5AQRB

Fragment-based screening of hsp70 sheds light on the functional role of atp-binding site residues
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
112
structure length
112
Chain Sequence
GSNSPQEEVELKKLKHLEKSVEKIADQLEELNKELTGIQQGFLPKDLQAEALCKLDRRVKATIEQFMKILEEIDTLILPENFKDSRLKRKGLVKKVQAFLAECDTVEQNICQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Chaperone
molecule keywords HEAT SHOCK COGNATE 71 KDA PROTEIN
publication title A fragment-based approach applied to a highly flexible target: Insights and challenges towards the inhibition of HSP70 isoforms.
pubmed doi rcsb
source organism Homo sapiens
total genus 45
structure length 112
sequence length 112
chains with identical sequence D, F
ec nomenclature
pdb deposition date 2015-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02179 BAG BAG domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.120 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 BAG domain 5aqrB00
3M3ZB 5AQFB 1HX1B 4HWHA 5AQVB 5AQUB 5AQHB 5AQKB 4HWIB 3FZHB 1UGOA 5AQMB 3FZLB 5AQNB 5AQPB 3A8YC 5AQIB 5AQTB 3FZFB 4HWDA 1T7SA 5AQLB 1UK5A 3FZMB 5AQQB 5AQSB 5AQOB 5AQRB 1I6ZA 4HWCA 3LDQB 1M62A 5AQGB 3FZKB 5AQJB 1M7KA 4HWFA 2D9DA
chains in the Genus database with same CATH superfamily
4Z8XA 1J1JA 2HPJA 3AAEB 2JIWA 2WDVA 1J5ET 4O4IE 5LXTE 4U2YA 4V1Av 3RQWA 2WMNA 4KHZF 2JMKA 2JRKA 4CN1A 2ZM8A 3SFDA 1BR4A 3CPZA 2KT9A 1N33T 3AVRA 2HH7A 1IBLT 4HFCA 3IA3A 2G0UA 3UTKA 2CE7A 4U72A 3TKLB 5BMVE 2F4VT 3B5MA 3RIAA 3PU8A 1M62A 4B3RT 2FJAA 3R84B 2WWUA 1HNZT 2UU9T 5LA6E 2IDOB 3SS1A 4ZI3D 2IC6A 1MMGA 3F2EA 5LMNT 2XSAA 3ZT6A 5C3JA 3PU3A 3FZKB 3SWHA 4QH4A 5L4EA 5LYJE 3KBUA 4ZEYA 4X5TA 2E9XD 1E7PA 2D5UA 5JQGE 4DV6T 3ZMSB 4COFA 4EYUA 2Q9QD 2M6IA 3SRZA 4QXHB 3AEDA 2LSJA 3HA4A 1Y01A 2JQKA 3CVRA 5CGMA 3VKGA 3FZHB 5LG3A 4PK4A 3F57A 2P9BA 2XJ7A 2E5VA 3AEGA 3JCFA 4CQIA 4EYYR 2UUAT 2XY8B 2CEAA 1UURA 4OX9T 2LHNA 5AQFB 4HGAA 2R6GF 4DO0A 1OEDC 3RI5A 5AQTB 4U3CA 2GK9A 4KI0F 3AAIA 3N9OA 5JTGA 4AKRB 4TUYE 2BS2A 2X9WA 3A5XA 1MNDA 3NZQA 2XAHB 1QLBA 4EB6E 4TV8E 2YDRA 2BZBA 4H63V 4H9PC 2K5BB 2BBHA 5F5WA 2E9XB 2MYSA 4J2CA 2Q9QB 5FY7A 3N9QA 2VK9A 4IE5A 4UVCB 4DR4T 5ABHA 4FJOA 4WZXA 4UF0B 1EZ3A 1S94A 2EHOA 4U33A 4O8SA 4QXBB 1H7CA 1UX4A 2V7MA 2UXCT 2XQ6A 2V7LA 4UELA 3I1AA 3W15B 2X0LB 4QHOA 5IHYA 5LHHB 3N9LA 5J2UE 4YSXA 4DMWA 1XNRT 4IDOA 1KEYA 3K3OA 4NXNT 3QB5K 4LMJA 3TLWA 3LJCA 1ZP0A 2BBJA 2V8SV 5CB4E 3PE0A 3L8RA 3O1IA 3DP7A 4BJMA 1QSDA 4HFVA 4OYJA 1WYCA 4MHCA 2ZM6T 3N9NA 3NVOA 5AQHB 5IWAT 3ETUA 5KMGP 4HFHA 2LSIA 4QKNA 3ESLA 2YEVC 1G73A 4O4JE 3P4WA 2W2UA 2A9UA 4H9NC 2IUBA 5FXVA 5FP3A 4GOUA 2QVAA 1BR0A 1L0VA 4HFBA 4JI4T 2W4XA 4XAXB 2WQYA 2PG8A 3GWHA 3AE3A 3CQGB 4EV6A 4GYRA 1XMOT 3EDUA 2CWOA 1E1HB 2YINA 2LE8A 2NW7A 3KV4A 4IGUA 4O2BE 5HYAA 3PV0F 1SHZC 2RP4A 4AQGA 4BJNA 2DCFA 2XHEB 4B6XA 3UUMA 1MIVA 2BS3A 2E2AA 3UFEA 4QH1A 2NP9A 3P4PA 2DNXA 2J1DG 2YDQA 2LRKA 3T1YT 1FEWA 1N32T 3ZSTA 2BKNA 1S35A 2WDRA 4AKLA 4AKGA 3ZYKA 2WAUA 5AQNB 4PJNA 5HXCA 4IIJE 4TX5A 4WNKA 2XAFB 4TWFA 2V1DB 3HL6A 3P4RA 4AISA 3AA1B 3EABA 3MKDA 2D9DA 3QB5A 4YTNA 2OLTA 2CXFA 1IBKT 1YQ3A 3K1SA 2BKOA 2WS3A 4AKHA 2IIUA 3J9X1 2ZM0A 1MMNA 4LF4T 3HKCE 3WAKA 5L2LA 3ZMTB 4X65T 2OV9A 2NWBA 3RYCE 4NUVA 2K3WA 2D0TA 2LM9A 3S4UA 2WWVA 2NTYA 1W0BA 3NKZA 4EZ4A 2KZ7B 4KMCA 2E9XA 4DVDA 2PTFA 5HWYA 2VQET 3N9MA 4AIUA 3RIUA 3ZT5A 2Q9QA 4IL4A 3O1JA 3K3NA 3FXEB 4TV9E 4X1YE 3O9XA 2ZMAA 4UF0A 3RLFF 2Y48B 1T98A 4LMKA 5ABGA 2L9QA 4NIQA 1D1BA 3T8OA 2VURA 4ZI7E 3AE1A 2LJLA 4PNIA 4P1NA 4JI0T 2CBJA 2QA7A 3HR0A 3C50A 4KUMB 4IHJE 2FJDA 2QRXA 4HWCA 3NBXX 5LHIB 2K48A 4PW8A 3CIRA 1KNPA 3VHLA 2VWAA 4QXCB 3UQ4A 3VU7H 1D0YA 2YK0A 5L3EB 3WAJA 2LKGA 3QOFA 4UR9A 4X1KE 5DQVA 3PUXF 2CWYA 4TWHA 1ZOYA 1MMAA 1WRDA 4JI2T 2JPFA 2LM2A 3C98B 4DV0T 4U7IA 3G06A 2X67A 4UVBB 2DI4A 1M7KA 3NZPA 5FXXA 3C64A 4DR3T 4HFEA 3V5UA 4CI3B 2SPCA 3PUZF 5HXSA 2MPKA 2XAGB 3Q5WA 5TAOA 3KVAA 4ADZA 3O1HA 4HE8A 3X1DA 2V7KA 4EOZB 1YD8G 5AQVB 2V6XA 2NW9A 3AECA 2CRBA 1WR0A 3UU8A 3EVYA 2LKHA 4MFRA 3RQUA 2C5KT 5IUXA 5AQQB 4YY3T 5AFUL 5C2TA 4IREA 4YSYA 4HFDA 5F8PA 4IDNA 2V7IA 4JYAT 4AKIA 5LGUB 4I50E 4LF9T 4X66T 4G2AA 5LNKA 4ISTA 3K8PC 1Z0PA 1HG2A 4L9IA 4E7ZA 3UUBA 2IAKA 4LF8T 2LHRA 4CI2B 4YHJA 3MJXA 1ZHCA 2MTQA 2EHOC 2VKOA 4JI5T 3ANWB 3UU5A 3AXJB 3L39A 4C91A 2CLYC 4BA9A 1GQEA 1HFAA 5L4HA 1XNQT 5J2TE 3MXZA 3P4SA 1SUMB 3J7Yq 2XM1A 5AQKB 1HNWT 2HN2A 3I0OA 1X9BA 1I94T 2M6BA 4CXYA 3N2OA 4UIGA 3LK2B 4I0UA 1MIWA 3EAMA 3UQ7A 3PUQA 1W9RA 1FMWA 5JRCB 5JR9B 2X66A 4DUYT 2CHOA 5FL1A 4I43B 3KBTA 4DMVA 4PAGA 4B3TT 1WR6A 4CXWA 3F31A 3PURA 4ZI2D 3C4WA 3FHNA 2X9HA 5HEHA 2CBIA 2K24A 5AQRB 2X0HA 2D2SA 4GKJT 2XQ8A 2V7JA 3E08A 5EK4A 4DV3T 3ZC0A 3VKHA 2WZIA 4XZCA 5FXWA 3U78A 2CXLA 4TNWA 1MNEA 2AXDS 4GK0E 3MA9A 4K0KT 1WYBA 2B1EA 2PJQA 5LGNB 3QNUA 4PJMA 2YOEA 1KF6A 4UEMA 4WW0A 5E0OA 4DNDA 5C8YE 1YW0A 4HEAA 3N2GE 1UGOA 5FYMA 5HAXA 3SFEA 5IYZE 4X64T 1UCUA 4UV9B 3Q9DA 1US7B 2I6HA 4KX6A 1JNZA 4TN7B 3LBXB 3EHZA 4X20E 4DR5T 5AQMB 3FZLB 5KDMC 4CN6A 1MMDA 4A98A 3VRBA 5FL0A 5HXHA 2BKPA 2J4GA 4DV7T 2BG9B 2C0SA 2VVNA 4DBRA 4G63A 4CI1B 2W0GA 4GIWA 2VKJA 3AB3B 4F6RC 4JLEA 5LB7B 1VOMA 3DTOA 3JC6C 1SE7A 2NOXA 4JUYA 2XQ4A 1LRZA 5HEOA 3ZN0B 4CZZB 2KINB 5ADXL 3LDQB 3QUJA 2WP9A 2VASA 4ZOLE 2UXXB 2XQ7A 5LBMA 2XUEA 2W62A 3OKQA 2LRLA 4UV8B 4LF6T 5HXEA 5HCJA 4JI7T 1DU2A 3IEEA 2IC9A 2YU1A 4GYSA 3LK42 1SA0E 1XZYA 2YU2A 2WY2A 2YDSA 1I6ZA 2BVLA 2E9XC 4OK0A 4UVAB 3UU4A 4CN4A 3RIUC 2Q9QC 2KMFA 1J5WA 5HEGA 4LF5T 2W61A 3P50A 2VKHA 3C4ZA 3PUAA 3E22E 3RPUA 3KDSE 3PJAA 5JDGA 1YQ4A 4BAYB 3MK7C 2J62A 3ANWA 3AXJA 5L3FB 2I0MA 1MIYA 3CQXC 1U5PA 4OHFA 3IF8B 2QGSA 5CA1E 2D0UA 5AQIB 5H6RB 5LHGB 5ABEA 4AQFA 4PK5A 5FMNA 3EI0A 3I9YA 2BG9E 5AQJB 2I59A 3ABVA 3ZMUB 4YTPA 3GN5B 1HCIA 2JQQA 2RPAA 4LFCT 5JRCA 3D0TA 3MACA 5JR9A 4YTMA 5LCYA 4U31A 3B57A 3Q5XA 3N2KE 5AQSB 4P0BA 4U7YA 2A2FX 3RH3A 3UUXB 3UU6A 4JI8T 4JI1T 2AE9A 3AE4A 3CK6A 3KV5A 3WI3A 4H9QC 3A7MA 3C51A 5LMUT 5JDLA 3RYIE 2WU5A 3ZSSA 2BDEA 4IDQA 2MOZA 3CMLA 2E8IA 1HX1B 4HWHA 3LG7A 3RYHE 1B7TA 3QK6A 4I4TE 1OXZA 2WDQA 2IMLA 4HTEA 4PJJA 5DQWA 2N2NA 2WZHA 5M4YA 2V5DA 2HHHT 3H37A 2YN6A 1Y64B 4DV5T 4A56A 2LSKA 2JQ9A 3ONLC 2KWIB 3FBZA 2PFVA 3Q5DA 3GMIA 3ZJ2A 3LBXA 4O2AE 4YHHT 3P8CD 2Y8DA 3CWZB 3T1HT 5EK2A 2H89A 5KX5E 2V6YB 5J1GA 2FUPA 4DIDB 3KV6A 2UXBT 2BG9A 3ZEFB 4LMLA 2BVMA 4L0RA 2XAQB 1NEKA 5LGTB 4KHPT 4GK5E 2H7VC 4QX8B 4JV5T 4QH5A 3JAFA 1BR1A 2VKDA 4A5XA 5DJQC 3AEFA 4KP3C 3AEBA 4YT0A 4U2ZA 4WBOA 3AA6B 3UUNA 5HCMA 3PDYA 3BK9A 3ZC1A 3OYZA 1D0XA 5LJMA 3RRWA 2Z6EA 2WU2A 3RKOA 5H6QB 4PJLA 2ODVA 1NENA 2VB6A 5AQOB 2W66A 2FJEA 4TZ4C 3RHWA 2NW8A 2E5LT 4OFZA 4E7SA 4K0UA 1O3XA 3PTRB 2KSRA 2LOSA 3KINB 4HN9A 1YKHB 3VR9A 4GKKT 4B3ST 3BQIA 1IJ5A 1FMVA 2BS4A 5FXZA 2K9AA 1VCTA 4ZHQE 1XWMA 4WYVA 2CMRA 2V5CA 1D0ZA 1OEDB 5LBQB 3RRCA 4AXPA 2H88A 3KVBA 2ACXA 3JADA 3JC6D 2ZLYA 3BQLA 4C90A 1KK7A 2X0YA 4WBNE 2UUBT 5JDQA 1HF8A 4HWIB 1UX5A 4JI3T 2W67A 1HNXT 4EEBA 3HKDE 2A72A 3HKEE 3PUVF 3L3PA 2CXDA 3GN5A 2UXNB 5GONE 4ANJA 5ABFB 3TLSA 2X68A 2CHNA 4JEUB 2WB5A 3OJAA 3ZCIA 3NRXA 4TNVA 2ZM2A 2WCAA 4Z91A 1IJ6A 4EGWA 4IE4A 4EZHA 3KFWX 4DUZT 3EUHA 2H3RA 2DLRA 2ES0A 3OTOT 3AEAA 1NAFA 3UT5E 3H3AA 3N9PA 1W09A 1CUNA 2ODUA 1R8IA 4H63H 4I55E 3PUSA 5L3GB 2LT3A 1D1CA 1T72A 3I0QA 4ZS2A 4H9SE 4O4HE 4EXTA 2H7OA 3LK3B 3ZCJA 3QC9A 1UK5A 3DJBA 3P4QA 3P7IA 2VL8A 1FJGT 3CKDA 1YKEB 2LSGA 3U3IA 4YFSA 4MBQA 2NR4A 3NWIA 3ZJ1A 5L3DB 1WFDA 3PUGA 4FI5A 3FB2A 2XZEA 5J0ZA 3ZLIA 4DV1T 4O4LE 2Y6XA 3IHRA 3RGLA 5CJ5A 1ZV4X 5CFBA 4F8HA 4Z90A 2LSYA 4L5GA 2N1GA 3UULA 2X9XA 5AQLB 5AQPB 4A97A 3AA0B 2XASB 2V6YA 1AJ3A 1JNRA 1OEDE 3L09A 3ZN1B 4IE6A 5LG4A 3PUWF 5ETWA 3HI2A 4ILBA 3ZYLA 1UUSA 2DWGA 2W00A 4JEHB 3FZMB 4KBMB 5A1LA 3B13A 5HWXA 3UFGA 2CM0A 4H9OC 5DABA 3UU3A 2XSBA 1D1AA 1FIOA 1KFYA 1HX8A 4TWDA 3OBVE 4DR6T 3IBPA 3ONXA 4AQFC 3CX6B 4LF7T 2XQ3A 1T8BA 4PFPA 5FNVE 4ILCA 1WLXA 4H9RC 5FKYA 2V26A 3LSVA 1LVKA 2L8KA 3N5LA 2A3DA 5JR9C 4HKAA 4LFBT 5L3CB 5LP6E 2LEHA 4ZS3A 3H3MA 2LOPA 1WCRA 1N34T 2B76A 4EEDA 4DV4T 2KLQA 3V5SA 4ILAA 2DWKA 2VVSA 3NRYA 2MAWA 3O4XE 1QUUA 4NUUA 4ZXLA 5LOVE 4YJ2E 4PFOA 4EIWA 4QX7B 3AA7B 4ZZCA 2VL0A 4AQYT 2JJ9A 3M3ZB 3RC8A 1OEDA 4NPPA 4ZI3C 1HG5A 1X79A 1YXRA 4N78D 4IDPA 4B3MT 2CPTA 1KNRA 3I9WA 2OA5A 3PJAJ 3VRAA 3AE5A 2W63A 5JREA 2CA5A 2KWHA 2XPKA 3K3QC 3OVUA 4UXNB 3Q2MA 2YKSA 1ZEEA 2FBWA 5HXRA 3RF1A 5JDHA 5ABFA 5EZYE 3JAEA 3BQKA 1N36T 2KNDA 5JDMA 2XQ9A 2XQYA 4DR2T 3SOLA 2XM2A 4X1IE 3Q5EA 2X51A 4IE7A 1HS7A 3TLUA 1HR0T 4ZZBA 4IDZA 4QWNB 3ZKRA 4PK6A 5JDFA 2BG9C 1IBMT 5FVLA 2C5IT 2PBIA 3MZKB 3LFMA 1G8XA 4YLHA 4P0AA 4IE0A 4ZI2C 5LJNA 2XTLA 4U74A 2WSSV 4ILUA 3R6NA 2LLYA 1LKXA 4MLKA 1XDPA 3ZMZB 2VQFT 5AQGB 2UXDT 3HKBE 5L3BB 4ASKA 5CA0E 1V9DA 1NWMX 1XMQT 4DBQA 1OWAA 3ONJA 4M1PA 4JI6T 2L3LA 3FXDB 3VR8A 3AE9A 1IZNB 4YSZA 4XBFB 4DR7T 5FVKA 3RYFE 4YJ3E 2J47A 3FBLA 3AAAB 2ACZA 3A8YC 3ZT7A 3FZFB 2EHOD 2KXPB 1E2AA 4IL9A 4JBWF 4AI6A 4ISSA 2HN1A 1CHUA 2N9DA 1IAPA 2IHR1 2QYWA 2IW5B 4DR1T 3RX6A 2XQ5A 3RIFA 2WM9A 4ERRA 3GA8A 3EDVA 3AE6A 3KV9A 4IT4A 4X62T 2DHRA 2RA1A 3C4XA 1U4QA 2XAJB 3AE7A 3CX8B 2UUCT 3M65A 3CX7B 5JDNA 4YXDA 3AEEA 3AVSA 5KXJA 1T7SA 1BR2A 2DL1A 1Z8UA 2WBLA 4OYKA 4HFIA 4MALA 5F3JA 3ETVA 3ZYMA 3CQCB 2NTXA 5FY0A 5AQUB 3ZMVB 1W0AA 2WMOA 3RKGA 4HWDA 1ZKEA 2M67A 5L47A 3OPCA 4EAHA 1HTJF 3TLVA 2XQAA 2JMHA 5BR8T 4NXMT 5HEJA 5JVDE 2X9YA 1VCSA 5EK3A 3PUYF 2EHOB 4P09A 5FY1A 4LFAT 4DV2T 3RC3A 2CLYB 3OYXA 1VRBA 3ZPOA 4HWFA 2JQHA 2MBGA 4CXXA 3E0ZA 2FJBA 1KNZA 2C5JA 2CCQA 3TLTA 2HPLA 5JH7E 5HEUA 3AE2A 4Q25A 3AE8A 1XDOA 1LVFA
chains in the Genus database with same CATH topology
3M3ZB 5AQFB 1HX1B 4HWHA 5AQVB 5AQUB 5AQHB 5AQKB 4HWIB 3FZHB 1UGOA 5AQMB 3FZLB 5AQNB 5AQPB 3A8YC 5AQIB 5AQTB 3FZFB 4HWDA 1T7SA 5AQLB 1UK5A 3FZMB 5AQQB 5AQSB 5AQOB 5AQRB 1I6ZA 4HWCA 3LDQB 1M62A 5AQGB 3FZKB 5AQJB 1M7KA 4HWFA 2D9DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M3Z B;  5AQF B;  1HX1 B;  4HWH A;  5AQV B;  5AQU B;  5AQH B;  5AQK B;  4HWI B;  3FZH B;  1UGO A;  5AQM B;  3FZL B;  5AQN B;  5AQP B;  3A8Y C;  5AQI B;  5AQT B;  3FZF B;  4HWD A;  1T7S A;  5AQL B;  1UK5 A;  3FZM B;  5AQQ B;  5AQS B;  5AQO B;  5AQR B;  1I6Z A;  4HWC A;  3LDQ B;  1M62 A;  5AQG B;  3FZK B;  5AQJ B;  1M7K A;  4HWF A;  2D9D A; 
#chains in the Genus database with same CATH topology
 4Z8X A;  1J1J A;  2HPJ A;  3AAE B;  2JIW A;  2WDV A;  1J5E T;  4O4I E;  5LXT E;  4U2Y A;  4V1A v;  3RQW A;  2WMN A;  4KHZ F;  2JMK A;  2JRK A;  4CN1 A;  2ZM8 A;  3SFD A;  1BR4 A;  3CPZ A;  2KT9 A;  1N33 T;  3AVR A;  2HH7 A;  1IBL T;  4HFC A;  3IA3 A;  2G0U A;  3UTK A;  2CE7 A;  4U72 A;  3TKL B;  5BMV E;  2F4V T;  3B5M A;  3RIA A;  3PU8 A;  1M62 A;  4B3R T;  2FJA A;  3R84 B;  2WWU A;  1HNZ T;  2UU9 T;  5LA6 E;  2IDO B;  3SS1 A;  4ZI3 D;  2IC6 A;  1MMG A;  3F2E A;  5LMN T;  2XSA A;  3ZT6 A;  5C3J A;  3PU3 A;  3FZK B;  3SWH A;  4QH4 A;  5L4E A;  5LYJ E;  3KBU A;  4ZEY A;  4X5T A;  2E9X D;  1E7P A;  2D5U A;  5JQG E;  4DV6 T;  3ZMS B;  4COF A;  4EYU A;  2Q9Q D;  2M6I A;  3SRZ A;  4QXH B;  3AED A;  2LSJ A;  3HA4 A;  1Y01 A;  2JQK A;  3CVR A;  5CGM A;  3VKG A;  3FZH B;  5LG3 A;  4PK4 A;  3F57 A;  2P9B A;  2XJ7 A;  2E5V A;  3AEG A;  3JCF A;  4CQI A;  4EYY R;  2UUA T;  2XY8 B;  2CEA A;  1UUR A;  4OX9 T;  2LHN A;  5AQF B;  4HGA A;  2R6G F;  4DO0 A;  1OED C;  3RI5 A;  5AQT B;  4U3C A;  2GK9 A;  4KI0 F;  3AAI A;  3N9O A;  5JTG A;  4AKR B;  4TUY E;  2BS2 A;  2X9W A;  3A5X A;  1MND A;  3NZQ A;  2XAH B;  1QLB A;  4EB6 E;  4TV8 E;  2YDR A;  2BZB A;  4H63 V;  4H9P C;  2K5B B;  2BBH A;  5F5W A;  2E9X B;  2MYS A;  4J2C A;  2Q9Q B;  5FY7 A;  3N9Q A;  2VK9 A;  4IE5 A;  4UVC B;  4DR4 T;  5ABH A;  4FJO A;  4WZX A;  4UF0 B;  1EZ3 A;  1S94 A;  2EHO A;  4U33 A;  4O8S A;  4QXB B;  1H7C A;  1UX4 A;  2V7M A;  2UXC T;  2XQ6 A;  2V7L A;  4UEL A;  3I1A A;  3W15 B;  2X0L B;  4QHO A;  5IHY A;  5LHH B;  3N9L A;  5J2U E;  4YSX A;  4DMW A;  1XNR T;  4IDO A;  1KEY A;  3K3O A;  4NXN T;  3QB5 K;  4LMJ A;  3TLW A;  3LJC A;  1ZP0 A;  2BBJ A;  2V8S V;  5CB4 E;  3PE0 A;  3L8R A;  3O1I A;  3DP7 A;  4BJM A;  1QSD A;  4HFV A;  4OYJ A;  1WYC A;  4MHC A;  2ZM6 T;  3N9N A;  3NVO A;  5AQH B;  5IWA T;  3ETU A;  5KMG P;  4HFH A;  2LSI A;  4QKN A;  3ESL A;  2YEV C;  1G73 A;  4O4J E;  3P4W A;  2W2U A;  2A9U A;  4H9N C;  2IUB A;  5FXV A;  5FP3 A;  4GOU A;  2QVA A;  1BR0 A;  1L0V A;  4HFB A;  4JI4 T;  2W4X A;  4XAX B;  2WQY A;  2PG8 A;  3GWH A;  3AE3 A;  3CQG B;  4EV6 A;  4GYR A;  1XMO T;  3EDU A;  2CWO A;  1E1H B;  2YIN A;  2LE8 A;  2NW7 A;  3KV4 A;  4IGU A;  4O2B E;  5HYA A;  3PV0 F;  1SHZ C;  2RP4 A;  4AQG A;  4BJN A;  2DCF A;  2XHE B;  4B6X A;  3UUM A;  1MIV A;  2BS3 A;  2E2A A;  3UFE A;  4QH1 A;  2NP9 A;  3P4P A;  2DNX A;  2J1D G;  2YDQ A;  2LRK A;  3T1Y T;  1FEW A;  1N32 T;  3ZST A;  2BKN A;  1S35 A;  2WDR A;  4AKL A;  4AKG A;  3ZYK A;  2WAU A;  5AQN B;  4PJN A;  5HXC A;  4IIJ E;  4TX5 A;  4WNK A;  2XAF B;  4TWF A;  2V1D B;  3HL6 A;  3P4R A;  4AIS A;  3AA1 B;  3EAB A;  3MKD A;  2D9D A;  3QB5 A;  4YTN A;  2OLT A;  2CXF A;  1IBK T;  1YQ3 A;  3K1S A;  2BKO A;  2WS3 A;  4AKH A;  2IIU A;  3J9X 1;  2ZM0 A;  1MMN A;  4LF4 T;  3HKC E;  3WAK A;  5L2L A;  3ZMT B;  4X65 T;  2OV9 A;  2NWB A;  3RYC E;  4NUV A;  2K3W A;  2D0T A;  2LM9 A;  3S4U A;  2WWV A;  2NTY A;  1W0B A;  3NKZ A;  4EZ4 A;  2KZ7 B;  4KMC A;  2E9X A;  4DVD A;  2PTF A;  5HWY A;  2VQE T;  3N9M A;  4AIU A;  3RIU A;  3ZT5 A;  2Q9Q A;  4IL4 A;  3O1J A;  3K3N A;  3FXE B;  4TV9 E;  4X1Y E;  3O9X A;  2ZMA A;  4UF0 A;  3RLF F;  2Y48 B;  1T98 A;  4LMK A;  5ABG A;  2L9Q A;  4NIQ A;  1D1B A;  3T8O A;  2VUR A;  4ZI7 E;  3AE1 A;  2LJL A;  4PNI A;  4P1N A;  4JI0 T;  2CBJ A;  2QA7 A;  3HR0 A;  3C50 A;  4KUM B;  4IHJ E;  2FJD A;  2QRX A;  4HWC A;  3NBX X;  5LHI B;  2K48 A;  4PW8 A;  3CIR A;  1KNP A;  3VHL A;  2VWA A;  4QXC B;  3UQ4 A;  3VU7 H;  1D0Y A;  2YK0 A;  5L3E B;  3WAJ A;  2LKG A;  3QOF A;  4UR9 A;  4X1K E;  5DQV A;  3PUX F;  2CWY A;  4TWH A;  1ZOY A;  1MMA A;  1WRD A;  4JI2 T;  2JPF A;  2LM2 A;  3C98 B;  4DV0 T;  4U7I A;  3G06 A;  2X67 A;  4UVB B;  2DI4 A;  1M7K A;  3NZP A;  5FXX A;  3C64 A;  4DR3 T;  4HFE A;  3V5U A;  4CI3 B;  2SPC A;  3PUZ F;  5HXS A;  2MPK A;  2XAG B;  3Q5W A;  5TAO A;  3KVA A;  4ADZ A;  3O1H A;  4HE8 A;  3X1D A;  2V7K A;  4EOZ B;  1YD8 G;  5AQV B;  2V6X A;  2NW9 A;  3AEC A;  2CRB A;  1WR0 A;  3UU8 A;  3EVY A;  2LKH A;  4MFR A;  3RQU A;  2C5K T;  5IUX A;  5AQQ B;  4YY3 T;  5AFU L;  5C2T A;  4IRE A;  4YSY A;  4HFD A;  5F8P A;  4IDN A;  2V7I A;  4JYA T;  4AKI A;  5LGU B;  4I50 E;  4LF9 T;  4X66 T;  4G2A A;  5LNK A;  4IST A;  3K8P C;  1Z0P A;  1HG2 A;  4L9I A;  4E7Z A;  3UUB A;  2IAK A;  4LF8 T;  2LHR A;  4CI2 B;  4YHJ A;  3MJX A;  1ZHC A;  2MTQ A;  2EHO C;  2VKO A;  4JI5 T;  3ANW B;  3UU5 A;  3AXJ B;  3L39 A;  4C91 A;  2CLY C;  4BA9 A;  1GQE A;  1HFA A;  5L4H A;  1XNQ T;  5J2T E;  3MXZ A;  3P4S A;  1SUM B;  3J7Y q;  2XM1 A;  5AQK B;  1HNW T;  2HN2 A;  3I0O A;  1X9B A;  1I94 T;  2M6B A;  4CXY A;  3N2O A;  4UIG A;  3LK2 B;  4I0U A;  1MIW A;  3EAM A;  3UQ7 A;  3PUQ A;  1W9R A;  1FMW A;  5JRC B;  5JR9 B;  2X66 A;  4DUY T;  2CHO A;  5FL1 A;  4I43 B;  3KBT A;  4DMV A;  4PAG A;  4B3T T;  1WR6 A;  4CXW A;  3F31 A;  3PUR A;  4ZI2 D;  3C4W A;  3FHN A;  2X9H A;  5HEH A;  2CBI A;  2K24 A;  5AQR B;  2X0H A;  2D2S A;  4GKJ T;  2XQ8 A;  2V7J A;  3E08 A;  5EK4 A;  4DV3 T;  3ZC0 A;  3VKH A;  2WZI A;  4XZC A;  5FXW A;  3U78 A;  2CXL A;  4TNW A;  1MNE A;  2AXD S;  4GK0 E;  3MA9 A;  4K0K T;  1WYB A;  2B1E A;  2PJQ A;  5LGN B;  3QNU A;  4PJM A;  2YOE A;  1KF6 A;  4UEM A;  4WW0 A;  5E0O A;  4DND A;  5C8Y E;  1YW0 A;  4HEA A;  3N2G E;  1UGO A;  5FYM A;  5HAX A;  3SFE A;  5IYZ E;  4X64 T;  1UCU A;  4UV9 B;  3Q9D A;  1US7 B;  2I6H A;  4KX6 A;  1JNZ A;  4TN7 B;  3LBX B;  3EHZ A;  4X20 E;  4DR5 T;  5AQM B;  3FZL B;  5KDM C;  4CN6 A;  1MMD A;  4A98 A;  3VRB A;  5FL0 A;  5HXH A;  2BKP A;  2J4G A;  4DV7 T;  2BG9 B;  2C0S A;  2VVN A;  4DBR A;  4G63 A;  4CI1 B;  2W0G A;  4GIW A;  2VKJ A;  3AB3 B;  4F6R C;  4JLE A;  5LB7 B;  1VOM A;  3DTO A;  3JC6 C;  1SE7 A;  2NOX A;  4JUY A;  2XQ4 A;  1LRZ A;  5HEO A;  3ZN0 B;  4CZZ B;  2KIN B;  5ADX L;  3LDQ B;  3QUJ A;  2WP9 A;  2VAS A;  4ZOL E;  2UXX B;  2XQ7 A;  5LBM A;  2XUE A;  2W62 A;  3OKQ A;  2LRL A;  4UV8 B;  4LF6 T;  5HXE A;  5HCJ A;  4JI7 T;  1DU2 A;  3IEE A;  2IC9 A;  2YU1 A;  4GYS A;  3LK4 2;  1SA0 E;  1XZY A;  2YU2 A;  2WY2 A;  2YDS A;  1I6Z A;  2BVL A;  2E9X C;  4OK0 A;  4UVA B;  3UU4 A;  4CN4 A;  3RIU C;  2Q9Q C;  2KMF A;  1J5W A;  5HEG A;  4LF5 T;  2W61 A;  3P50 A;  2VKH A;  3C4Z A;  3PUA A;  3E22 E;  3RPU A;  3KDS E;  3PJA A;  5JDG A;  1YQ4 A;  4BAY B;  3MK7 C;  2J62 A;  3ANW A;  3AXJ A;  5L3F B;  2I0M A;  1MIY A;  3CQX C;  1U5P A;  4OHF A;  3IF8 B;  2QGS A;  5CA1 E;  2D0U A;  5AQI B;  5H6R B;  5LHG B;  5ABE A;  4AQF A;  4PK5 A;  5FMN A;  3EI0 A;  3I9Y A;  2BG9 E;  5AQJ B;  2I59 A;  3ABV A;  3ZMU B;  4YTP A;  3GN5 B;  1HCI A;  2JQQ A;  2RPA A;  4LFC T;  5JRC A;  3D0T A;  3MAC A;  5JR9 A;  4YTM A;  5LCY A;  4U31 A;  3B57 A;  3Q5X A;  3N2K E;  5AQS B;  4P0B A;  4U7Y A;  2A2F X;  3RH3 A;  3UUX B;  3UU6 A;  4JI8 T;  4JI1 T;  2AE9 A;  3AE4 A;  3CK6 A;  3KV5 A;  3WI3 A;  4H9Q C;  3A7M A;  3C51 A;  5LMU T;  5JDL A;  3RYI E;  2WU5 A;  3ZSS A;  2BDE A;  4IDQ A;  2MOZ A;  3CML A;  2E8I A;  1HX1 B;  4HWH A;  3LG7 A;  3RYH E;  1B7T A;  3QK6 A;  4I4T E;  1OXZ A;  2WDQ A;  2IML A;  4HTE A;  4PJJ A;  5DQW A;  2N2N A;  2WZH A;  5M4Y A;  2V5D A;  2HHH T;  3H37 A;  2YN6 A;  1Y64 B;  4DV5 T;  4A56 A;  2LSK A;  2JQ9 A;  3ONL C;  2KWI B;  3FBZ A;  2PFV A;  3Q5D A;  3GMI A;  3ZJ2 A;  3LBX A;  4O2A E;  4YHH T;  3P8C D;  2Y8D A;  3CWZ B;  3T1H T;  5EK2 A;  2H89 A;  5KX5 E;  2V6Y B;  5J1G A;  2FUP A;  4DID B;  3KV6 A;  2UXB T;  2BG9 A;  3ZEF B;  4LML A;  2BVM A;  4L0R A;  2XAQ B;  1NEK A;  5LGT B;  4KHP T;  4GK5 E;  2H7V C;  4QX8 B;  4JV5 T;  4QH5 A;  3JAF A;  1BR1 A;  2VKD A;  4A5X A;  5DJQ C;  3AEF A;  4KP3 C;  3AEB A;  4YT0 A;  4U2Z A;  4WBO A;  3AA6 B;  3UUN A;  5HCM A;  3PDY A;  3BK9 A;  3ZC1 A;  3OYZ A;  1D0X A;  5LJM A;  3RRW A;  2Z6E A;  2WU2 A;  3RKO A;  5H6Q B;  4PJL A;  2ODV A;  1NEN A;  2VB6 A;  5AQO B;  2W66 A;  2FJE A;  4TZ4 C;  3RHW A;  2NW8 A;  2E5L T;  4OFZ A;  4E7S A;  4K0U A;  1O3X A;  3PTR B;  2KSR A;  2LOS A;  3KIN B;  4HN9 A;  1YKH B;  3VR9 A;  4GKK T;  4B3S T;  3BQI A;  1IJ5 A;  1FMV A;  2BS4 A;  5FXZ A;  2K9A A;  1VCT A;  4ZHQ E;  1XWM A;  4WYV A;  2CMR A;  2V5C A;  1D0Z A;  1OED B;  5LBQ B;  3RRC A;  4AXP A;  2H88 A;  3KVB A;  2ACX A;  3JAD A;  3JC6 D;  2ZLY A;  3BQL A;  4C90 A;  1KK7 A;  2X0Y A;  4WBN E;  2UUB T;  5JDQ A;  1HF8 A;  4HWI B;  1UX5 A;  4JI3 T;  2W67 A;  1HNX T;  4EEB A;  3HKD E;  2A72 A;  3HKE E;  3PUV F;  3L3P A;  2CXD A;  3GN5 A;  2UXN B;  5GON E;  4ANJ A;  5ABF B;  3TLS A;  2X68 A;  2CHN A;  4JEU B;  2WB5 A;  3OJA A;  3ZCI A;  3NRX A;  4TNV A;  2ZM2 A;  2WCA A;  4Z91 A;  1IJ6 A;  4EGW A;  4IE4 A;  4EZH A;  3KFW X;  4DUZ T;  3EUH A;  2H3R A;  2DLR A;  2ES0 A;  3OTO T;  3AEA A;  1NAF A;  3UT5 E;  3H3A A;  3N9P A;  1W09 A;  1CUN A;  2ODU A;  1R8I A;  4H63 H;  4I55 E;  3PUS A;  5L3G B;  2LT3 A;  1D1C A;  1T72 A;  3I0Q A;  4ZS2 A;  4H9S E;  4O4H E;  4EXT A;  2H7O A;  3LK3 B;  3ZCJ A;  3QC9 A;  1UK5 A;  3DJB A;  3P4Q A;  3P7I A;  2VL8 A;  1FJG T;  3CKD A;  1YKE B;  2LSG A;  3U3I A;  4YFS A;  4MBQ A;  2NR4 A;  3NWI A;  3ZJ1 A;  5L3D B;  1WFD A;  3PUG A;  4FI5 A;  3FB2 A;  2XZE A;  5J0Z A;  3ZLI A;  4DV1 T;  4O4L E;  2Y6X A;  3IHR A;  3RGL A;  5CJ5 A;  1ZV4 X;  5CFB A;  4F8H A;  4Z90 A;  2LSY A;  4L5G A;  2N1G A;  3UUL A;  2X9X A;  5AQL B;  5AQP B;  4A97 A;  3AA0 B;  2XAS B;  2V6Y A;  1AJ3 A;  1JNR A;  1OED E;  3L09 A;  3ZN1 B;  4IE6 A;  5LG4 A;  3PUW F;  5ETW A;  3HI2 A;  4ILB A;  3ZYL A;  1UUS A;  2DWG A;  2W00 A;  4JEH B;  3FZM B;  4KBM B;  5A1L A;  3B13 A;  5HWX A;  3UFG A;  2CM0 A;  4H9O C;  5DAB A;  3UU3 A;  2XSB A;  1D1A A;  1FIO A;  1KFY A;  1HX8 A;  4TWD A;  3OBV E;  4DR6 T;  3IBP A;  3ONX A;  4AQF C;  3CX6 B;  4LF7 T;  2XQ3 A;  1T8B A;  4PFP A;  5FNV E;  4ILC A;  1WLX A;  4H9R C;  5FKY A;  2V26 A;  3LSV A;  1LVK A;  2L8K A;  3N5L A;  2A3D A;  5JR9 C;  4HKA A;  4LFB T;  5L3C B;  5LP6 E;  2LEH A;  4ZS3 A;  3H3M A;  2LOP A;  1WCR A;  1N34 T;  2B76 A;  4EED A;  4DV4 T;  2KLQ A;  3V5S A;  4ILA A;  2DWK A;  2VVS A;  3NRY A;  2MAW A;  3O4X E;  1QUU A;  4NUU A;  4ZXL A;  5LOV E;  4YJ2 E;  4PFO A;  4EIW A;  4QX7 B;  3AA7 B;  4ZZC A;  2VL0 A;  4AQY T;  2JJ9 A;  3M3Z B;  3RC8 A;  1OED A;  4NPP A;  4ZI3 C;  1HG5 A;  1X79 A;  1YXR A;  4N78 D;  4IDP A;  4B3M T;  2CPT A;  1KNR A;  3I9W A;  2OA5 A;  3PJA J;  3VRA A;  3AE5 A;  2W63 A;  5JRE A;  2CA5 A;  2KWH A;  2XPK A;  3K3Q C;  3OVU A;  4UXN B;  3Q2M A;  2YKS A;  1ZEE A;  2FBW A;  5HXR A;  3RF1 A;  5JDH A;  5ABF A;  5EZY E;  3JAE A;  3BQK A;  1N36 T;  2KND A;  5JDM A;  2XQ9 A;  2XQY A;  4DR2 T;  3SOL A;  2XM2 A;  4X1I E;  3Q5E A;  2X51 A;  4IE7 A;  1HS7 A;  3TLU A;  1HR0 T;  4ZZB A;  4IDZ A;  4QWN B;  3ZKR A;  4PK6 A;  5JDF A;  2BG9 C;  1IBM T;  5FVL A;  2C5I T;  2PBI A;  3MZK B;  3LFM A;  1G8X A;  4YLH A;  4P0A A;  4IE0 A;  4ZI2 C;  5LJN A;  2XTL A;  4U74 A;  2WSS V;  4ILU A;  3R6N A;  2LLY A;  1LKX A;  4MLK A;  1XDP A;  3ZMZ B;  2VQF T;  5AQG B;  2UXD T;  3HKB E;  5L3B B;  4ASK A;  5CA0 E;  1V9D A;  1NWM X;  1XMQ T;  4DBQ A;  1OWA A;  3ONJ A;  4M1P A;  4JI6 T;  2L3L A;  3FXD B;  3VR8 A;  3AE9 A;  1IZN B;  4YSZ A;  4XBF B;  4DR7 T;  5FVK A;  3RYF E;  4YJ3 E;  2J47 A;  3FBL A;  3AAA B;  2ACZ A;  3A8Y C;  3ZT7 A;  3FZF B;  2EHO D;  2KXP B;  1E2A A;  4IL9 A;  4JBW F;  4AI6 A;  4ISS A;  2HN1 A;  1CHU A;  2N9D A;  1IAP A;  2IHR 1;  2QYW A;  2IW5 B;  4DR1 T;  3RX6 A;  2XQ5 A;  3RIF A;  2WM9 A;  4ERR A;  3GA8 A;  3EDV A;  3AE6 A;  3KV9 A;  4IT4 A;  4X62 T;  2DHR A;  2RA1 A;  3C4X A;  1U4Q A;  2XAJ B;  3AE7 A;  3CX8 B;  2UUC T;  3M65 A;  3CX7 B;  5JDN A;  4YXD A;  3AEE A;  3AVS A;  5KXJ A;  1T7S A;  1BR2 A;  2DL1 A;  1Z8U A;  2WBL A;  4OYK A;  4HFI A;  4MAL A;  5F3J A;  3ETV A;  3ZYM A;  3CQC B;  2NTX A;  5FY0 A;  5AQU B;  3ZMV B;  1W0A A;  2WMO A;  3RKG A;  4HWD A;  1ZKE A;  2M67 A;  5L47 A;  3OPC A;  4EAH A;  1HTJ F;  3TLV A;  2XQA A;  2JMH A;  5BR8 T;  4NXM T;  5HEJ A;  5JVD E;  2X9Y A;  1VCS A;  5EK3 A;  3PUY F;  2EHO B;  4P09 A;  5FY1 A;  4LFA T;  4DV2 T;  3RC3 A;  2CLY B;  3OYX A;  1VRB A;  3ZPO A;  4HWF A;  2JQH A;  2MBG A;  4CXX A;  3E0Z A;  2FJB A;  1KNZ A;  2C5J A;  2CCQ A;  3TLT A;  2HPL A;  5JH7 E;  5HEU A;  3AE2 A;  4Q25 A;  3AE8 A;  1XDO A;  1LVF A; 
#chains in the Genus database with same CATH homology
 3M3Z B;  5AQF B;  1HX1 B;  4HWH A;  5AQV B;  5AQU B;  5AQH B;  5AQK B;  4HWI B;  3FZH B;  1UGO A;  5AQM B;  3FZL B;  5AQN B;  5AQP B;  3A8Y C;  5AQI B;  5AQT B;  3FZF B;  4HWD A;  1T7S A;  5AQL B;  1UK5 A;  3FZM B;  5AQQ B;  5AQS B;  5AQO B;  5AQR B;  1I6Z A;  4HWC A;  3LDQ B;  1M62 A;  5AQG B;  3FZK B;  5AQJ B;  1M7K A;  4HWF A;  2D9D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...