5LNKA

Entire ovine respiratory complex i
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
115
structure length
115
Chain Sequence
MNLMITLLTNFTLATLLVTIAFWLPQLNVYSEKTSPYECGFDPMGSARLPFSMKFFLVAITFLLFDLEIALLLPLPWASQTTNLNTMLTMALLLIFLLAVSLAYEWTQKGLEWTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitochondrial complex I, 51 kDa subunit
publication title Atomic structure of the entire mammalian mitochondrial complex I.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 32
structure length 115
sequence length 115
ec nomenclature ec 7.1.1.2: NADH:ubiquinone reductase (H(+)-translocating).
pdb deposition date 2016-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00507 Oxidored_q4 NADH-ubiquinone/plastoquinone oxidoreductase, chain 3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1610 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 5lnkA00
3RKOA 4HE8A 5LNKA 4HEAA
chains in the Genus database with same CATH superfamily
3LJCA 4HFCA 3SFEA 4CXYA 4TWHA 3PJAA 4CXXA 3PU8A 4YTNA 3UU3A 1HX8A 5C2TA 1NEKA 1E2AA 2PBIA 5AQQB 4L9IA 4DV5T 2NTXA 2Q9QA 4MHCA 4ZZCA 5ETWA 4PFPA 1WR6A 4HWDA 1HS7A 3KV4A 3ZMSB 2YDQA 2X68A 4ZS3A 2YKSA 3AA7B 3HL6A 3F57A 3M65A 1OEDC 1W09A 2NW8A 5JR9A 3R84B 3PUVF 2DL1A 3AE6A 5FP3A 2X66A 3EVYA 4HFVA 4DR6T 3LDQB 3BQLA 3RIUA 4DO0A 4Z90A 2MPKA 3SS1A 3KBTA 4IT4A 3K3NA 1KNRA 2WCAA 5L47A 2W63A 5EK3A 1MMNA 5LB7B 3OKQA 1OEDE 4EEBA 3N2GE 4IDNA 1EZ3A 4ZI3D 3PV0F 3E08A 4YTMA 3DJBA 5AQPB 4HE8A 3C98B 1OWAA 3CQGB 4HEAA 1D0XA 3NRXA 3FBZA 2D5UA 2RP4A 5A1LA 3MA9A 2BG9E 2M6IA 2FBWA 1WCRA 2ZM6T 4GYSA 4X1IE 4IE4A 4JLEA 3TLWA 4TNWA 3UFEA 3PTRB 3VU7H 3L39A 4C91A 4I50E 5HWYA 2F4VT 3ZT6A 1MMDA 2ZMAA 4DBQA 2N2NA 3EHZA 2KMFA 4JI2T 3ZJ2A 3IBPA 4EZHA 3HA4A 2OV9A 4QWNB 3ZYKA 2LHNA 5E0OA 2XAGB 3RC3A 3GN5A 3IEEA 5AQVB 4H9NC 2XY8B 5AQKB 1VCTA 5C3JA 4HFIA 3CMLA 2XZEA 3UU8A 3FXDB 2ACZA 1MNEA 4ASKA 1BR2A 2LSJA 2KWHA 3IHRA 3OTOT 3C4WA 3L3PA 4WBOA 3UUMA 5FXZA 3CX6B 4KUMB 3ZC0A 5HEGA 2JPFA 2CXFA 4IE7A 1H7CA 3FZHB 2W2UA 2VL0A 1MIVA 3AE4A 2XAHB 1BR1A 2Y48B 4KMCA 4ZI2D 3AEDA 3Q9DA 3A8YC 4IL9A 1U5PA 3ONJA 5AQLB 2HN2A 3ZN1B 1QLBA 3Q5XA 3N9OA 3N9QA 2UXXB 2QGSA 1LKXA 5JRCB 4CZZB 1MMGA 4H9QC 5CB4E 3LK3B 2CWYA 4E7ZA 3B57A 3AVRA 1UUSA 4X5TA 2WDRA 3QNUA 3KV9A 1NENA 4TWDA 3AA1B 3I9YA 2E2AA 2ZM8A 4QH1A 1J1JA 3L09A 3R6NA 5JDGA 2BDEA 2H7VC 5AQTB 5LMNT 2LSYA 3Q5WA 1J5WA 4K0KT 3O1IA 2YDRA 4H63H 2JIWA 4A5XA 2YEVC 1ZOYA 4TUYE 4EZ4A 2W4XA 4ADZA 1OXZA 3L8RA 1OEDB 2Q9QC 2M6BA 5FXVA 1WLXA 1IBLT 1KK7A 1MNDA 1E7PA 3RC8A 1N32T 1OEDA 1N33T 3P50A 5CFBA 2UU9T 3T1YT 1I94T 2CBJA 4DV7T 4MBQA 4LMKA 3KVBA 3S4UA 2BKPA 4NUVA 3FZKB 4HWFA 2XQ8A 5JR9C 2LHRA 1YD8G 5LA6E 3K3OA 3PUZF 3ESLA 4OHFA 4UR9A 2WWVA 4LFCT 2BG9A 3KVAA 3RIUC 2KNDA 2XTLA 3JCFA 5AQRB 4BA9A 4QH4A 3VHLA 3ANWA 4DNDA 1WYBA 2E8IA 4ZS2A 1UK5A 2VVNA 1NWMX 3CQXC 3AEEA 2XASB 5FXXA 4O2AE 4JI6T 2OA5A 4DR3T 5AFUL 4DBRA 5IHYA 5LCYA 3ZC1A 4YJ2E 2E5LT 2LSIA 2XQ5A 4E7SA 4JUYA 2NWBA 4WBNE 5F5WA 2WP9A 4YHJA 5AQUB 1R8IA 4B3MT 4YLHA 1CUNA 4PK4A 3AEFA 1FMWA 3HI2A 4GIWA 4IL4A 3JAEA 2JQQA 2LM2A 2I0MA 1SHZC 4WZXA 1D0ZA 3PUWF 3RIFA 2D9DA 5JDNA 3AE7A 5FY1A 2MBGA 3AB3B 2H3RA 3RQUA 3PURA 4U3CA 2H89A 3VKGA 2M67A 3AE8A 3ABVA 2YINA 2V6YA 1D1BA 4HTEA 4AQGA 1US7B 4CN4A 3AAIA 5ADXL 2JQHA 3RYIE 4CI1B 2DCFA 4GKJT 2NW9A 2CWOA 3GWHA 4O4HE 4EYYR 2L3LA 3C50A 4TN7B 3AEBA 5H6QB 2VQFT 2ZM0A 2D0UA 3RRWA 2CPTA 4NIQA 2XAJB 5JQGE 2IAKA 4PW8A 5L3GB 2V7LA 3RQWA 1S94A 2A72A 4U2YA 2XAFB 3C4ZA 4V1Av 2YK0A 2DWGA 5J2TE 4CI2B 3RHWA 5ABFB 3OPCA 5JTGA 4A98A 3T1HT 5L3EB 5DABA 5ABFA 4ANJA 1SA0E 1HR0T 3ZCJA 2V1DB 4AKRB 1YKHB 3P4WA 4CXWA 2V6XA 3N9NA 4ZI2C 2LE8A 3K1SA 5EZYE 2QA7A 2JRKA 1XNRT 4DIDB 1WYCA 2Q9QD 4I0UA 2IW5B 4H9RC 4I55E 1T7SA 3P4QA 3FB2A 4P0BA 3O4XE 2MYSA 3SFDA 2FJDA 5JDMA 2BKOA 2UUAT 5HXHA 2MAWA 2Q9QB 4QX8B 2CHOA 2NW7A 4DR2T 2XHEB 3UT5E 3ZPOA 4DR4T 5LG4A 4QXBB 5FL1A 4KP3C 1D1AA 2B1EA 2YU2A 4G63A 3ETUA 3TLVA 5JR9B 5L2LA 4KHZF 1IBKT 1KNPA 4YHHT 1UX5A 2I59A 4EYUA 2IIUA 2BS3A 3Q5DA 3BK9A 3BQKA 5DQVA 5LBMA 4AQFA 4LF6T 3MK7C 2XQ3A 2UUBT 5BMVE 2IMLA 4NXMT 3ONLC 1Z8UA 1G8XA 4IREA 2BG9C 2HHHT 2KXPB 3JADA 2WWUA 5LP6E 1UX4A 3ONXA 3CPZA 3WAJA 3ZEFB 4JBWF 1T8BA 4PK5A 4DV2T 4ZEYA 2X51A 3LG7A 4WNKA 4U2ZA 3AE9A 2E9XC 3VR9A 3RGLA 3FHNA 2DI4A 1X79A 2ZM2A 3UQ7A 4TV9E 1FIOA 4FI5A 3AE3A 4AISA 2G0UA 2VVSA 2VKDA 5GONE 2RA1A 3WAKA 1NAFA 2L8KA 4AXPA 4F8HA 5JDQA 4PK6A 2KWIB 4JI0T 3N9MA 5KDMC 2LLYA 4UELA 4ILAA 5FVLA 4EAHA 4O4JE 1L0VA 1Z0PA 4GYRA 3HKCE 4GOUA 3GN5B 3QOFA 5CGMA 4PNIA 4UV9B 2BVMA 2MTQA 4GK0E 1FJGT 4YT0A 5LNKA 5LJNA 4U33A 2WU5A 3AA6B 4H63V 1HF8A 1Y01A 2XQ6A 4C90A 4LFBT 2HPLA 4QKNA 3Q5EA 2R6GF 2AE9A 2X9HA 1IAPA 2CA5A 1YQ4A 2X9YA 1VRBA 3BQIA 3RIAA 3RKOA 2FJBA 3CIRA 1W0AA 2VL8A 3O1HA 5LOVE 2XPKA 3A5XA 2CHNA 5AQOB 2D0TA 4YXDA 2IHR1 3OVUA 5FY0A 4Q25A 5ABGA 2BBJA 3RKGA 2VWAA 3EDVA 5L3DB 1D0YA 3UFGA 2X0HA 1FEWA 1FMVA 4DR1T 2KINB 4AQYT 4AKIA 1KF6A 4IDPA 1UGOA 2K9AA 3PUAA 4AI6A 1BR4A 3EDUA 4CN1A 5LYJE 4JV5T 1ZHCA 4L0RA 3AAEB 3TLSA 3AXJA 4JI5T 2WU2A 2V8SV 4OFZA 5IYZE 4B3RT 4JI3T 3G06A 4HWIB 4IIJE 3A7MA 2W67A 5LHIB 2VKHA 1VOMA 3LFMA 1W9RA 4U7YA 1M62A 2UXCT 5KX5E 4EV6A 5HEHA 4B3ST 3K8PC 5JDLA 4HFBA 5HXCA 2LKHA 3JC6D 3OJAA 5FL0A 3PUSA 4ILUA 4IGUA 2X9XA 4IHJE 2J62A 3AA0B 4MFRA 3I0QA 2IUBA 3P8CD 3ZMVB 5IWAT 2CEAA 4YFSA 5L4HA 2WDQA 2BKNA 2WM9A 4AKLA 3P4SA 4KBMB 4XBFB 5HWXA 3QB5A 4P0AA 4UXNB 3N2OA 1MIWA 2V5CA 4WYVA 4IDOA 2BVLA 3QB5K 3TLTA 4YTPA 2PFVA 5LGTB 2BG9B 2FJEA 2E9XD 3IA3A 4AQFC 5FNVE 2YN6A 4BJNA 1CHUA 2VKOA 3ANWB 4O4IE 3C64A 2XQAA 4EIWA 1HCIA 3B5MA 4Z91A 2QVAA 3RYCE 2LKGA 3ZMTB 4XZCA 3OYZA 2E9XA 3CVRA 1ZP0A 4DMWA 1AJ3A 4YSZA 5LHHB 3RX6A 2XQ4A 4DV1T 1E1HB 2SPCA 3EAMA 3P4RA 2FJAA 3F2EA 3ZT5A 5J2UE 3I1AA 3ZLIA 4N78D 2V7JA 1XWMA 2W66A 2CXLA 3P7IA 3UQ4A 2V7MA 1T98A 3AECA 3SRZA 1HTJF 5J0ZA 2B76A 4QHOA 4UF0A 2XUEA 1I6ZA 3VRBA 5LBQB 2WAUA 3T8OA 5LHGB 2NP9A 3CWZB 4GKKT 5F8PA 1YQ3A 3ZKRA 5HYAA 1ZEEA 2IC6A 2EHOD 3H37A 3H3AA 2JQ9A 2QYWA 2WY2A 2V6YB 5HEOA 3HKEE 4HKAA 3NZQA 2L9QA 4X66T 2X0LB 3RF1A 2J4GA 5FMNA 4HFEA 5FKYA 3PJAJ 2EHOA 3UUNA 5ABHA 2UXDT 4M1PA 5HAXA 4CQIA 4LF7T 1HG5A 4LMJA 2J47A 3PUYF 3NBXX 2VK9A 1W0BA 5L4EA 2PTFA 4ZOLE 3SWHA 3NVOA 3WI3A 4ZXLA 4P09A 1Y64B 4HWHA 3LBXA 1O3XA 3QC9A 3ZN0B 2CXDA 4DV3T 2A3DA 5FVKA 1HG2A 2ACXA 3I9WA 2BBHA 4KHPT 4I4TE 2BZBA 2WB5A 3HKBE 4P1NA 4HGAA 2VQET 2N1GA 2WS3A 2XM1A 4IE0A 4H9SE 4PJLA 4QXCB 3F31A 3Q2MA 2LRLA 5C8YE 2H88A 3PDYA 4X1YE 3KDSE 2V26A 1S35A 1LVKA 2VURA 1HNWT 4DV0T 3CX7B 2XSBA 2VASA 3AAAB 4F6RC 3LSVA 1IJ5A 3V5UA 2WZIA 4UVAB 3H3MA 4TZ4C 4U74A 3E22E 4HWCA 3RPUA 3C51A 1G73A 4TV8E 3NKZA 3AEGA 2V7IA 3I0OA 3KFWX 2KSRA 5EK2A 1J5ET 3AE2A 3K3QC 3ZSSA 2K48A 2XAQB 4YSYA 5HCJA 4OK0A 1JNRA 3ETVA 3KBUA 1ZV4X 4JI4T 3GA8A 3PUXF 4OX9T 5L3FB 1XMOT 2WQYA 2C5JA 4B6XA 2HH7A 3MZKB 2QRXA 3UU6A 1B7TA 3UUXB 3JC6C 5CA1E 4OYJA 1WFDA 2VKJA 1M7KA 2V5DA 3PUGA 3TLUA 5AQGB 2UXBT 3ZMZB 3GMIA 2WBLA 4X64T 4O4LE 4OYKA 4DVDA 2WSSV 2CRBA 2LOPA 2DHRA 2W0GA 4NUUA 2P9BA 3KV5A 2JQKA 3MXZA 2BS4A 3U3IA 4YY3T 2CLYC 2X9WA 3NWIA 4H9PC 2K3WA 3UULA 4LFAT 2NR4A 2J1DG 3O1JA 4EB6E 4UIGA 5AQNB 1MMAA 3EUHA 2YOEA 3U78A 2IC9A 5AQJB 2LOSA 1SUMB 4ISSA 4FJOA 1U4QA 3VKHA 2HN1A 3PE0A 4O8SA 3B13A 4MALA 3UU5A 5KMGP 5JVDE 3FZLB 3N5LA 3M3ZB 5F3JA 5DJQC 4DR5T 5M4YA 4AKGA 3W15B 3AEAA 3MACA 2X0YA 3NRYA 3OYXA 2BS2A 1XZYA 2C5IT 4JI8T 2DWKA 3J9X1 3ZT7A 1UCUA 3PU3A 4DMVA 2NTYA 4PJJA 2W62A 2Y8DA 2EHOC 3CX8B 3MKDA 3KV6A 1IJ6A 3LK2B 3RI5A 3ZCIA 1QSDA 4LF5T 3TKLB 3RLFF 5CA0E 4LF4T 2GK9A 5JREA 4TX5A 3CK6A 5AQFB 1KEYA 2LJLA 2UXNB 1YW0A 4LF8T 5ABEA 4ZHQE 3IF8B 3CQCB 1BR0A 1IZNB 4A56A 5HCMA 4HN9A 3AXJB 2A9UA 4QX7B 4ISTA 5TAOA 2WMOA 2RPAA 3N2KE 1KFYA 3RRCA 1SE7A 4DV4T 1T72A 3RYFE 3FBLA 2IDOB 4IE5A 1LVFA 2H7OA 5AQHB 3N9LA 5KXJA 2V7KA 4G2AA 3ZYLA 1D1CA 3FXEB 4PFOA 5JRCA 2VB6A 5LMUT 5FY7A 2LM9A 3UUBA 5IUXA 2C5KT 2DLRA 3DP7A 5AQMB 1HFAA 4BJMA 4X62T 1QUUA 3P4PA 2ES0A 5LXTE 4U7IA 2JMKA 2WZHA 4UEMA 4BAYB 4ZZBA 2CM0A 5AQIB 3KINB 1ZKEA 1HNZT 4L5GA 3EI0A 1IBMT 4X20E 2NOXA 4AIUA 3AE5A 2X67A 1V9DA 1X9BA 4JYAT 2C0SA 5HEJA 1N34T 2ZLYA 3E0ZA 1YKEB 2XQ9A 4NPPA 2LT3A 2LEHA 4NXNT 3ZYMA 2Z6EA 1XDPA 2CE7A 2E9XB 2XSAA 2CLYB 1LRZA 3FZFB 5JH7E 4GK5E 4UVBB 4I43B 5HXSA 2PG8A 3J7Yq 1UURA 2N9DA 2YU1A 1WR0A 5L3BB 3UTKA 3V5SA 4QXHB 4JI7T 2K24A 4AKHA 5HEUA 2CCQA 2ODVA 3EABA 4CI3B 4UF0B 4JEHB 3VRAA 4ERRA 2ODUA 3QUJA 1XMQT 2WMNA 4CN6A 4IDQA 1HX1B 3QK6A 4XAXB 3D0TA 4YSXA 4DUYT 2WDVA 4X1KE 3HR0A 2D2SA 4ZI3C 3PUQA 5FXWA 4COFA 4MLKA 4EOZB 4HFDA 2MOZA 3AVSA 4DR7T 3HKDE 3VR8A 5J1GA 3C4XA 1GQEA 5LJMA 4PAGA 3N9PA 4LMLA 3ZSTA 1XNQT 4EXTA 2CBIA 4UV8B 4DUZT 2KLQA 4IDZA 4YJ3E 3RYHE 5HXRA 1KNZA 3DTOA 5LGUB 2EHOB 5JDFA 4ILCA 2W00A 5JDHA 4U31A 2HPJA 3NZPA 1WRDA 4PJNA 4KX6A 5CJ5A 3FZMB 3LBXB 4TWFA 4O2BE 5EK4A 5LGNB 1VCSA 3OBVE 2JMHA 4J2CA 2XM2A 4WW0A 3UU4A 2XQ7A 4QH5A 4H9OC 4A97A 1HNXT 2XJ7A 5FYMA 3AE1A 2OLTA 5AQSB 4JEUB 5BR8T 2W61A 4Z8XA 3CKDA 2JJ9A 3X1DA 2K5BB 4U72A 1DU2A 3O9XA 4JI1T 3ZMUB 3JAFA 3MJXA 1N36T 3RH3A 4UVCB 2I6HA 4B3TT 1YXRA 2AXDS 1MIYA 2KZ7B 4EEDA 2DNXA 5DQWA 4EGWA 5LG3A 4X65T 3LK42 4PJMA 4K0UA 4KI0F 4LF9T 2UUCT 2E5VA 3ZJ1A 5HXEA 2XQYA 4HFHA 2A2FX 2LRKA 2FUPA 4IE6A 1XDOA 4TNVA 2KT9A 2Y6XA 2CMRA 2LSKA 3SOLA 2PJQA 4ZI7E 5L3CB 4ILBA 2YDSA 1JNZA 2LSGA 4DV6T 5H6RB
chains in the Genus database with same CATH topology
2JQQA 5KMGP 5JVDE 3N5LA 2VKHA 3LJCA 1VOMA 1SHZC 3LFMA 5F3JA 5KX5E 1D0ZA 3K8PC 5DJQC 5JDLA 4CXYA 5HXCA 5JDNA 5FY1A 4CXXA 3PU8A 3AB3B 2H3RA 2MBGA 3JC6D 3OJAA 1HX8A 3PUSA 3PURA 5M4YA 4AKGA 4ILUA 2PBIA 3W15B 4IGUA 2X9XA 3MACA 4L9IA 2NTXA 4IHJE 2Q9QA 3OYXA 3NRYA 4MHCA 5ETWA 2C5IT 3AA0B 4PFPA 4MFRA 2DWKA 2M67A 3I0QA 3J9X1 3P8CD 3ZMVB 1WR6A 3VKGA 1HS7A 3KV4A 3ZMSB 1UCUA 2CEAA 3PU3A 2X68A 4DMVA 4YFSA 4ZS3A 2YINA 4AKLA 2NTYA 2WM9A 1D1BA 4PJJA 4KBMB 4HTEA 2W62A 4AQGA 4XBFB 2Y8DA 2EHOC 5HWXA 3AA7B 4P0AA 1US7B 4UXNB 3N2OA 3CX8B 3AAIA 3MKDA 1MIWA 3HL6A 5ADXL 2BVLA 3F57A 3KV6A 3M65A 1IJ6A 3RYIE 2DCFA 4CI1B 2PFVA 5LGTB 2NW9A 3LK2B 2NW8A 5JR9A 3R84B 2CWOA 2E9XD 3GWHA 4O4HE 3ZCIA 4EYYR 1QSDA 2L3LA 4AQFC 5FNVE 5FP3A 4BJNA 2X66A 3EVYA 4HFVA 3TKLB 2VKOA 3C50A 5CA0E 3BQLA 3ANWB 4O4IE 3C64A 4TN7B 4DO0A 5H6QB 4EIWA 1HCIA 3SS1A 2GK9A 5JREA 3KBTA 4TX5A 3K3NA 2ZM0A 2W63A 3RYCE 2LJLA 2UXNB 2D0UA 5EK3A 1YW0A 3RRWA 1MMNA 3ZMTB 4XZCA 4ZHQE 3OKQA 2XAJB 3IF8B 5JQGE 3CQCB 2IAKA 3N2GE 4PW8A 5L3GB 2V7LA 1EZ3A 3OYZA 1BR0A 2E9XA 3CVRA 4ZI3D 4DMWA 1AJ3A 1S94A 1IZNB 2A72A 3E08A 5LHHB 4A56A 3DJBA 4HN9A 2XAFB 3C4ZA 4V1Av 2YK0A 2DWGA 3RX6A 4HE8A 5J2TE 4QX7B 4ISTA 3C98B 1OWAA 4CI2B 1E1HB 2SPCA 5TAOA 3F2EA 3CQGB 2WMOA 4HEAA 3N2KE 1D0XA 3NRXA 5J2UE 3RRCA 3I1AA 3ZLIA 3FBZA 5L3EB 2D5UA 5DABA 2RP4A 4N78D 3RYFE 3FBLA 3MA9A 2V7JA 1SA0E 4IE5A 4ANJA 5A1LA 3ZCJA 2CXLA 3P7IA 1LVFA 2V1DB 2V7MA 4AKRB 2H7OA 4GYSA 1YKHB 1T98A 3N9LA 4X1IE 4IE4A 3SRZA 2V7KA 4JLEA 4CXWA 3N9NA 4ZI2C 1HTJF 2LE8A 4G2AA 3ZYLA 1D1CA 3FXEB 4PFOA 3UFEA 3PTRB 5EZYE 5JRCA 4QHOA 2VB6A 4UF0A 2QA7A 3VU7H 2XUEA 5FY7A 2LM9A 2JRKA 2C5KT 1WYCA 2Q9QD 4C91A 5LBQB 2WAUA 3T8OA 5LHGB 4I50E 2DLRA 2NP9A 3CWZB 3DP7A 5HWYA 1HFAA 5F8PA 4BJMA 1MMDA 2ZMAA 2IW5B 4DBQA 2N2NA 5HYAA 4H9RC 4I55E 4P0BA 1QUUA 3FB2A 2ES0A 1ZEEA 3O4XE 2MYSA 5JDMA 2IC6A 2KMFA 5LXTE 3ZJ2A 2EHOD 5HXHA 3IBPA 2Q9QB 3H37A 3H3AA 4EZHA 4QX8B 2JMKA 4UEMA 2NW7A 2XHEB 3HA4A 4BAYB 2CM0A 4QWNB 3UT5E 3ZPOA 3ZYKA 3KINB 1ZKEA 4L5GA 2LHNA 3HKEE 5LG4A 5E0OA 4HKAA 3NZQA 2L9QA 2XAGB 3RC3A 4X20E 3GN5A 4QXBB 2NOXA 3IEEA 4H9NC 4KP3C 1D1AA 2B1EA 2X67A 2YU2A 1V9DA 2X0LB 4G63A 5FMNA 3ETUA 5JR9B 2C0SA 5L2LA 2EHOA 3UUNA 3CMLA 4M1PA 5HAXA 1UX5A 2I59A 4CQIA 2ZLYA 3E0ZA 1HG5A 4EYUA 1YKEB 3FXDB 3BK9A 2LT3A 1MNEA 3NBXX 2VK9A 4ASKA 3SWHA 1BR2A 4ZOLE 2LSJA 3BQKA 2KWHA 2LEHA 5DQVA 3IHRA 3WI3A 5LBMA 4AQFA 4P09A 1Y64B 3MK7C 3LBXA 1O3XA 3QC9A 3ZN0B 2Z6EA 3C4WA 3ZYMA 2CXDA 3L3PA 4WBOA 3UUMA 5BMVE 5FXZA 3CX6B 2A3DA 2CE7A 2E9XB 4KUMB 3ZC0A 1HG2A 2JPFA 2ACXA 1G8XA 2CXFA 3I9WA 4IE7A 2CLYB 2KXPB 1H7CA 2WWUA 4I4TE 5LP6E 1LRZA 5JH7E 1UX4A 1MIVA 3ONXA 2XAHB 2BZBA 4GK5E 3HKBE 1BR1A 4UVBB 2Y48B 3CPZA 3WAJA 4I43B 3ZEFB 4KMCA 5HXSA 4ZI2D 2PG8A 4HGAA 3Q9DA 3J7Yq 2N9DA 2YU1A 2N1GA 1U5PA 5L3BB 3UTKA 3ZN1B 4PK5A 4IE0A 3V5SA 2X51A 4QXHB 3Q5XA 4H9SE 3LG7A 4WNKA 4PJLA 4QXCB 3N9OA 3N9QA 2E9XC 2UXXB 2K24A 3F31A 3FHNA 4AKHA 2DI4A 2QGSA 1X79A 2CCQA 2ZM2A 3Q2MA 5C8YE 3PDYA 1LKXA 4TV9E 5JRCB 2ODVA 4X1YE 4CI3B 4UF0B 1FIOA 3KDSE 4CZZB 4JEHB 4FI5A 2V26A 1MMGA 1S35A 4H9QC 2G0UA 1LVKA 5CB4E 2VKDA 3LK3B 4ERRA 5GONE 2CWYA 2ODUA 2RA1A 4E7ZA 3CX7B 3QUJA 2WMNA 3WAKA 3B57A 1NAFA 3AVRA 3QK6A 2VASA 3AAAB 4XAXB 4F6RC 1IJ5A 3D0TA 3V5UA 3KV9A 4UVAB 3AA1B 3I9YA 4TZ4C 2ZM8A 2L8KA 4X1KE 3HR0A 2D2SA 4U74A 4AXPA 3E22E 4ZI3C 3L09A 3R6NA 3RPUA 3PUQA 5JDQA 5FXWA 5JDGA 4MLKA 4PK6A 2KWIB 4EOZB 2MOZA 3AVSA 3C51A 3N9MA 1G73A 5KDMC 4UELA 4TV8E 2BDEA 2H7VC 2V7IA 2LSYA 3HKDE 4EAHA 4O4JE 5J1GA 3C4XA 3I0OA 1Z0PA 3KFWX 4GYRA 3HKCE 5LJMA 4PAGA 3Q5WA 3N9PA 4GOUA 3GN5B 3O1IA 4H63H 5EK2A 4PNIA 4EXTA 4UV9B 4UV8B 3K3QC 2YEVC 2BVMA 2KLQA 4IDZA 4YJ3E 2MTQA 4GK0E 4TUYE 5HXRA 3RYHE 2K48A 2XAQB 4EZ4A 1KNZA 3DTOA 5LGUB 2EHOB 5LNKA 5LJNA 5JDFA 4ADZA 1OXZA 4OK0A 3ETVA 2W00A 5JDHA 3AA6B 2HPJA 4H63V 2Q9QC 1HF8A 3KBUA 5FXVA 3NZPA 1ZV4X 1WRDA 1WLXA 1KK7A 1MNDA 4PJNA 4C90A 3GA8A 2HPLA 4QKNA 3RC8A 5L3FB 3LBXB 2X9HA 1IAPA 2C5JA 2CA5A 4B6XA 2HH7A 3MZKB 2X9YA 1VRBA 4O2BE 5EK4A 3BQIA 5LGNB 3OBVE 2JMHA 4J2CA 4MBQA 3RKOA 3KVBA 3S4UA 1B7TA 3UUXB 3JC6C 5CA1E 4OYJA 2VKJA 4WW0A 4NUVA 4H9OC 5JR9C 2VL8A 3O1HA 5LOVE 5FYMA 3PUGA 3A5XA 2LHRA 1YD8G 5LA6E 2D0TA 3ZMZB 3K3OA 3GMIA 3ESLA 4JEUB 4OHFA 5FY0A 3KVAA 2WBLA 4O4LE 2VWAA 3EDVA 4OYKA 2W61A 2KNDA 2XTLA 4DVDA 5L3DB 4Z8XA 3CKDA 1D0YA 2JJ9A 2WSSV 2LOPA 4BA9A 1FEWA 1FMVA 2DHRA 2KINB 2K5BB 2W0GA 4U72A 4NUUA 2P9BA 3KV5A 3VHLA 3ANWA 3O9XA 3MXZA 4AKIA 4DNDA 1WYBA 3ZMUB 2E8IA 3MJXA 4ZS2A 3RH3A 2K9AA 3PUAA 4UVCB 3U3IA 4AI6A 1NWMX 2CLYC 3CQXC 1BR4A 2X9WA 2XASB 3EDUA 1MIYA 5FXXA 4O2AE 2KZ7B 2OA5A 5LYJE 1ZHCA 4L0RA 2DNXA 4H9PC 3AAEB 3UULA 5AFUL 5DQWA 4DBRA 2J1DG 3O1JA 5IHYA 4EB6E 4UIGA 5LCYA 3LK42 4PJMA 3ZC1A 4YJ2E 1MMAA 4K0UA 3EUHA 2LSIA 4E7SA 4JUYA 2NWBA 4OFZA 3U78A 5IYZE 4WBNE 3ZJ1A 4YHJA 5HXEA 2XQYA 2IC9A 2LOSA 4ISSA 2A2FX 4IIJE 4FJOA 4IE6A 1U4QA 3VKHA 2KT9A 4YLHA 2Y6XA 1CUNA 2CMRA 3PE0A 2LSKA 4O8SA 4PK4A 2PJQA 3SOLA 1FMWA 3HI2A 4ZI7E 4GIWA 5L3CB 5LHIB 3B13A 2LSGA 4MALA 5H6RB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RKO A;  4HE8 A;  5LNK A;  4HEA A; 
#chains in the Genus database with same CATH topology
 3LJC A;  4HFC A;  3SFE A;  4CXY A;  4TWH A;  3PJA A;  4CXX A;  3PU8 A;  4YTN A;  3UU3 A;  1HX8 A;  5C2T A;  1NEK A;  1E2A A;  2PBI A;  5AQQ B;  4L9I A;  4DV5 T;  2NTX A;  2Q9Q A;  4MHC A;  4ZZC A;  5ETW A;  4PFP A;  1WR6 A;  4HWD A;  1HS7 A;  3KV4 A;  3ZMS B;  2YDQ A;  2X68 A;  4ZS3 A;  2YKS A;  3AA7 B;  3HL6 A;  3F57 A;  3M65 A;  1OED C;  1W09 A;  2NW8 A;  5JR9 A;  3R84 B;  3PUV F;  2DL1 A;  3AE6 A;  5FP3 A;  2X66 A;  3EVY A;  4HFV A;  4DR6 T;  3LDQ B;  3BQL A;  3RIU A;  4DO0 A;  4Z90 A;  2MPK A;  3SS1 A;  3KBT A;  4IT4 A;  3K3N A;  1KNR A;  2WCA A;  5L47 A;  2W63 A;  5EK3 A;  1MMN A;  5LB7 B;  3OKQ A;  1OED E;  4EEB A;  3N2G E;  4IDN A;  1EZ3 A;  4ZI3 D;  3PV0 F;  3E08 A;  4YTM A;  3DJB A;  5AQP B;  4HE8 A;  3C98 B;  1OWA A;  3CQG B;  4HEA A;  1D0X A;  3NRX A;  3FBZ A;  2D5U A;  2RP4 A;  5A1L A;  3MA9 A;  2BG9 E;  2M6I A;  2FBW A;  1WCR A;  2ZM6 T;  4GYS A;  4X1I E;  4IE4 A;  4JLE A;  3TLW A;  4TNW A;  3UFE A;  3PTR B;  3VU7 H;  3L39 A;  4C91 A;  4I50 E;  5HWY A;  2F4V T;  3ZT6 A;  1MMD A;  2ZMA A;  4DBQ A;  2N2N A;  3EHZ A;  2KMF A;  4JI2 T;  3ZJ2 A;  3IBP A;  4EZH A;  3HA4 A;  2OV9 A;  4QWN B;  3ZYK A;  2LHN A;  5E0O A;  2XAG B;  3RC3 A;  3GN5 A;  3IEE A;  5AQV B;  4H9N C;  2XY8 B;  5AQK B;  1VCT A;  5C3J A;  4HFI A;  3CML A;  2XZE A;  3UU8 A;  3FXD B;  2ACZ A;  1MNE A;  4ASK A;  1BR2 A;  2LSJ A;  2KWH A;  3IHR A;  3OTO T;  3C4W A;  3L3P A;  4WBO A;  3UUM A;  5FXZ A;  3CX6 B;  4KUM B;  3ZC0 A;  5HEG A;  2JPF A;  2CXF A;  4IE7 A;  1H7C A;  3FZH B;  2W2U A;  2VL0 A;  1MIV A;  3AE4 A;  2XAH B;  1BR1 A;  2Y48 B;  4KMC A;  4ZI2 D;  3AED A;  3Q9D A;  3A8Y C;  4IL9 A;  1U5P A;  3ONJ A;  5AQL B;  2HN2 A;  3ZN1 B;  1QLB A;  3Q5X A;  3N9O A;  3N9Q A;  2UXX B;  2QGS A;  1LKX A;  5JRC B;  4CZZ B;  1MMG A;  4H9Q C;  5CB4 E;  3LK3 B;  2CWY A;  4E7Z A;  3B57 A;  3AVR A;  1UUS A;  4X5T A;  2WDR A;  3QNU A;  3KV9 A;  1NEN A;  4TWD A;  3AA1 B;  3I9Y A;  2E2A A;  2ZM8 A;  4QH1 A;  1J1J A;  3L09 A;  3R6N A;  5JDG A;  2BDE A;  2H7V C;  5AQT B;  5LMN T;  2LSY A;  3Q5W A;  1J5W A;  4K0K T;  3O1I A;  2YDR A;  4H63 H;  2JIW A;  4A5X A;  2YEV C;  1ZOY A;  4TUY E;  4EZ4 A;  2W4X A;  4ADZ A;  1OXZ A;  3L8R A;  1OED B;  2Q9Q C;  2M6B A;  5FXV A;  1WLX A;  1IBL T;  1KK7 A;  1MND A;  1E7P A;  3RC8 A;  1N32 T;  1OED A;  1N33 T;  3P50 A;  5CFB A;  2UU9 T;  3T1Y T;  1I94 T;  2CBJ A;  4DV7 T;  4MBQ A;  4LMK A;  3KVB A;  3S4U A;  2BKP A;  4NUV A;  3FZK B;  4HWF A;  2XQ8 A;  5JR9 C;  2LHR A;  1YD8 G;  5LA6 E;  3K3O A;  3PUZ F;  3ESL A;  4OHF A;  4UR9 A;  2WWV A;  4LFC T;  2BG9 A;  3KVA A;  3RIU C;  2KND A;  2XTL A;  3JCF A;  5AQR B;  4BA9 A;  4QH4 A;  3VHL A;  3ANW A;  4DND A;  1WYB A;  2E8I A;  4ZS2 A;  1UK5 A;  2VVN A;  1NWM X;  3CQX C;  3AEE A;  2XAS B;  5FXX A;  4O2A E;  4JI6 T;  2OA5 A;  4DR3 T;  5AFU L;  4DBR A;  5IHY A;  5LCY A;  3ZC1 A;  4YJ2 E;  2E5L T;  2LSI A;  2XQ5 A;  4E7S A;  4JUY A;  2NWB A;  4WBN E;  5F5W A;  2WP9 A;  4YHJ A;  5AQU B;  1R8I A;  4B3M T;  4YLH A;  1CUN A;  4PK4 A;  3AEF A;  1FMW A;  3HI2 A;  4GIW A;  4IL4 A;  3JAE A;  2JQQ A;  2LM2 A;  2I0M A;  1SHZ C;  4WZX A;  1D0Z A;  3PUW F;  3RIF A;  2D9D A;  5JDN A;  3AE7 A;  5FY1 A;  2MBG A;  3AB3 B;  2H3R A;  3RQU A;  3PUR A;  4U3C A;  2H89 A;  3VKG A;  2M67 A;  3AE8 A;  3ABV A;  2YIN A;  2V6Y A;  1D1B A;  4HTE A;  4AQG A;  1US7 B;  4CN4 A;  3AAI A;  5ADX L;  2JQH A;  3RYI E;  4CI1 B;  2DCF A;  4GKJ T;  2NW9 A;  2CWO A;  3GWH A;  4O4H E;  4EYY R;  2L3L A;  3C50 A;  4TN7 B;  3AEB A;  5H6Q B;  2VQF T;  2ZM0 A;  2D0U A;  3RRW A;  2CPT A;  4NIQ A;  2XAJ B;  5JQG E;  2IAK A;  4PW8 A;  5L3G B;  2V7L A;  3RQW A;  1S94 A;  2A72 A;  4U2Y A;  2XAF B;  3C4Z A;  4V1A v;  2YK0 A;  2DWG A;  5J2T E;  4CI2 B;  3RHW A;  5ABF B;  3OPC A;  5JTG A;  4A98 A;  3T1H T;  5L3E B;  5DAB A;  5ABF A;  4ANJ A;  1SA0 E;  1HR0 T;  3ZCJ A;  2V1D B;  4AKR B;  1YKH B;  3P4W A;  4CXW A;  2V6X A;  3N9N A;  4ZI2 C;  2LE8 A;  3K1S A;  5EZY E;  2QA7 A;  2JRK A;  1XNR T;  4DID B;  1WYC A;  2Q9Q D;  4I0U A;  2IW5 B;  4H9R C;  4I55 E;  1T7S A;  3P4Q A;  3FB2 A;  4P0B A;  3O4X E;  2MYS A;  3SFD A;  2FJD A;  5JDM A;  2BKO A;  2UUA T;  5HXH A;  2MAW A;  2Q9Q B;  4QX8 B;  2CHO A;  2NW7 A;  4DR2 T;  2XHE B;  3UT5 E;  3ZPO A;  4DR4 T;  5LG4 A;  4QXB B;  5FL1 A;  4KP3 C;  1D1A A;  2B1E A;  2YU2 A;  4G63 A;  3ETU A;  3TLV A;  5JR9 B;  5L2L A;  4KHZ F;  1IBK T;  1KNP A;  4YHH T;  1UX5 A;  2I59 A;  4EYU A;  2IIU A;  2BS3 A;  3Q5D A;  3BK9 A;  3BQK A;  5DQV A;  5LBM A;  4AQF A;  4LF6 T;  3MK7 C;  2XQ3 A;  2UUB T;  5BMV E;  2IML A;  4NXM T;  3ONL C;  1Z8U A;  1G8X A;  4IRE A;  2BG9 C;  2HHH T;  2KXP B;  3JAD A;  2WWU A;  5LP6 E;  1UX4 A;  3ONX A;  3CPZ A;  3WAJ A;  3ZEF B;  4JBW F;  1T8B A;  4PK5 A;  4DV2 T;  4ZEY A;  2X51 A;  3LG7 A;  4WNK A;  4U2Z A;  3AE9 A;  2E9X C;  3VR9 A;  3RGL A;  3FHN A;  2DI4 A;  1X79 A;  2ZM2 A;  3UQ7 A;  4TV9 E;  1FIO A;  4FI5 A;  3AE3 A;  4AIS A;  2G0U A;  2VVS A;  2VKD A;  5GON E;  2RA1 A;  3WAK A;  1NAF A;  2L8K A;  4AXP A;  4F8H A;  5JDQ A;  4PK6 A;  2KWI B;  4JI0 T;  3N9M A;  5KDM C;  2LLY A;  4UEL A;  4ILA A;  5FVL A;  4EAH A;  4O4J E;  1L0V A;  1Z0P A;  4GYR A;  3HKC E;  4GOU A;  3GN5 B;  3QOF A;  5CGM A;  4PNI A;  4UV9 B;  2BVM A;  2MTQ A;  4GK0 E;  1FJG T;  4YT0 A;  5LNK A;  5LJN A;  4U33 A;  2WU5 A;  3AA6 B;  4H63 V;  1HF8 A;  1Y01 A;  2XQ6 A;  4C90 A;  4LFB T;  2HPL A;  4QKN A;  3Q5E A;  2R6G F;  2AE9 A;  2X9H A;  1IAP A;  2CA5 A;  1YQ4 A;  2X9Y A;  1VRB A;  3BQI A;  3RIA A;  3RKO A;  2FJB A;  3CIR A;  1W0A A;  2VL8 A;  3O1H A;  5LOV E;  2XPK A;  3A5X A;  2CHN A;  5AQO B;  2D0T A;  4YXD A;  2IHR 1;  3OVU A;  5FY0 A;  4Q25 A;  5ABG A;  2BBJ A;  3RKG A;  2VWA A;  3EDV A;  5L3D B;  1D0Y A;  3UFG A;  2X0H A;  1FEW A;  1FMV A;  4DR1 T;  2KIN B;  4AQY T;  4AKI A;  1KF6 A;  4IDP A;  1UGO A;  2K9A A;  3PUA A;  4AI6 A;  1BR4 A;  3EDU A;  4CN1 A;  5LYJ E;  4JV5 T;  1ZHC A;  4L0R A;  3AAE B;  3TLS A;  3AXJ A;  4JI5 T;  2WU2 A;  2V8S V;  4OFZ A;  5IYZ E;  4B3R T;  4JI3 T;  3G06 A;  4HWI B;  4IIJ E;  3A7M A;  2W67 A;  5LHI B;  2VKH A;  1VOM A;  3LFM A;  1W9R A;  4U7Y A;  1M62 A;  2UXC T;  5KX5 E;  4EV6 A;  5HEH A;  4B3S T;  3K8P C;  5JDL A;  4HFB A;  5HXC A;  2LKH A;  3JC6 D;  3OJA A;  5FL0 A;  3PUS A;  4ILU A;  4IGU A;  2X9X A;  4IHJ E;  2J62 A;  3AA0 B;  4MFR A;  3I0Q A;  2IUB A;  3P8C D;  3ZMV B;  5IWA T;  2CEA A;  4YFS A;  5L4H A;  2WDQ A;  2BKN A;  2WM9 A;  4AKL A;  3P4S A;  4KBM B;  4XBF B;  5HWX A;  3QB5 A;  4P0A A;  4UXN B;  3N2O A;  1MIW A;  2V5C A;  4WYV A;  4IDO A;  2BVL A;  3QB5 K;  3TLT A;  4YTP A;  2PFV A;  5LGT B;  2BG9 B;  2FJE A;  2E9X D;  3IA3 A;  4AQF C;  5FNV E;  2YN6 A;  4BJN A;  1CHU A;  2VKO A;  3ANW B;  4O4I E;  3C64 A;  2XQA A;  4EIW A;  1HCI A;  3B5M A;  4Z91 A;  2QVA A;  3RYC E;  2LKG A;  3ZMT B;  4XZC A;  3OYZ A;  2E9X A;  3CVR A;  1ZP0 A;  4DMW A;  1AJ3 A;  4YSZ A;  5LHH B;  3RX6 A;  2XQ4 A;  4DV1 T;  1E1H B;  2SPC A;  3EAM A;  3P4R A;  2FJA A;  3F2E A;  3ZT5 A;  5J2U E;  3I1A A;  3ZLI A;  4N78 D;  2V7J A;  1XWM A;  2W66 A;  2CXL A;  3P7I A;  3UQ4 A;  2V7M A;  1T98 A;  3AEC A;  3SRZ A;  1HTJ F;  5J0Z A;  2B76 A;  4QHO A;  4UF0 A;  2XUE A;  1I6Z A;  3VRB A;  5LBQ B;  2WAU A;  3T8O A;  5LHG B;  2NP9 A;  3CWZ B;  4GKK T;  5F8P A;  1YQ3 A;  3ZKR A;  5HYA A;  1ZEE A;  2IC6 A;  2EHO D;  3H37 A;  3H3A A;  2JQ9 A;  2QYW A;  2WY2 A;  2V6Y B;  5HEO A;  3HKE E;  4HKA A;  3NZQ A;  2L9Q A;  4X66 T;  2X0L B;  3RF1 A;  2J4G A;  5FMN A;  4HFE A;  5FKY A;  3PJA J;  2EHO A;  3UUN A;  5ABH A;  2UXD T;  4M1P A;  5HAX A;  4CQI A;  4LF7 T;  1HG5 A;  4LMJ A;  2J47 A;  3PUY F;  3NBX X;  2VK9 A;  1W0B A;  5L4E A;  2PTF A;  4ZOL E;  3SWH A;  3NVO A;  3WI3 A;  4ZXL A;  4P09 A;  1Y64 B;  4HWH A;  3LBX A;  1O3X A;  3QC9 A;  3ZN0 B;  2CXD A;  4DV3 T;  2A3D A;  5FVK A;  1HG2 A;  2ACX A;  3I9W A;  2BBH A;  4KHP T;  4I4T E;  2BZB A;  2WB5 A;  3HKB E;  4P1N A;  4HGA A;  2VQE T;  2N1G A;  2WS3 A;  2XM1 A;  4IE0 A;  4H9S E;  4PJL A;  4QXC B;  3F31 A;  3Q2M A;  2LRL A;  5C8Y E;  2H88 A;  3PDY A;  4X1Y E;  3KDS E;  2V26 A;  1S35 A;  1LVK A;  2VUR A;  1HNW T;  4DV0 T;  3CX7 B;  2XSB A;  2VAS A;  3AAA B;  4F6R C;  3LSV A;  1IJ5 A;  3V5U A;  2WZI A;  4UVA B;  3H3M A;  4TZ4 C;  4U74 A;  3E22 E;  4HWC A;  3RPU A;  3C51 A;  1G73 A;  4TV8 E;  3NKZ A;  3AEG A;  2V7I A;  3I0O A;  3KFW X;  2KSR A;  5EK2 A;  1J5E T;  3AE2 A;  3K3Q C;  3ZSS A;  2K48 A;  2XAQ B;  4YSY A;  5HCJ A;  4OK0 A;  1JNR A;  3ETV A;  3KBU A;  1ZV4 X;  4JI4 T;  3GA8 A;  3PUX F;  4OX9 T;  5L3F B;  1XMO T;  2WQY A;  2C5J A;  4B6X A;  2HH7 A;  3MZK B;  2QRX A;  3UU6 A;  1B7T A;  3UUX B;  3JC6 C;  5CA1 E;  4OYJ A;  1WFD A;  2VKJ A;  1M7K A;  2V5D A;  3PUG A;  3TLU A;  5AQG B;  2UXB T;  3ZMZ B;  3GMI A;  2WBL A;  4X64 T;  4O4L E;  4OYK A;  4DVD A;  2WSS V;  2CRB A;  2LOP A;  2DHR A;  2W0G A;  4NUU A;  2P9B A;  3KV5 A;  2JQK A;  3MXZ A;  2BS4 A;  3U3I A;  4YY3 T;  2CLY C;  2X9W A;  3NWI A;  4H9P C;  2K3W A;  3UUL A;  4LFA T;  2NR4 A;  2J1D G;  3O1J A;  4EB6 E;  4UIG A;  5AQN B;  1MMA A;  3EUH A;  2YOE A;  3U78 A;  2IC9 A;  5AQJ B;  2LOS A;  1SUM B;  4ISS A;  4FJO A;  1U4Q A;  3VKH A;  2HN1 A;  3PE0 A;  4O8S A;  3B13 A;  4MAL A;  3UU5 A;  5KMG P;  5JVD E;  3FZL B;  3N5L A;  3M3Z B;  5F3J A;  5DJQ C;  4DR5 T;  5M4Y A;  4AKG A;  3W15 B;  3AEA A;  3MAC A;  2X0Y A;  3NRY A;  3OYX A;  2BS2 A;  1XZY A;  2C5I T;  4JI8 T;  2DWK A;  3J9X 1;  3ZT7 A;  1UCU A;  3PU3 A;  4DMV A;  2NTY A;  4PJJ A;  2W62 A;  2Y8D A;  2EHO C;  3CX8 B;  3MKD A;  3KV6 A;  1IJ6 A;  3LK2 B;  3RI5 A;  3ZCI A;  1QSD A;  4LF5 T;  3TKL B;  3RLF F;  5CA0 E;  4LF4 T;  2GK9 A;  5JRE A;  4TX5 A;  3CK6 A;  5AQF B;  1KEY A;  2LJL A;  2UXN B;  1YW0 A;  4LF8 T;  5ABE A;  4ZHQ E;  3IF8 B;  3CQC B;  1BR0 A;  1IZN B;  4A56 A;  5HCM A;  4HN9 A;  3AXJ B;  2A9U A;  4QX7 B;  4IST A;  5TAO A;  2WMO A;  2RPA A;  3N2K E;  1KFY A;  3RRC A;  1SE7 A;  4DV4 T;  1T72 A;  3RYF E;  3FBL A;  2IDO B;  4IE5 A;  1LVF A;  2H7O A;  5AQH B;  3N9L A;  5KXJ A;  2V7K A;  4G2A A;  3ZYL A;  1D1C A;  3FXE B;  4PFO A;  5JRC A;  2VB6 A;  5LMU T;  5FY7 A;  2LM9 A;  3UUB A;  5IUX A;  2C5K T;  2DLR A;  3DP7 A;  5AQM B;  1HFA A;  4BJM A;  4X62 T;  1QUU A;  3P4P A;  2ES0 A;  5LXT E;  4U7I A;  2JMK A;  2WZH A;  4UEM A;  4BAY B;  4ZZB A;  2CM0 A;  5AQI B;  3KIN B;  1ZKE A;  1HNZ T;  4L5G A;  3EI0 A;  1IBM T;  4X20 E;  2NOX A;  4AIU A;  3AE5 A;  2X67 A;  1V9D A;  1X9B A;  4JYA T;  2C0S A;  5HEJ A;  1N34 T;  2ZLY A;  3E0Z A;  1YKE B;  2XQ9 A;  4NPP A;  2LT3 A;  2LEH A;  4NXN T;  3ZYM A;  2Z6E A;  1XDP A;  2CE7 A;  2E9X B;  2XSA A;  2CLY B;  1LRZ A;  3FZF B;  5JH7 E;  4GK5 E;  4UVB B;  4I43 B;  5HXS A;  2PG8 A;  3J7Y q;  1UUR A;  2N9D A;  2YU1 A;  1WR0 A;  5L3B B;  3UTK A;  3V5S A;  4QXH B;  4JI7 T;  2K24 A;  4AKH A;  5HEU A;  2CCQ A;  2ODV A;  3EAB A;  4CI3 B;  4UF0 B;  4JEH B;  3VRA A;  4ERR A;  2ODU A;  3QUJ A;  1XMQ T;  2WMN A;  4CN6 A;  4IDQ A;  1HX1 B;  3QK6 A;  4XAX B;  3D0T A;  4YSX A;  4DUY T;  2WDV A;  4X1K E;  3HR0 A;  2D2S A;  4ZI3 C;  3PUQ A;  5FXW A;  4COF A;  4MLK A;  4EOZ B;  4HFD A;  2MOZ A;  3AVS A;  4DR7 T;  3HKD E;  3VR8 A;  5J1G A;  3C4X A;  1GQE A;  5LJM A;  4PAG A;  3N9P A;  4LML A;  3ZST A;  1XNQ T;  4EXT A;  2CBI A;  4UV8 B;  4DUZ T;  2KLQ A;  4IDZ A;  4YJ3 E;  3RYH E;  5HXR A;  1KNZ A;  3DTO A;  5LGU B;  2EHO B;  5JDF A;  4ILC A;  2W00 A;  5JDH A;  4U31 A;  2HPJ A;  3NZP A;  1WRD A;  4PJN A;  4KX6 A;  5CJ5 A;  3FZM B;  3LBX B;  4TWF A;  4O2B E;  5EK4 A;  5LGN B;  1VCS A;  3OBV E;  2JMH A;  4J2C A;  2XM2 A;  4WW0 A;  3UU4 A;  2XQ7 A;  4QH5 A;  4H9O C;  4A97 A;  1HNX T;  2XJ7 A;  5FYM A;  3AE1 A;  2OLT A;  5AQS B;  4JEU B;  5BR8 T;  2W61 A;  4Z8X A;  3CKD A;  2JJ9 A;  3X1D A;  2K5B B;  4U72 A;  1DU2 A;  3O9X A;  4JI1 T;  3ZMU B;  3JAF A;  3MJX A;  1N36 T;  3RH3 A;  4UVC B;  2I6H A;  4B3T T;  1YXR A;  2AXD S;  1MIY A;  2KZ7 B;  4EED A;  2DNX A;  5DQW A;  4EGW A;  5LG3 A;  4X65 T;  3LK4 2;  4PJM A;  4K0U A;  4KI0 F;  4LF9 T;  2UUC T;  2E5V A;  3ZJ1 A;  5HXE A;  2XQY A;  4HFH A;  2A2F X;  2LRK A;  2FUP A;  4IE6 A;  1XDO A;  4TNV A;  2KT9 A;  2Y6X A;  2CMR A;  2LSK A;  3SOL A;  2PJQ A;  4ZI7 E;  5L3C B;  4ILB A;  2YDS A;  1JNZ A;  2LSG A;  4DV6 T;  5H6R B; 
#chains in the Genus database with same CATH homology
 2JQQ A;  5KMG P;  5JVD E;  3N5L A;  2VKH A;  3LJC A;  1VOM A;  1SHZ C;  3LFM A;  5F3J A;  5KX5 E;  1D0Z A;  3K8P C;  5DJQ C;  5JDL A;  4CXY A;  5HXC A;  5JDN A;  5FY1 A;  4CXX A;  3PU8 A;  3AB3 B;  2H3R A;  2MBG A;  3JC6 D;  3OJA A;  1HX8 A;  3PUS A;  3PUR A;  5M4Y A;  4AKG A;  4ILU A;  2PBI A;  3W15 B;  4IGU A;  2X9X A;  3MAC A;  4L9I A;  2NTX A;  4IHJ E;  2Q9Q A;  3OYX A;  3NRY A;  4MHC A;  5ETW A;  2C5I T;  3AA0 B;  4PFP A;  4MFR A;  2DWK A;  2M67 A;  3I0Q A;  3J9X 1;  3P8C D;  3ZMV B;  1WR6 A;  3VKG A;  1HS7 A;  3KV4 A;  3ZMS B;  1UCU A;  2CEA A;  3PU3 A;  2X68 A;  4DMV A;  4YFS A;  4ZS3 A;  2YIN A;  4AKL A;  2NTY A;  2WM9 A;  1D1B A;  4PJJ A;  4KBM B;  4HTE A;  2W62 A;  4AQG A;  4XBF B;  2Y8D A;  2EHO C;  5HWX A;  3AA7 B;  4P0A A;  1US7 B;  4UXN B;  3N2O A;  3CX8 B;  3AAI A;  3MKD A;  1MIW A;  3HL6 A;  5ADX L;  2BVL A;  3F57 A;  3KV6 A;  3M65 A;  1IJ6 A;  3RYI E;  2DCF A;  4CI1 B;  2PFV A;  5LGT B;  2NW9 A;  3LK2 B;  2NW8 A;  5JR9 A;  3R84 B;  2CWO A;  2E9X D;  3GWH A;  4O4H E;  3ZCI A;  4EYY R;  1QSD A;  2L3L A;  4AQF C;  5FNV E;  5FP3 A;  4BJN A;  2X66 A;  3EVY A;  4HFV A;  3TKL B;  2VKO A;  3C50 A;  5CA0 E;  3BQL A;  3ANW B;  4O4I E;  3C64 A;  4TN7 B;  4DO0 A;  5H6Q B;  4EIW A;  1HCI A;  3SS1 A;  2GK9 A;  5JRE A;  3KBT A;  4TX5 A;  3K3N A;  2ZM0 A;  2W63 A;  3RYC E;  2LJL A;  2UXN B;  2D0U A;  5EK3 A;  1YW0 A;  3RRW A;  1MMN A;  3ZMT B;  4XZC A;  4ZHQ E;  3OKQ A;  2XAJ B;  3IF8 B;  5JQG E;  3CQC B;  2IAK A;  3N2G E;  4PW8 A;  5L3G B;  2V7L A;  1EZ3 A;  3OYZ A;  1BR0 A;  2E9X A;  3CVR A;  4ZI3 D;  4DMW A;  1AJ3 A;  1S94 A;  1IZN B;  2A72 A;  3E08 A;  5LHH B;  4A56 A;  3DJB A;  4HN9 A;  2XAF B;  3C4Z A;  4V1A v;  2YK0 A;  2DWG A;  3RX6 A;  4HE8 A;  5J2T E;  4QX7 B;  4IST A;  3C98 B;  1OWA A;  4CI2 B;  1E1H B;  2SPC A;  5TAO A;  3F2E A;  3CQG B;  2WMO A;  4HEA A;  3N2K E;  1D0X A;  3NRX A;  5J2U E;  3RRC A;  3I1A A;  3ZLI A;  3FBZ A;  5L3E B;  2D5U A;  5DAB A;  2RP4 A;  4N78 D;  3RYF E;  3FBL A;  3MA9 A;  2V7J A;  1SA0 E;  4IE5 A;  4ANJ A;  5A1L A;  3ZCJ A;  2CXL A;  3P7I A;  1LVF A;  2V1D B;  2V7M A;  4AKR B;  2H7O A;  4GYS A;  1YKH B;  1T98 A;  3N9L A;  4X1I E;  4IE4 A;  3SRZ A;  2V7K A;  4JLE A;  4CXW A;  3N9N A;  4ZI2 C;  1HTJ F;  2LE8 A;  4G2A A;  3ZYL A;  1D1C A;  3FXE B;  4PFO A;  3UFE A;  3PTR B;  5EZY E;  5JRC A;  4QHO A;  2VB6 A;  4UF0 A;  2QA7 A;  3VU7 H;  2XUE A;  5FY7 A;  2LM9 A;  2JRK A;  2C5K T;  1WYC A;  2Q9Q D;  4C91 A;  5LBQ B;  2WAU A;  3T8O A;  5LHG B;  4I50 E;  2DLR A;  2NP9 A;  3CWZ B;  3DP7 A;  5HWY A;  1HFA A;  5F8P A;  4BJM A;  1MMD A;  2ZMA A;  2IW5 B;  4DBQ A;  2N2N A;  5HYA A;  4H9R C;  4I55 E;  4P0B A;  1QUU A;  3FB2 A;  2ES0 A;  1ZEE A;  3O4X E;  2MYS A;  5JDM A;  2IC6 A;  2KMF A;  5LXT E;  3ZJ2 A;  2EHO D;  5HXH A;  3IBP A;  2Q9Q B;  3H37 A;  3H3A A;  4EZH A;  4QX8 B;  2JMK A;  4UEM A;  2NW7 A;  2XHE B;  3HA4 A;  4BAY B;  2CM0 A;  4QWN B;  3UT5 E;  3ZPO A;  3ZYK A;  3KIN B;  1ZKE A;  4L5G A;  2LHN A;  3HKE E;  5LG4 A;  5E0O A;  4HKA A;  3NZQ A;  2L9Q A;  2XAG B;  3RC3 A;  4X20 E;  3GN5 A;  4QXB B;  2NOX A;  3IEE A;  4H9N C;  4KP3 C;  1D1A A;  2B1E A;  2X67 A;  2YU2 A;  1V9D A;  2X0L B;  4G63 A;  5FMN A;  3ETU A;  5JR9 B;  2C0S A;  5L2L A;  2EHO A;  3UUN A;  3CML A;  4M1P A;  5HAX A;  1UX5 A;  2I59 A;  4CQI A;  2ZLY A;  3E0Z A;  1HG5 A;  4EYU A;  1YKE B;  3FXD B;  3BK9 A;  2LT3 A;  1MNE A;  3NBX X;  2VK9 A;  4ASK A;  3SWH A;  1BR2 A;  4ZOL E;  2LSJ A;  3BQK A;  2KWH A;  2LEH A;  5DQV A;  3IHR A;  3WI3 A;  5LBM A;  4AQF A;  4P09 A;  1Y64 B;  3MK7 C;  3LBX A;  1O3X A;  3QC9 A;  3ZN0 B;  2Z6E A;  3C4W A;  3ZYM A;  2CXD A;  3L3P A;  4WBO A;  3UUM A;  5BMV E;  5FXZ A;  3CX6 B;  2A3D A;  2CE7 A;  2E9X B;  4KUM B;  3ZC0 A;  1HG2 A;  2JPF A;  2ACX A;  1G8X A;  2CXF A;  3I9W A;  4IE7 A;  2CLY B;  2KXP B;  1H7C A;  2WWU A;  4I4T E;  5LP6 E;  1LRZ A;  5JH7 E;  1UX4 A;  1MIV A;  3ONX A;  2XAH B;  2BZB A;  4GK5 E;  3HKB E;  1BR1 A;  4UVB B;  2Y48 B;  3CPZ A;  3WAJ A;  4I43 B;  3ZEF B;  4KMC A;  5HXS A;  4ZI2 D;  2PG8 A;  4HGA A;  3Q9D A;  3J7Y q;  2N9D A;  2YU1 A;  2N1G A;  1U5P A;  5L3B B;  3UTK A;  3ZN1 B;  4PK5 A;  4IE0 A;  3V5S A;  2X51 A;  4QXH B;  3Q5X A;  4H9S E;  3LG7 A;  4WNK A;  4PJL A;  4QXC B;  3N9O A;  3N9Q A;  2E9X C;  2UXX B;  2K24 A;  3F31 A;  3FHN A;  4AKH A;  2DI4 A;  2QGS A;  1X79 A;  2CCQ A;  2ZM2 A;  3Q2M A;  5C8Y E;  3PDY A;  1LKX A;  4TV9 E;  5JRC B;  2ODV A;  4X1Y E;  4CI3 B;  4UF0 B;  1FIO A;  3KDS E;  4CZZ B;  4JEH B;  4FI5 A;  2V26 A;  1MMG A;  1S35 A;  4H9Q C;  2G0U A;  1LVK A;  5CB4 E;  2VKD A;  3LK3 B;  4ERR A;  5GON E;  2CWY A;  2ODU A;  2RA1 A;  4E7Z A;  3CX7 B;  3QUJ A;  2WMN A;  3WAK A;  3B57 A;  1NAF A;  3AVR A;  3QK6 A;  2VAS A;  3AAA B;  4XAX B;  4F6R C;  1IJ5 A;  3D0T A;  3V5U A;  3KV9 A;  4UVA B;  3AA1 B;  3I9Y A;  4TZ4 C;  2ZM8 A;  2L8K A;  4X1K E;  3HR0 A;  2D2S A;  4U74 A;  4AXP A;  3E22 E;  4ZI3 C;  3L09 A;  3R6N A;  3RPU A;  3PUQ A;  5JDQ A;  5FXW A;  5JDG A;  4MLK A;  4PK6 A;  2KWI B;  4EOZ B;  2MOZ A;  3AVS A;  3C51 A;  3N9M A;  1G73 A;  5KDM C;  4UEL A;  4TV8 E;  2BDE A;  2H7V C;  2V7I A;  2LSY A;  3HKD E;  4EAH A;  4O4J E;  5J1G A;  3C4X A;  3I0O A;  1Z0P A;  3KFW X;  4GYR A;  3HKC E;  5LJM A;  4PAG A;  3Q5W A;  3N9P A;  4GOU A;  3GN5 B;  3O1I A;  4H63 H;  5EK2 A;  4PNI A;  4EXT A;  4UV9 B;  4UV8 B;  3K3Q C;  2YEV C;  2BVM A;  2KLQ A;  4IDZ A;  4YJ3 E;  2MTQ A;  4GK0 E;  4TUY E;  5HXR A;  3RYH E;  2K48 A;  2XAQ B;  4EZ4 A;  1KNZ A;  3DTO A;  5LGU B;  2EHO B;  5LNK A;  5LJN A;  5JDF A;  4ADZ A;  1OXZ A;  4OK0 A;  3ETV A;  2W00 A;  5JDH A;  3AA6 B;  2HPJ A;  4H63 V;  2Q9Q C;  1HF8 A;  3KBU A;  5FXV A;  3NZP A;  1ZV4 X;  1WRD A;  1WLX A;  1KK7 A;  1MND A;  4PJN A;  4C90 A;  3GA8 A;  2HPL A;  4QKN A;  3RC8 A;  5L3F B;  3LBX B;  2X9H A;  1IAP A;  2C5J A;  2CA5 A;  4B6X A;  2HH7 A;  3MZK B;  2X9Y A;  1VRB A;  4O2B E;  5EK4 A;  3BQI A;  5LGN B;  3OBV E;  2JMH A;  4J2C A;  4MBQ A;  3RKO A;  3KVB A;  3S4U A;  1B7T A;  3UUX B;  3JC6 C;  5CA1 E;  4OYJ A;  2VKJ A;  4WW0 A;  4NUV A;  4H9O C;  5JR9 C;  2VL8 A;  3O1H A;  5LOV E;  5FYM A;  3PUG A;  3A5X A;  2LHR A;  1YD8 G;  5LA6 E;  2D0T A;  3ZMZ B;  3K3O A;  3GMI A;  3ESL A;  4JEU B;  4OHF A;  5FY0 A;  3KVA A;  2WBL A;  4O4L E;  2VWA A;  3EDV A;  4OYK A;  2W61 A;  2KND A;  2XTL A;  4DVD A;  5L3D B;  4Z8X A;  3CKD A;  1D0Y A;  2JJ9 A;  2WSS V;  2LOP A;  4BA9 A;  1FEW A;  1FMV A;  2DHR A;  2KIN B;  2K5B B;  2W0G A;  4U72 A;  4NUU A;  2P9B A;  3KV5 A;  3VHL A;  3ANW A;  3O9X A;  3MXZ A;  4AKI A;  4DND A;  1WYB A;  3ZMU B;  2E8I A;  3MJX A;  4ZS2 A;  3RH3 A;  2K9A A;  3PUA A;  4UVC B;  3U3I A;  4AI6 A;  1NWM X;  2CLY C;  3CQX C;  1BR4 A;  2X9W A;  2XAS B;  3EDU A;  1MIY A;  5FXX A;  4O2A E;  2KZ7 B;  2OA5 A;  5LYJ E;  1ZHC A;  4L0R A;  2DNX A;  4H9P C;  3AAE B;  3UUL A;  5AFU L;  5DQW A;  4DBR A;  2J1D G;  3O1J A;  5IHY A;  4EB6 E;  4UIG A;  5LCY A;  3LK4 2;  4PJM A;  3ZC1 A;  4YJ2 E;  1MMA A;  4K0U A;  3EUH A;  2LSI A;  4E7S A;  4JUY A;  2NWB A;  4OFZ A;  3U78 A;  5IYZ E;  4WBN E;  3ZJ1 A;  4YHJ A;  5HXE A;  2XQY A;  2IC9 A;  2LOS A;  4ISS A;  2A2F X;  4IIJ E;  4FJO A;  4IE6 A;  1U4Q A;  3VKH A;  2KT9 A;  4YLH A;  2Y6X A;  1CUN A;  2CMR A;  3PE0 A;  2LSK A;  4O8S A;  4PK4 A;  2PJQ A;  3SOL A;  1FMW A;  3HI2 A;  4ZI7 E;  4GIW A;  5L3C B;  5LHI B;  3B13 A;  2LSG A;  4MAL A;  5H6R B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...