5AQRB

Fragment-based screening of hsp70 sheds light on the functional role of atp-binding site residues
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
112
structure length
112
Chain Sequence
GSNSPQEEVELKKLKHLEKSVEKIADQLEELNKELTGIQQGFLPKDLQAEALCKLDRRVKATIEQFMKILEEIDTLILPENFKDSRLKRKGLVKKVQAFLAECDTVEQNICQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords HEAT SHOCK COGNATE 71 KDA PROTEIN
publication title A fragment-based approach applied to a highly flexible target: Insights and challenges towards the inhibition of HSP70 isoforms.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chaperone
total genus 45
structure length 112
sequence length 112
chains with identical sequence D, F
ec nomenclature
pdb deposition date 2015-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02179 BAG BAG domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.120 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 BAG domain 5aqrB00
3FZLB 1I6ZA 4HWCA 3FZMB 5AQVB 5AQIB 5AQOB 3FZFB 5AQQB 5AQLB 1HX1B 1UGOA 3FZHB 5AQSB 1UK5A 5AQRB 5AQHB 5AQTB 1M7KA 3LDQB 3FZKB 5AQJB 5AQFB 5AQGB 5AQMB 5AQNB 5AQUB 3M3ZB 2D9DA 1M62A 4HWFA 5AQPB 3A8YC 5AQKB 1T7SA 4HWIB 4HWHA 4HWDA
chains in the Genus database with same CATH superfamily
5LJMA 4I43B 2XQ8A 5ABFB 2IIUA 2WCAA 3K3NA 4PK5A 2RP4A 5JTGA 5JVDE 5FXXA 5LJNA 2CEAA 3LSVA 2XQ6A 3SFEA 2W61A 3ZJ2A 4DR6T 3P4SA 3AB3B 3GA8A 4ANJA 5F8PA 1HR0T 4HEAA 2BS4A 1XNRT 2WS3A 4DNDA 3C4WA 2XSAA 2BVMA 4UELA 4AQYT 3K8PC 4QH5A 3QK6A 3TLTA 2NR4A 2NP9A 2FJBA 3R6NA 2BKPA 3ZYLA 4GK0E 3CMLA 5AFUL 4H9SE 4CXXA 4HFVA 3D0TA 1XNQT 3C98B 2HHHT 3L8RA 2KWIB 2WDRA 1ZEEA 3PUXF 2XJ7A 4LF4T 5JDNA 4A56A 2WZIA 2N2NA 2A3DA 2IMLA 2Q9QA 3RIAA 1FJGT 5AQUB 5FXZA 4A5XA 2AXDS 4DV5T 3RRCA 5IYZE 3SWHA 2FJAA 3AE8A 5E0OA 4JI7T 4WNKA 3FBLA 4QXHB 4DV0T 1MMNA 5J1GA 4KI0F 3RHWA 2NW8A 4X1KE 5LXTE 1MIYA 3AXJA 1YQ4A 5LMUT 4AQFA 1G73A 1IJ5A 2BG9E 2XHEB 4FJOA 1FMWA 4JI5T 3K3OA 3P4QA 3UFEA 4H63H 4A98A 2CCQA 3AECA 4G63A 4ILAA 2IUBA 3A7MA 3C51A 4ZI3D 2LSKA 2M67A 3N9NA 1M7KA 4AKHA 3QB5K 4QKNA 2A72A 4E7ZA 2WB5A 5FY0A 3LK42 3O1JA 4TX5A 1BR1A 4EAHA 2SPCA 4CN4A 1I94T 4U74A 3P4PA 1B7TA 3M3ZB 4HFEA 1KNZA 3IBPA 1MMAA 4QXBB 2EHOC 1HNWT 2LM2A 3FBZA 2UXNB 5HCMA 2WZHA 4DV1T 3MXZA 4JBWF 3T1YT 2ACZA 1WR0A 5LHGB 4O4IE 2BG9A 3PUWF 1S35A 1ZP0A 2LE8A 2KT9A 4QX7B 5CFBA 3HI2A 3PUGA 4U3CA 3M65A 1R8IA 3VR8A 5HEJA 4B6XA 1S94A 5FXVA 2C5KT 4YJ2E 1YQ3A 2LSJA 5L4EA 2E8IA 2YDQA 4TNWA 1ZHCA 2LKHA 3HKEE 2IC6A 2XAJB 3E08A 1LVKA 2F4VT 4JEUB 4BA9A 2CMRA 3Q5XA 1UK5A 5HAXA 1IZNB 1VCSA 2XQYA 2LHNA 3RYFE 2WU5A 3H3MA 1D0XA 1JNZA 1OEDB 2H7OA 4ILUA 3QUJA 2UUAT 5JRCA 2JPFA 2RPAA 5AQVB 3ZSTA 2ES0A 3ZT6A 2G0UA 1QLBA 2MBGA 2DNXA 3QB5A 5M4YA 2CBJA 3TLUA 3CQXC 4CZZB 2XQ5A 2WWUA 2W4XA 4TWDA 2HN2A 3LBXA 5AQHB 4AQGA 3RF1A 2VKHA 4EXTA 3UUBA 3O1HA 2D9DA 4HWFA 4YHJA 4I50E 2YU1A 3UQ7A 5LBQB 3HL6A 1UGOA 3ZYKA 3UUMA 4ZZCA 4UF0A 4XZCA 2W66A 2ZMAA 3HKDE 2CLYC 3RRWA 3X1DA 3P4RA 3OBVE 2ZM2A 4O2BE 3A8YC 4IE6A 4WBOA 2JRKA 4C90A 2NWBA 4QWNB 4DMVA 3FZMB 3P4WA 3ZN1B 3F57A 2HH7A 4H63V 2FJEA 1FMVA 1IBKT 3P8CD 3I9WA 5JDLA 2JQHA 3AA6B 4QH1A 5LG4A 1OXZA 4TN7B 5FYMA 5J0ZA 1YW0A 4XAXB 4F8HA 3UUXB 4GKJT 1YKEB 3ZT5A 5IWAT 3OYZA 4EB6E 3UU6A 2BKOA 3QNUA 1GQEA 4QXCB 2BDEA 3PUVF 3G06A 4N78D 4CN6A 2Q9QB 1Z0PA 5L2LA 1WCRA 2AE9A 1CHUA 3W15B 4U33A 5HWYA 2QYWA 3ZMTB 2H3RA 3PU8A 5C3JA 4AI6A 2X0YA 1XWMA 5BR8T 4LF5T 3ZMZB 4JI0T 3V5SA 3AXJB 3R84B 4IE0A 5KXJA 3EDUA 1SA0E 3N2GE 3GMIA 2XY8B 2OV9A 5HWXA 4Z91A 2V6XA 4JV5T 4DMWA 3CX7B 3PJAJ 3KBUA 2JQKA 3HA4A 4QX8B 4LF9T 2WDVA 4ZEYA 4K0KT 4X1IE 1MNDA 3NZQA 1VOMA 3I0QA 4DV3T 3H3AA 1WR6A 3VKGA 4YTMA 2QA7A 3AVRA 4LMKA 4WW0A 2DL1A 4O2AE 4U7YA 3HKBE 3JADA 3AA1B 2LRKA 5DJQC 1HG2A 4ASKA 1BR2A 5LB7B 4KHZF 3EAMA 4IREA 4ADZA 4PNIA 5HXSA 3FZHB 2BBHA 3KVBA 2J47A 3ESLA 3RLFF 5AQJB 3RI5A 4GK5E 4XBFB 3WAJA 3UQ4A 2LSYA 3NBXX 2JQQA 2V7KA 2UXBT 4MBQA 4P0BA 3F31A 4HN9A 4HGAA 1VRBA 4B3TT 2BG9B 4ZI2C 4JI8T 3B5MA 1IAPA 2CXDA 4ZOLE 5LP6E 3RC3A 3MKDA 2H7VC 3EI0A 4UEMA 4ZHQE 5A1LA 4KUMB 2H88A 3ZC0A 4PJNA 2VK9A 2LSIA 1KF6A 5FY7A 2DWGA 1W0BA 2X66A 2V6YA 3CK6A 4AIUA 5ABEA 5HXCA 2H89A 5LCYA 4UIGA 3KV9A 5AQSB 5FY1A 4YT0A 3ZKRA 5JDHA 4NXNT 2J1DG 2QVAA 5JRCB 4OYKA 2WM9A 1M62A 3SFDA 1HF8A 4YTPA 1KNPA 2XPKA 3SOLA 2C0SA 3RYCE 3A5XA 4EEBA 3LDQB 2DWKA 3OKQA 4DR3T 4OK0A 1J5WA 4TWFA 4JI2T 2WDQA 4GYRA 1I6ZA 4QH4A 2XQ7A 2CWOA 3LBXB 4YSXA 3PURA 5DQWA 4QHOA 4MLKA 4UR9A 2HN1A 2XQ9A 3O9XA 1SHZC 4E7SA 4H9NC 4MALA 3RIUA 1HNZT 2M6BA 3E22E 4EZ4A 3UTKA 2E2AA 2YKSA 5EK4A 5L3DB 4UF0B 5AQOB 2UUCT 5HXHA 1J5ET 3VR9A 5C8YE 5LGUB 4GOUA 3ONLC 4NUUA 5JR9A 4X1YE 2YK0A 3CKDA 3LJCA 3ANWA 4PW8A 5LGTB 3FXEB 3BQLA 1ZOYA 1BR0A 1UUSA 2V7IA 2N9DA 2NTYA 5BMVE 3N9PA 4AKIA 2XM1A 3AAEB 2WMNA 1E1HB 5L3EB 2EHOD 3UU8A 4Q25A 2VQET 2C5JA 4EEDA 5GONE 1N36T 1HX1B 3AAIA 3PTRB 5C2TA 5FNVE 3ZPOA 2PJQA 2PG8A 2VVSA 4IDZA 2MAWA 3MJXA 3ZC1A 5LHIB 5DQVA 2B76A 3F2EA 3AE5A 3V5UA 4IDNA 3QC9A 1UX5A 2W62A 3TLVA 4IL9A 3RYHE 3U78A 4L0RA 1N34T 2X51A 1N32T 3N2OA 4NPPA 4AXPA 2M6IA 3T1HT 4ZZBA 2DLRA 1OWAA 4CI2B 4HWIB 4YJ3E 2WWVA 1W9RA 2J62A 1T98A 4DR1T 5ABFA 5ADXL 4MHCA 2PFVA 4NUVA 1SUMB 3L3PA 4IT4A 4I55E 2A9UA 3ZCJA 1XZYA 2CRBA 1YXRA 4B3ST 1V9DA 2L3LA 3TLSA 3N5LA 2MOZA 4UV8B 5AQTB 3UT5E 2KSRA 4A97A 4CXWA 3ZSSA 1AJ3A 3Q2MA 1DU2A 4TZ4C 2CM0A 1OEDC 3KV6A 4I4TE 2KLQA 4WZXA 3PJAA 1EZ3A 4IIJE 3ZJ1A 2YDRA 4DO0A 3HR0A 2LEHA 4WYVA 2WU2A 5EZYE 2QRXA 1XMQT 3SRZA 1FIOA 2CXLA 2WBLA 2VASA 3JAEA 3JC6D 1NENA 2KMFA 3OJAA 2ODUA 3E0ZA 2IW5B 3I9YA 4H9PC 4HFIA 4IGUA 4TNVA 3ZLIA 5JDMA 1BR4A 3CPZA 4C91A 2V5CA 5F5WA 5CJ5A 5KMGP 3JC6C 2CHNA 2ZM8A 1IBMT 5DABA 2LKGA 3Q9DA 2LSGA 3OVUA 2LOSA 4KHPT 2CXFA 5FL1A 5AQNB 2V26A 4DR2T 2FUPA 3RQUA 3Q5DA 5L3FB 4IE4A 3PUZF 3DP7A 5KDMC 3UU3A 5HCJA 3OTOT 3MZKB 2V6YB 4PJMA 4YSYA 4H9OC 5HEOA 2I0MA 2D0UA 3CQCB 4JI3T 4NXMT 2VKDA 2XQAA 2XM2A 4JEHB 3C4XA 2LLYA 2MPKA 5J2UE 3RQWA 3C64A 4LF6T 2XUEA 4PAGA 2YU2A 4DUZT 1MIWA 2MTQA 2E9XD 5H6RB 2VVNA 2BVLA 4KBMB 1HNXT 3CWZB 1H7CA 3JAFA 2NW7A 3BQKA 1HCIA 3FZLB 4TWHA 4MFRA 4DIDB 3K1SA 4HKAA 1HG5A 1VCTA 5CA1E 1E7PA 3ABVA 5FXWA 1X79A 3AA0B 5FMNA 4ZS3A 4PK4A 3DTOA 2E9XC 3JCFA 4J2CA 3GN5A 1N33T 2X68A 4YXDA 4LFAT 4Z90A 2EHOA 4GIWA 4IE5A 2C5IT 4HFBA 4IL4A 3NWIA 3UU5A 4O4HE 1MMGA 5LOVE 4BJMA 1LRZA 5LHHB 2VKJA 5AQQB 2I6HA 5LNKA 4UV9B 3WI3A 3AA7B 3S4UA 2KWHA 1D0YA 5JR9B 2V7LA 2JMHA 2LOPA 2V7JA 1US7B 2VL8A 5L3GB 3MK7C 2CE7A 3ANWB 1WRDA 3FHNA 5JDFA 4JUYA 2VB6A 2CA5A 2GK9A 1J1JA 2Y6XA 2KXPB 2XQ4A 1KK7A 2X0LB 4L5GA 4JI4T 1YKHB 3HKCE 2KNDA 3NVOA 4OFZA 5AQRB 4X66T 2WMOA 3AE9A 4ZI2D 2BKNA 1XMOT 3N2KE 5EK3A 3L39A 5FP3A 2WP9A 3I1AA 2BS3A 4JI6T 2PBIA 3C50A 2XZEA 2WAUA 5FVKA 3VKHA 5AQLB 5LG3A 2V1DB 4PFPA 2BG9C 4EZHA 1LVFA 3J9X1 2LRLA 3CVRA 3UUNA 4YY3T 1ZKEA 4EOZB 3LFMA 4PFOA 1Y64B 2PTFA 3ZT7A 2Y48B 3RC8A 4GYSA 4L9IA 3RPUA 3AE4A 3RX6A 5FKYA 4JI1T 3OPCA 2WSSV 2IDOB 4P09A 2W2UA 3IF8B 3PUYF 1KNRA 2ZM6T 2D0TA 4PJLA 1D0ZA 3LK3B 4LMJA 4U7IA 2P9BA 2WY2A 4HWCA 2RA1A 2DI4A 2YEVC 3PUSA 3ZN0B 3EUHA 4H9QC 2UXCT 2ZM0A 3IHRA 4YHHT 5HXEA 3AE2A 3B57A 4IHJE 1QUUA 4TV8E 1O3XA 3C4ZA 3K3QC 5LGNB 4X5TA 2XAFB 3AEGA 5L47A 2CPTA 4DR7T 4ERRA 4UVBB 3PUQA 1UURA 1L0VA 3KFWX 3AEEA 1HFAA 4LF7T 4HTEA 4OHFA 2VKOA 3AVSA 4HFCA 1Z8UA 3ETVA 1W09A 5HEUA 5FL0A 4DUYT 4V1Av 4ISTA 3T8OA 2A2FX 3P50A 1HX8A 4HFHA 4PJJA 2E9XA 4U2YA 3VRAA 5AQPB 4HWHA 2MYSA 2KINB 3N9QA 4DV6T 4WBNE 2L9QA 4LFBT 5LA6E 2JQ9A 4LMLA 3B13A 2Z6EA 1E2AA 3N9MA 4X64T 4B3RT 5J2TE 3O4XE 5CA0E 4DV7T 3KV5A 4OX9T 1SE7A 3EABA 4KX6A 3O1IA 4X62T 4X20E 4BJNA 4CI1B 5JDQA 3OYXA 4AISA 1NAFA 2K9AA 5AQFB 3RGLA 4DR5T 2FJDA 4G2AA 2W63A 3VRBA 3GWHA 4HFDA 1KEYA 3NRXA 3AE6A 4JLEA 2K5BB 1LKXA 3RKOA 1T72A 4ISSA 4CI3B 1YD8G 4O4LE 1Y01A 5CGMA 4GKKT 2W67A 1T8BA 2KZ7B 3DJBA 3Q5EA 5AQKB 4ILCA 3ONJA 2BBJA 4ZS2A 5F3JA 3LK2B 3N9OA 3KV4A 2DHRA 4ZI3C 3FXDB 3WAKA 2B1EA 3KBTA 3MA9A 2LM9A 3PU3A 3RIFA 1HTJF 3GN5B 4PK6A 4IDQA 2K48A 5L4HA 5EK2A 2CWYA 2EHOB 3NRYA 3PDYA 3AEAA 3ZMUB 3TLWA 3UULA 2XAHB 1MNEA 1KFYA 1NWMX 1IJ6A 1FEWA 3AEFA 4LF8T 2V8SV 5JH7E 5L3CB 4P0AA 1MMDA 3AE3A 5JREA 2BS2A 2XSBA 3ZMSB 2NOXA 4DV4T 3CIRA 4EYUA 2YINA 5IUXA 4UXNB 3CX6B 5ABHA 3VHLA 4CQIA 2HPLA 3SS1A 2LJLA 5CB4E 4U72A 4AKLA 4UVCB 1WFDA 4O8SA 2ZLYA 3RYIE 3KDSE 3PUAA 5ABGA 1D1AA 4AKRB 2W0GA 2XAGB 2YDSA 2K3WA 3UU4A 2Y8DA 5HEHA 5H6QB 3Q5WA 1ZV4X 1UCUA 4CXYA 3KVAA 4F6RC 5AQGB 4H9RC 2R6GF 5KX5E 2N1GA 3ZEFB 1WLXA 3PE0A 2V5DA 3L09A 4DBRA 3VU7H 4YSZA 1HS7A 1U4QA 2DCFA 4P1NA 1JNRA 3FZKB 4JYAT 2J4GA 3KINB 2IC9A 2X9HA 3EVYA 1XDPA 4EGWA 3I0OA 3N9LA 3NZPA 2I59A 2VURA 1G8XA 2UXDT 2CLYB 3ZYMA 3P7IA 4I0UA 2D2SA 4IDOA 4KMCA 5LYJE 4U31A 2ODVA 3J7Yq 4AKGA 1U5PA 4LFCT 4DR4T 2VWAA 3IEEA 4ZXLA 1QSDA 3TKLB 4X65T 3FB2A 2JMKA 2Q9QD 2X9YA 3CQGB 5TAOA 3AE7A 2XAQB 3IA3A 2ACXA 1W0AA 2OLTA 5HXRA 1T7SA 4TUYE 4DVDA 2IAKA 2K24A 2XASB 4NIQA 2UXXB 3ZMVB 4EYYR 4ZI7E 2Q9QC 1OEDE 3MACA 3AEBA 4IE7A 1IBLT 4HWDA 2NW9A 2L8KA 2UUBT 3EHZA 4BAYB 1WYCA 2E9XB 3RIUC 5JQGE 3U3IA 3AE1A 2X9WA 2XQ3A 2VQFT 3RKGA 2HPJA 2X67A 5JDGA 5HEGA 4AQFC 2E5LT 4U2ZA 1D1BA 3ONXA 3NKZA 2BZBA 3UFGA 5AQIB 2X9XA 3FZFB 1CUNA 5ETWA 4K0UA 2D5UA 5L3BB 4FI5A 5JR9C 4IDPA 4ILBA 5AQMB 5LMNT 2V7MA 5LBMA 2JIWA 2JJ9A 4CN1A 5IHYA 3RH3A 3CX8B 5FVLA 2NTXA 2W00A 2QGSA 5HYAA 4M1PA 2CBIA 4KP3C 3AEDA 2UU9T 4Z8XA 4DBQA 2X0HA 2FBWA 4HE8A 3QOFA 2E5VA 3H37A 2LT3A 1X9BA 1NEKA 1OEDA 2YOEA 4EV6A 4UVAB 3ZCIA 3LG7A 4O4JE 4YLHA 1MIVA 3PV0F 3BQIA 2IHR1 2CHOA 1WYBA 3EDVA 1UX4A 4B3MT 2WQYA 2XTLA 1D1CA 4DV2T 3AAAB 4YFSA 1XDOA 2LHRA 4TV9E 4YTNA 4EIWA 4OYJA 2VL0A 2OA5A 4COFA 3ETUA 3BK9A 2YN6A
chains in the Genus database with same CATH topology
3FZLB 1I6ZA 4HWCA 3FZMB 5AQVB 5AQIB 5AQOB 3FZFB 5AQQB 5AQLB 1HX1B 1UGOA 3FZHB 5AQSB 1UK5A 5AQRB 5AQHB 5AQTB 1M7KA 3LDQB 3FZKB 5AQJB 5AQFB 5AQGB 5AQMB 5AQNB 5AQUB 3M3ZB 2D9DA 1M62A 4HWFA 5AQPB 3A8YC 5AQKB 1T7SA 4HWIB 4HWHA 4HWDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FZL B;  1I6Z A;  4HWC A;  3FZM B;  5AQV B;  5AQI B;  5AQO B;  3FZF B;  5AQQ B;  5AQL B;  1HX1 B;  1UGO A;  3FZH B;  5AQS B;  1UK5 A;  5AQR B;  5AQH B;  5AQT B;  1M7K A;  3LDQ B;  3FZK B;  5AQJ B;  5AQF B;  5AQG B;  5AQM B;  5AQN B;  5AQU B;  3M3Z B;  2D9D A;  1M62 A;  4HWF A;  5AQP B;  3A8Y C;  5AQK B;  1T7S A;  4HWI B;  4HWH A;  4HWD A; 
#chains in the Genus database with same CATH topology
 5LJM A;  4I43 B;  2XQ8 A;  5ABF B;  2IIU A;  2WCA A;  3K3N A;  4PK5 A;  2RP4 A;  5JTG A;  5JVD E;  5FXX A;  5LJN A;  2CEA A;  3LSV A;  2XQ6 A;  3SFE A;  2W61 A;  3ZJ2 A;  4DR6 T;  3P4S A;  3AB3 B;  3GA8 A;  4ANJ A;  5F8P A;  1HR0 T;  4HEA A;  2BS4 A;  1XNR T;  2WS3 A;  4DND A;  3C4W A;  2XSA A;  2BVM A;  4UEL A;  4AQY T;  3K8P C;  4QH5 A;  3QK6 A;  3TLT A;  2NR4 A;  2NP9 A;  2FJB A;  3R6N A;  2BKP A;  3ZYL A;  4GK0 E;  3CML A;  5AFU L;  4H9S E;  4CXX A;  4HFV A;  3D0T A;  1XNQ T;  3C98 B;  2HHH T;  3L8R A;  2KWI B;  2WDR A;  1ZEE A;  3PUX F;  2XJ7 A;  4LF4 T;  5JDN A;  4A56 A;  2WZI A;  2N2N A;  2A3D A;  2IML A;  2Q9Q A;  3RIA A;  1FJG T;  5AQU B;  5FXZ A;  4A5X A;  2AXD S;  4DV5 T;  3RRC A;  5IYZ E;  3SWH A;  2FJA A;  3AE8 A;  5E0O A;  4JI7 T;  4WNK A;  3FBL A;  4QXH B;  4DV0 T;  1MMN A;  5J1G A;  4KI0 F;  3RHW A;  2NW8 A;  4X1K E;  5LXT E;  1MIY A;  3AXJ A;  1YQ4 A;  5LMU T;  4AQF A;  1G73 A;  1IJ5 A;  2BG9 E;  2XHE B;  4FJO A;  1FMW A;  4JI5 T;  3K3O A;  3P4Q A;  3UFE A;  4H63 H;  4A98 A;  2CCQ A;  3AEC A;  4G63 A;  4ILA A;  2IUB A;  3A7M A;  3C51 A;  4ZI3 D;  2LSK A;  2M67 A;  3N9N A;  1M7K A;  4AKH A;  3QB5 K;  4QKN A;  2A72 A;  4E7Z A;  2WB5 A;  5FY0 A;  3LK4 2;  3O1J A;  4TX5 A;  1BR1 A;  4EAH A;  2SPC A;  4CN4 A;  1I94 T;  4U74 A;  3P4P A;  1B7T A;  3M3Z B;  4HFE A;  1KNZ A;  3IBP A;  1MMA A;  4QXB B;  2EHO C;  1HNW T;  2LM2 A;  3FBZ A;  2UXN B;  5HCM A;  2WZH A;  4DV1 T;  3MXZ A;  4JBW F;  3T1Y T;  2ACZ A;  1WR0 A;  5LHG B;  4O4I E;  2BG9 A;  3PUW F;  1S35 A;  1ZP0 A;  2LE8 A;  2KT9 A;  4QX7 B;  5CFB A;  3HI2 A;  3PUG A;  4U3C A;  3M65 A;  1R8I A;  3VR8 A;  5HEJ A;  4B6X A;  1S94 A;  5FXV A;  2C5K T;  4YJ2 E;  1YQ3 A;  2LSJ A;  5L4E A;  2E8I A;  2YDQ A;  4TNW A;  1ZHC A;  2LKH A;  3HKE E;  2IC6 A;  2XAJ B;  3E08 A;  1LVK A;  2F4V T;  4JEU B;  4BA9 A;  2CMR A;  3Q5X A;  1UK5 A;  5HAX A;  1IZN B;  1VCS A;  2XQY A;  2LHN A;  3RYF E;  2WU5 A;  3H3M A;  1D0X A;  1JNZ A;  1OED B;  2H7O A;  4ILU A;  3QUJ A;  2UUA T;  5JRC A;  2JPF A;  2RPA A;  5AQV B;  3ZST A;  2ES0 A;  3ZT6 A;  2G0U A;  1QLB A;  2MBG A;  2DNX A;  3QB5 A;  5M4Y A;  2CBJ A;  3TLU A;  3CQX C;  4CZZ B;  2XQ5 A;  2WWU A;  2W4X A;  4TWD A;  2HN2 A;  3LBX A;  5AQH B;  4AQG A;  3RF1 A;  2VKH A;  4EXT A;  3UUB A;  3O1H A;  2D9D A;  4HWF A;  4YHJ A;  4I50 E;  2YU1 A;  3UQ7 A;  5LBQ B;  3HL6 A;  1UGO A;  3ZYK A;  3UUM A;  4ZZC A;  4UF0 A;  4XZC A;  2W66 A;  2ZMA A;  3HKD E;  2CLY C;  3RRW A;  3X1D A;  3P4R A;  3OBV E;  2ZM2 A;  4O2B E;  3A8Y C;  4IE6 A;  4WBO A;  2JRK A;  4C90 A;  2NWB A;  4QWN B;  4DMV A;  3FZM B;  3P4W A;  3ZN1 B;  3F57 A;  2HH7 A;  4H63 V;  2FJE A;  1FMV A;  1IBK T;  3P8C D;  3I9W A;  5JDL A;  2JQH A;  3AA6 B;  4QH1 A;  5LG4 A;  1OXZ A;  4TN7 B;  5FYM A;  5J0Z A;  1YW0 A;  4XAX B;  4F8H A;  3UUX B;  4GKJ T;  1YKE B;  3ZT5 A;  5IWA T;  3OYZ A;  4EB6 E;  3UU6 A;  2BKO A;  3QNU A;  1GQE A;  4QXC B;  2BDE A;  3PUV F;  3G06 A;  4N78 D;  4CN6 A;  2Q9Q B;  1Z0P A;  5L2L A;  1WCR A;  2AE9 A;  1CHU A;  3W15 B;  4U33 A;  5HWY A;  2QYW A;  3ZMT B;  2H3R A;  3PU8 A;  5C3J A;  4AI6 A;  2X0Y A;  1XWM A;  5BR8 T;  4LF5 T;  3ZMZ B;  4JI0 T;  3V5S A;  3AXJ B;  3R84 B;  4IE0 A;  5KXJ A;  3EDU A;  1SA0 E;  3N2G E;  3GMI A;  2XY8 B;  2OV9 A;  5HWX A;  4Z91 A;  2V6X A;  4JV5 T;  4DMW A;  3CX7 B;  3PJA J;  3KBU A;  2JQK A;  3HA4 A;  4QX8 B;  4LF9 T;  2WDV A;  4ZEY A;  4K0K T;  4X1I E;  1MND A;  3NZQ A;  1VOM A;  3I0Q A;  4DV3 T;  3H3A A;  1WR6 A;  3VKG A;  4YTM A;  2QA7 A;  3AVR A;  4LMK A;  4WW0 A;  2DL1 A;  4O2A E;  4U7Y A;  3HKB E;  3JAD A;  3AA1 B;  2LRK A;  5DJQ C;  1HG2 A;  4ASK A;  1BR2 A;  5LB7 B;  4KHZ F;  3EAM A;  4IRE A;  4ADZ A;  4PNI A;  5HXS A;  3FZH B;  2BBH A;  3KVB A;  2J47 A;  3ESL A;  3RLF F;  5AQJ B;  3RI5 A;  4GK5 E;  4XBF B;  3WAJ A;  3UQ4 A;  2LSY A;  3NBX X;  2JQQ A;  2V7K A;  2UXB T;  4MBQ A;  4P0B A;  3F31 A;  4HN9 A;  4HGA A;  1VRB A;  4B3T T;  2BG9 B;  4ZI2 C;  4JI8 T;  3B5M A;  1IAP A;  2CXD A;  4ZOL E;  5LP6 E;  3RC3 A;  3MKD A;  2H7V C;  3EI0 A;  4UEM A;  4ZHQ E;  5A1L A;  4KUM B;  2H88 A;  3ZC0 A;  4PJN A;  2VK9 A;  2LSI A;  1KF6 A;  5FY7 A;  2DWG A;  1W0B A;  2X66 A;  2V6Y A;  3CK6 A;  4AIU A;  5ABE A;  5HXC A;  2H89 A;  5LCY A;  4UIG A;  3KV9 A;  5AQS B;  5FY1 A;  4YT0 A;  3ZKR A;  5JDH A;  4NXN T;  2J1D G;  2QVA A;  5JRC B;  4OYK A;  2WM9 A;  1M62 A;  3SFD A;  1HF8 A;  4YTP A;  1KNP A;  2XPK A;  3SOL A;  2C0S A;  3RYC E;  3A5X A;  4EEB A;  3LDQ B;  2DWK A;  3OKQ A;  4DR3 T;  4OK0 A;  1J5W A;  4TWF A;  4JI2 T;  2WDQ A;  4GYR A;  1I6Z A;  4QH4 A;  2XQ7 A;  2CWO A;  3LBX B;  4YSX A;  3PUR A;  5DQW A;  4QHO A;  4MLK A;  4UR9 A;  2HN1 A;  2XQ9 A;  3O9X A;  1SHZ C;  4E7S A;  4H9N C;  4MAL A;  3RIU A;  1HNZ T;  2M6B A;  3E22 E;  4EZ4 A;  3UTK A;  2E2A A;  2YKS A;  5EK4 A;  5L3D B;  4UF0 B;  5AQO B;  2UUC T;  5HXH A;  1J5E T;  3VR9 A;  5C8Y E;  5LGU B;  4GOU A;  3ONL C;  4NUU A;  5JR9 A;  4X1Y E;  2YK0 A;  3CKD A;  3LJC A;  3ANW A;  4PW8 A;  5LGT B;  3FXE B;  3BQL A;  1ZOY A;  1BR0 A;  1UUS A;  2V7I A;  2N9D A;  2NTY A;  5BMV E;  3N9P A;  4AKI A;  2XM1 A;  3AAE B;  2WMN A;  1E1H B;  5L3E B;  2EHO D;  3UU8 A;  4Q25 A;  2VQE T;  2C5J A;  4EED A;  5GON E;  1N36 T;  1HX1 B;  3AAI A;  3PTR B;  5C2T A;  5FNV E;  3ZPO A;  2PJQ A;  2PG8 A;  2VVS A;  4IDZ A;  2MAW A;  3MJX A;  3ZC1 A;  5LHI B;  5DQV A;  2B76 A;  3F2E A;  3AE5 A;  3V5U A;  4IDN A;  3QC9 A;  1UX5 A;  2W62 A;  3TLV A;  4IL9 A;  3RYH E;  3U78 A;  4L0R A;  1N34 T;  2X51 A;  1N32 T;  3N2O A;  4NPP A;  4AXP A;  2M6I A;  3T1H T;  4ZZB A;  2DLR A;  1OWA A;  4CI2 B;  4HWI B;  4YJ3 E;  2WWV A;  1W9R A;  2J62 A;  1T98 A;  4DR1 T;  5ABF A;  5ADX L;  4MHC A;  2PFV A;  4NUV A;  1SUM B;  3L3P A;  4IT4 A;  4I55 E;  2A9U A;  3ZCJ A;  1XZY A;  2CRB A;  1YXR A;  4B3S T;  1V9D A;  2L3L A;  3TLS A;  3N5L A;  2MOZ A;  4UV8 B;  5AQT B;  3UT5 E;  2KSR A;  4A97 A;  4CXW A;  3ZSS A;  1AJ3 A;  3Q2M A;  1DU2 A;  4TZ4 C;  2CM0 A;  1OED C;  3KV6 A;  4I4T E;  2KLQ A;  4WZX A;  3PJA A;  1EZ3 A;  4IIJ E;  3ZJ1 A;  2YDR A;  4DO0 A;  3HR0 A;  2LEH A;  4WYV A;  2WU2 A;  5EZY E;  2QRX A;  1XMQ T;  3SRZ A;  1FIO A;  2CXL A;  2WBL A;  2VAS A;  3JAE A;  3JC6 D;  1NEN A;  2KMF A;  3OJA A;  2ODU A;  3E0Z A;  2IW5 B;  3I9Y A;  4H9P C;  4HFI A;  4IGU A;  4TNV A;  3ZLI A;  5JDM A;  1BR4 A;  3CPZ A;  4C91 A;  2V5C A;  5F5W A;  5CJ5 A;  5KMG P;  3JC6 C;  2CHN A;  2ZM8 A;  1IBM T;  5DAB A;  2LKG A;  3Q9D A;  2LSG A;  3OVU A;  2LOS A;  4KHP T;  2CXF A;  5FL1 A;  5AQN B;  2V26 A;  4DR2 T;  2FUP A;  3RQU A;  3Q5D A;  5L3F B;  4IE4 A;  3PUZ F;  3DP7 A;  5KDM C;  3UU3 A;  5HCJ A;  3OTO T;  3MZK B;  2V6Y B;  4PJM A;  4YSY A;  4H9O C;  5HEO A;  2I0M A;  2D0U A;  3CQC B;  4JI3 T;  4NXM T;  2VKD A;  2XQA A;  2XM2 A;  4JEH B;  3C4X A;  2LLY A;  2MPK A;  5J2U E;  3RQW A;  3C64 A;  4LF6 T;  2XUE A;  4PAG A;  2YU2 A;  4DUZ T;  1MIW A;  2MTQ A;  2E9X D;  5H6R B;  2VVN A;  2BVL A;  4KBM B;  1HNX T;  3CWZ B;  1H7C A;  3JAF A;  2NW7 A;  3BQK A;  1HCI A;  3FZL B;  4TWH A;  4MFR A;  4DID B;  3K1S A;  4HKA A;  1HG5 A;  1VCT A;  5CA1 E;  1E7P A;  3ABV A;  5FXW A;  1X79 A;  3AA0 B;  5FMN A;  4ZS3 A;  4PK4 A;  3DTO A;  2E9X C;  3JCF A;  4J2C A;  3GN5 A;  1N33 T;  2X68 A;  4YXD A;  4LFA T;  4Z90 A;  2EHO A;  4GIW A;  4IE5 A;  2C5I T;  4HFB A;  4IL4 A;  3NWI A;  3UU5 A;  4O4H E;  1MMG A;  5LOV E;  4BJM A;  1LRZ A;  5LHH B;  2VKJ A;  5AQQ B;  2I6H A;  5LNK A;  4UV9 B;  3WI3 A;  3AA7 B;  3S4U A;  2KWH A;  1D0Y A;  5JR9 B;  2V7L A;  2JMH A;  2LOP A;  2V7J A;  1US7 B;  2VL8 A;  5L3G B;  3MK7 C;  2CE7 A;  3ANW B;  1WRD A;  3FHN A;  5JDF A;  4JUY A;  2VB6 A;  2CA5 A;  2GK9 A;  1J1J A;  2Y6X A;  2KXP B;  2XQ4 A;  1KK7 A;  2X0L B;  4L5G A;  4JI4 T;  1YKH B;  3HKC E;  2KND A;  3NVO A;  4OFZ A;  5AQR B;  4X66 T;  2WMO A;  3AE9 A;  4ZI2 D;  2BKN A;  1XMO T;  3N2K E;  5EK3 A;  3L39 A;  5FP3 A;  2WP9 A;  3I1A A;  2BS3 A;  4JI6 T;  2PBI A;  3C50 A;  2XZE A;  2WAU A;  5FVK A;  3VKH A;  5AQL B;  5LG3 A;  2V1D B;  4PFP A;  2BG9 C;  4EZH A;  1LVF A;  3J9X 1;  2LRL A;  3CVR A;  3UUN A;  4YY3 T;  1ZKE A;  4EOZ B;  3LFM A;  4PFO A;  1Y64 B;  2PTF A;  3ZT7 A;  2Y48 B;  3RC8 A;  4GYS A;  4L9I A;  3RPU A;  3AE4 A;  3RX6 A;  5FKY A;  4JI1 T;  3OPC A;  2WSS V;  2IDO B;  4P09 A;  2W2U A;  3IF8 B;  3PUY F;  1KNR A;  2ZM6 T;  2D0T A;  4PJL A;  1D0Z A;  3LK3 B;  4LMJ A;  4U7I A;  2P9B A;  2WY2 A;  4HWC A;  2RA1 A;  2DI4 A;  2YEV C;  3PUS A;  3ZN0 B;  3EUH A;  4H9Q C;  2UXC T;  2ZM0 A;  3IHR A;  4YHH T;  5HXE A;  3AE2 A;  3B57 A;  4IHJ E;  1QUU A;  4TV8 E;  1O3X A;  3C4Z A;  3K3Q C;  5LGN B;  4X5T A;  2XAF B;  3AEG A;  5L47 A;  2CPT A;  4DR7 T;  4ERR A;  4UVB B;  3PUQ A;  1UUR A;  1L0V A;  3KFW X;  3AEE A;  1HFA A;  4LF7 T;  4HTE A;  4OHF A;  2VKO A;  3AVS A;  4HFC A;  1Z8U A;  3ETV A;  1W09 A;  5HEU A;  5FL0 A;  4DUY T;  4V1A v;  4IST A;  3T8O A;  2A2F X;  3P50 A;  1HX8 A;  4HFH A;  4PJJ A;  2E9X A;  4U2Y A;  3VRA A;  5AQP B;  4HWH A;  2MYS A;  2KIN B;  3N9Q A;  4DV6 T;  4WBN E;  2L9Q A;  4LFB T;  5LA6 E;  2JQ9 A;  4LML A;  3B13 A;  2Z6E A;  1E2A A;  3N9M A;  4X64 T;  4B3R T;  5J2T E;  3O4X E;  5CA0 E;  4DV7 T;  3KV5 A;  4OX9 T;  1SE7 A;  3EAB A;  4KX6 A;  3O1I A;  4X62 T;  4X20 E;  4BJN A;  4CI1 B;  5JDQ A;  3OYX A;  4AIS A;  1NAF A;  2K9A A;  5AQF B;  3RGL A;  4DR5 T;  2FJD A;  4G2A A;  2W63 A;  3VRB A;  3GWH A;  4HFD A;  1KEY A;  3NRX A;  3AE6 A;  4JLE A;  2K5B B;  1LKX A;  3RKO A;  1T72 A;  4ISS A;  4CI3 B;  1YD8 G;  4O4L E;  1Y01 A;  5CGM A;  4GKK T;  2W67 A;  1T8B A;  2KZ7 B;  3DJB A;  3Q5E A;  5AQK B;  4ILC A;  3ONJ A;  2BBJ A;  4ZS2 A;  5F3J A;  3LK2 B;  3N9O A;  3KV4 A;  2DHR A;  4ZI3 C;  3FXD B;  3WAK A;  2B1E A;  3KBT A;  3MA9 A;  2LM9 A;  3PU3 A;  3RIF A;  1HTJ F;  3GN5 B;  4PK6 A;  4IDQ A;  2K48 A;  5L4H A;  5EK2 A;  2CWY A;  2EHO B;  3NRY A;  3PDY A;  3AEA A;  3ZMU B;  3TLW A;  3UUL A;  2XAH B;  1MNE A;  1KFY A;  1NWM X;  1IJ6 A;  1FEW A;  3AEF A;  4LF8 T;  2V8S V;  5JH7 E;  5L3C B;  4P0A A;  1MMD A;  3AE3 A;  5JRE A;  2BS2 A;  2XSB A;  3ZMS B;  2NOX A;  4DV4 T;  3CIR A;  4EYU A;  2YIN A;  5IUX A;  4UXN B;  3CX6 B;  5ABH A;  3VHL A;  4CQI A;  2HPL A;  3SS1 A;  2LJL A;  5CB4 E;  4U72 A;  4AKL A;  4UVC B;  1WFD A;  4O8S A;  2ZLY A;  3RYI E;  3KDS E;  3PUA A;  5ABG A;  1D1A A;  4AKR B;  2W0G A;  2XAG B;  2YDS A;  2K3W A;  3UU4 A;  2Y8D A;  5HEH A;  5H6Q B;  3Q5W A;  1ZV4 X;  1UCU A;  4CXY A;  3KVA A;  4F6R C;  5AQG B;  4H9R C;  2R6G F;  5KX5 E;  2N1G A;  3ZEF B;  1WLX A;  3PE0 A;  2V5D A;  3L09 A;  4DBR A;  3VU7 H;  4YSZ A;  1HS7 A;  1U4Q A;  2DCF A;  4P1N A;  1JNR A;  3FZK B;  4JYA T;  2J4G A;  3KIN B;  2IC9 A;  2X9H A;  3EVY A;  1XDP A;  4EGW A;  3I0O A;  3N9L A;  3NZP A;  2I59 A;  2VUR A;  1G8X A;  2UXD T;  2CLY B;  3ZYM A;  3P7I A;  4I0U A;  2D2S A;  4IDO A;  4KMC A;  5LYJ E;  4U31 A;  2ODV A;  3J7Y q;  4AKG A;  1U5P A;  4LFC T;  4DR4 T;  2VWA A;  3IEE A;  4ZXL A;  1QSD A;  3TKL B;  4X65 T;  3FB2 A;  2JMK A;  2Q9Q D;  2X9Y A;  3CQG B;  5TAO A;  3AE7 A;  2XAQ B;  3IA3 A;  2ACX A;  1W0A A;  2OLT A;  5HXR A;  1T7S A;  4TUY E;  4DVD A;  2IAK A;  2K24 A;  2XAS B;  4NIQ A;  2UXX B;  3ZMV B;  4EYY R;  4ZI7 E;  2Q9Q C;  1OED E;  3MAC A;  3AEB A;  4IE7 A;  1IBL T;  4HWD A;  2NW9 A;  2L8K A;  2UUB T;  3EHZ A;  4BAY B;  1WYC A;  2E9X B;  3RIU C;  5JQG E;  3U3I A;  3AE1 A;  2X9W A;  2XQ3 A;  2VQF T;  3RKG A;  2HPJ A;  2X67 A;  5JDG A;  5HEG A;  4AQF C;  2E5L T;  4U2Z A;  1D1B A;  3ONX A;  3NKZ A;  2BZB A;  3UFG A;  5AQI B;  2X9X A;  3FZF B;  1CUN A;  5ETW A;  4K0U A;  2D5U A;  5L3B B;  4FI5 A;  5JR9 C;  4IDP A;  4ILB A;  5AQM B;  5LMN T;  2V7M A;  5LBM A;  2JIW A;  2JJ9 A;  4CN1 A;  5IHY A;  3RH3 A;  3CX8 B;  5FVL A;  2NTX A;  2W00 A;  2QGS A;  5HYA A;  4M1P A;  2CBI A;  4KP3 C;  3AED A;  2UU9 T;  4Z8X A;  4DBQ A;  2X0H A;  2FBW A;  4HE8 A;  3QOF A;  2E5V A;  3H37 A;  2LT3 A;  1X9B A;  1NEK A;  1OED A;  2YOE A;  4EV6 A;  4UVA B;  3ZCI A;  3LG7 A;  4O4J E;  4YLH A;  1MIV A;  3PV0 F;  3BQI A;  2IHR 1;  2CHO A;  1WYB A;  3EDV A;  1UX4 A;  4B3M T;  2WQY A;  2XTL A;  1D1C A;  4DV2 T;  3AAA B;  4YFS A;  1XDO A;  2LHR A;  4TV9 E;  4YTN A;  4EIW A;  4OYJ A;  2VL0 A;  2OA5 A;  4COF A;  3ETU A;  3BK9 A;  2YN6 A; 
#chains in the Genus database with same CATH homology
 3FZL B;  1I6Z A;  4HWC A;  3FZM B;  5AQV B;  5AQI B;  5AQO B;  3FZF B;  5AQQ B;  5AQL B;  1HX1 B;  1UGO A;  3FZH B;  5AQS B;  1UK5 A;  5AQR B;  5AQH B;  5AQT B;  1M7K A;  3LDQ B;  3FZK B;  5AQJ B;  5AQF B;  5AQG B;  5AQM B;  5AQN B;  5AQU B;  3M3Z B;  2D9D A;  1M62 A;  4HWF A;  5AQP B;  3A8Y C;  5AQK B;  1T7S A;  4HWI B;  4HWH A;  4HWD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...