5LNKA

Entire ovine respiratory complex i
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
115
structure length
115
Chain Sequence
MNLMITLLTNFTLATLLVTIAFWLPQLNVYSEKTSPYECGFDPMGSARLPFSMKFFLVAITFLLFDLEIALLLPLPWASQTTNLNTMLTMALLLIFLLAVSLAYEWTQKGLEWTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitochondrial complex I, 51 kDa subunit
publication title Atomic structure of the entire mammalian mitochondrial complex I.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 32
structure length 115
sequence length 115
ec nomenclature ec 7.1.1.2: NADH:ubiquinone reductase (H(+)-translocating).
pdb deposition date 2016-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00507 Oxidored_q4 NADH-ubiquinone/plastoquinone oxidoreductase, chain 3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1610 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 5lnkA00
4HE8A 4HEAA 3RKOA 5LNKA
chains in the Genus database with same CATH superfamily
2LOSA 3FZMB 5J0ZA 4Z8XA 1ZP0A 5FY0A 5KX5E 3ZYKA 3RQUA 4EGWA 3IHRA 1R8IA 3UULA 4CN1A 5BR8T 4ZZBA 4ISTA 5LGTB 3AVRA 1HS7A 3OTOT 1KK7A 4EYUA 3AE7A 2L8KA 2ZLYA 5ABEA 4QXCB 5LA6E 4HTEA 4EXTA 3NRXA 5EK4A 4BAYB 2WDVA 4NXNT 3B13A 3RIUA 5IWAT 4IE4A 2R6GF 1XDOA 3NRYA 1US7B 2UUCT 1KFYA 2KWHA 3CKDA 2BS2A 1YQ4A 4GYRA 1Y01A 3PU8A 3JCFA 5L47A 3AXJB 2D9DA 1D1BA 1W9RA 5JDQA 4LF4T 2VVSA 2XQYA 5HEOA 5DJQC 3B57A 3FBLA 5AQKB 2CHOA 4B3TT 3RIUC 1VCTA 2LEHA 3LG7A 4O4HE 3M3ZB 2VURA 4EYYR 3J9X1 2X0YA 1E2AA 3H3AA 4U7IA 1UURA 2VKDA 4A97A 3UQ7A 1HNZT 5LG4A 4HKAA 4U72A 4CXXA 4CXYA 3VR9A 2QGSA 1N33T 3RYIE 2FUPA 1HX8A 3ZN0B 3QUJA 3PU3A 4EB6E 2IIUA 2DL1A 3S4UA 3IBPA 5AQFB 4O8SA 1HTJF 4ERRA 3D0TA 1N34T 3ETVA 1NEKA 2LJLA 1LVKA 2WWVA 2LSKA 5AQLB 3RF1A 2XQ4A 4QH1A 1Y64B 3ZJ2A 3ZSSA 2IDOB 4U31A 4YJ2E 5JRCA 4XZCA 4ZI3D 3L3PA 3QB5A 4UR9A 2Y48B 5HXRA 3GN5A 2LHNA 5LBMA 3IEEA 5JDMA 5IHYA 3UUNA 2VL8A 3C51A 2UXDT 2H3RA 4IL4A 2JQQA 1QLBA 1GQEA 4UVBB 3RKOA 4LF9T 3UFEA 2X9YA 2L3LA 2K9AA 2VB6A 3QOFA 3OKQA 3SFDA 1NWMX 5JDLA 2H7OA 5ABHA 2PG8A 5LHHB 2E9XA 3PUWF 2WB5A 2H88A 1MIVA 1D0YA 3E08A 2NW8A 4H9OC 1EZ3A 5AQGB 4JI0T 1NENA 4H9SE 4UVCB 4KHZF 2PBIA 3O1JA 2VKJA 2LLYA 4GK5E 5HEJA 3E22E 1MMGA 2Q9QC 3P4WA 5ABFB 3N9PA 3FXDB 3JAEA 3ZKRA 1HF8A 4WBNE 3N9NA 2RA1A 2SPCA 3A8YC 3NWIA 3CVRA 4P0AA 2Y8DA 2E9XC 4CXWA 2L9QA 5IUXA 5JREA 3HKEE 2WS3A 5LBQB 1HNWT 4AKGA 2LSGA 3UT5E 1VCSA 5GONE 5LMUT 3ZYLA 2NOXA 5FL0A 4QHOA 3PUZF 4OX9T 2V7JA 2IMLA 4EV6A 4HFDA 4PJNA 1N36T 5JRCB 1SHZC 4DO0A 4DR6T 3GN5B 4ZI7E 4YY3T 4I0UA 1YW0A 5KDMC 5JQGE 5HAXA 2YOEA 2VASA 4B3ST 5L3BB 3ZCIA 2E9XD 2C5IT 2Q9QB 3ETUA 4ZS3A 5J2UE 3AE6A 4GOUA 5AQJB 1D1CA 2BBHA 4TWFA 3OBVE 2MBGA 1ZEEA 1B7TA 1MIWA 2E9XB 2V26A 4TUYE 2OLTA 3Q9DA 2XM2A 2V5CA 1M7KA 1MMAA 2KMFA 2WWUA 1WLXA 4H9QC 1ZKEA 2ODVA 2DI4A 1QSDA 3C64A 4AIUA 2LE8A 2A3DA 3C98B 2CXDA 5FVKA 4DMVA 5HXSA 4MHCA 4YHHT 4B3RT 3AE8A 5EZYE 4A56A 4DNDA 2FJDA 4UELA 1W0AA 5ETWA 2NP9A 4X65T 2XQ8A 2PFVA 1OWAA 5L3DB 4JI1T 1W0BA 3C4WA 2JQKA 2KLQA 5LGUB 2X67A 3RRWA 2VQFT 2OA5A 2X0HA 4ZI2C 3AAAB 4NPPA 3NKZA 5L3EB 4ZHQE 2ES0A 4DV2T 3DP7A 4TNVA 1E1HB 4X1IE 4OK0A 5CA0E 2QA7A 3I9WA 2F4VT 4AQFA 3KV4A 2ZM0A 2P9BA 4U7YA 4LMLA 3VRAA 2I59A 3EUHA 4KUMB 2BG9A 3L09A 5AQQB 3ZMTB 2W62A 1WR6A 1UX4A 2UXXB 3ZC1A 2XSAA 2BG9E 2J62A 4WW0A 2XPKA 4MFRA 5HXEA 3QNUA 3P8CD 4DR1T 4AQFC 4PK6A 4DMWA 4H63V 1UGOA 2V5DA 5HCJA 2HPLA 3ZEFB 2BG9C 4ILUA 4ZEYA 1KNRA 3MKDA 3EI0A 4HWHA 4EEDA 3KV6A 4BA9A 1BR2A 3N2OA 3O4XE 2DWGA 3LDQB 2NW9A 1J1JA 5FY1A 2HN2A 2M6IA 3L8RA 3EABA 1XDPA 4X66T 1KF6A 2D2SA 4KMCA 3T1YT 3B5MA 3N2KE 4KX6A 2NR4A 2I6HA 5HEUA 3I9YA 5IYZE 3DTOA 4M1PA 4UXNB 5CA1E 4K0UA 3PE0A 3Q2MA 4N78D 1FMWA 5J2TE 1DU2A 2LKGA 4KHPT 2E5VA 3MXZA 2BG9B 3RYHE 2BZBA 3JC6C 2CM0A 3N9QA 5FYMA 2ACXA 3F57A 3OJAA 1S94A 5LGNB 2WDQA 3EHZA 3SS1A 4ANJA 1T98A 2CE7A 1OXZA 2HPJA 2YINA 4GK0E 1WYCA 2B1EA 5AFUL 1I6ZA 4PJLA 3ANWA 3J7Yq 3TLWA 2LKHA 1OEDA 4YLHA 2JMKA 5LJNA 3MACA 4PJMA 2KNDA 3X1DA 2KXPB 2CRBA 3UUXB 2HN1A 4JV5T 1N32T 1JNRA 2M6BA 2D5UA 2XQ5A 1MMDA 1OEDE 2YDQA 2FBWA 4IDPA 5E0OA 1WRDA 3AEAA 2QVAA 3SWHA 4DUZT 2UUBT 2XAHB 1KNZA 2DCFA 1FJGT 5BMVE 4A98A 3I0OA 4EOZB 3PUXF 4YJ3E 1OEDC 3LSVA 1UCUA 2MYSA 2N1GA 5JDNA 1BR4A 4Z90A 5FL1A 2VQET 2XTLA 3AA6B 3VHLA 4YTNA 1WFDA 2LRKA 4LF5T 3TLTA 2BKNA 4HEAA 4ILBA 1SUMB 4JLEA 3CQCB 5AQHB 4IE5A 1T7SA 3CX7B 3QB5K 4H9NC 4HFEA 5ABFA 4TWHA 2MPKA 4JI2T 3I1AA 5JR9C 4AI6A 3P7IA 2CMRA 4HWIB 2VVNA 3N5LA 3FZHB 1D0XA 3K8PC 5F8PA 3P4RA 3RYFE 3AAEB 3CIRA 1HNXT 4E7SA 3ANWB 3H3MA 5EK3A 4I43B 3CQXC 5FXWA 3ZSTA 4O2AE 3EVYA 4Q25A 1OEDB 1IBLT 4TV9E 3RYCE 1Z8UA 2LSYA 4JI8T 3UUBA 2FJEA 3BQKA 4X1KE 3G06A 3SRZA 1XMQT 1X9BA 3OYZA 2WY2A 1LRZA 2MTQA 2YN6A 1G8XA 3N9OA 2BVMA 2RPAA 2YKSA 3PUQA 3PURA 4X64T 1I94T 1Z0PA 3AECA 1XNRT 3V5SA 2Q9QA 1YD8G 4ZS2A 4YTMA 2YU2A 4GYSA 5JR9B 3CQGB 3RIAA 3NZPA 4XAXB 2WSSV 4G63A 4V1Av 5F5WA 2DHRA 4WZXA 4OFZA 4OYKA 4PAGA 2XJ7A 2CWYA 4AQYT 1MMNA 3AE5A 4YXDA 1M62A 5AQUB 1KEYA 4HFHA 4PFOA 5AQVB 1J5WA 2W4XA 2K24A 1UUSA 1CHUA 2IW5B 2JRKA 3AAIA 5AQPB 3LJCA 2I0MA 3AB3B 4IIJE 4HFBA 2V7KA 2WBLA 2V1DB 3TLSA 2X9WA 2N9DA 2CPTA 4JEUB 2CBIA 4CI1B 4IHJE 4U33A 2RP4A 4CQIA 3PUGA 4YSYA 4QWNB 2C5JA 3IA3A 4DV1T 4ISSA 3K3OA 4QH5A 5L4HA 2FJBA 4A5XA 4YFSA 3RKGA 2CA5A 3JAFA 1MNDA 3KV9A 4CN4A 3EDVA 2V6YA 4FJOA 4KP3C 2Q9QD 2XASB 3LK3B 4P09A 3MK7C 2B76A 4BJNA 4GIWA 2CXFA 3TLUA 5CB4E 2ODUA 3WAKA 4AQGA 4PFPA 4F6RC 2BS4A 2ZMAA 3FZLB 4O4LE 1IJ6A 5HYAA 3AEBA 4DR4T 4MLKA 3O1IA 1MIYA 2N2NA 3PJAA 2AE9A 3MA9A 4L5GA 3CPZA 1ZV4X 4DVDA 2XAQB 2BKOA 3GA8A 3L39A 2JQ9A 4U74A 2CCQA 5FVLA 3P50A 2UXCT 2KINB 2LSIA 2JPFA 2FJAA 4ILCA 3ZMSB 2D0TA 4QX7B 2UXBT 4TZ4C 1XZYA 2YEVC 3UU4A 4CZZB 1FMVA 3AE4A 4IDNA 5LP6E 4QX8B 1IJ5A 3O9XA 3UU3A 4IE7A 5LOVE 3RGLA 1L0VA 2E5LT 1CUNA 2WU5A 4U2ZA 2HHHT 4F8HA 3RX6A 2NW7A 3ZMVB 3GMIA 1W09A 2IHR1 5KXJA 2UXNB 2A9UA 2V7IA 4TX5A 2C5KT 5LJMA 1H7CA 3AA1B 4CN6A 1HR0T 3EAMA 3CMLA 2V6YB 2W66A 2X9HA 3UU8A 4NUVA 4PNIA 5FKYA 3ZLIA 4TN7B 5C8YE 3ONJA 2W0GA 1XNQT 2LM9A 3RQWA 3JADA 4UVAB 4DV6T 5FXXA 2K3WA 3K3NA 4HFCA 2X9XA 3MZKB 3RLFF 2MAWA 1BR1A 3FXEB 3UTKA 3NZQA 3U3IA 1JNZA 4LMJA 3KV5A 5CGMA 5DQWA 4ZI2D 4JUYA 3AVSA 4QKNA 4B3MT 3UU5A 2WZIA 3ZCJA 2JJ9A 2E8IA 2C0SA 3HI2A 5LB7B 4HE8A 3C4ZA 2JIWA 4EAHA 4H63H 1U5PA 4TWDA 3AE2A 1IBMT 3PUYF 1D0ZA 2LT3A 5HWYA 3R6NA 1WCRA 1HFAA 4C91A 2H89A 3N2GE 1VOMA 1HX1B 4EZ4A 2ACZA 3HKCE 4G2AA 4LF8T 4XBFB 2XAGB 4NXMT 4OHFA 5FMNA 3ZT5A 1QUUA 3CK6A 4KBMB 5F3JA 4HGAA 2WMOA 4PK4A 2J47A 4Z91A 1BR0A 2PJQA 4X20E 5LXTE 5LNKA 3LBXB 3C4XA 3A5XA 2HH7A 3ONXA 3RRCA 3A7MA 5AQMB 2VKOA 1SE7A 1IBKT 4HWFA 2XQ9A 4AXPA 1LKXA 3WI3A 3ZT6A 3P4PA 4AKHA 3WAJA 2XUEA 3O1HA 4DUYT 2E2AA 2KWIB 4COFA 4UF0B 4LFBT 4ZZCA 2M67A 4WBOA 2X0LB 3BQLA 2KSRA 3C50A 2WM9A 2XAJB 4AKRB 4DV3T 4HN9A 4E7ZA 2MOZA 4QH4A 5FNVE 3OYXA 4LF7T 5L2LA 3JC6D 3DJBA 2YDRA 3FBZA 3KVAA 2DLRA 4ADZA 3R84B 3TLVA 4AKLA 4FI5A 2V6XA 4DIDB 2LOPA 2QRXA 4JI7T 2IAKA 5JR9A 5JDGA 2BS3A 2QYWA 3VKHA 2YDSA 2NTXA 2GK9A 4IGUA 3Q5XA 4DBQA 2XZEA 4TV8E 4DV7T 5AQTB 4CI2B 3KFWX 1YQ3A 5JTGA 2XM1A 2WZHA 4DV5T 2BDEA 2NTYA 2JMHA 5AQOB 5CJ5A 4AKIA 1SA0E 5TAOA 2BVLA 2XQ3A 3AA0B 3I0QA 3Q5DA 3RH3A 3AEGA 4ZI3C 4DV0T 1O3XA 3N9LA 2H7VC 2CLYC 1FIOA 2VK9A 4QXBB 2LHRA 1HG5A 2WDRA 4I55E 3EDUA 4X5TA 3F31A 3PUAA 2J1DG 3VRBA 5C2TA 2OV9A 4CI3B 3NBXX 3RHWA 1T72A 5FP3A 3PTRB 3NVOA 1ZHCA 3AEFA 4YSXA 3K1SA 4WYVA 2WCAA 1XWMA 4JEHB 3ABVA 4IDZA 5AQSB 4QXHB 3ZPOA 3UUMA 3ZT7A 5FY7A 3VU7H 2WAUA 3PV0F 5LG3A 2XSBA 4PW8A 3OPCA 3P4SA 3Q5EA 5LCYA 1WR0A 3K3QC 4IE0A 3CWZB 3IF8B 3H37A 3ZN1B 5C3JA 5ADXL 3ESLA 1HCIA 4PJJA 5J1GA 4NIQA 3E0ZA 4HFVA 2CLYB 2J4GA 5JVDE 5AQIB 3SFEA 4AISA 4BJMA 2A72A 3HA4A 3RI5A 1YKHB 5A1LA 3VR8A 4DBRA 4IDOA 4LF6T 5DQVA 3M65A 3PUSA 4MBQA 4UEMA 4IREA 3KBUA 4JBWF 4LFAT 3PUVF 1IAPA 5JDHA 4LFCT 3KBTA 3QK6A 4EIWA 1FEWA 2LSJA 3FB2A 5L3FB 2W61A 4ZXLA 4YSZA 5HWXA 5ABGA 4X1YE 3SOLA 3T8OA 2WU2A 2DNXA 3AE1A 2BBJA 2PTFA 1UK5A 4JI4T 4UIGA 1MNEA 4P0BA 3AEDA 2VWAA 2CEAA 4EEBA 4ZOLE 1E7PA 5HXCA 2DWKA 3ZMZB 3ZMUB 3UU6A 3KVBA 1U4QA 1VRBA 2CXLA 2UUAT 3PDYA 2K5BB 3FZFB 3QC9A 4IE6A 2WMNA 1HG2A 2W63A 4H9RC 5AQNB 3AA7B 1WYBA 4OYJA 4I50E 4PK5A 5CFBA 2VKHA 1T8BA 2IUBA 3UFGA 2XQ6A 2XHEB 2ZM8A 5L3CB 1UX5A 4IL9A 4U2YA 4I4TE 5H6RB 2WQYA 3LK2B 3AEEA 5FXVA 1J5ET 3RIFA 2ZM2A 4IT4A 3FZKB 2XQ7A 3V5UA 3HKBE 2V8SV 2JQHA 2VL0A 5H6QB 4UV8B 2LRLA 4O2BE 5DABA 4LMKA 4HWCA 3BK9A 5EK2A 4JI6T 4TNWA 2X68A 4DR7T 4YTPA 3LK42 3KINB 1X79A 5FXZA 3VKGA 1ZOYA 3ZYMA 3KDSE 4HWDA 3CX8B 1NAFA 1V9DA 4ASKA 3CX6B 5M4YA 5LHGB 3LBXA 2A2FX 3T1HT 4GKKT 2IC6A 2XQAA 2LM2A 1LVFA 4GKJT 4UV9B 2IC9A 5HEHA 4YT0A 5HCMA 4X62T 4DR3T 2EHOA 3FHNA 4U3CA 2W67A 4B6XA 2G0UA 2V7LA 3RPUA 3U78A 2YU1A 4DR5T 5LHIB 1D1AA 2CWOA 2NWBA 2CHNA 2V7MA 4UF0A 3AE9A 2AXDS 3OVUA 2W00A 2CBJA 2UU9T 3ZJ1A 3GWHA 2XAFB 4O4IE 2ZM6T 5L3GB 3P4QA 4O4JE 3F2EA 4ILAA 3ONLC 5JH7E 4C90A 2EHOC 5KMGP 1KNPA 1AJ3A 2YK0A 3RC8A 2X66A 5HXHA 5AQRB 3ZC0A 1YXRA 3W15B 2BKPA 3MJXA 3RC3A 5LMNT 5LYJE 3HR0A 1XMOT 1IZNB 4MALA 3PJAJ 3UQ4A 4WNKA 2K48A 3Q5WA 2KT9A 4L9IA 4DV4T 2X51A 4L0RA 4YHJA 5HEGA 2XY8B 3N9MA 1G73A 4EZHA 4K0KT 3AXJA 4IDQA 2Y6XA 4DR2T 3HL6A 4JI3T 3TKLB 2D0UA 4JI5T 2EHOD 3HKDE 4NUUA 1S35A 5L4EA 3BQIA 4J2CA 4P1NA 2EHOB 2Z6EA 4JYAT 4KI0F 4HFIA 3AE3A 4H9PC 2WP9A 2KZ7B 5JDFA 3LFMA 2W2UA 1YKEB
chains in the Genus database with same CATH topology
2LOSA 4YFSA 4Z8XA 2CA5A 4AQFA 3KV4A 2ZM0A 2P9BA 5FY0A 4CI3B 5KX5E 3NBXX 3ZYKA 1MNDA 5FP3A 3KV9A 2I59A 3PTRB 3EDVA 4FJOA 3EUHA 3IHRA 4KP3C 4KUMB 1ZHCA 2Q9QD 2XASB 3LK3B 4P09A 3UULA 3MK7C 4BJNA 3L09A 4JEHB 4GIWA 4ISSA 2CXFA 4ISTA 4IDZA 5LGTB 3ZMTB 5CB4E 3AVRA 2W62A 4QXHB 1WR6A 3ZPOA 1HS7A 3UUMA 2ODUA 3WAKA 4AQGA 1UX4A 1KK7A 5FY7A 3VU7H 2WAUA 4PFPA 4EYUA 2UXXB 3ZC1A 2L8KA 4F6RC 2ZLYA 2ZMAA 4O4LE 4QXCB 4PW8A 5LA6E 4HTEA 1IJ6A 4EXTA 5HYAA 3NRXA 5EK4A 5LCYA 4MLKA 3O1IA 4IE0A 3K3QC 4WW0A 4MFRA 3CWZB 4BAYB 5HXEA 3IF8B 3P8CD 1MIYA 2N2NA 3H37A 3ZN1B 5ADXL 3ESLA 1HCIA 4PJJA 5J1GA 4AQFC 3B13A 4PK6A 4DMWA 4H63V 3MA9A 4L5GA 3CPZA 2HPLA 3E0ZA 4HFVA 2CLYB 1ZV4X 5JVDE 4DVDA 3ZEFB 4IE4A 2XAQB 4ILUA 3GA8A 3NRYA 1US7B 3MKDA 4BJMA 2KWHA 4U74A 2A72A 2CCQA 3CKDA 3HA4A 5A1LA 1YKHB 3KV6A 2KINB 2LSIA 4BA9A 4DBRA 2JPFA 4GYRA 3PU8A 1BR2A 5DQVA 3ZMSB 2D0TA 3M65A 3N2OA 2DWGA 3O4XE 4QX7B 3PUSA 4MBQA 1D1BA 4TZ4C 2YEVC 2NW9A 5FY1A 4CZZB 1FMVA 4UEMA 5JDQA 2XQYA 3KBUA 5LP6E 4QX8B 1IAPA 5JDHA 1IJ5A 2D2SA 4KMCA 5DJQC 3O9XA 3B57A 3FBLA 4IE7A 5LOVE 3N2KE 3KBTA 3QK6A 4EIWA 1CUNA 1FEWA 2LEHA 2LSJA 3I9YA 3LG7A 3RX6A 5IYZE 2NW7A 4O4HE 3FB2A 3DTOA 3ZMVB 2W61A 5L3FB 3GMIA 3J9X1 4EYYR 3H3AA 4M1PA 5HWXA 4X1YE 3SOLA 4UXNB 5CA1E 3T8OA 2VKDA 2UXNB 5LG4A 4HKAA 4K0UA 4U72A 4CXXA 2DNXA 2V7IA 4TX5A 2C5KT 3PE0A 5LJMA 4CXYA 3Q2MA 4N78D 1H7CA 1FMWA 2QGSA 5J2TE 3RYIE 3AA1B 4UIGA 1MNEA 1HX8A 3MXZA 3CMLA 3ZN0B 3QUJA 3PU3A 4EB6E 3RYHE 2X9HA 4NUVA 4PNIA 3S4UA 3IBPA 4O8SA 4P0BA 1HTJF 2BZBA 3JC6C 4ERRA 2CM0A 2VWAA 3ZLIA 3N9QA 4TN7B 2ACXA 3F57A 3OJAA 2CEAA 3D0TA 5FYMA 5C8YE 1S94A 5LGNB 2W0GA 3SS1A 2LM9A 3ETVA 4ANJA 1T98A 4UVAB 4ZOLE 2LJLA 2CE7A 1LVKA 2LSKA 1OXZA 2HPJA 2YINA 4GK0E 5FXXA 1Y64B 1WYCA 2B1EA 3K3NA 3ZJ2A 5AFUL 5HXCA 2X9XA 3MZKB 2DWKA 1BR1A 3ANWA 3FXEB 4PJLA 3UTKA 3ZMZB 3J7Yq 3NZQA 3ZMUB 4YJ2E 3U3IA 3KVBA 5JRCA 1U4QA 4XZCA 1VRBA 4ZI3D 2CXLA 3KV5A 3PDYA 3L3PA 4YLHA 5DQWA 4ZI2D 2Y48B 2K5BB 3AVSA 3QC9A 2JMKA 4IE6A 4JUYA 2WMNA 3GN5A 4QKNA 5HXRA 5LJNA 2LHNA 1HG2A 2W63A 3MACA 4H9RC 4PJMA 5LBMA 3IEEA 5JDMA 3ZCJA 2JJ9A 3AA7B 5IHYA 2E8IA 1WYBA 4OYJA 4I50E 4PK5A 2KNDA 3UUNA 2VL8A 2C0SA 2VKHA 2KXPB 3C51A 3UUXB 3HI2A 2H3RA 2JQQA 2XHEB 4HE8A 2D5UA 1MMDA 3C4ZA 2ZM8A 4UVBB 3RKOA 4EAHA 3UFEA 5L3CB 2X9YA 2L3LA 4H63H 1WRDA 5E0OA 1U5PA 2K9AA 2VB6A 1UX5A 3OKQA 3SWHA 1NWMX 5JDLA 2XAHB 2H7OA 4I4TE 1KNZA 2DCFA 5BMVE 2PG8A 5H6RB 3I0OA 2E9XA 5LHHB 4EOZB 3LK2B 4YJ3E 1D0ZA 5FXVA 2LT3A 2ZM2A 5HWYA 1MIVA 3R6NA 1D0YA 3V5UA 1HFAA 3HKBE 4C91A 3E08A 2NW8A 1UCUA 4H9OC 1EZ3A 3N2GE 2MYSA 1VOMA 2N1GA 4UV8B 5H6QB 5JDNA 1BR4A 4H9SE 4UVCB 2XTLA 3AA6B 4O2BE 5DABA 2PBIA 3VHLA 4G2AA 3HKCE 3O1JA 4EZ4A 3BK9A 4XBFB 2VKJA 4GK5E 5EK2A 2XAGB 4HEAA 4JLEA 4OHFA 3E22E 5FMNA 1MMGA 3CQCB 2Q9QC 1QUUA 4IE5A 2X68A 3N9PA 3CX7B 4KBMB 5F3JA 4HGAA 3FXDB 1HF8A 2WMOA 4PK4A 3LK42 3KINB 1X79A 5FXZA 4H9NC 4WBNE 1BR0A 2PJQA 3N9NA 3VKGA 2RA1A 2SPCA 4X20E 3CVRA 4P0AA 5LXTE 2Y8DA 2E9XC 4CXWA 3ZYMA 2L9QA 5JREA 3HKEE 5LNKA 3LBXB 3C4XA 3KDSE 3A5XA 5LBQB 3I1AA 3CX8B 2HH7A 1NAFA 1V9DA 3ONXA 4ASKA 5JR9C 4AKGA 3RRCA 4AI6A 2LSGA 3UT5E 3P7IA 3CX6B 2CMRA 5M4YA 2VKOA 3N5LA 5LHGB 3LBXA 2A2FX 3K8PC 1D0XA 5GONE 5F8PA 2IC6A 4AXPA 1LKXA 3RYFE 3WI3A 3ZYLA 4AKHA 3AAEB 2NOXA 3WAJA 4E7SA 1LVFA 4QHOA 2V7JA 3ANWB 2XUEA 5EK3A 3O1HA 4UV9B 4I43B 3CQXC 2IC9A 5FXWA 4O2AE 4PJNA 3EVYA 5JRCB 2KWIB 2EHOA 3FHNA 1SHZC 4TV9E 3RYCE 4DO0A 2LSYA 4B6XA 3GN5B 4UF0B 4ZI7E 2G0UA 2V7LA 2M67A 3RPUA 3BQKA 4WBOA 4X1KE 3SRZA 2YU1A 3U78A 1YW0A 5KDMC 5LHIB 1D1AA 2CWOA 2X0LB 3OYZA 3BQLA 1LRZA 2MTQA 2NWBA 3C50A 5JQGE 2V7MA 1G8XA 5HAXA 4UF0A 3N9OA 2WM9A 2BVMA 2XAJB 4AKRB 2VASA 3PUQA 3PURA 2W00A 5L3BB 3ZCIA 2Q9QB 2E9XD 2C5IT 3ETUA 4ZS3A 4HN9A 4GOUA 4E7ZA 2MOZA 5J2UE 3ZJ1A 1Z0PA 1D1CA 2XAFB 3GWHA 4O4IE 5FNVE 3OBVE 3OYXA 5L3GB 2MBGA 1ZEEA 1B7TA 3V5SA 4O4JE 2Q9QA 1MIWA 2E9XB 1YD8G 2V26A 4TUYE 4ZS2A 3F2EA 5L2LA 3JC6D 5JH7E 2YU2A 3DJBA 4C90A 3FBZA 3KVAA 2DLRA 2EHOC 4ADZA 3R84B 4AKLA 4FI5A 4GYSA 5KMGP 5JR9B 3Q9DA 3CQGB 1AJ3A 2YK0A 3RC8A 2LOPA 2X66A 3NZPA 1MMAA 4XAXB 2WSSV 5HXHA 2KMFA 3ZC0A 2WWUA 1WLXA 4H9QC 1ZKEA 2ODVA 2DI4A 3C64A 1QSDA 2IAKA 4G63A 3W15B 4V1Av 2DHRA 5JR9A 3MJXA 4OFZA 3RC3A 2LE8A 2A3DA 3C98B 4OYKA 4PAGA 5JDGA 2CXDA 5LYJE 3HR0A 1IZNB 3VKHA 4MALA 4WNKA 4DMVA 2CWYA 1MMNA 2NTXA 1YKEB 2K48A 3Q5WA 4MHCA 5HXSA 2GK9A 2KT9A 4IGUA 3Q5XA 4DBQA 4TV8E 4L9IA 4PFOA 4CI2B 3KFWX 2X51A 5EZYE 4L0RA 4YHJA 2K24A 2BDEA 2NTYA 3N9MA 1G73A 2IW5B 2JRKA 4A56A 4DNDA 3AAIA 2JMHA 4UELA 4EZHA 3LJCA 2NP9A 5ETWA 3AB3B 4IIJE 2PFVA 1OWAA 2Y6XA 5L3DB 3HL6A 4AKIA 1SA0E 2V7KA 5TAOA 2WBLA 3C4WA 2BVLA 3AA0B 3I0QA 3TKLB 2V1DB 2KLQA 3RH3A 2D0UA 5LGUB 2X67A 3RRWA 4ZI3C 2EHOD 2X9WA 2N9DA 3HKDE 2OA5A 4JEUB 4NUUA 1S35A 4CI1B 4IHJE 4ZI2C 3AAAB 1O3XA 3BQIA 3N9LA 4J2CA 2H7VC 2CLYC 1FIOA 2RP4A 2VK9A 5L3EB 4ZHQE 2EHOB 2ES0A 2Z6EA 4QXBB 4CQIA 3DP7A 3PUGA 2LHRA 1E1HB 1HG5A 4I55E 3EDUA 4H9PC 2KZ7B 3F31A 4QWNB 4X1IE 2C5JA 5JDFA 4OK0A 5CA0E 3LFMA 3PUAA 2J1DG 2QA7A 3K3OA 3I9WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HE8 A;  4HEA A;  3RKO A;  5LNK A; 
#chains in the Genus database with same CATH topology
 2LOS A;  3FZM B;  5J0Z A;  4Z8X A;  1ZP0 A;  5FY0 A;  5KX5 E;  3ZYK A;  3RQU A;  4EGW A;  3IHR A;  1R8I A;  3UUL A;  4CN1 A;  5BR8 T;  4ZZB A;  4IST A;  5LGT B;  3AVR A;  1HS7 A;  3OTO T;  1KK7 A;  4EYU A;  3AE7 A;  2L8K A;  2ZLY A;  5ABE A;  4QXC B;  5LA6 E;  4HTE A;  4EXT A;  3NRX A;  5EK4 A;  4BAY B;  2WDV A;  4NXN T;  3B13 A;  3RIU A;  5IWA T;  4IE4 A;  2R6G F;  1XDO A;  3NRY A;  1US7 B;  2UUC T;  1KFY A;  2KWH A;  3CKD A;  2BS2 A;  1YQ4 A;  4GYR A;  1Y01 A;  3PU8 A;  3JCF A;  5L47 A;  3AXJ B;  2D9D A;  1D1B A;  1W9R A;  5JDQ A;  4LF4 T;  2VVS A;  2XQY A;  5HEO A;  5DJQ C;  3B57 A;  3FBL A;  5AQK B;  2CHO A;  4B3T T;  3RIU C;  1VCT A;  2LEH A;  3LG7 A;  4O4H E;  3M3Z B;  2VUR A;  4EYY R;  3J9X 1;  2X0Y A;  1E2A A;  3H3A A;  4U7I A;  1UUR A;  2VKD A;  4A97 A;  3UQ7 A;  1HNZ T;  5LG4 A;  4HKA A;  4U72 A;  4CXX A;  4CXY A;  3VR9 A;  2QGS A;  1N33 T;  3RYI E;  2FUP A;  1HX8 A;  3ZN0 B;  3QUJ A;  3PU3 A;  4EB6 E;  2IIU A;  2DL1 A;  3S4U A;  3IBP A;  5AQF B;  4O8S A;  1HTJ F;  4ERR A;  3D0T A;  1N34 T;  3ETV A;  1NEK A;  2LJL A;  1LVK A;  2WWV A;  2LSK A;  5AQL B;  3RF1 A;  2XQ4 A;  4QH1 A;  1Y64 B;  3ZJ2 A;  3ZSS A;  2IDO B;  4U31 A;  4YJ2 E;  5JRC A;  4XZC A;  4ZI3 D;  3L3P A;  3QB5 A;  4UR9 A;  2Y48 B;  5HXR A;  3GN5 A;  2LHN A;  5LBM A;  3IEE A;  5JDM A;  5IHY A;  3UUN A;  2VL8 A;  3C51 A;  2UXD T;  2H3R A;  4IL4 A;  2JQQ A;  1QLB A;  1GQE A;  4UVB B;  3RKO A;  4LF9 T;  3UFE A;  2X9Y A;  2L3L A;  2K9A A;  2VB6 A;  3QOF A;  3OKQ A;  3SFD A;  1NWM X;  5JDL A;  2H7O A;  5ABH A;  2PG8 A;  5LHH B;  2E9X A;  3PUW F;  2WB5 A;  2H88 A;  1MIV A;  1D0Y A;  3E08 A;  2NW8 A;  4H9O C;  1EZ3 A;  5AQG B;  4JI0 T;  1NEN A;  4H9S E;  4UVC B;  4KHZ F;  2PBI A;  3O1J A;  2VKJ A;  2LLY A;  4GK5 E;  5HEJ A;  3E22 E;  1MMG A;  2Q9Q C;  3P4W A;  5ABF B;  3N9P A;  3FXD B;  3JAE A;  3ZKR A;  1HF8 A;  4WBN E;  3N9N A;  2RA1 A;  2SPC A;  3A8Y C;  3NWI A;  3CVR A;  4P0A A;  2Y8D A;  2E9X C;  4CXW A;  2L9Q A;  5IUX A;  5JRE A;  3HKE E;  2WS3 A;  5LBQ B;  1HNW T;  4AKG A;  2LSG A;  3UT5 E;  1VCS A;  5GON E;  5LMU T;  3ZYL A;  2NOX A;  5FL0 A;  4QHO A;  3PUZ F;  4OX9 T;  2V7J A;  2IML A;  4EV6 A;  4HFD A;  4PJN A;  1N36 T;  5JRC B;  1SHZ C;  4DO0 A;  4DR6 T;  3GN5 B;  4ZI7 E;  4YY3 T;  4I0U A;  1YW0 A;  5KDM C;  5JQG E;  5HAX A;  2YOE A;  2VAS A;  4B3S T;  5L3B B;  3ZCI A;  2E9X D;  2C5I T;  2Q9Q B;  3ETU A;  4ZS3 A;  5J2U E;  3AE6 A;  4GOU A;  5AQJ B;  1D1C A;  2BBH A;  4TWF A;  3OBV E;  2MBG A;  1ZEE A;  1B7T A;  1MIW A;  2E9X B;  2V26 A;  4TUY E;  2OLT A;  3Q9D A;  2XM2 A;  2V5C A;  1M7K A;  1MMA A;  2KMF A;  2WWU A;  1WLX A;  4H9Q C;  1ZKE A;  2ODV A;  2DI4 A;  1QSD A;  3C64 A;  4AIU A;  2LE8 A;  2A3D A;  3C98 B;  2CXD A;  5FVK A;  4DMV A;  5HXS A;  4MHC A;  4YHH T;  4B3R T;  3AE8 A;  5EZY E;  4A56 A;  4DND A;  2FJD A;  4UEL A;  1W0A A;  5ETW A;  2NP9 A;  4X65 T;  2XQ8 A;  2PFV A;  1OWA A;  5L3D B;  4JI1 T;  1W0B A;  3C4W A;  2JQK A;  2KLQ A;  5LGU B;  2X67 A;  3RRW A;  2VQF T;  2OA5 A;  2X0H A;  4ZI2 C;  3AAA B;  4NPP A;  3NKZ A;  5L3E B;  4ZHQ E;  2ES0 A;  4DV2 T;  3DP7 A;  4TNV A;  1E1H B;  4X1I E;  4OK0 A;  5CA0 E;  2QA7 A;  3I9W A;  2F4V T;  4AQF A;  3KV4 A;  2ZM0 A;  2P9B A;  4U7Y A;  4LML A;  3VRA A;  2I59 A;  3EUH A;  4KUM B;  2BG9 A;  3L09 A;  5AQQ B;  3ZMT B;  2W62 A;  1WR6 A;  1UX4 A;  2UXX B;  3ZC1 A;  2XSA A;  2BG9 E;  2J62 A;  4WW0 A;  2XPK A;  4MFR A;  5HXE A;  3QNU A;  3P8C D;  4DR1 T;  4AQF C;  4PK6 A;  4DMW A;  4H63 V;  1UGO A;  2V5D A;  5HCJ A;  2HPL A;  3ZEF B;  2BG9 C;  4ILU A;  4ZEY A;  1KNR A;  3MKD A;  3EI0 A;  4HWH A;  4EED A;  3KV6 A;  4BA9 A;  1BR2 A;  3N2O A;  3O4X E;  2DWG A;  3LDQ B;  2NW9 A;  1J1J A;  5FY1 A;  2HN2 A;  2M6I A;  3L8R A;  3EAB A;  1XDP A;  4X66 T;  1KF6 A;  2D2S A;  4KMC A;  3T1Y T;  3B5M A;  3N2K E;  4KX6 A;  2NR4 A;  2I6H A;  5HEU A;  3I9Y A;  5IYZ E;  3DTO A;  4M1P A;  4UXN B;  5CA1 E;  4K0U A;  3PE0 A;  3Q2M A;  4N78 D;  1FMW A;  5J2T E;  1DU2 A;  2LKG A;  4KHP T;  2E5V A;  3MXZ A;  2BG9 B;  3RYH E;  2BZB A;  3JC6 C;  2CM0 A;  3N9Q A;  5FYM A;  2ACX A;  3F57 A;  3OJA A;  1S94 A;  5LGN B;  2WDQ A;  3EHZ A;  3SS1 A;  4ANJ A;  1T98 A;  2CE7 A;  1OXZ A;  2HPJ A;  2YIN A;  4GK0 E;  1WYC A;  2B1E A;  5AFU L;  1I6Z A;  4PJL A;  3ANW A;  3J7Y q;  3TLW A;  2LKH A;  1OED A;  4YLH A;  2JMK A;  5LJN A;  3MAC A;  4PJM A;  2KND A;  3X1D A;  2KXP B;  2CRB A;  3UUX B;  2HN1 A;  4JV5 T;  1N32 T;  1JNR A;  2M6B A;  2D5U A;  2XQ5 A;  1MMD A;  1OED E;  2YDQ A;  2FBW A;  4IDP A;  5E0O A;  1WRD A;  3AEA A;  2QVA A;  3SWH A;  4DUZ T;  2UUB T;  2XAH B;  1KNZ A;  2DCF A;  1FJG T;  5BMV E;  4A98 A;  3I0O A;  4EOZ B;  3PUX F;  4YJ3 E;  1OED C;  3LSV A;  1UCU A;  2MYS A;  2N1G A;  5JDN A;  1BR4 A;  4Z90 A;  5FL1 A;  2VQE T;  2XTL A;  3AA6 B;  3VHL A;  4YTN A;  1WFD A;  2LRK A;  4LF5 T;  3TLT A;  2BKN A;  4HEA A;  4ILB A;  1SUM B;  4JLE A;  3CQC B;  5AQH B;  4IE5 A;  1T7S A;  3CX7 B;  3QB5 K;  4H9N C;  4HFE A;  5ABF A;  4TWH A;  2MPK A;  4JI2 T;  3I1A A;  5JR9 C;  4AI6 A;  3P7I A;  2CMR A;  4HWI B;  2VVN A;  3N5L A;  3FZH B;  1D0X A;  3K8P C;  5F8P A;  3P4R A;  3RYF E;  3AAE B;  3CIR A;  1HNX T;  4E7S A;  3ANW B;  3H3M A;  5EK3 A;  4I43 B;  3CQX C;  5FXW A;  3ZST A;  4O2A E;  3EVY A;  4Q25 A;  1OED B;  1IBL T;  4TV9 E;  3RYC E;  1Z8U A;  2LSY A;  4JI8 T;  3UUB A;  2FJE A;  3BQK A;  4X1K E;  3G06 A;  3SRZ A;  1XMQ T;  1X9B A;  3OYZ A;  2WY2 A;  1LRZ A;  2MTQ A;  2YN6 A;  1G8X A;  3N9O A;  2BVM A;  2RPA A;  2YKS A;  3PUQ A;  3PUR A;  4X64 T;  1I94 T;  1Z0P A;  3AEC A;  1XNR T;  3V5S A;  2Q9Q A;  1YD8 G;  4ZS2 A;  4YTM A;  2YU2 A;  4GYS A;  5JR9 B;  3CQG B;  3RIA A;  3NZP A;  4XAX B;  2WSS V;  4G63 A;  4V1A v;  5F5W A;  2DHR A;  4WZX A;  4OFZ A;  4OYK A;  4PAG A;  2XJ7 A;  2CWY A;  4AQY T;  1MMN A;  3AE5 A;  4YXD A;  1M62 A;  5AQU B;  1KEY A;  4HFH A;  4PFO A;  5AQV B;  1J5W A;  2W4X A;  2K24 A;  1UUS A;  1CHU A;  2IW5 B;  2JRK A;  3AAI A;  5AQP B;  3LJC A;  2I0M A;  3AB3 B;  4IIJ E;  4HFB A;  2V7K A;  2WBL A;  2V1D B;  3TLS A;  2X9W A;  2N9D A;  2CPT A;  4JEU B;  2CBI A;  4CI1 B;  4IHJ E;  4U33 A;  2RP4 A;  4CQI A;  3PUG A;  4YSY A;  4QWN B;  2C5J A;  3IA3 A;  4DV1 T;  4ISS A;  3K3O A;  4QH5 A;  5L4H A;  2FJB A;  4A5X A;  4YFS A;  3RKG A;  2CA5 A;  3JAF A;  1MND A;  3KV9 A;  4CN4 A;  3EDV A;  2V6Y A;  4FJO A;  4KP3 C;  2Q9Q D;  2XAS B;  3LK3 B;  4P09 A;  3MK7 C;  2B76 A;  4BJN A;  4GIW A;  2CXF A;  3TLU A;  5CB4 E;  2ODU A;  3WAK A;  4AQG A;  4PFP A;  4F6R C;  2BS4 A;  2ZMA A;  3FZL B;  4O4L E;  1IJ6 A;  5HYA A;  3AEB A;  4DR4 T;  4MLK A;  3O1I A;  1MIY A;  2N2N A;  3PJA A;  2AE9 A;  3MA9 A;  4L5G A;  3CPZ A;  1ZV4 X;  4DVD A;  2XAQ B;  2BKO A;  3GA8 A;  3L39 A;  2JQ9 A;  4U74 A;  2CCQ A;  5FVL A;  3P50 A;  2UXC T;  2KIN B;  2LSI A;  2JPF A;  2FJA A;  4ILC A;  3ZMS B;  2D0T A;  4QX7 B;  2UXB T;  4TZ4 C;  1XZY A;  2YEV C;  3UU4 A;  4CZZ B;  1FMV A;  3AE4 A;  4IDN A;  5LP6 E;  4QX8 B;  1IJ5 A;  3O9X A;  3UU3 A;  4IE7 A;  5LOV E;  3RGL A;  1L0V A;  2E5L T;  1CUN A;  2WU5 A;  4U2Z A;  2HHH T;  4F8H A;  3RX6 A;  2NW7 A;  3ZMV B;  3GMI A;  1W09 A;  2IHR 1;  5KXJ A;  2UXN B;  2A9U A;  2V7I A;  4TX5 A;  2C5K T;  5LJM A;  1H7C A;  3AA1 B;  4CN6 A;  1HR0 T;  3EAM A;  3CML A;  2V6Y B;  2W66 A;  2X9H A;  3UU8 A;  4NUV A;  4PNI A;  5FKY A;  3ZLI A;  4TN7 B;  5C8Y E;  3ONJ A;  2W0G A;  1XNQ T;  2LM9 A;  3RQW A;  3JAD A;  4UVA B;  4DV6 T;  5FXX A;  2K3W A;  3K3N A;  4HFC A;  2X9X A;  3MZK B;  3RLF F;  2MAW A;  1BR1 A;  3FXE B;  3UTK A;  3NZQ A;  3U3I A;  1JNZ A;  4LMJ A;  3KV5 A;  5CGM A;  5DQW A;  4ZI2 D;  4JUY A;  3AVS A;  4QKN A;  4B3M T;  3UU5 A;  2WZI A;  3ZCJ A;  2JJ9 A;  2E8I A;  2C0S A;  3HI2 A;  5LB7 B;  4HE8 A;  3C4Z A;  2JIW A;  4EAH A;  4H63 H;  1U5P A;  4TWD A;  3AE2 A;  1IBM T;  3PUY F;  1D0Z A;  2LT3 A;  5HWY A;  3R6N A;  1WCR A;  1HFA A;  4C91 A;  2H89 A;  3N2G E;  1VOM A;  1HX1 B;  4EZ4 A;  2ACZ A;  3HKC E;  4G2A A;  4LF8 T;  4XBF B;  2XAG B;  4NXM T;  4OHF A;  5FMN A;  3ZT5 A;  1QUU A;  3CK6 A;  4KBM B;  5F3J A;  4HGA A;  2WMO A;  4PK4 A;  2J47 A;  4Z91 A;  1BR0 A;  2PJQ A;  4X20 E;  5LXT E;  5LNK A;  3LBX B;  3C4X A;  3A5X A;  2HH7 A;  3ONX A;  3RRC A;  3A7M A;  5AQM B;  2VKO A;  1SE7 A;  1IBK T;  4HWF A;  2XQ9 A;  4AXP A;  1LKX A;  3WI3 A;  3ZT6 A;  3P4P A;  4AKH A;  3WAJ A;  2XUE A;  3O1H A;  4DUY T;  2E2A A;  2KWI B;  4COF A;  4UF0 B;  4LFB T;  4ZZC A;  2M67 A;  4WBO A;  2X0L B;  3BQL A;  2KSR A;  3C50 A;  2WM9 A;  2XAJ B;  4AKR B;  4DV3 T;  4HN9 A;  4E7Z A;  2MOZ A;  4QH4 A;  5FNV E;  3OYX A;  4LF7 T;  5L2L A;  3JC6 D;  3DJB A;  2YDR A;  3FBZ A;  3KVA A;  2DLR A;  4ADZ A;  3R84 B;  3TLV A;  4AKL A;  4FI5 A;  2V6X A;  4DID B;  2LOP A;  2QRX A;  4JI7 T;  2IAK A;  5JR9 A;  5JDG A;  2BS3 A;  2QYW A;  3VKH A;  2YDS A;  2NTX A;  2GK9 A;  4IGU A;  3Q5X A;  4DBQ A;  2XZE A;  4TV8 E;  4DV7 T;  5AQT B;  4CI2 B;  3KFW X;  1YQ3 A;  5JTG A;  2XM1 A;  2WZH A;  4DV5 T;  2BDE A;  2NTY A;  2JMH A;  5AQO B;  5CJ5 A;  4AKI A;  1SA0 E;  5TAO A;  2BVL A;  2XQ3 A;  3AA0 B;  3I0Q A;  3Q5D A;  3RH3 A;  3AEG A;  4ZI3 C;  4DV0 T;  1O3X A;  3N9L A;  2H7V C;  2CLY C;  1FIO A;  2VK9 A;  4QXB B;  2LHR A;  1HG5 A;  2WDR A;  4I55 E;  3EDU A;  4X5T A;  3F31 A;  3PUA A;  2J1D G;  3VRB A;  5C2T A;  2OV9 A;  4CI3 B;  3NBX X;  3RHW A;  1T72 A;  5FP3 A;  3PTR B;  3NVO A;  1ZHC A;  3AEF A;  4YSX A;  3K1S A;  4WYV A;  2WCA A;  1XWM A;  4JEH B;  3ABV A;  4IDZ A;  5AQS B;  4QXH B;  3ZPO A;  3UUM A;  3ZT7 A;  5FY7 A;  3VU7 H;  2WAU A;  3PV0 F;  5LG3 A;  2XSB A;  4PW8 A;  3OPC A;  3P4S A;  3Q5E A;  5LCY A;  1WR0 A;  3K3Q C;  4IE0 A;  3CWZ B;  3IF8 B;  3H37 A;  3ZN1 B;  5C3J A;  5ADX L;  3ESL A;  1HCI A;  4PJJ A;  5J1G A;  4NIQ A;  3E0Z A;  4HFV A;  2CLY B;  2J4G A;  5JVD E;  5AQI B;  3SFE A;  4AIS A;  4BJM A;  2A72 A;  3HA4 A;  3RI5 A;  1YKH B;  5A1L A;  3VR8 A;  4DBR A;  4IDO A;  4LF6 T;  5DQV A;  3M65 A;  3PUS A;  4MBQ A;  4UEM A;  4IRE A;  3KBU A;  4JBW F;  4LFA T;  3PUV F;  1IAP A;  5JDH A;  4LFC T;  3KBT A;  3QK6 A;  4EIW A;  1FEW A;  2LSJ A;  3FB2 A;  5L3F B;  2W61 A;  4ZXL A;  4YSZ A;  5HWX A;  5ABG A;  4X1Y E;  3SOL A;  3T8O A;  2WU2 A;  2DNX A;  3AE1 A;  2BBJ A;  2PTF A;  1UK5 A;  4JI4 T;  4UIG A;  1MNE A;  4P0B A;  3AED A;  2VWA A;  2CEA A;  4EEB A;  4ZOL E;  1E7P A;  5HXC A;  2DWK A;  3ZMZ B;  3ZMU B;  3UU6 A;  3KVB A;  1U4Q A;  1VRB A;  2CXL A;  2UUA T;  3PDY A;  2K5B B;  3FZF B;  3QC9 A;  4IE6 A;  2WMN A;  1HG2 A;  2W63 A;  4H9R C;  5AQN B;  3AA7 B;  1WYB A;  4OYJ A;  4I50 E;  4PK5 A;  5CFB A;  2VKH A;  1T8B A;  2IUB A;  3UFG A;  2XQ6 A;  2XHE B;  2ZM8 A;  5L3C B;  1UX5 A;  4IL9 A;  4U2Y A;  4I4T E;  5H6R B;  2WQY A;  3LK2 B;  3AEE A;  5FXV A;  1J5E T;  3RIF A;  2ZM2 A;  4IT4 A;  3FZK B;  2XQ7 A;  3V5U A;  3HKB E;  2V8S V;  2JQH A;  2VL0 A;  5H6Q B;  4UV8 B;  2LRL A;  4O2B E;  5DAB A;  4LMK A;  4HWC A;  3BK9 A;  5EK2 A;  4JI6 T;  4TNW A;  2X68 A;  4DR7 T;  4YTP A;  3LK4 2;  3KIN B;  1X79 A;  5FXZ A;  3VKG A;  1ZOY A;  3ZYM A;  3KDS E;  4HWD A;  3CX8 B;  1NAF A;  1V9D A;  4ASK A;  3CX6 B;  5M4Y A;  5LHG B;  3LBX A;  2A2F X;  3T1H T;  4GKK T;  2IC6 A;  2XQA A;  2LM2 A;  1LVF A;  4GKJ T;  4UV9 B;  2IC9 A;  5HEH A;  4YT0 A;  5HCM A;  4X62 T;  4DR3 T;  2EHO A;  3FHN A;  4U3C A;  2W67 A;  4B6X A;  2G0U A;  2V7L A;  3RPU A;  3U78 A;  2YU1 A;  4DR5 T;  5LHI B;  1D1A A;  2CWO A;  2NWB A;  2CHN A;  2V7M A;  4UF0 A;  3AE9 A;  2AXD S;  3OVU A;  2W00 A;  2CBJ A;  2UU9 T;  3ZJ1 A;  3GWH A;  2XAF B;  4O4I E;  2ZM6 T;  5L3G B;  3P4Q A;  4O4J E;  3F2E A;  4ILA A;  3ONL C;  5JH7 E;  4C90 A;  2EHO C;  5KMG P;  1KNP A;  1AJ3 A;  2YK0 A;  3RC8 A;  2X66 A;  5HXH A;  5AQR B;  3ZC0 A;  1YXR A;  3W15 B;  2BKP A;  3MJX A;  3RC3 A;  5LMN T;  5LYJ E;  3HR0 A;  1XMO T;  1IZN B;  4MAL A;  3PJA J;  3UQ4 A;  4WNK A;  2K48 A;  3Q5W A;  2KT9 A;  4L9I A;  4DV4 T;  2X51 A;  4L0R A;  4YHJ A;  5HEG A;  2XY8 B;  3N9M A;  1G73 A;  4EZH A;  4K0K T;  3AXJ A;  4IDQ A;  2Y6X A;  4DR2 T;  3HL6 A;  4JI3 T;  3TKL B;  2D0U A;  4JI5 T;  2EHO D;  3HKD E;  4NUU A;  1S35 A;  5L4E A;  3BQI A;  4J2C A;  4P1N A;  2EHO B;  2Z6E A;  4JYA T;  4KI0 F;  4HFI A;  3AE3 A;  4H9P C;  2WP9 A;  2KZ7 B;  5JDF A;  3LFM A;  2W2U A;  1YKE B; 
#chains in the Genus database with same CATH homology
 2LOS A;  4YFS A;  4Z8X A;  2CA5 A;  4AQF A;  3KV4 A;  2ZM0 A;  2P9B A;  5FY0 A;  4CI3 B;  5KX5 E;  3NBX X;  3ZYK A;  1MND A;  5FP3 A;  3KV9 A;  2I59 A;  3PTR B;  3EDV A;  4FJO A;  3EUH A;  3IHR A;  4KP3 C;  4KUM B;  1ZHC A;  2Q9Q D;  2XAS B;  3LK3 B;  4P09 A;  3UUL A;  3MK7 C;  4BJN A;  3L09 A;  4JEH B;  4GIW A;  4ISS A;  2CXF A;  4IST A;  4IDZ A;  5LGT B;  3ZMT B;  5CB4 E;  3AVR A;  2W62 A;  4QXH B;  1WR6 A;  3ZPO A;  1HS7 A;  3UUM A;  2ODU A;  3WAK A;  4AQG A;  1UX4 A;  1KK7 A;  5FY7 A;  3VU7 H;  2WAU A;  4PFP A;  4EYU A;  2UXX B;  3ZC1 A;  2L8K A;  4F6R C;  2ZLY A;  2ZMA A;  4O4L E;  4QXC B;  4PW8 A;  5LA6 E;  4HTE A;  1IJ6 A;  4EXT A;  5HYA A;  3NRX A;  5EK4 A;  5LCY A;  4MLK A;  3O1I A;  4IE0 A;  3K3Q C;  4WW0 A;  4MFR A;  3CWZ B;  4BAY B;  5HXE A;  3IF8 B;  3P8C D;  1MIY A;  2N2N A;  3H37 A;  3ZN1 B;  5ADX L;  3ESL A;  1HCI A;  4PJJ A;  5J1G A;  4AQF C;  3B13 A;  4PK6 A;  4DMW A;  4H63 V;  3MA9 A;  4L5G A;  3CPZ A;  2HPL A;  3E0Z A;  4HFV A;  2CLY B;  1ZV4 X;  5JVD E;  4DVD A;  3ZEF B;  4IE4 A;  2XAQ B;  4ILU A;  3GA8 A;  3NRY A;  1US7 B;  3MKD A;  4BJM A;  2KWH A;  4U74 A;  2A72 A;  2CCQ A;  3CKD A;  3HA4 A;  5A1L A;  1YKH B;  3KV6 A;  2KIN B;  2LSI A;  4BA9 A;  4DBR A;  2JPF A;  4GYR A;  3PU8 A;  1BR2 A;  5DQV A;  3ZMS B;  2D0T A;  3M65 A;  3N2O A;  2DWG A;  3O4X E;  4QX7 B;  3PUS A;  4MBQ A;  1D1B A;  4TZ4 C;  2YEV C;  2NW9 A;  5FY1 A;  4CZZ B;  1FMV A;  4UEM A;  5JDQ A;  2XQY A;  3KBU A;  5LP6 E;  4QX8 B;  1IAP A;  5JDH A;  1IJ5 A;  2D2S A;  4KMC A;  5DJQ C;  3O9X A;  3B57 A;  3FBL A;  4IE7 A;  5LOV E;  3N2K E;  3KBT A;  3QK6 A;  4EIW A;  1CUN A;  1FEW A;  2LEH A;  2LSJ A;  3I9Y A;  3LG7 A;  3RX6 A;  5IYZ E;  2NW7 A;  4O4H E;  3FB2 A;  3DTO A;  3ZMV B;  2W61 A;  5L3F B;  3GMI A;  3J9X 1;  4EYY R;  3H3A A;  4M1P A;  5HWX A;  4X1Y E;  3SOL A;  4UXN B;  5CA1 E;  3T8O A;  2VKD A;  2UXN B;  5LG4 A;  4HKA A;  4K0U A;  4U72 A;  4CXX A;  2DNX A;  2V7I A;  4TX5 A;  2C5K T;  3PE0 A;  5LJM A;  4CXY A;  3Q2M A;  4N78 D;  1H7C A;  1FMW A;  2QGS A;  5J2T E;  3RYI E;  3AA1 B;  4UIG A;  1MNE A;  1HX8 A;  3MXZ A;  3CML A;  3ZN0 B;  3QUJ A;  3PU3 A;  4EB6 E;  3RYH E;  2X9H A;  4NUV A;  4PNI A;  3S4U A;  3IBP A;  4O8S A;  4P0B A;  1HTJ F;  2BZB A;  3JC6 C;  4ERR A;  2CM0 A;  2VWA A;  3ZLI A;  3N9Q A;  4TN7 B;  2ACX A;  3F57 A;  3OJA A;  2CEA A;  3D0T A;  5FYM A;  5C8Y E;  1S94 A;  5LGN B;  2W0G A;  3SS1 A;  2LM9 A;  3ETV A;  4ANJ A;  1T98 A;  4UVA B;  4ZOL E;  2LJL A;  2CE7 A;  1LVK A;  2LSK A;  1OXZ A;  2HPJ A;  2YIN A;  4GK0 E;  5FXX A;  1Y64 B;  1WYC A;  2B1E A;  3K3N A;  3ZJ2 A;  5AFU L;  5HXC A;  2X9X A;  3MZK B;  2DWK A;  1BR1 A;  3ANW A;  3FXE B;  4PJL A;  3UTK A;  3ZMZ B;  3J7Y q;  3NZQ A;  3ZMU B;  4YJ2 E;  3U3I A;  3KVB A;  5JRC A;  1U4Q A;  4XZC A;  1VRB A;  4ZI3 D;  2CXL A;  3KV5 A;  3PDY A;  3L3P A;  4YLH A;  5DQW A;  4ZI2 D;  2Y48 B;  2K5B B;  3AVS A;  3QC9 A;  2JMK A;  4IE6 A;  4JUY A;  2WMN A;  3GN5 A;  4QKN A;  5HXR A;  5LJN A;  2LHN A;  1HG2 A;  2W63 A;  3MAC A;  4H9R C;  4PJM A;  5LBM A;  3IEE A;  5JDM A;  3ZCJ A;  2JJ9 A;  3AA7 B;  5IHY A;  2E8I A;  1WYB A;  4OYJ A;  4I50 E;  4PK5 A;  2KND A;  3UUN A;  2VL8 A;  2C0S A;  2VKH A;  2KXP B;  3C51 A;  3UUX B;  3HI2 A;  2H3R A;  2JQQ A;  2XHE B;  4HE8 A;  2D5U A;  1MMD A;  3C4Z A;  2ZM8 A;  4UVB B;  3RKO A;  4EAH A;  3UFE A;  5L3C B;  2X9Y A;  2L3L A;  4H63 H;  1WRD A;  5E0O A;  1U5P A;  2K9A A;  2VB6 A;  1UX5 A;  3OKQ A;  3SWH A;  1NWM X;  5JDL A;  2XAH B;  2H7O A;  4I4T E;  1KNZ A;  2DCF A;  5BMV E;  2PG8 A;  5H6R B;  3I0O A;  2E9X A;  5LHH B;  4EOZ B;  3LK2 B;  4YJ3 E;  1D0Z A;  5FXV A;  2LT3 A;  2ZM2 A;  5HWY A;  1MIV A;  3R6N A;  1D0Y A;  3V5U A;  1HFA A;  3HKB E;  4C91 A;  3E08 A;  2NW8 A;  1UCU A;  4H9O C;  1EZ3 A;  3N2G E;  2MYS A;  1VOM A;  2N1G A;  4UV8 B;  5H6Q B;  5JDN A;  1BR4 A;  4H9S E;  4UVC B;  2XTL A;  3AA6 B;  4O2B E;  5DAB A;  2PBI A;  3VHL A;  4G2A A;  3HKC E;  3O1J A;  4EZ4 A;  3BK9 A;  4XBF B;  2VKJ A;  4GK5 E;  5EK2 A;  2XAG B;  4HEA A;  4JLE A;  4OHF A;  3E22 E;  5FMN A;  1MMG A;  3CQC B;  2Q9Q C;  1QUU A;  4IE5 A;  2X68 A;  3N9P A;  3CX7 B;  4KBM B;  5F3J A;  4HGA A;  3FXD B;  1HF8 A;  2WMO A;  4PK4 A;  3LK4 2;  3KIN B;  1X79 A;  5FXZ A;  4H9N C;  4WBN E;  1BR0 A;  2PJQ A;  3N9N A;  3VKG A;  2RA1 A;  2SPC A;  4X20 E;  3CVR A;  4P0A A;  5LXT E;  2Y8D A;  2E9X C;  4CXW A;  3ZYM A;  2L9Q A;  5JRE A;  3HKE E;  5LNK A;  3LBX B;  3C4X A;  3KDS E;  3A5X A;  5LBQ B;  3I1A A;  3CX8 B;  2HH7 A;  1NAF A;  1V9D A;  3ONX A;  4ASK A;  5JR9 C;  4AKG A;  3RRC A;  4AI6 A;  2LSG A;  3UT5 E;  3P7I A;  3CX6 B;  2CMR A;  5M4Y A;  2VKO A;  3N5L A;  5LHG B;  3LBX A;  2A2F X;  3K8P C;  1D0X A;  5GON E;  5F8P A;  2IC6 A;  4AXP A;  1LKX A;  3RYF E;  3WI3 A;  3ZYL A;  4AKH A;  3AAE B;  2NOX A;  3WAJ A;  4E7S A;  1LVF A;  4QHO A;  2V7J A;  3ANW B;  2XUE A;  5EK3 A;  3O1H A;  4UV9 B;  4I43 B;  3CQX C;  2IC9 A;  5FXW A;  4O2A E;  4PJN A;  3EVY A;  5JRC B;  2KWI B;  2EHO A;  3FHN A;  1SHZ C;  4TV9 E;  3RYC E;  4DO0 A;  2LSY A;  4B6X A;  3GN5 B;  4UF0 B;  4ZI7 E;  2G0U A;  2V7L A;  2M67 A;  3RPU A;  3BQK A;  4WBO A;  4X1K E;  3SRZ A;  2YU1 A;  3U78 A;  1YW0 A;  5KDM C;  5LHI B;  1D1A A;  2CWO A;  2X0L B;  3OYZ A;  3BQL A;  1LRZ A;  2MTQ A;  2NWB A;  3C50 A;  5JQG E;  2V7M A;  1G8X A;  5HAX A;  4UF0 A;  3N9O A;  2WM9 A;  2BVM A;  2XAJ B;  4AKR B;  2VAS A;  3PUQ A;  3PUR A;  2W00 A;  5L3B B;  3ZCI A;  2Q9Q B;  2E9X D;  2C5I T;  3ETU A;  4ZS3 A;  4HN9 A;  4GOU A;  4E7Z A;  2MOZ A;  5J2U E;  3ZJ1 A;  1Z0P A;  1D1C A;  2XAF B;  3GWH A;  4O4I E;  5FNV E;  3OBV E;  3OYX A;  5L3G B;  2MBG A;  1ZEE A;  1B7T A;  3V5S A;  4O4J E;  2Q9Q A;  1MIW A;  2E9X B;  1YD8 G;  2V26 A;  4TUY E;  4ZS2 A;  3F2E A;  5L2L A;  3JC6 D;  5JH7 E;  2YU2 A;  3DJB A;  4C90 A;  3FBZ A;  3KVA A;  2DLR A;  2EHO C;  4ADZ A;  3R84 B;  4AKL A;  4FI5 A;  4GYS A;  5KMG P;  5JR9 B;  3Q9D A;  3CQG B;  1AJ3 A;  2YK0 A;  3RC8 A;  2LOP A;  2X66 A;  3NZP A;  1MMA A;  4XAX B;  2WSS V;  5HXH A;  2KMF A;  3ZC0 A;  2WWU A;  1WLX A;  4H9Q C;  1ZKE A;  2ODV A;  2DI4 A;  3C64 A;  1QSD A;  2IAK A;  4G63 A;  3W15 B;  4V1A v;  2DHR A;  5JR9 A;  3MJX A;  4OFZ A;  3RC3 A;  2LE8 A;  2A3D A;  3C98 B;  4OYK A;  4PAG A;  5JDG A;  2CXD A;  5LYJ E;  3HR0 A;  1IZN B;  3VKH A;  4MAL A;  4WNK A;  4DMV A;  2CWY A;  1MMN A;  2NTX A;  1YKE B;  2K48 A;  3Q5W A;  4MHC A;  5HXS A;  2GK9 A;  2KT9 A;  4IGU A;  3Q5X A;  4DBQ A;  4TV8 E;  4L9I A;  4PFO A;  4CI2 B;  3KFW X;  2X51 A;  5EZY E;  4L0R A;  4YHJ A;  2K24 A;  2BDE A;  2NTY A;  3N9M A;  1G73 A;  2IW5 B;  2JRK A;  4A56 A;  4DND A;  3AAI A;  2JMH A;  4UEL A;  4EZH A;  3LJC A;  2NP9 A;  5ETW A;  3AB3 B;  4IIJ E;  2PFV A;  1OWA A;  2Y6X A;  5L3D B;  3HL6 A;  4AKI A;  1SA0 E;  2V7K A;  5TAO A;  2WBL A;  3C4W A;  2BVL A;  3AA0 B;  3I0Q A;  3TKL B;  2V1D B;  2KLQ A;  3RH3 A;  2D0U A;  5LGU B;  2X67 A;  3RRW A;  4ZI3 C;  2EHO D;  2X9W A;  2N9D A;  3HKD E;  2OA5 A;  4JEU B;  4NUU A;  1S35 A;  4CI1 B;  4IHJ E;  4ZI2 C;  3AAA B;  1O3X A;  3BQI A;  3N9L A;  4J2C A;  2H7V C;  2CLY C;  1FIO A;  2RP4 A;  2VK9 A;  5L3E B;  4ZHQ E;  2EHO B;  2ES0 A;  2Z6E A;  4QXB B;  4CQI A;  3DP7 A;  3PUG A;  2LHR A;  1E1H B;  1HG5 A;  4I55 E;  3EDU A;  4H9P C;  2KZ7 B;  3F31 A;  4QWN B;  4X1I E;  2C5J A;  5JDF A;  4OK0 A;  5CA0 E;  3LFM A;  3PUA A;  2J1D G;  2QA7 A;  3K3O A;  3I9W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...