A;  1MMA A;  2YU2 A;  2W66 A;  4UV8 B;  1I94 T;  3CML A;  5JH7 E;  1MMN A;  2J1D G;  2V6Y A;  3UU3 A;  1VCS A;  2CWY A;  4HE8 A;  5LB7 B;  2CM0 A;  3RYC E;  1US7 B;  2XQ5 A;  4DV5 T;  3GMI A;  2P9B A;  1UUS A;  3GN5 B;  4TWD A;  2FBW A;  2XAS B;  3UT5 E;  4IE5 A;  1IBK T;  3D0T A;  3RX6 A;  4EED A;  5DQV A;  5C2T A;  1YQ4 A;  4JYA T;  4LFA T;  2XQ7 A;  3VR9 A;  1JNR A;  3QNU A;  4HGA A;  5LYJ E;  4DND A;  3PUW F;  3LG7 A;  3Q5W A;  2B1E A;  2V7I A;  4KMC A;  2AE9 A;  2OA5 A;  1B7T A;  2DL1 A;  4OYJ A;  1KK7 A;  2L3L A;  1FMV A;  2Q9Q C;  2LHR A;  1S35 A;  2NTY A;  1NEK A;  2DLR A;  4C91 A;  1IZN B;  4UIG A;  4X64 T;  4A98 A;  1FJG T;  1G8X A;  2VQE T;  1YW0 A;  2E9X A;  3AA1 B;  2VL0 A;  1EZ3 A;  2BKP A;  5HWY A;  3MJX A;  2SPC A;  4IGU A;  3RRW A;  2LOP A;  3UU5 A;  1XDO A;  3LK3 B;  5F5W A;  2WU5 A;  4A56 A;  2LM9 A;  4DBQ A;  1BR2 A;  4BA9 A;  1HX8 A;  1IAP A;  5LJM A;  1YQ3 A;  4H9N C;  2EHO C;  5AQL B;  2CMR A;  5JDM A;  2LM2 A;  2IW5 B;  1WLX A;  1ZKE A;  4YHJ A;  5EK4 A;  5HEG A;  2E9X B;  4UVB B;  3FZK B;  2FJD A;  1J1J A;  4ILU A;  4IL4 A;  4AXP A;  2E5L T;  3NRX A;  2VKJ A;  4C90 A;  3EDV A;  2K9A A;  4LFB T;  2YDR A;  4ZS2 A;  3MKD A;  4ZZB A;  3AE8 A;  1XWM A;  1KNZ A;  4EYY R;  3PTR B;  4U2Z A;  4AI6 A;  3N9L A;  5AQF B;  3IBP A;  2X0Y A;  2V1D B;  4B3M T;  4AKR B;  3RYH E;  1IJ5 A;  3LFM A;  2VVN A;  5FL1 A;  2WDV A;  2KWI B;  4YLH A;  5LXT E;  2WAU A;  3KBU A;  2H7V C;  2OLT A;  1UGO A;  2NOX A;  4UVA B;  2A2F X;  3RYF E;  3FBL A;  3ONJ A;  2W00 A;  2W62 A;  4ZS3 A;  3CX6 B;  2QVA A;  2D5U A;  2LRK A;  2WMN A;  3P7I A;  4LMK A;  3JAE A;  5AQU B;  1IJ6 A;  2D9D A;  4CN6 A;  1XMO T;  4I4T E;  4LFC T;  4X65 T;  2VKH A;  3ESL A;  1OED A;  1NEN A;  1O3X A;  2JJ9 A;  4O2B E;  5BMV E;  4DR2 T;  2UXN B;  4EZH A;  3DTO A;  3RC8 A;  4I43 B;  3C98 B;  1MIV A;  5KDM C;  3AXJ B;  3EAM A;  4AQF C;  3GA8 A;  4K0K T;  5FYM A;  4DR7 T;  2HHH T;  4JUY A;  5LA6 E;  2IC9 A;  4PFP A;  3RYI E;  2WU2 A;  3C4W A;  5L3G B;  4KBM B;  1W0A A;  3ZT7 A;  2JPF A;  5J1G A;  2GK9 A;  4JEH B;  5L3B B;  4F6R C;  2QRX A;  3VKG A;  2IUB A;  2IDO B;  4EEB A;  5FY0 A;  3RQU A;  2W2U A;  2CHO A;  2MTQ A;  4MHC A;  2LHN A;  2KZ7 B;  5A1L A;  1HR0 T;  5LGU B;  1U5P A;  4QXC B;  1ZOY A;  3JAF A;  3AE5 A;  5CA1 E;  2VL8 A;  3NZP A;  2FUP A;  3O1I A;  5AFU L;  3RHW A;  4DR6 T;  1YXR A;  5JDG A;  2CXF A;  1E2A A;  1FEW A;  5CJ5 A;  2PFV A;  3I9W A;  2WS3 A;  1OXZ A;  3RKG A;  4O4I E;  2VKO A;  3CX7 B;  4X5T A;  5IUX A;  2XZE A;  4CI1 B;  2BVL A;  4B3S T;  3EUH A;  1OWA A;  4H9R C;  4XZC A;  5H6R B;  5FXZ A;  3NWI A;  1FIO A;  2YEV C;  5FVK A;  3IHR A;  5IWA T;  3UQ7 A;  4HN9 A;  4TZ4 C;  5E0O A;  4PK6 A;  5DQW A;  2LE8 A;  2Y8D A;  2MBG A;  5AQM B;  3ZC0 A;  2BS3 A;  2M6I A;  2XAQ B;  2PG8 A;  5LOV E;  3C64 A;  3Q9D A;  3C4X A;  1D0X A;  3OJA A;  2V5D A;  2LJL A;  3KV6 A;  3LBX A;  4U7Y A;  5AQI B;  3Q5D A;  3SWH A;  5LBQ B;  3E08 A;  5CFB A;  2WCA A;  2PBI A;  3KV5 A;  2WSS V;  1BR4 A;  3P8C D;  4ADZ A;  1QLB A;  5ABG A;  2R6G F;  4AQF A;  4TUY E;  2V7M A;  3RKO A;  4HFI A; 
#chains in the Genus database with same CATH homology
 5AQS B;  5AQI B;  1M62 A;  3LDQ B;  5AQM B;  5AQL B;  1T7S A;  3FZM B;  5AQG B;  1UK5 A;  5AQH B;  3FZL B;  4HWC A;  5AQP B;  4HWD A;  5AQR B;  4HWI B;  5AQV B;  5AQT B;  5AQK B;  1I6Z A;  1HX1 B;  5AQN B;  3FZH B;  3M3Z B;  3FZK B;  3FZF B;  5AQQ B;  5AQF B;  5AQU B;  2D9D A;  5AQJ B;  5AQO B;  4HWF A;  1M7K A;  4HWH A;  3A8Y C;  1UGO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...