5AQRB

Fragment-based screening of hsp70 sheds light on the functional role of atp-binding site residues
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
112
structure length
112
Chain Sequence
GSNSPQEEVELKKLKHLEKSVEKIADQLEELNKELTGIQQGFLPKDLQAEALCKLDRRVKATIEQFMKILEEIDTLILPENFKDSRLKRKGLVKKVQAFLAECDTVEQNICQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A fragment-based approach applied to a highly flexible target: Insights and challenges towards the inhibition of HSP70 isoforms.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chaperone
molecule keywords HEAT SHOCK COGNATE 71 KDA PROTEIN
total genus 45
structure length 112
sequence length 112
chains with identical sequence D, F
ec nomenclature
pdb deposition date 2015-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02179 BAG BAG domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.120 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 BAG domain 5aqrB00
5AQOB 5AQUB 1T7SA 3LDQB 5AQSB 4HWFA 5AQFB 3FZKB 1UGOA 5AQNB 5AQKB 5AQLB 1UK5A 5AQJB 4HWIB 5AQVB 5AQRB 5AQQB 3M3ZB 5AQPB 3FZHB 3FZFB 1HX1B 4HWCA 5AQIB 5AQGB 4HWDA 1M7KA 3FZMB 1M62A 1I6ZA 3A8YC 4HWHA 5AQHB 2D9DA 5AQMB 3FZLB 5AQTB
chains in the Genus database with same CATH superfamily
4GK5E 1W0AA 3I0QA 3PU3A 2LLYA 4LF9T 3JAFA 4P09A 4O2AE 4OK0A 3WAJA 2LHRA 4U2ZA 4HFVA 4UVAB 3BK9A 3RIUA 3ZSSA 2UXDT 1HS7A 2I0MA 4IHJE 1UGOA 2JRKA 4JEUB 4Z90A 3K8PC 3QNUA 3CK6A 1S35A 2CXFA 3N9OA 4HN9A 4Z91A 3RPUA 5C8YE 3UQ7A 4P0BA 1XWMA 4DV6T 3R84B 1FMVA 2EHOB 4HFHA 4I50E 4ADZA 3O1HA 5DQVA 3GN5B 4U7YA 3P50A 3VHLA 5J2TE 2Q9QC 2VQFT 2IC6A 1HCIA 3I9YA 2DL1A 2ZLYA 3O4XE 4X1KE 4HFEA 1US7B 4ZI3D 3LJCA 2CBJA 3MKDA 3ZC0A 2B1EA 2WSSV 3A7MA 4ZOLE 5LB7B 4AISA 3RKOA 4ERRA 5HXSA 2UXNB 4YSXA 4OX9T 2JJ9A 2OLTA 3O1JA 4OHFA 3FXDB 2WS3A 5AQMB 3UUBA 5JDLA 1D0ZA 3P8CD 4PJJA 3CQCB 4GIWA 4IT4A 4U7IA 2D5UA 4LF8T 3C98B 2YU2A 1YKHB 2ZM8A 2Y48B 2FJBA 2WCAA 3C51A 3HI2A 4PNIA 3N5LA 2C5IT 3K3NA 3QOFA 4B3MT 2WWVA 3ZC1A 4EIWA 2CWOA 5M4YA 5JVDE 5DJQC 5LMUT 4DV4T 4UELA 4X1YE 2WMOA 2MAWA 5LP6E 2UU9T 4TN7B 2N9DA 3PUYF 2F4VT 2NTYA 3JCFA 2XQAA 5LNKA 2X9WA 5FKYA 4YSZA 3AB3B 5LHIB 2VQET 1FEWA 3AA6B 3S4UA 5AQGB 1Z0PA 1I94T 2G0UA 2WB5A 2XM1A 2NWBA 2Y8DA 3F57A 4IL4A 3PUZF 3UULA 2XM2A 4JI1T 1N32T 2QVAA 3SFEA 1WCRA 2WY2A 2XSBA 3AAAB 4EEDA 3RYIE 4X62T 2E5VA 2XQ9A 2FBWA 2NW7A 2YN6A 5C2TA 5CJ5A 1WFDA 3C50A 1U5PA 1KFYA 2LRKA 2XSAA 2OA5A 3PJAA 3C4ZA 3RQWA 4JYAT 2M6BA 5JDNA 3V5UA 2JQ9A 2V7IA 3P4SA 1T7SA 2VKHA 3QUJA 2IHR1 2WM9A 4XBFB 1O3XA 2DI4A 1N33T 4TNVA 2XAFB 3RYHE 2WZHA 4YY3T 2KSRA 3UU6A 1UK5A 2I59A 5LGUB 3O9XA 1S94A 2IDOB 3HKEE 3V5SA 4TWHA 3N9NA 3R6NA 4XAXB 5A1LA 4KP3C 2H7OA 4O2BE 5FY0A 3RH3A 4OYJA 2LM2A 2V7JA 4A5XA 3AXJA 3HL6A 4AKLA 4DV1T 4AKGA 4ZZCA 2L9QA 1HG5A 3FXEB 3PUQA 2MTQA 4NXMT 2X66A 3QB5K 1E7PA 4H63V 3CIRA 2QYWA 3AVSA 5L3DB 4FI5A 5FVKA 4BAYB 1OEDE 4JI7T 2PG8A 3IEEA 2X68A 4KMCA 3WI3A 3LG7A 3P4WA 5IYZE 3ZT5A 3OPCA 5AQUB 2Q9QB 2VL0A 5IUXA 4H9RC 5L3EB 4I55E 3ZMSB 3KV5A 5L4HA 2X67A 3K3QC 4V1Av 2V6YB 2V26A 3KBUA 2E9XD 4H9OC 4ZXLA 4DUZT 2ZM0A 1IBLT 2WDQA 5LBMA 4LMKA 2CLYC 3RI5A 5AFUL 5AQRB 4EEBA 2CRBA 3CQXC 2LOSA 4TUYE 2ZM2A 2JQKA 1WR0A 2M6IA 4HFBA 1J1JA 3B13A 3HKBE 4ISSA 4PJNA 3UUMA 4E7ZA 4ZI2D 2XAHB 4HWDA 3KV4A 1IJ6A 2HN2A 2D0UA 5FVLA 5HXRA 5FP3A 1EZ3A 1MMDA 2DLRA 1IBMT 2UUBT 2BG9C 4IE7A 2E5LT 2P9BA 2VKJA 2V8SV 4H9QC 4ILBA 4DR2T 4M1PA 2W0GA 5EK3A 2VVSA 2XAGB 4MLKA 5HXCA 4PJLA 1MNDA 1OWAA 3O1IA 3VRBA 4IE5A 4DNDA 3T1HT 2BKPA 1E1HB 3ABVA 3IA3A 4IIJE 3OBVE 4I43B 1YW0A 3KDSE 4EOZB 2XZEA 4EXTA 4YTNA 3TLVA 3CQGB 5AQKB 3ZMUB 2NOXA 4H9NC 5FNVE 3Q9DA 2IMLA 2K9AA 3DJBA 3SRZA 3QB5A 4IDPA 2CLYB 5AQPB 5HWXA 3H3MA 2VK9A 1HX1B 2X51A 2SPCA 2NP9A 4YFSA 5HEUA 4LF6T 2QA7A 3BQIA 3KFWX 3NZQA 2XUEA 4YT0A 2K24A 4PAGA 2L8KA 4NIQA 5GONE 2KINB 4KHZF 1MMNA 1WRDA 3BQLA 3E22E 1J5WA 3U78A 5L47A 3NRXA 4KUMB 4UIGA 2UUAT 3ZEFB 4AQYT 3G06A 2LE8A 3EI0A 2CWYA 4E7SA 2UXCT 4I4TE 4AQGA 1D1CA 5AQOB 2L3LA 4QXBB 3LDQB 3ANWB 4HWFA 2HPJA 4IDZA 5AQFB 1WYCA 4UXNB 2FJDA 2NTXA 1W9RA 1XDPA 3KVAA 2ACXA 3RIFA 5HEJA 5JR9B 2HHHT 4JBWF 5AQLB 5JDHA 4JI5T 4LF7T 4HE8A 4HWIB 2XQ6A 5JDMA 1CUNA 4QHOA 1B7TA 4JI4T 5LG4A 2LSIA 5LHGB 2LSJA 3PURA 1XMOT 3ZSTA 3C4XA 4JLEA 3PU8A 5AQIB 4PJMA 3UUNA 3AA7B 3J7Yq 5HYAA 1YXRA 4HGAA 3VR8A 3AVRA 3AEGA 3F2EA 4L0RA 1MMAA 3ZMZB 2LEHA 2X0LB 3EABA 4WBOA 5LJNA 5AQTB 5FXXA 3M65A 5DABA 4DV0T 1XDOA 4EYYR 4KHPT 4YTPA 4N78D 4B3RT 5KX5E 2BKNA 4HFCA 4ZI7E 2V7MA 4O4IE 2BDEA 5JR9A 4GYRA 2LRLA 2X0HA 5HXHA 5HEHA 5L4EA 4UV9B 3JC6C 4TZ4C 3NZPA 3OTOT 3UTKA 2DCFA 2PBIA 4PFOA 5LBQB 2BVMA 3AEAA 3D0TA 3ZCJA 5JR9C 4I0UA 4ZS2A 4X64T 3L09A 3ESLA 4C91A 3RRCA 3ZN1B 2CBIA 3AEBA 2VKOA 1HF8A 2YKSA 5HEOA 5LXTE 2IW5B 3KBTA 1HNWT 5L3CB 5ABFB 1BR0A 1M62A 4JI6T 2XHEB 1I6ZA 4WZXA 4CI3B 1OEDC 5FL1A 3MXZA 4U33A 5ETWA 1W09A 2Y6XA 3RYCE 2HN1A 2A72A 2DWKA 3PUAA 2YEVC 2LHNA 2WQYA 3FZLB 4KI0F 4LMJA 2D0TA 2V5CA 2FJEA 4JI0T 4LF4T 3ZKRA 1MIWA 4IE6A 1R8IA 4U74A 4YLHA 5EZYE 5CB4E 3RIAA 2N1GA 3AE6A 3UT5E 2W00A 2BS4A 2RP4A 3MK7C 5L3FB 4PK5A 2D2SA 1JNZA 4O4JE 3IBPA 4QX7B 4TV8E 2WZIA 1L0VA 4F8HA 2CCQA 5LJMA 1ZEEA 2IUBA 4JV5T 1YQ4A 2CHNA 3KV9A 5HXEA 3JAEA 5LGTB 2X9XA 2HPLA 2W61A 4MHCA 4WNKA 1VCSA 3C4WA 2HH7A 2XY8B 2DWGA 2NW8A 2BZBA 2XAQB 3N9QA 4HWCA 3MJXA 3RGLA 4AIUA 1D1BA 3X1DA 3SWHA 4ZZBA 5F3JA 5JDGA 5LGNB 4COFA 3HR0A 3FZMB 4DMVA 3FBZA 2LM9A 2M67A 2DNXA 3FHNA 4IL9A 3NBXX 3NWIA 1YQ3A 4YSYA 3UFEA 3UUXB 2XQYA 2WDRA 3LSVA 4QWNB 2XTLA 3ZYKA 4DO0A 4EGWA 2BBJA 4CQIA 4QXCB 2JMHA 3ZMTB 3U3IA 4NXNT 2EHOC 5AQSB 3PV0F 4DMWA 3DP7A 4AKHA 4DBQA 4J2CA 2WWUA 4EZHA 4DR4T 2V6XA 2KWHA 3CX6B 4G2AA 4MALA 1G8XA 1MNEA 5ADXL 1T72A 3AE4A 4HFIA 3H3AA 4JEHB 5H6QB 1NAFA 5ABEA 3KINB 2IIUA 2WMNA 4A97A 2IAKA 2YDQA 1UX4A 2XQ3A 3H37A 3HKDE 5H6RB 1XNRT 3LBXA 2YU1A 2LJLA 2UUCT 2MPKA 3P4RA 2IC9A 2VURA 3PUWF 4YJ2E 1KK7A 3EDVA 5CA1E 4AI6A 3AE3A 1ZKEA 1SUMB 3SOLA 3NVOA 4TX5A 3K3OA 3N9LA 4AKRB 1ZOYA 3AEDA 1XMQT 4X5TA 2J1DG 2XQ7A 3AA0B 4AXPA 1BR4A 5HCMA 4LFBT 2LSYA 1FIOA 1ZP0A 4TWFA 4AQFC 4DV2T 2NW9A 4U2YA 1G73A 1HNZT 4GKKT 4A56A 4B3TT 2YINA 1UX5A 5FL0A 1LVKA 3IF8B 4EAHA 2A9UA 2X9YA 1MIYA 2E2AA 3FZKB 5FMNA 3SS1A 3N2GE 2GK9A 3RHWA 1VCTA 4OYKA 1SE7A 3RYFE 2C5JA 3MACA 4WYVA 3TLUA 3M3ZB 5JTGA 2R6GF 3AE1A 4IREA 4CZZB 4CXYA 3FZFB 4AQFA 4JI8T 1KNZA 4ANJA 2H89A 2KXPB 2LT3A 3UQ4A 3PUSA 1Y64B 2X0YA 3VRAA 3ZCIA 1IBKT 2MYSA 2H88A 4UVBB 4NPPA 1DU2A 1LKXA 2AXDS 3CPZA 4ZEYA 5BMVE 2KLQA 2E9XA 5JDQA 3Q5DA 4LFAT 3L39A 4YHJA 1H7CA 5JQGE 3CWZB 3Q5XA 4EZ4A 4H9SE 3PJAJ 4YJ3E 2BVLA 4BJMA 2PFVA 3OKQA 4CI2B 3KV6A 2CXLA 3EAMA 3OJAA 1W0BA 1WLXA 4QH1A 4LMLA 5TAOA 4OFZA 5L3BB 4DIDB 4P0AA 3LBXB 1MIVA 5FY1A 3T8OA 4DR3T 2J47A 2QRXA 3LK3B 5FXVA 2MOZA 2LKHA 2VWAA 5BR8T 4O4HE 1J5ET 3LK2B 4TV9E 2Q9QD 2KNDA 5IHYA 4KBMB 4X20E 3VU7H 1NEKA 2JIWA 3AE9A 4YHHT 3ETUA 4GYSA 4LFCT 2W4XA 3AECA 4LF5T 2E9XC 3N9PA 3TKLB 2W62A 3P7IA 4QH5A 5L3GB 1JNRA 4B3ST 4CXXA 1FJGT 3VKHA 5ABFA 2VVNA 1Z8UA 3A8YC 5CFBA 2W2UA 3ZT6A 4YXDA 5KMGP 3RIUC 2J4GA 3UFGA 4QX8B 2WBLA 1WR6A 2E8IA 3PUVF 4XZCA 5LOVE 5L2LA 3I1AA 2ODVA 3DTOA 3MZKB 3QK6A 5J2UE 2WU5A 3F31A 3ZN0B 2XPKA 4UF0A 4GOUA 1QUUA 1D0XA 2A2FX 3OYXA 1KNPA 5LHHB 2ZMAA 3AE2A 1YKEB 1ZV4X 2V7KA 1D1AA 4MBQA 1LVFA 3ZJ2A 4WW0A 2LOPA 2W67A 3SFDA 2JMKA 1N36T 1NWMX 5AQJB 4L5GA 3RF1A 4EYUA 2LKGA 4ILAA 4JI3T 3MA9A 2BKOA 1OEDB 2V1DB 3A5XA 3FBLA 2PTFA 1VOMA 2BG9B 1KF6A 2VKDA 1BR1A 2J62A 2NR4A 3AEEA 3B5MA 3CX7B 4IE4A 1X79A 2ODUA 5HAXA 2B76A 2C5KT 2FUPA 3JADA 4TNWA 1M7KA 2ACZA 2KWIB 3P4QA 2YDSA 3ZMVB 3ZPOA 5CA0E 1LRZA 3CX8B 4ILCA 1XNQT 4TWDA 4HEAA 3TLTA 4HFDA 2JQQA 4GK0E 4QH4A 2Q9QA 4U72A 1UURA 4DR1T 2YK0A 1N34T 2KT9A 2C0SA 4UV8B 1OEDA 3RX6A 3UU8A 3W15B 5C3JA 5F5WA 4C90A 3PTRB 5FYMA 3Q5EA 4IDQA 3UU5A 2H7VC 5JRCB 3ANWA 2H3RA 3GMIA 2V7LA 4PK4A 4DUYT 2EHOA 2DHRA 4U31A 4DR7T 2CEAA 2UXBT 4CN1A 1KEYA 5AQQB 3UU4A 1Y01A 4X66T 2JPFA 2Z6EA 3PDYA 5J1GA 3ZYMA 5ABHA 5HCJA 2BS3A 2RA1A 2XAJB 4O4LE 2V5DA 2YDRA 4HTEA 1VRBA 3I0OA 5JREA 5LCYA 1IAPA 3CKDA 5J0ZA 2CM0A 3L3PA 3RQUA 5IWAT 1V9DA 2WU2A 2BG9E 4MFRA 1T98A 4EB6E 2X9HA 4G63A 4AKIA 1SA0E 2LSGA 3RLFF 2UXXB 2AE9A 1T8BA 3E0ZA 3GA8A 4ISTA 3ZT7A 5CGMA 3ONLC 2EHOD 2RPAA 4Q25A 4UVCB 3OYZA 2V6YA 2W63A 4QKNA 2BG9A 2K3WA 3ZLIA 3PUGA 3ZYLA 3T1YT 3PUXF 4DV3T 1FMWA 1IJ5A 3VR9A 2CMRA 3GN5A 4DV7T 1D0YA 2OV9A 3TLSA 2XQ5A 4H63H 4H9PC 1UUSA 2MBGA 1YD8G 3ZJ1A 4B6XA 1HNXT 3GWHA 4ILUA 5LYJE 4KX6A 4F6RC 3I9WA 4L9IA 4UF0B 5EK2A 1HR0T 3RKGA 2QGSA 3AE7A 4O8SA 4DR6T 3JC6D 2XJ7A 4PK6A 2LSKA 2VL8A 2FJAA 3AXJB 4CN6A 4QXHB 3VKGA 4U3CA 2E9XB 3E08A 1CHUA 3B57A 2D9DA 3KVBA 2XQ4A 3OVUA 4X65T 3AAEB 3ONJA 5KXJA 2JQHA 2XASB 2A3DA 2K5BB 4Z8XA 4P1NA 4CI1B 2ES0A 3AA1B 2CHOA 3AAIA 5HEGA 2CA5A 4ZS3A 2I6HA 3Q2MA 1HG2A 3P4PA 5AQNB 1X9BA 1ZHCA 5FXWA 1U4QA 3BQKA 4DVDA 3LFMA 3FB2A 3CVRA 2XQ8A 5JH7E 4DV5T 4HKAA 1UCUA 2YOEA 2BS2A 3HKCE 5LG3A 2KZ7B 1GQEA 2CXDA 1AJ3A 1BR2A 3RRWA 3CMLA 4PW8A 4WBNE 1E2AA 5DQWA 4BJNA 4EV6A 3EHZA 3NRYA 4K0KT 2N2NA 2WAUA 1IZNB 2W66A 3HA4A 4IGUA 3N2OA 4K0UA 3C64A 1HX8A 1OXZA 4HWHA 4CN4A 4BA9A 3AE8A 3K1SA 4IDOA 5FY7A 4ZHQE 3NKZA 2VASA 3TLWA 3UU3A 3ONXA 5KDMC 2CE7A 5F8PA 4ZI2C 4JUYA 1HTJF 5JDFA 4A98A 1QLBA 3L8RA 3EVYA 4X1IE 4IDNA 3RC3A 3LK42 1WYBA 5E0OA 5LA6E 2PJQA 3J9X1 2WP9A 4UR9A 3N9MA 2CPTA 4FJOA 4PFPA 2BBHA 5AQVB 1MMGA 4YTMA 1SHZC 3N2KE 2WDVA 1QSDA 1HFAA 3FZHB 2KMFA 5EK4A 4JI2T 5ABGA 2ZM6T 5JRCA 1NENA 3AEFA 4IE0A 3RC8A 2VB6A 5LMNT 3WAKA 4DR5T 4ZI3C 3IHRA 4NUVA 3ETVA 3Q5WA 4CXWA 3PE0A 4ASKA 4GKJT 2K48A 4UEMA 3AE5A 5AQHB 5FXZA 3EDUA 4NUUA 1XZYA 3EUHA 5HWYA 4DBRA 1KNRA 3QC9A
chains in the Genus database with same CATH topology
5AQOB 5AQUB 1T7SA 3LDQB 5AQSB 4HWFA 5AQFB 3FZKB 1UGOA 5AQNB 5AQKB 5AQLB 1UK5A 5AQJB 4HWIB 5AQVB 5AQRB 5AQQB 3M3ZB 5AQPB 3FZHB 3FZFB 1HX1B 4HWCA 5AQIB 5AQGB 4HWDA 1M7KA 3FZMB 1M62A 1I6ZA 3A8YC 4HWHA 5AQHB 2D9DA 5AQMB 3FZLB 5AQTB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AQO B;  5AQU B;  1T7S A;  3LDQ B;  5AQS B;  4HWF A;  5AQF B;  3FZK B;  1UGO A;  5AQN B;  5AQK B;  5AQL B;  1UK5 A;  5AQJ B;  4HWI B;  5AQV B;  5AQR B;  5AQQ B;  3M3Z B;  5AQP B;  3FZH B;  3FZF B;  1HX1 B;  4HWC A;  5AQI B;  5AQG B;  4HWD A;  1M7K A;  3FZM B;  1M62 A;  1I6Z A;  3A8Y C;  4HWH A;  5AQH B;  2D9D A;  5AQM B;  3FZL B;  5AQT B; 
#chains in the Genus database with same CATH topology
 4GK5 E;  1W0A A;  3I0Q A;  3PU3 A;  2LLY A;  4LF9 T;  3JAF A;  4P09 A;  4O2A E;  4OK0 A;  3WAJ A;  2LHR A;  4U2Z A;  4HFV A;  4UVA B;  3BK9 A;  3RIU A;  3ZSS A;  2UXD T;  1HS7 A;  2I0M A;  4IHJ E;  1UGO A;  2JRK A;  4JEU B;  4Z90 A;  3K8P C;  3QNU A;  3CK6 A;  1S35 A;  2CXF A;  3N9O A;  4HN9 A;  4Z91 A;  3RPU A;  5C8Y E;  3UQ7 A;  4P0B A;  1XWM A;  4DV6 T;  3R84 B;  1FMV A;  2EHO B;  4HFH A;  4I50 E;  4ADZ A;  3O1H A;  5DQV A;  3GN5 B;  4U7Y A;  3P50 A;  3VHL A;  5J2T E;  2Q9Q C;  2VQF T;  2IC6 A;  1HCI A;  3I9Y A;  2DL1 A;  2ZLY A;  3O4X E;  4X1K E;  4HFE A;  1US7 B;  4ZI3 D;  3LJC A;  2CBJ A;  3MKD A;  3ZC0 A;  2B1E A;  2WSS V;  3A7M A;  4ZOL E;  5LB7 B;  4AIS A;  3RKO A;  4ERR A;  5HXS A;  2UXN B;  4YSX A;  4OX9 T;  2JJ9 A;  2OLT A;  3O1J A;  4OHF A;  3FXD B;  2WS3 A;  5AQM B;  3UUB A;  5JDL A;  1D0Z A;  3P8C D;  4PJJ A;  3CQC B;  4GIW A;  4IT4 A;  4U7I A;  2D5U A;  4LF8 T;  3C98 B;  2YU2 A;  1YKH B;  2ZM8 A;  2Y48 B;  2FJB A;  2WCA A;  3C51 A;  3HI2 A;  4PNI A;  3N5L A;  2C5I T;  3K3N A;  3QOF A;  4B3M T;  2WWV A;  3ZC1 A;  4EIW A;  2CWO A;  5M4Y A;  5JVD E;  5DJQ C;  5LMU T;  4DV4 T;  4UEL A;  4X1Y E;  2WMO A;  2MAW A;  5LP6 E;  2UU9 T;  4TN7 B;  2N9D A;  3PUY F;  2F4V T;  2NTY A;  3JCF A;  2XQA A;  5LNK A;  2X9W A;  5FKY A;  4YSZ A;  3AB3 B;  5LHI B;  2VQE T;  1FEW A;  3AA6 B;  3S4U A;  5AQG B;  1Z0P A;  1I94 T;  2G0U A;  2WB5 A;  2XM1 A;  2NWB A;  2Y8D A;  3F57 A;  4IL4 A;  3PUZ F;  3UUL A;  2XM2 A;  4JI1 T;  1N32 T;  2QVA A;  3SFE A;  1WCR A;  2WY2 A;  2XSB A;  3AAA B;  4EED A;  3RYI E;  4X62 T;  2E5V A;  2XQ9 A;  2FBW A;  2NW7 A;  2YN6 A;  5C2T A;  5CJ5 A;  1WFD A;  3C50 A;  1U5P A;  1KFY A;  2LRK A;  2XSA A;  2OA5 A;  3PJA A;  3C4Z A;  3RQW A;  4JYA T;  2M6B A;  5JDN A;  3V5U A;  2JQ9 A;  2V7I A;  3P4S A;  1T7S A;  2VKH A;  3QUJ A;  2IHR 1;  2WM9 A;  4XBF B;  1O3X A;  2DI4 A;  1N33 T;  4TNV A;  2XAF B;  3RYH E;  2WZH A;  4YY3 T;  2KSR A;  3UU6 A;  1UK5 A;  2I59 A;  5LGU B;  3O9X A;  1S94 A;  2IDO B;  3HKE E;  3V5S A;  4TWH A;  3N9N A;  3R6N A;  4XAX B;  5A1L A;  4KP3 C;  2H7O A;  4O2B E;  5FY0 A;  3RH3 A;  4OYJ A;  2LM2 A;  2V7J A;  4A5X A;  3AXJ A;  3HL6 A;  4AKL A;  4DV1 T;  4AKG A;  4ZZC A;  2L9Q A;  1HG5 A;  3FXE B;  3PUQ A;  2MTQ A;  4NXM T;  2X66 A;  3QB5 K;  1E7P A;  4H63 V;  3CIR A;  2QYW A;  3AVS A;  5L3D B;  4FI5 A;  5FVK A;  4BAY B;  1OED E;  4JI7 T;  2PG8 A;  3IEE A;  2X68 A;  4KMC A;  3WI3 A;  3LG7 A;  3P4W A;  5IYZ E;  3ZT5 A;  3OPC A;  5AQU B;  2Q9Q B;  2VL0 A;  5IUX A;  4H9R C;  5L3E B;  4I55 E;  3ZMS B;  3KV5 A;  5L4H A;  2X67 A;  3K3Q C;  4V1A v;  2V6Y B;  2V26 A;  3KBU A;  2E9X D;  4H9O C;  4ZXL A;  4DUZ T;  2ZM0 A;  1IBL T;  2WDQ A;  5LBM A;  4LMK A;  2CLY C;  3RI5 A;  5AFU L;  5AQR B;  4EEB A;  2CRB A;  3CQX C;  2LOS A;  4TUY E;  2ZM2 A;  2JQK A;  1WR0 A;  2M6I A;  4HFB A;  1J1J A;  3B13 A;  3HKB E;  4ISS A;  4PJN A;  3UUM A;  4E7Z A;  4ZI2 D;  2XAH B;  4HWD A;  3KV4 A;  1IJ6 A;  2HN2 A;  2D0U A;  5FVL A;  5HXR A;  5FP3 A;  1EZ3 A;  1MMD A;  2DLR A;  1IBM T;  2UUB T;  2BG9 C;  4IE7 A;  2E5L T;  2P9B A;  2VKJ A;  2V8S V;  4H9Q C;  4ILB A;  4DR2 T;  4M1P A;  2W0G A;  5EK3 A;  2VVS A;  2XAG B;  4MLK A;  5HXC A;  4PJL A;  1MND A;  1OWA A;  3O1I A;  3VRB A;  4IE5 A;  4DND A;  3T1H T;  2BKP A;  1E1H B;  3ABV A;  3IA3 A;  4IIJ E;  3OBV E;  4I43 B;  1YW0 A;  3KDS E;  4EOZ B;  2XZE A;  4EXT A;  4YTN A;  3TLV A;  3CQG B;  5AQK B;  3ZMU B;  2NOX A;  4H9N C;  5FNV E;  3Q9D A;  2IML A;  2K9A A;  3DJB A;  3SRZ A;  3QB5 A;  4IDP A;  2CLY B;  5AQP B;  5HWX A;  3H3M A;  2VK9 A;  1HX1 B;  2X51 A;  2SPC A;  2NP9 A;  4YFS A;  5HEU A;  4LF6 T;  2QA7 A;  3BQI A;  3KFW X;  3NZQ A;  2XUE A;  4YT0 A;  2K24 A;  4PAG A;  2L8K A;  4NIQ A;  5GON E;  2KIN B;  4KHZ F;  1MMN A;  1WRD A;  3BQL A;  3E22 E;  1J5W A;  3U78 A;  5L47 A;  3NRX A;  4KUM B;  4UIG A;  2UUA T;  3ZEF B;  4AQY T;  3G06 A;  2LE8 A;  3EI0 A;  2CWY A;  4E7S A;  2UXC T;  4I4T E;  4AQG A;  1D1C A;  5AQO B;  2L3L A;  4QXB B;  3LDQ B;  3ANW B;  4HWF A;  2HPJ A;  4IDZ A;  5AQF B;  1WYC A;  4UXN B;  2FJD A;  2NTX A;  1W9R A;  1XDP A;  3KVA A;  2ACX A;  3RIF A;  5HEJ A;  5JR9 B;  2HHH T;  4JBW F;  5AQL B;  5JDH A;  4JI5 T;  4LF7 T;  4HE8 A;  4HWI B;  2XQ6 A;  5JDM A;  1CUN A;  4QHO A;  1B7T A;  4JI4 T;  5LG4 A;  2LSI A;  5LHG B;  2LSJ A;  3PUR A;  1XMO T;  3ZST A;  3C4X A;  4JLE A;  3PU8 A;  5AQI B;  4PJM A;  3UUN A;  3AA7 B;  3J7Y q;  5HYA A;  1YXR A;  4HGA A;  3VR8 A;  3AVR A;  3AEG A;  3F2E A;  4L0R A;  1MMA A;  3ZMZ B;  2LEH A;  2X0L B;  3EAB A;  4WBO A;  5LJN A;  5AQT B;  5FXX A;  3M65 A;  5DAB A;  4DV0 T;  1XDO A;  4EYY R;  4KHP T;  4YTP A;  4N78 D;  4B3R T;  5KX5 E;  2BKN A;  4HFC A;  4ZI7 E;  2V7M A;  4O4I E;  2BDE A;  5JR9 A;  4GYR A;  2LRL A;  2X0H A;  5HXH A;  5HEH A;  5L4E A;  4UV9 B;  3JC6 C;  4TZ4 C;  3NZP A;  3OTO T;  3UTK A;  2DCF A;  2PBI A;  4PFO A;  5LBQ B;  2BVM A;  3AEA A;  3D0T A;  3ZCJ A;  5JR9 C;  4I0U A;  4ZS2 A;  4X64 T;  3L09 A;  3ESL A;  4C91 A;  3RRC A;  3ZN1 B;  2CBI A;  3AEB A;  2VKO A;  1HF8 A;  2YKS A;  5HEO A;  5LXT E;  2IW5 B;  3KBT A;  1HNW T;  5L3C B;  5ABF B;  1BR0 A;  1M62 A;  4JI6 T;  2XHE B;  1I6Z A;  4WZX A;  4CI3 B;  1OED C;  5FL1 A;  3MXZ A;  4U33 A;  5ETW A;  1W09 A;  2Y6X A;  3RYC E;  2HN1 A;  2A72 A;  2DWK A;  3PUA A;  2YEV C;  2LHN A;  2WQY A;  3FZL B;  4KI0 F;  4LMJ A;  2D0T A;  2V5C A;  2FJE A;  4JI0 T;  4LF4 T;  3ZKR A;  1MIW A;  4IE6 A;  1R8I A;  4U74 A;  4YLH A;  5EZY E;  5CB4 E;  3RIA A;  2N1G A;  3AE6 A;  3UT5 E;  2W00 A;  2BS4 A;  2RP4 A;  3MK7 C;  5L3F B;  4PK5 A;  2D2S A;  1JNZ A;  4O4J E;  3IBP A;  4QX7 B;  4TV8 E;  2WZI A;  1L0V A;  4F8H A;  2CCQ A;  5LJM A;  1ZEE A;  2IUB A;  4JV5 T;  1YQ4 A;  2CHN A;  3KV9 A;  5HXE A;  3JAE A;  5LGT B;  2X9X A;  2HPL A;  2W61 A;  4MHC A;  4WNK A;  1VCS A;  3C4W A;  2HH7 A;  2XY8 B;  2DWG A;  2NW8 A;  2BZB A;  2XAQ B;  3N9Q A;  4HWC A;  3MJX A;  3RGL A;  4AIU A;  1D1B A;  3X1D A;  3SWH A;  4ZZB A;  5F3J A;  5JDG A;  5LGN B;  4COF A;  3HR0 A;  3FZM B;  4DMV A;  3FBZ A;  2LM9 A;  2M67 A;  2DNX A;  3FHN A;  4IL9 A;  3NBX X;  3NWI A;  1YQ3 A;  4YSY A;  3UFE A;  3UUX B;  2XQY A;  2WDR A;  3LSV A;  4QWN B;  2XTL A;  3ZYK A;  4DO0 A;  4EGW A;  2BBJ A;  4CQI A;  4QXC B;  2JMH A;  3ZMT B;  3U3I A;  4NXN T;  2EHO C;  5AQS B;  3PV0 F;  4DMW A;  3DP7 A;  4AKH A;  4DBQ A;  4J2C A;  2WWU A;  4EZH A;  4DR4 T;  2V6X A;  2KWH A;  3CX6 B;  4G2A A;  4MAL A;  1G8X A;  1MNE A;  5ADX L;  1T72 A;  3AE4 A;  4HFI A;  3H3A A;  4JEH B;  5H6Q B;  1NAF A;  5ABE A;  3KIN B;  2IIU A;  2WMN A;  4A97 A;  2IAK A;  2YDQ A;  1UX4 A;  2XQ3 A;  3H37 A;  3HKD E;  5H6R B;  1XNR T;  3LBX A;  2YU1 A;  2LJL A;  2UUC T;  2MPK A;  3P4R A;  2IC9 A;  2VUR A;  3PUW F;  4YJ2 E;  1KK7 A;  3EDV A;  5CA1 E;  4AI6 A;  3AE3 A;  1ZKE A;  1SUM B;  3SOL A;  3NVO A;  4TX5 A;  3K3O A;  3N9L A;  4AKR B;  1ZOY A;  3AED A;  1XMQ T;  4X5T A;  2J1D G;  2XQ7 A;  3AA0 B;  4AXP A;  1BR4 A;  5HCM A;  4LFB T;  2LSY A;  1FIO A;  1ZP0 A;  4TWF A;  4AQF C;  4DV2 T;  2NW9 A;  4U2Y A;  1G73 A;  1HNZ T;  4GKK T;  4A56 A;  4B3T T;  2YIN A;  1UX5 A;  5FL0 A;  1LVK A;  3IF8 B;  4EAH A;  2A9U A;  2X9Y A;  1MIY A;  2E2A A;  3FZK B;  5FMN A;  3SS1 A;  3N2G E;  2GK9 A;  3RHW A;  1VCT A;  4OYK A;  1SE7 A;  3RYF E;  2C5J A;  3MAC A;  4WYV A;  3TLU A;  3M3Z B;  5JTG A;  2R6G F;  3AE1 A;  4IRE A;  4CZZ B;  4CXY A;  3FZF B;  4AQF A;  4JI8 T;  1KNZ A;  4ANJ A;  2H89 A;  2KXP B;  2LT3 A;  3UQ4 A;  3PUS A;  1Y64 B;  2X0Y A;  3VRA A;  3ZCI A;  1IBK T;  2MYS A;  2H88 A;  4UVB B;  4NPP A;  1DU2 A;  1LKX A;  2AXD S;  3CPZ A;  4ZEY A;  5BMV E;  2KLQ A;  2E9X A;  5JDQ A;  3Q5D A;  4LFA T;  3L39 A;  4YHJ A;  1H7C A;  5JQG E;  3CWZ B;  3Q5X A;  4EZ4 A;  4H9S E;  3PJA J;  4YJ3 E;  2BVL A;  4BJM A;  2PFV A;  3OKQ A;  4CI2 B;  3KV6 A;  2CXL A;  3EAM A;  3OJA A;  1W0B A;  1WLX A;  4QH1 A;  4LML A;  5TAO A;  4OFZ A;  5L3B B;  4DID B;  4P0A A;  3LBX B;  1MIV A;  5FY1 A;  3T8O A;  4DR3 T;  2J47 A;  2QRX A;  3LK3 B;  5FXV A;  2MOZ A;  2LKH A;  2VWA A;  5BR8 T;  4O4H E;  1J5E T;  3LK2 B;  4TV9 E;  2Q9Q D;  2KND A;  5IHY A;  4KBM B;  4X20 E;  3VU7 H;  1NEK A;  2JIW A;  3AE9 A;  4YHH T;  3ETU A;  4GYS A;  4LFC T;  2W4X A;  3AEC A;  4LF5 T;  2E9X C;  3N9P A;  3TKL B;  2W62 A;  3P7I A;  4QH5 A;  5L3G B;  1JNR A;  4B3S T;  4CXX A;  1FJG T;  3VKH A;  5ABF A;  2VVN A;  1Z8U A;  3A8Y C;  5CFB A;  2W2U A;  3ZT6 A;  4YXD A;  5KMG P;  3RIU C;  2J4G A;  3UFG A;  4QX8 B;  2WBL A;  1WR6 A;  2E8I A;  3PUV F;  4XZC A;  5LOV E;  5L2L A;  3I1A A;  2ODV A;  3DTO A;  3MZK B;  3QK6 A;  5J2U E;  2WU5 A;  3F31 A;  3ZN0 B;  2XPK A;  4UF0 A;  4GOU A;  1QUU A;  1D0X A;  2A2F X;  3OYX A;  1KNP A;  5LHH B;  2ZMA A;  3AE2 A;  1YKE B;  1ZV4 X;  2V7K A;  1D1A A;  4MBQ A;  1LVF A;  3ZJ2 A;  4WW0 A;  2LOP A;  2W67 A;  3SFD A;  2JMK A;  1N36 T;  1NWM X;  5AQJ B;  4L5G A;  3RF1 A;  4EYU A;  2LKG A;  4ILA A;  4JI3 T;  3MA9 A;  2BKO A;  1OED B;  2V1D B;  3A5X A;  3FBL A;  2PTF A;  1VOM A;  2BG9 B;  1KF6 A;  2VKD A;  1BR1 A;  2J62 A;  2NR4 A;  3AEE A;  3B5M A;  3CX7 B;  4IE4 A;  1X79 A;  2ODU A;  5HAX A;  2B76 A;  2C5K T;  2FUP A;  3JAD A;  4TNW A;  1M7K A;  2ACZ A;  2KWI B;  3P4Q A;  2YDS A;  3ZMV B;  3ZPO A;  5CA0 E;  1LRZ A;  3CX8 B;  4ILC A;  1XNQ T;  4TWD A;  4HEA A;  3TLT A;  4HFD A;  2JQQ A;  4GK0 E;  4QH4 A;  2Q9Q A;  4U72 A;  1UUR A;  4DR1 T;  2YK0 A;  1N34 T;  2KT9 A;  2C0S A;  4UV8 B;  1OED A;  3RX6 A;  3UU8 A;  3W15 B;  5C3J A;  5F5W A;  4C90 A;  3PTR B;  5FYM A;  3Q5E A;  4IDQ A;  3UU5 A;  2H7V C;  5JRC B;  3ANW A;  2H3R A;  3GMI A;  2V7L A;  4PK4 A;  4DUY T;  2EHO A;  2DHR A;  4U31 A;  4DR7 T;  2CEA A;  2UXB T;  4CN1 A;  1KEY A;  5AQQ B;  3UU4 A;  1Y01 A;  4X66 T;  2JPF A;  2Z6E A;  3PDY A;  5J1G A;  3ZYM A;  5ABH A;  5HCJ A;  2BS3 A;  2RA1 A;  2XAJ B;  4O4L E;  2V5D A;  2YDR A;  4HTE A;  1VRB A;  3I0O A;  5JRE A;  5LCY A;  1IAP A;  3CKD A;  5J0Z A;  2CM0 A;  3L3P A;  3RQU A;  5IWA T;  1V9D A;  2WU2 A;  2BG9 E;  4MFR A;  1T98 A;  4EB6 E;  2X9H A;  4G63 A;  4AKI A;  1SA0 E;  2LSG A;  3RLF F;  2UXX B;  2AE9 A;  1T8B A;  3E0Z A;  3GA8 A;  4IST A;  3ZT7 A;  5CGM A;  3ONL C;  2EHO D;  2RPA A;  4Q25 A;  4UVC B;  3OYZ A;  2V6Y A;  2W63 A;  4QKN A;  2BG9 A;  2K3W A;  3ZLI A;  3PUG A;  3ZYL A;  3T1Y T;  3PUX F;  4DV3 T;  1FMW A;  1IJ5 A;  3VR9 A;  2CMR A;  3GN5 A;  4DV7 T;  1D0Y A;  2OV9 A;  3TLS A;  2XQ5 A;  4H63 H;  4H9P C;  1UUS A;  2MBG A;  1YD8 G;  3ZJ1 A;  4B6X A;  1HNX T;  3GWH A;  4ILU A;  5LYJ E;  4KX6 A;  4F6R C;  3I9W A;  4L9I A;  4UF0 B;  5EK2 A;  1HR0 T;  3RKG A;  2QGS A;  3AE7 A;  4O8S A;  4DR6 T;  3JC6 D;  2XJ7 A;  4PK6 A;  2LSK A;  2VL8 A;  2FJA A;  3AXJ B;  4CN6 A;  4QXH B;  3VKG A;  4U3C A;  2E9X B;  3E08 A;  1CHU A;  3B57 A;  2D9D A;  3KVB A;  2XQ4 A;  3OVU A;  4X65 T;  3AAE B;  3ONJ A;  5KXJ A;  2JQH A;  2XAS B;  2A3D A;  2K5B B;  4Z8X A;  4P1N A;  4CI1 B;  2ES0 A;  3AA1 B;  2CHO A;  3AAI A;  5HEG A;  2CA5 A;  4ZS3 A;  2I6H A;  3Q2M A;  1HG2 A;  3P4P A;  5AQN B;  1X9B A;  1ZHC A;  5FXW A;  1U4Q A;  3BQK A;  4DVD A;  3LFM A;  3FB2 A;  3CVR A;  2XQ8 A;  5JH7 E;  4DV5 T;  4HKA A;  1UCU A;  2YOE A;  2BS2 A;  3HKC E;  5LG3 A;  2KZ7 B;  1GQE A;  2CXD A;  1AJ3 A;  1BR2 A;  3RRW A;  3CML A;  4PW8 A;  4WBN E;  1E2A A;  5DQW A;  4BJN A;  4EV6 A;  3EHZ A;  3NRY A;  4K0K T;  2N2N A;  2WAU A;  1IZN B;  2W66 A;  3HA4 A;  4IGU A;  3N2O A;  4K0U A;  3C64 A;  1HX8 A;  1OXZ A;  4HWH A;  4CN4 A;  4BA9 A;  3AE8 A;  3K1S A;  4IDO A;  5FY7 A;  4ZHQ E;  3NKZ A;  2VAS A;  3TLW A;  3UU3 A;  3ONX A;  5KDM C;  2CE7 A;  5F8P A;  4ZI2 C;  4JUY A;  1HTJ F;  5JDF A;  4A98 A;  1QLB A;  3L8R A;  3EVY A;  4X1I E;  4IDN A;  3RC3 A;  3LK4 2;  1WYB A;  5E0O A;  5LA6 E;  2PJQ A;  3J9X 1;  2WP9 A;  4UR9 A;  3N9M A;  2CPT A;  4FJO A;  4PFP A;  2BBH A;  5AQV B;  1MMG A;  4YTM A;  1SHZ C;  3N2K E;  2WDV A;  1QSD A;  1HFA A;  3FZH B;  2KMF A;  5EK4 A;  4JI2 T;  5ABG A;  2ZM6 T;  5JRC A;  1NEN A;  3AEF A;  4IE0 A;  3RC8 A;  2VB6 A;  5LMN T;  3WAK A;  4DR5 T;  4ZI3 C;  3IHR A;  4NUV A;  3ETV A;  3Q5W A;  4CXW A;  3PE0 A;  4ASK A;  4GKJ T;  2K48 A;  4UEM A;  3AE5 A;  5AQH B;  5FXZ A;  3EDU A;  4NUU A;  1XZY A;  3EUH A;  5HWY A;  4DBR A;  1KNR A;  3QC9 A; 
#chains in the Genus database with same CATH homology
 5AQO B;  5AQU B;  1T7S A;  3LDQ B;  5AQS B;  4HWF A;  5AQF B;  3FZK B;  1UGO A;  5AQN B;  5AQK B;  5AQL B;  1UK5 A;  5AQJ B;  4HWI B;  5AQV B;  5AQR B;  5AQQ B;  3M3Z B;  5AQP B;  3FZH B;  3FZF B;  1HX1 B;  4HWC A;  5AQI B;  5AQG B;  4HWD A;  1M7K A;  3FZM B;  1M62 A;  1I6Z A;  3A8Y C;  4HWH A;  5AQH B;  2D9D A;  5AQM B;  3FZL B;  5AQT B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...