5LNKA

Entire ovine respiratory complex i
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
115
structure length
115
Chain Sequence
MNLMITLLTNFTLATLLVTIAFWLPQLNVYSEKTSPYECGFDPMGSARLPFSMKFFLVAITFLLFDLEIALLLPLPWASQTTNLNTMLTMALLLIFLLAVSLAYEWTQKGLEWTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Mitochondrial complex I, 51 kDa subunit
publication title Atomic structure of the entire mammalian mitochondrial complex I.
pubmed doi rcsb
total genus 32
structure length 115
sequence length 115
ec nomenclature ec 7.1.1.2: NADH:ubiquinone reductase (H(+)-translocating).
pdb deposition date 2016-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00507 Oxidored_q4 NADH-ubiquinone/plastoquinone oxidoreductase, chain 3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1610 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 5lnkA00
3RKOA 5LNKA 4HEAA 4HE8A
chains in the Genus database with same CATH superfamily
3VRAA 3NVOA 2W4XA 2DL1A 1FMVA 2CWOA 3WAJA 1CHUA 2HHHT 2NW7A 2YEVC 2XHEB 2LM9A 3FHNA 1E7PA 1WFDA 3CX8B 4DBRA 3BQKA 2NWBA 2AXDS 4JI4T 2W67A 4TWHA 5HEHA 2NTXA 3O9XA 4LMKA 3A5XA 2C0SA 5J1GA 4TNVA 1HX1B 5AQMB 2J1DG 1QUUA 3AEBA 2DCFA 5A1LA 2XAFB 1FMWA 4ZI3C 3ZT5A 5L3EB 1HNXT 4WYVA 2I6HA 4UF0B 2DWKA 4YSYA 2BKOA 4HWHA 5AQGB 4ZEYA 4TUYE 5AQRB 4DV1T 4OHFA 3IBPA 4AIUA 2C5IT 2YKSA 3ANWA 1J1JA 3ZYLA 2G0UA 3CQXC 1QLBA 2WM9A 2Y48B 1OWAA 4NXMT 3I0OA 3UU8A 2IC9A 2WDQA 3AXJB 5IYZE 2IHR1 2QYWA 5LP6E 5ETWA 3C51A 3ZPOA 4TZ4C 2D9DA 1D1AA 3EHZA 2NW8A 2ZM0A 1H7CA 1MIWA 4QX8B 4TX5A 5HEJA 1BR1A 2JQHA 3AAEB 5HXSA 1J5WA 1KF6A 5HEOA 4EEDA 4KHPT 1U4QA 5GONE 2V5CA 2LOPA 3N9MA 3DJBA 3KBUA 1VRBA 2ZM2A 4ADZA 4JI0T 2E9XD 3NZQA 2RPAA 4YHJA 3BQIA 2Y8DA 4U2ZA 1JNRA 3GMIA 2YU1A 2N1GA 2PJQA 3AB3B 4C90A 1IBLT 1J5ET 4DNDA 1ZP0A 2X9HA 4YJ3E 4IE4A 2FJDA 3F31A 3AE8A 5DABA 2XM1A 2CBIA 2IW5B 4H63V 1E2AA 4AXPA 5FXXA 4U7YA 5LB7B 4JI6T 2WZHA 3GWHA 2X67A 5JTGA 5CA1E 3KINB 5JDNA 2W66A 4OYJA 3AAAB 4LF5T 2UXDT 4JEUB 3CVRA 4I55E 4TWFA 2LHNA 4IREA 3FXDB 2NR4A 3LSVA 3ZCIA 1T72A 3O1HA 3ONJA 5LA6E 3MXZA 4DR4T 4CXXA 3WAKA 3CWZB 2BKPA 2XSBA 4LF6T 1SE7A 5AQHB 1HFAA 3AA1B 2VASA 3PUQA 5LNKA 4H9NC 2ZMAA 3OYXA 2YN6A 3N9LA 5LJMA 1XNRT 1D0XA 4KBMB 4J2CA 1LVFA 5HEUA 3LBXB 1DU2A 2HN1A 5JDMA 4JLEA 2XQYA 2PG8A 1D1CA 4UVBB 2LSKA 4QXCB 3AE7A 2N2NA 5FXVA 1YD8G 3MK7C 2LOSA 4MLKA 2BBJA 3C98B 3PTRB 2VL0A 5ABGA 1N34T 2Y6XA 2WS3A 3LJCA 2UUBT 2YDRA 1OEDC 4GOUA 3ONXA 2E9XB 3F2EA 2VURA 5L2LA 5ABEA 4DMVA 5FMNA 3K8PC 2YK0A 4IGUA 5HEGA 3Q5EA 2XQ6A 4Q25A 1XMQT 2V8SV 4YFSA 2H88A 2XJ7A 4O2BE 1X9BA 5J0ZA 3T8OA 3N9NA 3U78A 2J62A 1MNDA 5FY0A 1W09A 2W62A 1OXZA 4QXBB 2FUPA 2WDRA 3FZLB 4H9PC 3W15B 2LJLA 2JPFA 4B3TT 4GKJT 1M7KA 3ONLC 2BVMA 4O4JE 3JADA 4X65T 2KLQA 2VQFT 4PJNA 2BZBA 4X1YE 4V1Av 4NUVA 3TLSA 4X62T 3AE5A 4JI5T 3NWIA 4ILAA 2ACXA 1XDOA 2BS3A 4DUZT 2V6YB 3FZFB 4CXWA 4TWDA 1Y01A 3ZJ2A 4KP3C 3RQWA 4ZI3D 4IDOA 2HH7A 4UEMA 4QH5A 3TLUA 1M62A 2E5VA 4CI2B 5C3JA 3QC9A 2XM2A 3CQGB 2W61A 5LGTB 3FZKB 4QH1A 2E8IA 1BR2A 4Z8XA 4KX6A 5LG4A 1XZYA 4JYAT 3RH3A 3MJXA 1UUSA 1KNZA 3RKGA 3OPCA 3ETVA 4P1NA 2V5DA 4ISSA 1YQ4A 1UX4A 2EHOA 4ZZCA 4MHCA 2WWUA 3AAIA 1D1BA 4UVCB 4DR1T 4A56A 5L3FB 4HFBA 2YU2A 3UQ7A 1QSDA 2XQ4A 5HWXA 2YDQA 5AQNB 1WYBA 4TNWA 2LEHA 1GQEA 3PUXF 4F6RC 2K5BB 5LGNB 2JJ9A 2V7MA 3ESLA 4IL9A 3P8CD 3E08A 5TAOA 4LFCT 4UV9B 4QHOA 3UULA 2IMLA 4L0RA 4UXNB 2W00A 2HPJA 4B3ST 3UUXB 4YTNA 2MPKA 3RIUA 1ZEEA 3AE2A 2VKDA 2VVSA 4CN6A 4AKIA 4HFVA 4IIJE 5LXTE 3V5SA 3ZMZB 3C4ZA 3AE9A 4LFBT 3RYIE 4NPPA 3RI5A 5AQSB 4PK6A 3ZMTB 1I6ZA 2K9AA 1W9RA 5AQLB 1LKXA 2HN2A 2KMFA 4JI2T 2H89A 4GIWA 3FXEB 4AISA 2DNXA 1T98A 3N2KE 3AECA 3P4QA 3PU8A 3CX7B 4U72A 4QWNB 3P7IA 5HXEA 1Z0PA 3N9QA 4GKKT 5AQFB 3PUWF 3IF8B 2X0HA 3UFGA 2FBWA 2XUEA 3LK42 2EHOC 2UUCT 3C64A 2XQ9A 1UGOA 3HL6A 5JH7E 3C4WA 1VOMA 2CXFA 2OLTA 3MKDA 5L4EA 4HWDA 4BA9A 3N9OA 4QKNA 5FVKA 4ZS2A 4UF0A 4HFCA 2OA5A 2WP9A 2VVNA 1UCUA 2H7OA 2ZM6T 3ZT7A 4ILUA 3NZPA 3K1SA 1YW0A 2JMHA 2X9WA 3AE4A 2C5JA 4AKGA 1HG2A 4M1PA 4X66T 5EK3A 3RIUC 4U33A 2WB5A 1WLXA 1YXRA 3TKLB 4WBNE 4ZI2C 2W0GA 2PBIA 4JI7T 4CI3B 4HFHA 3Q5XA 2X9XA 2X66A 4U31A 2JQ9A 3AEFA 1WYCA 5AQQB 4LMJA 3CKDA 2LKHA 2XAHB 3G06A 2KWHA 2A2FX 4KUMB 2Q9QA 2LRKA 3PJAJ 3UUBA 3UU4A 2PTFA 4H9QC 2GK9A 4NXNT 5LMUT 2LM2A 2KINB 2WU5A 2P9BA 4PK4A 2C5KT 1E1HB 3RC8A 4DBQA 3R6NA 3S4UA 3ZEFB 5ADXL 2XQ8A 3GN5A 4H9OC 4P0BA 2H7VC 5DQVA 3ANWB 4IDNA 2IDOB 4QXHB 3J9X1 2R6GF 5HCMA 4HFIA 3N9PA 3RQUA 5KMGP 2DHRA 3FZHB 3HKEE 3PUYF 5C2TA 3I0QA 2XSAA 3E22E 4YT0A 1IAPA 2KZ7B 3LG7A 3AEGA 1US7B 3IHRA 4LMLA 4DV5T 4WW0A 3CK6A 4HFEA 5LJNA 4KI0F 5HXRA 2XY8B 3B5MA 2WMOA 3VR9A 5J2TE 2D0UA 3HI2A 4EYYR 3PUVF 4U2YA 3E0ZA 3RKOA 3ZYMA 2D0TA 2PFVA 4X5TA 4DV2T 2I59A 2CBJA 4NUUA 3AEAA 2BG9A 1HR0T 4XZCA 3AE3A 3PDYA 4N78D 2DLRA 2JMKA 3CMLA 5JR9A 2LLYA 2Q9QC 2WSSV 2LKGA 3ZN0B 1W0AA 2E5LT 2MTQA 2JRKA 3M65A 5AQUB 2LRLA 3OYZA 5L3GB 4A98A 3BK9A 4E7SA 1IZNB 3SRZA 5HCJA 3PUSA 1OEDB 4PK5A 1FJGT 1SUMB 2CA5A 2KWIB 4IDQA 3L8RA 2KT9A 3UQ4A 1X79A 5BMVE 3RYFE 2WWVA 3QOFA 4YHHT 1ZV4X 4BAYB 3M3ZB 4DV3T 3HKDE 4G63A 2YOEA 3O1IA 2B76A 3Q5DA 2MBGA 3KV5A 2LSYA 4HWCA 3ZMSB 5HXHA 3RX6A 2CWYA 3CQCB 3EDUA 1HG5A 4JI8T 5EK2A 2ZLYA 5JVDE 5CB4E 3IA3A 5JDGA 3KFWX 2CCQA 2QGSA 5HYAA 5HXCA 3RRWA 2LHRA 4ZXLA 1WR0A 4P09A 1FIOA 4I0UA 4LF9T 3CPZA 2UUAT 2CHOA 5H6QB 3ZC0A 4JBWF 4GYRA 4DVDA 4B3RT 2BG9C 2VWAA 1NENA 4IE5A 3P4SA 4DR7T 3DTOA 5JR9C 4IE7A 2UXBT 3JAFA 4IE0A 2XQAA 5FKYA 4FI5A 3RRCA 4HE8A 3P4WA 5JRCB 2JQQA 4ERRA 3FZMB 2BDEA 3EVYA 3X1DA 3KV4A 5AQIB 5AQOB 3H37A 3UUMA 2EHOD 4OK0A 3U3IA 2BKNA 3RPUA 4TN7B 3R84B 2KNDA 1LVKA 4JI1T 3A7MA 1B7TA 1BR0A 5JDQA 1HF8A 4DR6T 3C4XA 4HWFA 4IDPA 4PFOA 2WAUA 2CPTA 3MACA 4JV5T 4UV8B 5CFBA 2BS4A 4I43B 3EUHA 1XDPA 3FBZA 4KHZF 2MAWA 4L5GA 5JDHA 4YSZA 4K0KT 1T7SA 1KNRA 5FY1A 4BJNA 5LMNT 5LOVE 1N36T 2CE7A 4WBOA 1N32T 1KEYA 5L3CB 3L39A 3KV9A 4UR9A 2WQYA 4GYSA 2CLYB 4ZI2D 1IBKT 3MA9A 3TLTA 5LGUB 2IUBA 3EAMA 2XAJB 2LE8A 3VKGA 3JC6C 3QB5A 4JEHB 5KX5E 4PAGA 4DO0A 4H9RC 3OTOT 1MNEA 1NAFA 4KMCA 3KV6A 4QX7B 4ANJA 1KNPA 2XQ3A 2A72A 3PURA 1XWMA 4WNKA 2CEAA 5KXJA 2J47A 3ZJ1A 5JDLA 2V7IA 5BR8T 2V7KA 2LSIA 2MOZA 2EHOB 3QNUA 4I4TE 1D0YA 3EDVA 3VU7H 1OEDE 4X64T 4DV0T 3UU6A 2XZEA 1UX5A 2F4VT 1S35A 4IHJE 3ZC1A 2V6XA 3PJAA 2X68A 4DV4T 4ILCA 4ISTA 2CRBA 4NIQA 5L3DB 2QA7A 2ODVA 5CGMA 1CUNA 4ZHQE 3CX6B 2CM0A 4O4HE 2Q9QD 2M6BA 4EEBA 3AE1A 3H3AA 3UFEA 5FY7A 3Q2MA 5LG3A 4DUYT 2UXXB 2KXPB 1HCIA 3ZYKA 4TV9E 2K24A 1YQ3A 2XAQB 2I0MA 2RP4A 1ZKEA 1MMNA 5LBQB 2XQ7A 5FYMA 1UURA 4CN4A 2VK9A 2NW9A 5IHYA 5ABFB 3ZSSA 5AQKB 1YKEB 4X1KE 2WMNA 3AXJA 4CZZB 4IDZA 3O4XE 2WCAA 3ETUA 4YTPA 4MALA 2NOXA 1S94A 1NEKA 3AA0B 4PJLA 4B3MT 1IJ5A 1JNZA 1MMDA 3ZKRA 2X0LB 3RIAA 3C50A 3RC3A 5L4HA 4EV6A 2XAGB 4U3CA 2CHNA 4HN9A 5FL1A 3FBLA 3TLVA 1IJ6A 2IAKA 3UUNA 2AE9A 1N33T 5CA0E 1VCTA 3PUAA 2E2AA 4HFDA 5DJQC 4AKRB 2NTYA 1V9DA 3ZMUB 4DV7T 4LF7T 2K3WA 1IBMT 1R8IA 1WR6A 2L3LA 3B57A 5AQPB 4JI3T 3K3OA 3KVAA 4ZZBA 3AVRA 4QH4A 2DI4A 3OBVE 3LK3B 4O2AE 4ASKA 2ZM8A 5LHIB 4DMWA 3AEDA 2A9UA 4LF8T 2VQET 3ZN1B 3N2OA 3ABVA 4L9IA 4K0UA 3O1JA 4EOZB 4XAXB 4EB6E 5JQGE 1BR4A 1D0ZA 4LF4T 1O3XA 5L47A 4OX9T 2CXLA 2Q9QB 3EABA 2IIUA 4EYUA 3RHWA 1T8BA 4LFAT 4GK5E 2M67A 4DR2T 3N2GE 3ZSTA 4HKAA 2XQ5A 3MZKB 2Z6EA 3PV0F 2JIWA 1KK7A 4C91A 3ZCJA 3PU3A 1HNZT 5FL0A 2FJBA 3ZLIA 2X0YA 5F3JA 5LHGB 3GN5B 3QK6A 1MIVA 2WBLA 1LRZA 2LSJA 1NWMX 3B13A 1OEDA 4X20E 4CN1A 2N9DA 5FNVE 3OJAA 1YKHB 2WZIA 5HWYA 3LK2B 5IUXA 5ABHA 3LBXA 4YSXA 4H63H 3OKQA 2OV9A 1EZ3A 3PUZF 3SFEA 5FVLA 1W0BA 5IWAT 4BJMA 2J4GA 5LHHB 2BBHA 2DWGA 3EI0A 4EZHA 2VL8A 2IC6A 3OVUA 4O4IE 2CXDA 1Z8UA 3JC6D 5LCYA 3RF1A 4E7ZA 1MMAA 2V7LA 4FJOA 4HTEA 4MFRA 5AQVB 2V7JA 2E9XA 2H3RA 3K3NA 2BG9B 2V1DB 3PUGA 2FJEA 2XTLA 2JQKA 1UK5A 3H3MA 4ZI7E 5JR9B 4AQYT 3BQLA 4G2AA 4EXTA 3HKBE 4XBFB 4AKLA 5E0OA 1G73A 4O4LE 2BS2A 4O8SA 1L0VA 2ACZA 2MYSA 2WU2A 5FP3A 5JRCA 3AEEA 2BVLA 3HKCE 3CIRA 1U5PA 3F57A 5CJ5A 4I50E 4YY3T 4COFA 4UIGA 3NKZA 5J2UE 2UU9T 5DQWA 3LDQB 1G8XA 4GK0E 2YDSA 5L3BB 2XASB 3JCFA 2W2UA 5JDFA 3UT5E 2L9QA 4Z91A 3N5LA 3TLWA 4U7IA 3LFMA 4AI6A 3SWHA 5KDMC 4IL4A 2RA1A 2M6IA 2X9YA 5AQJB 3RYCE 2V6YA 3HA4A 2WY2A 1WCRA 4PJJA 2VKOA 4IT4A 4YJ2E 3UU3A 4AKHA 3SOLA 5AFUL 1SHZC 4A97A 1MMGA 3QB5K 2WDVA 2E9XC 4YLHA 4DV6T 2YINA 2SPCA 5JREA 3NBXX 4AQFA 1HNWT 2VKJA 1VCSA 2CMRA 3WI3A 3A8YC 3L09A 4ZS3A 3ZT6A 4MBQA 3P4RA 3J7Yq 3VHLA 4HEAA 5F8PA 5FXZA 2ES0A 1HTJF 2VB6A 4F8HA 4DR3T 3PE0A 1ZOYA 4DR5T 2LT3A 1FEWA 2W63A 4YXDA 3UU5A 4B6XA 3HR0A 2KSRA 2HPLA 3KDSE 4HWIB 5LYJE 5EZYE 1SA0E 4EGWA 2XPKA 4IE6A 2VKHA 4UVAB 2FJAA 3I9WA 3VKHA 3GA8A 5FXWA 4WZXA 3SFDA 3Q9DA 2A3DA 4HGAA 4EZ4A 4CI1B 4AQGA 3K3QC 4PJMA 4EIWA 3UTKA 3T1HT 2K48A 4UELA 4PNIA 5H6RB 3AE6A 3I1AA 3NRYA 3SS1A 1ZHCA 3L3PA 4OFZA 3AA6B 3I9YA 2B1EA 3KVBA 1HX8A 2D5UA 2QRXA 1MIYA 4AQFC 4H9SE 3AA7B 3KBTA 4U74A 4PFPA 2CLYC 3RLFF 3ZMVB 5F5WA 3QUJA 3P50A 3RIFA 4CXYA 3Q5WA 2ODUA 3T1YT 3FB2A 4DIDB 3P4PA 2UXNB 4P0AA 5M4YA 2NP9A 3NRXA 4JUYA 3IEEA 5EK4A 3JAEA 3AVSA 3RYHE 2UXCT 4Z90A 4YTMA 4OYKA 5C8YE 4CQIA 2BG9E 1I94T 2V26A 4X1IE 5LBMA 2LSGA 4EAHA 1WRDA 1Y64B 3RGLA 2X51A 4ZOLE 1XMOT 4A5XA 1HS7A 3V5UA 5HAXA 5ABFA 2QVAA 5AQTB 1KFYA 4ILBA 2L8KA 4PW8A 3DP7A 1AJ3A 3D0TA 1XNQT 3VR8A 4TV8E 2D2SA 3VRBA
chains in the Genus database with same CATH topology
3CQGB 1D0ZA 2CCQA 2W61A 2QGSA 5HYAA 5LGTB 1FMVA 1O3XA 5HXCA 2E8IA 2CXLA 3RRWA 1BR2A 2LHRA 4Z8XA 5LG4A 2CWOA 2Q9QB 3WAJA 3RH3A 3MJXA 4EYUA 4P09A 2NW7A 1FIOA 2YEVC 1KNZA 4GK5E 3CPZA 2M67A 2XHEB 3ETVA 2LM9A 3FHNA 3N2GE 4HKAA 3MZKB 4ISSA 1UX4A 2EHOA 2Z6EA 4MHCA 2WWUA 3AAIA 5H6QB 1KK7A 1D1BA 4UVCB 4C91A 3ZCJA 3ZC0A 4GYRA 3PU3A 4DVDA 4A56A 3CX8B 2VWAA 5L3FB 3ZLIA 4DBRA 3BQKA 2NWBA 2YU2A 1QSDA 4IE5A 5HWXA 5F3JA 1WYBA 3DTOA 5LHGB 5JR9C 2NTXA 4IE7A 3GN5B 3QK6A 1MIVA 2LEHA 3O9XA 3A5XA 2C0SA 5J1GA 2WBLA 1LRZA 2LSJA 4IE0A 1NWMX 3B13A 4FI5A 4X20E 2N9DA 3RRCA 2J1DG 5FNVE 4HE8A 1QUUA 2JQQA 5JRCB 3OJAA 1YKHB 2DCFA 4ERRA 4F6RC 5A1LA 2BDEA 2XAFB 1FMWA 2K5BB 4ZI3C 5HWYA 3LK2B 5LGNB 3EVYA 5L3EB 3KV4A 3LBXA 2JJ9A 4H63H 3H37A 3OKQA 4UF0B 2DWKA 1EZ3A 2EHOD 3UUMA 4OK0A 2V7MA 3ESLA 3P8CD 3E08A 3U3IA 5TAOA 4TUYE 4QHOA 4UV9B 4TN7B 3RPUA 3R84B 3UULA 4L0RA 4BJMA 4OHFA 4UXNB 2W00A 3IBPA 2C5IT 5LHHB 3ANWA 2HPJA 2DWGA 1LVKA 2KNDA 3UUXB 3ZYLA 2G0UA 4EZHA 1B7TA 1BR0A 1ZEEA 2VL8A 3CQXC 2IC6A 4O4IE 2VKDA 2CXDA 2WM9A 4AKIA 4HFVA 2Y48B 1OWAA 1HF8A 5JDQA 3JC6D 3I0OA 4IIJE 3C4XA 5LXTE 2IC9A 5LCYA 3V5SA 3ZMZB 5IYZE 3C4ZA 4E7ZA 4PFOA 2WAUA 3RYIE 3MACA 1MMAA 5LP6E 4UV8B 2V7LA 4FJOA 3C51A 5ETWA 4I43B 4PK6A 3ZMTB 4HTEA 4MFRA 3EUHA 2V7JA 2E9XA 2H3RA 3K3NA 3ZPOA 2K9AA 3FBZA 4TZ4C 2V1DB 1LKXA 4L5GA 2KMFA 3PUGA 5JDHA 1D1AA 2XTLA 5FY1A 4GIWA 3FXEB 4BJNA 5LOVE 2DNXA 1T98A 2CE7A 2NW8A 2ZM0A 3N2KE 1H7CA 4WBOA 4ZI7E 5JR9B 3PU8A 1MIWA 3CX7B 4U72A 4QWNB 3P7IA 4QX8B 4TX5A 3BQLA 1BR1A 5HXEA 3AAEB 4G2AA 5HXSA 1Z0PA 3N9QA 4EXTA 3HKBE 3IF8B 5L3CB 4XBFB 2XUEA 5E0OA 1U4QA 4AKLA 1G73A 4O4LE 3KV9A 3LK42 4O8SA 2EHOC 5GONE 2LOPA 2MYSA 3N9MA 4GYSA 3DJBA 3KBUA 2CLYB 3C64A 4ZI2D 5FP3A 5JRCA 1VRBA 2ZM2A 4ADZA 3HL6A 5JH7E 3C4WA 3MA9A 2BVLA 1VOMA 2CXFA 2E9XD 3HKCE 3MKDA 3NZQA 4YHJA 1U5PA 3F57A 4I50E 5LGUB 4UIGA 4BA9A 3N9OA 4QKNA 4ZS2A 5J2UE 4UF0A 5DQWA 3BQIA 2XAJB 2LE8A 2Y8DA 2OA5A 3VKGA 3JC6C 1G8XA 4GK0E 4JEHB 5KX5E 4PAGA 3GMIA 2YU1A 4DO0A 1UCUA 2H7OA 2N1GA 5L3BB 2PJQA 2XASB 4H9RC 3AB3B 4C90A 1MNEA 4DNDA 1NAFA 4KMCA 3KV6A 4QX7B 4ANJA 2X9HA 4YJ3E 4IE4A 5JDFA 3UT5E 4ILUA 2L9QA 3N5LA 3LFMA 3NZPA 3F31A 4AI6A 1YW0A 5DABA 3SWHA 2A72A 2JMHA 2IW5B 2X9WA 4H63V 3PURA 2C5JA 4AXPA 5FXXA 4AKGA 1HG2A 5KDMC 4M1PA 4WNKA 5EK3A 2CEAA 2RA1A 2X9YA 3GWHA 3RYCE 2X67A 3HA4A 4PJJA 5CA1E 3ZJ1A 5JDLA 2VKOA 4YJ2E 1WLXA 3KINB 4AKHA 3SOLA 5JDNA 2V7IA 2V7KA 5AFUL 4OYJA 1SHZC 3AAAB 3TKLB 4WBNE 4JEUB 4ZI2C 2W0GA 1MMGA 2PBIA 3CVRA 4I55E 2LSIA 4CI3B 2MOZA 2EHOB 4I4TE 2E9XC 3Q5XA 4YLHA 1D0YA 2LHNA 2X9XA 2YINA 3FXDB 2SPCA 2X66A 5JREA 3EDVA 3VU7H 3NBXX 3ZCIA 1WYCA 3O1HA 4AQFA 3CKDA 5LA6E 2VKJA 2XAHB 2CMRA 3WI3A 3L09A 3MXZA 4ZS3A 2KWHA 2A2FX 4KUMB 2Q9QA 4MBQA 4CXXA 3WAKA 3CWZB 3J7Yq 3VHLA 4HEAA 4H9QC 2GK9A 5F8PA 5FXZA 2ES0A 1HTJF 2VB6A 1HFAA 1UX5A 3AA1B 1S35A 2KINB 2VASA 3PUQA 4IHJE 3PE0A 3ZC1A 5LNKA 2P9BA 4PK4A 4H9NC 2C5KT 2ZMAA 2LT3A 3OYXA 1FEWA 2X68A 1E1HB 2W63A 3N9LA 4DBQA 5LJMA 1D0XA 3RC8A 3R6NA 4KBMB 4ISTA 4J2CA 1LVFA 3S4UA 5L3DB 3LBXB 2QA7A 5JDMA 3ZEFB 5ADXL 2ODVA 4JLEA 2XQYA 2PG8A 3GN5A 1D1CA 1CUNA 4UVBB 2LSKA 4H9OC 4P0BA 4B6XA 2H7VC 4ZHQE 4QXCB 3HR0A 3CX6B 2HPLA 5DQVA 3KDSE 2CM0A 3ANWB 4O4HE 2N2NA 4QXHB 2Q9QD 5FXVA 5LYJE 5EZYE 1YD8G 3J9X1 1SA0E 3H3AA 3UFEA 5JDGA 5FY7A 3MK7C 2LOSA 3N9PA 5KMGP 4MLKA 3C98B 2DHRA 3Q2MA 3PTRB 4IE6A 2VKHA 3HKEE 2Y6XA 4UVAB 3I0QA 2UXXB 2KXPB 1HCIA 3E22E 3ZYKA 3LJCA 1IAPA 2KZ7B 3LG7A 3I9WA 4TV9E 2K24A 1US7B 2XAQB 3VKHA 3IHRA 4GOUA 2RP4A 1ZKEA 3GA8A 3ONXA 4WW0A 5FXWA 1MMNA 5LBQB 5LJNA 2E9XB 3F2EA 3Q9DA 5FYMA 5HXRA 2A3DA 4HGAA 2VK9A 4EZ4A 2NW9A 4CI1B 5IHYA 2WMOA 4AQGA 5L2LA 3K3QC 5J2TE 4PJMA 4DMVA 4EIWA 5FMNA 3K8PC 2D0UA 3UTKA 2YK0A 3HI2A 2K48A 4EYYR 4IGUA 4UELA 4PNIA 3E0ZA 5H6RB 1YKEB 3I1AA 3NRYA 4X1KE 3SS1A 2WMNA 4CZZB 4IDZA 3O4XE 3ETUA 4MALA 1ZHCA 3RKOA 2NOXA 3ZYMA 3L3PA 4OFZA 4YFSA 2D0TA 2PFVA 3AA6B 1S94A 2I59A 4O2BE 3I9YA 4NUUA 3AA0B 4PJLA 3T8OA 2B1EA 3KVBA 1IJ5A 1MMDA 3N9NA 4XZCA 1HX8A 3U78A 2D5UA 2X0LB 3PDYA 3C50A 1MNDA 5FY0A 1MIYA 4N78D 4AQFC 4H9SE 2W62A 2DLRA 2JMKA 3CMLA 5JR9A 3RC3A 3AA7B 3KBTA 4U74A 4PFPA 2CLYC 1OXZA 2Q9QC 2WSSV 4QXBB 3ZN0B 3ZMVB 2XAGB 4H9PC 3QUJA 2MTQA 2JRKA 4HN9A 3M65A 3Q5WA 3W15B 4CXYA 2ODUA 3FBLA 1IJ6A 2IAKA 2LJLA 3UUNA 2JPFA 5CA0E 3FB2A 3PUAA 3OYZA 5DJQC 2UXNB 4P0AA 4AKRB 5M4YA 2NP9A 2NTYA 1V9DA 3ZMUB 5L3GB 3NRXA 4JUYA 2BVMA 3BK9A 3IEEA 5EK4A 4E7SA 3AVSA 3RYHE 4O4JE 1IZNB 3SRZA 2KLQA 3PUSA 4PJNA 2BZBA 4OYKA 4PK5A 5C8YE 4X1YE 4V1Av 1WR6A 4NUVA 2CA5A 4CQIA 2L3LA 2KWIB 3B57A 2V26A 4X1IE 2KT9A 5LBMA 2LSGA 1X79A 2ACXA 3K3OA 3KVAA 3AVRA 4EAHA 1WRDA 5BMVE 3RYFE 1Y64B 2DI4A 2X51A 4ZOLE 1ZV4X 3OBVE 4BAYB 3LK3B 4O2AE 4ASKA 4CXWA 2ZM8A 1HS7A 3V5UA 5HAXA 3HKDE 5LHIB 3ZJ2A 4G63A 4DMWA 4KP3C 3O1IA 2L8KA 4PW8A 4ZI3D 3DP7A 2MBGA 2HH7A 1AJ3A 3KV5A 3D0TA 4UEMA 3ZN1B 3N2OA 2LSYA 4L9IA 4K0UA 3ZMSB 5HXHA 3O1JA 3RX6A 4EOZB 4XAXB 2CWYA 3CQCB 3EDUA 1HG5A 4EB6E 4CI2B 2ZLYA 5JVDE 4TV8E 5CB4E 5EK2A 3QC9A 5JQGE 3KFWX 1BR4A 2D2SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RKO A;  5LNK A;  4HEA A;  4HE8 A; 
#chains in the Genus database with same CATH topology
 3VRA A;  3NVO A;  2W4X A;  2DL1 A;  1FMV A;  2CWO A;  3WAJ A;  1CHU A;  2HHH T;  2NW7 A;  2YEV C;  2XHE B;  2LM9 A;  3FHN A;  1E7P A;  1WFD A;  3CX8 B;  4DBR A;  3BQK A;  2NWB A;  2AXD S;  4JI4 T;  2W67 A;  4TWH A;  5HEH A;  2NTX A;  3O9X A;  4LMK A;  3A5X A;  2C0S A;  5J1G A;  4TNV A;  1HX1 B;  5AQM B;  2J1D G;  1QUU A;  3AEB A;  2DCF A;  5A1L A;  2XAF B;  1FMW A;  4ZI3 C;  3ZT5 A;  5L3E B;  1HNX T;  4WYV A;  2I6H A;  4UF0 B;  2DWK A;  4YSY A;  2BKO A;  4HWH A;  5AQG B;  4ZEY A;  4TUY E;  5AQR B;  4DV1 T;  4OHF A;  3IBP A;  4AIU A;  2C5I T;  2YKS A;  3ANW A;  1J1J A;  3ZYL A;  2G0U A;  3CQX C;  1QLB A;  2WM9 A;  2Y48 B;  1OWA A;  4NXM T;  3I0O A;  3UU8 A;  2IC9 A;  2WDQ A;  3AXJ B;  5IYZ E;  2IHR 1;  2QYW A;  5LP6 E;  5ETW A;  3C51 A;  3ZPO A;  4TZ4 C;  2D9D A;  1D1A A;  3EHZ A;  2NW8 A;  2ZM0 A;  1H7C A;  1MIW A;  4QX8 B;  4TX5 A;  5HEJ A;  1BR1 A;  2JQH A;  3AAE B;  5HXS A;  1J5W A;  1KF6 A;  5HEO A;  4EED A;  4KHP T;  1U4Q A;  5GON E;  2V5C A;  2LOP A;  3N9M A;  3DJB A;  3KBU A;  1VRB A;  2ZM2 A;  4ADZ A;  4JI0 T;  2E9X D;  3NZQ A;  2RPA A;  4YHJ A;  3BQI A;  2Y8D A;  4U2Z A;  1JNR A;  3GMI A;  2YU1 A;  2N1G A;  2PJQ A;  3AB3 B;  4C90 A;  1IBL T;  1J5E T;  4DND A;  1ZP0 A;  2X9H A;  4YJ3 E;  4IE4 A;  2FJD A;  3F31 A;  3AE8 A;  5DAB A;  2XM1 A;  2CBI A;  2IW5 B;  4H63 V;  1E2A A;  4AXP A;  5FXX A;  4U7Y A;  5LB7 B;  4JI6 T;  2WZH A;  3GWH A;  2X67 A;  5JTG A;  5CA1 E;  3KIN B;  5JDN A;  2W66 A;  4OYJ A;  3AAA B;  4LF5 T;  2UXD T;  4JEU B;  3CVR A;  4I55 E;  4TWF A;  2LHN A;  4IRE A;  3FXD B;  2NR4 A;  3LSV A;  3ZCI A;  1T72 A;  3O1H A;  3ONJ A;  5LA6 E;  3MXZ A;  4DR4 T;  4CXX A;  3WAK A;  3CWZ B;  2BKP A;  2XSB A;  4LF6 T;  1SE7 A;  5AQH B;  1HFA A;  3AA1 B;  2VAS A;  3PUQ A;  5LNK A;  4H9N C;  2ZMA A;  3OYX A;  2YN6 A;  3N9L A;  5LJM A;  1XNR T;  1D0X A;  4KBM B;  4J2C A;  1LVF A;  5HEU A;  3LBX B;  1DU2 A;  2HN1 A;  5JDM A;  4JLE A;  2XQY A;  2PG8 A;  1D1C A;  4UVB B;  2LSK A;  4QXC B;  3AE7 A;  2N2N A;  5FXV A;  1YD8 G;  3MK7 C;  2LOS A;  4MLK A;  2BBJ A;  3C98 B;  3PTR B;  2VL0 A;  5ABG A;  1N34 T;  2Y6X A;  2WS3 A;  3LJC A;  2UUB T;  2YDR A;  1OED C;  4GOU A;  3ONX A;  2E9X B;  3F2E A;  2VUR A;  5L2L A;  5ABE A;  4DMV A;  5FMN A;  3K8P C;  2YK0 A;  4IGU A;  5HEG A;  3Q5E A;  2XQ6 A;  4Q25 A;  1XMQ T;  2V8S V;  4YFS A;  2H88 A;  2XJ7 A;  4O2B E;  1X9B A;  5J0Z A;  3T8O A;  3N9N A;  3U78 A;  2J62 A;  1MND A;  5FY0 A;  1W09 A;  2W62 A;  1OXZ A;  4QXB B;  2FUP A;  2WDR A;  3FZL B;  4H9P C;  3W15 B;  2LJL A;  2JPF A;  4B3T T;  4GKJ T;  1M7K A;  3ONL C;  2BVM A;  4O4J E;  3JAD A;  4X65 T;  2KLQ A;  2VQF T;  4PJN A;  2BZB A;  4X1Y E;  4V1A v;  4NUV A;  3TLS A;  4X62 T;  3AE5 A;  4JI5 T;  3NWI A;  4ILA A;  2ACX A;  1XDO A;  2BS3 A;  4DUZ T;  2V6Y B;  3FZF B;  4CXW A;  4TWD A;  1Y01 A;  3ZJ2 A;  4KP3 C;  3RQW A;  4ZI3 D;  4IDO A;  2HH7 A;  4UEM A;  4QH5 A;  3TLU A;  1M62 A;  2E5V A;  4CI2 B;  5C3J A;  3QC9 A;  2XM2 A;  3CQG B;  2W61 A;  5LGT B;  3FZK B;  4QH1 A;  2E8I A;  1BR2 A;  4Z8X A;  4KX6 A;  5LG4 A;  1XZY A;  4JYA T;  3RH3 A;  3MJX A;  1UUS A;  1KNZ A;  3RKG A;  3OPC A;  3ETV A;  4P1N A;  2V5D A;  4ISS A;  1YQ4 A;  1UX4 A;  2EHO A;  4ZZC A;  4MHC A;  2WWU A;  3AAI A;  1D1B A;  4UVC B;  4DR1 T;  4A56 A;  5L3F B;  4HFB A;  2YU2 A;  3UQ7 A;  1QSD A;  2XQ4 A;  5HWX A;  2YDQ A;  5AQN B;  1WYB A;  4TNW A;  2LEH A;  1GQE A;  3PUX F;  4F6R C;  2K5B B;  5LGN B;  2JJ9 A;  2V7M A;  3ESL A;  4IL9 A;  3P8C D;  3E08 A;  5TAO A;  4LFC T;  4UV9 B;  4QHO A;  3UUL A;  2IML A;  4L0R A;  4UXN B;  2W00 A;  2HPJ A;  4B3S T;  3UUX B;  4YTN A;  2MPK A;  3RIU A;  1ZEE A;  3AE2 A;  2VKD A;  2VVS A;  4CN6 A;  4AKI A;  4HFV A;  4IIJ E;  5LXT E;  3V5S A;  3ZMZ B;  3C4Z A;  3AE9 A;  4LFB T;  3RYI E;  4NPP A;  3RI5 A;  5AQS B;  4PK6 A;  3ZMT B;  1I6Z A;  2K9A A;  1W9R A;  5AQL B;  1LKX A;  2HN2 A;  2KMF A;  4JI2 T;  2H89 A;  4GIW A;  3FXE B;  4AIS A;  2DNX A;  1T98 A;  3N2K E;  3AEC A;  3P4Q A;  3PU8 A;  3CX7 B;  4U72 A;  4QWN B;  3P7I A;  5HXE A;  1Z0P A;  3N9Q A;  4GKK T;  5AQF B;  3PUW F;  3IF8 B;  2X0H A;  3UFG A;  2FBW A;  2XUE A;  3LK4 2;  2EHO C;  2UUC T;  3C64 A;  2XQ9 A;  1UGO A;  3HL6 A;  5JH7 E;  3C4W A;  1VOM A;  2CXF A;  2OLT A;  3MKD A;  5L4E A;  4HWD A;  4BA9 A;  3N9O A;  4QKN A;  5FVK A;  4ZS2 A;  4UF0 A;  4HFC A;  2OA5 A;  2WP9 A;  2VVN A;  1UCU A;  2H7O A;  2ZM6 T;  3ZT7 A;  4ILU A;  3NZP A;  3K1S A;  1YW0 A;  2JMH A;  2X9W A;  3AE4 A;  2C5J A;  4AKG A;  1HG2 A;  4M1P A;  4X66 T;  5EK3 A;  3RIU C;  4U33 A;  2WB5 A;  1WLX A;  1YXR A;  3TKL B;  4WBN E;  4ZI2 C;  2W0G A;  2PBI A;  4JI7 T;  4CI3 B;  4HFH A;  3Q5X A;  2X9X A;  2X66 A;  4U31 A;  2JQ9 A;  3AEF A;  1WYC A;  5AQQ B;  4LMJ A;  3CKD A;  2LKH A;  2XAH B;  3G06 A;  2KWH A;  2A2F X;  4KUM B;  2Q9Q A;  2LRK A;  3PJA J;  3UUB A;  3UU4 A;  2PTF A;  4H9Q C;  2GK9 A;  4NXN T;  5LMU T;  2LM2 A;  2KIN B;  2WU5 A;  2P9B A;  4PK4 A;  2C5K T;  1E1H B;  3RC8 A;  4DBQ A;  3R6N A;  3S4U A;  3ZEF B;  5ADX L;  2XQ8 A;  3GN5 A;  4H9O C;  4P0B A;  2H7V C;  5DQV A;  3ANW B;  4IDN A;  2IDO B;  4QXH B;  3J9X 1;  2R6G F;  5HCM A;  4HFI A;  3N9P A;  3RQU A;  5KMG P;  2DHR A;  3FZH B;  3HKE E;  3PUY F;  5C2T A;  3I0Q A;  2XSA A;  3E22 E;  4YT0 A;  1IAP A;  2KZ7 B;  3LG7 A;  3AEG A;  1US7 B;  3IHR A;  4LML A;  4DV5 T;  4WW0 A;  3CK6 A;  4HFE A;  5LJN A;  4KI0 F;  5HXR A;  2XY8 B;  3B5M A;  2WMO A;  3VR9 A;  5J2T E;  2D0U A;  3HI2 A;  4EYY R;  3PUV F;  4U2Y A;  3E0Z A;  3RKO A;  3ZYM A;  2D0T A;  2PFV A;  4X5T A;  4DV2 T;  2I59 A;  2CBJ A;  4NUU A;  3AEA A;  2BG9 A;  1HR0 T;  4XZC A;  3AE3 A;  3PDY A;  4N78 D;  2DLR A;  2JMK A;  3CML A;  5JR9 A;  2LLY A;  2Q9Q C;  2WSS V;  2LKG A;  3ZN0 B;  1W0A A;  2E5L T;  2MTQ A;  2JRK A;  3M65 A;  5AQU B;  2LRL A;  3OYZ A;  5L3G B;  4A98 A;  3BK9 A;  4E7S A;  1IZN B;  3SRZ A;  5HCJ A;  3PUS A;  1OED B;  4PK5 A;  1FJG T;  1SUM B;  2CA5 A;  2KWI B;  4IDQ A;  3L8R A;  2KT9 A;  3UQ4 A;  1X79 A;  5BMV E;  3RYF E;  2WWV A;  3QOF A;  4YHH T;  1ZV4 X;  4BAY B;  3M3Z B;  4DV3 T;  3HKD E;  4G63 A;  2YOE A;  3O1I A;  2B76 A;  3Q5D A;  2MBG A;  3KV5 A;  2LSY A;  4HWC A;  3ZMS B;  5HXH A;  3RX6 A;  2CWY A;  3CQC B;  3EDU A;  1HG5 A;  4JI8 T;  5EK2 A;  2ZLY A;  5JVD E;  5CB4 E;  3IA3 A;  5JDG A;  3KFW X;  2CCQ A;  2QGS A;  5HYA A;  5HXC A;  3RRW A;  2LHR A;  4ZXL A;  1WR0 A;  4P09 A;  1FIO A;  4I0U A;  4LF9 T;  3CPZ A;  2UUA T;  2CHO A;  5H6Q B;  3ZC0 A;  4JBW F;  4GYR A;  4DVD A;  4B3R T;  2BG9 C;  2VWA A;  1NEN A;  4IE5 A;  3P4S A;  4DR7 T;  3DTO A;  5JR9 C;  4IE7 A;  2UXB T;  3JAF A;  4IE0 A;  2XQA A;  5FKY A;  4FI5 A;  3RRC A;  4HE8 A;  3P4W A;  5JRC B;  2JQQ A;  4ERR A;  3FZM B;  2BDE A;  3EVY A;  3X1D A;  3KV4 A;  5AQI B;  5AQO B;  3H37 A;  3UUM A;  2EHO D;  4OK0 A;  3U3I A;  2BKN A;  3RPU A;  4TN7 B;  3R84 B;  2KND A;  1LVK A;  4JI1 T;  3A7M A;  1B7T A;  1BR0 A;  5JDQ A;  1HF8 A;  4DR6 T;  3C4X A;  4HWF A;  4IDP A;  4PFO A;  2WAU A;  2CPT A;  3MAC A;  4JV5 T;  4UV8 B;  5CFB A;  2BS4 A;  4I43 B;  3EUH A;  1XDP A;  3FBZ A;  4KHZ F;  2MAW A;  4L5G A;  5JDH A;  4YSZ A;  4K0K T;  1T7S A;  1KNR A;  5FY1 A;  4BJN A;  5LMN T;  5LOV E;  1N36 T;  2CE7 A;  4WBO A;  1N32 T;  1KEY A;  5L3C B;  3L39 A;  3KV9 A;  4UR9 A;  2WQY A;  4GYS A;  2CLY B;  4ZI2 D;  1IBK T;  3MA9 A;  3TLT A;  5LGU B;  2IUB A;  3EAM A;  2XAJ B;  2LE8 A;  3VKG A;  3JC6 C;  3QB5 A;  4JEH B;  5KX5 E;  4PAG A;  4DO0 A;  4H9R C;  3OTO T;  1MNE A;  1NAF A;  4KMC A;  3KV6 A;  4QX7 B;  4ANJ A;  1KNP A;  2XQ3 A;  2A72 A;  3PUR A;  1XWM A;  4WNK A;  2CEA A;  5KXJ A;  2J47 A;  3ZJ1 A;  5JDL A;  2V7I A;  5BR8 T;  2V7K A;  2LSI A;  2MOZ A;  2EHO B;  3QNU A;  4I4T E;  1D0Y A;  3EDV A;  3VU7 H;  1OED E;  4X64 T;  4DV0 T;  3UU6 A;  2XZE A;  1UX5 A;  2F4V T;  1S35 A;  4IHJ E;  3ZC1 A;  2V6X A;  3PJA A;  2X68 A;  4DV4 T;  4ILC A;  4IST A;  2CRB A;  4NIQ A;  5L3D B;  2QA7 A;  2ODV A;  5CGM A;  1CUN A;  4ZHQ E;  3CX6 B;  2CM0 A;  4O4H E;  2Q9Q D;  2M6B A;  4EEB A;  3AE1 A;  3H3A A;  3UFE A;  5FY7 A;  3Q2M A;  5LG3 A;  4DUY T;  2UXX B;  2KXP B;  1HCI A;  3ZYK A;  4TV9 E;  2K24 A;  1YQ3 A;  2XAQ B;  2I0M A;  2RP4 A;  1ZKE A;  1MMN A;  5LBQ B;  2XQ7 A;  5FYM A;  1UUR A;  4CN4 A;  2VK9 A;  2NW9 A;  5IHY A;  5ABF B;  3ZSS A;  5AQK B;  1YKE B;  4X1K E;  2WMN A;  3AXJ A;  4CZZ B;  4IDZ A;  3O4X E;  2WCA A;  3ETU A;  4YTP A;  4MAL A;  2NOX A;  1S94 A;  1NEK A;  3AA0 B;  4PJL A;  4B3M T;  1IJ5 A;  1JNZ A;  1MMD A;  3ZKR A;  2X0L B;  3RIA A;  3C50 A;  3RC3 A;  5L4H A;  4EV6 A;  2XAG B;  4U3C A;  2CHN A;  4HN9 A;  5FL1 A;  3FBL A;  3TLV A;  1IJ6 A;  2IAK A;  3UUN A;  2AE9 A;  1N33 T;  5CA0 E;  1VCT A;  3PUA A;  2E2A A;  4HFD A;  5DJQ C;  4AKR B;  2NTY A;  1V9D A;  3ZMU B;  4DV7 T;  4LF7 T;  2K3W A;  1IBM T;  1R8I A;  1WR6 A;  2L3L A;  3B57 A;  5AQP B;  4JI3 T;  3K3O A;  3KVA A;  4ZZB A;  3AVR A;  4QH4 A;  2DI4 A;  3OBV E;  3LK3 B;  4O2A E;  4ASK A;  2ZM8 A;  5LHI B;  4DMW A;  3AED A;  2A9U A;  4LF8 T;  2VQE T;  3ZN1 B;  3N2O A;  3ABV A;  4L9I A;  4K0U A;  3O1J A;  4EOZ B;  4XAX B;  4EB6 E;  5JQG E;  1BR4 A;  1D0Z A;  4LF4 T;  1O3X A;  5L47 A;  4OX9 T;  2CXL A;  2Q9Q B;  3EAB A;  2IIU A;  4EYU A;  3RHW A;  1T8B A;  4LFA T;  4GK5 E;  2M67 A;  4DR2 T;  3N2G E;  3ZST A;  4HKA A;  2XQ5 A;  3MZK B;  2Z6E A;  3PV0 F;  2JIW A;  1KK7 A;  4C91 A;  3ZCJ A;  3PU3 A;  1HNZ T;  5FL0 A;  2FJB A;  3ZLI A;  2X0Y A;  5F3J A;  5LHG B;  3GN5 B;  3QK6 A;  1MIV A;  2WBL A;  1LRZ A;  2LSJ A;  1NWM X;  3B13 A;  1OED A;  4X20 E;  4CN1 A;  2N9D A;  5FNV E;  3OJA A;  1YKH B;  2WZI A;  5HWY A;  3LK2 B;  5IUX A;  5ABH A;  3LBX A;  4YSX A;  4H63 H;  3OKQ A;  2OV9 A;  1EZ3 A;  3PUZ F;  3SFE A;  5FVL A;  1W0B A;  5IWA T;  4BJM A;  2J4G A;  5LHH B;  2BBH A;  2DWG A;  3EI0 A;  4EZH A;  2VL8 A;  2IC6 A;  3OVU A;  4O4I E;  2CXD A;  1Z8U A;  3JC6 D;  5LCY A;  3RF1 A;  4E7Z A;  1MMA A;  2V7L A;  4FJO A;  4HTE A;  4MFR A;  5AQV B;  2V7J A;  2E9X A;  2H3R A;  3K3N A;  2BG9 B;  2V1D B;  3PUG A;  2FJE A;  2XTL A;  2JQK A;  1UK5 A;  3H3M A;  4ZI7 E;  5JR9 B;  4AQY T;  3BQL A;  4G2A A;  4EXT A;  3HKB E;  4XBF B;  4AKL A;  5E0O A;  1G73 A;  4O4L E;  2BS2 A;  4O8S A;  1L0V A;  2ACZ A;  2MYS A;  2WU2 A;  5FP3 A;  5JRC A;  3AEE A;  2BVL A;  3HKC E;  3CIR A;  1U5P A;  3F57 A;  5CJ5 A;  4I50 E;  4YY3 T;  4COF A;  4UIG A;  3NKZ A;  5J2U E;  2UU9 T;  5DQW A;  3LDQ B;  1G8X A;  4GK0 E;  2YDS A;  5L3B B;  2XAS B;  3JCF A;  2W2U A;  5JDF A;  3UT5 E;  2L9Q A;  4Z91 A;  3N5L A;  3TLW A;  4U7I A;  3LFM A;  4AI6 A;  3SWH A;  5KDM C;  4IL4 A;  2RA1 A;  2M6I A;  2X9Y A;  5AQJ B;  3RYC E;  2V6Y A;  3HA4 A;  2WY2 A;  1WCR A;  4PJJ A;  2VKO A;  4IT4 A;  4YJ2 E;  3UU3 A;  4AKH A;  3SOL A;  5AFU L;  1SHZ C;  4A97 A;  1MMG A;  3QB5 K;  2WDV A;  2E9X C;  4YLH A;  4DV6 T;  2YIN A;  2SPC A;  5JRE A;  3NBX X;  4AQF A;  1HNW T;  2VKJ A;  1VCS A;  2CMR A;  3WI3 A;  3A8Y C;  3L09 A;  4ZS3 A;  3ZT6 A;  4MBQ A;  3P4R A;  3J7Y q;  3VHL A;  4HEA A;  5F8P A;  5FXZ A;  2ES0 A;  1HTJ F;  2VB6 A;  4F8H A;  4DR3 T;  3PE0 A;  1ZOY A;  4DR5 T;  2LT3 A;  1FEW A;  2W63 A;  4YXD A;  3UU5 A;  4B6X A;  3HR0 A;  2KSR A;  2HPL A;  3KDS E;  4HWI B;  5LYJ E;  5EZY E;  1SA0 E;  4EGW A;  2XPK A;  4IE6 A;  2VKH A;  4UVA B;  2FJA A;  3I9W A;  3VKH A;  3GA8 A;  5FXW A;  4WZX A;  3SFD A;  3Q9D A;  2A3D A;  4HGA A;  4EZ4 A;  4CI1 B;  4AQG A;  3K3Q C;  4PJM A;  4EIW A;  3UTK A;  3T1H T;  2K48 A;  4UEL A;  4PNI A;  5H6R B;  3AE6 A;  3I1A A;  3NRY A;  3SS1 A;  1ZHC A;  3L3P A;  4OFZ A;  3AA6 B;  3I9Y A;  2B1E A;  3KVB A;  1HX8 A;  2D5U A;  2QRX A;  1MIY A;  4AQF C;  4H9S E;  3AA7 B;  3KBT A;  4U74 A;  4PFP A;  2CLY C;  3RLF F;  3ZMV B;  5F5W A;  3QUJ A;  3P50 A;  3RIF A;  4CXY A;  3Q5W A;  2ODU A;  3T1Y T;  3FB2 A;  4DID B;  3P4P A;  2UXN B;  4P0A A;  5M4Y A;  2NP9 A;  3NRX A;  4JUY A;  3IEE A;  5EK4 A;  3JAE A;  3AVS A;  3RYH E;  2UXC T;  4Z90 A;  4YTM A;  4OYK A;  5C8Y E;  4CQI A;  2BG9 E;  1I94 T;  2V26 A;  4X1I E;  5LBM A;  2LSG A;  4EAH A;  1WRD A;  1Y64 B;  3RGL A;  2X51 A;  4ZOL E;  1XMO T;  4A5X A;  1HS7 A;  3V5U A;  5HAX A;  5ABF A;  2QVA A;  5AQT B;  1KFY A;  4ILB A;  2L8K A;  4PW8 A;  3DP7 A;  1AJ3 A;  3D0T A;  1XNQ T;  3VR8 A;  4TV8 E;  2D2S A;  3VRB A; 
#chains in the Genus database with same CATH homology
 3CQG B;  1D0Z A;  2CCQ A;  2W61 A;  2QGS A;  5HYA A;  5LGT B;  1FMV A;  1O3X A;  5HXC A;  2E8I A;  2CXL A;  3RRW A;  1BR2 A;  2LHR A;  4Z8X A;  5LG4 A;  2CWO A;  2Q9Q B;  3WAJ A;  3RH3 A;  3MJX A;  4EYU A;  4P09 A;  2NW7 A;  1FIO A;  2YEV C;  1KNZ A;  4GK5 E;  3CPZ A;  2M67 A;  2XHE B;  3ETV A;  2LM9 A;  3FHN A;  3N2G E;  4HKA A;  3MZK B;  4ISS A;  1UX4 A;  2EHO A;  2Z6E A;  4MHC A;  2WWU A;  3AAI A;  5H6Q B;  1KK7 A;  1D1B A;  4UVC B;  4C91 A;  3ZCJ A;  3ZC0 A;  4GYR A;  3PU3 A;  4DVD A;  4A56 A;  3CX8 B;  2VWA A;  5L3F B;  3ZLI A;  4DBR A;  3BQK A;  2NWB A;  2YU2 A;  1QSD A;  4IE5 A;  5HWX A;  5F3J A;  1WYB A;  3DTO A;  5LHG B;  5JR9 C;  2NTX A;  4IE7 A;  3GN5 B;  3QK6 A;  1MIV A;  2LEH A;  3O9X A;  3A5X A;  2C0S A;  5J1G A;  2WBL A;  1LRZ A;  2LSJ A;  4IE0 A;  1NWM X;  3B13 A;  4FI5 A;  4X20 E;  2N9D A;  3RRC A;  2J1D G;  5FNV E;  4HE8 A;  1QUU A;  2JQQ A;  5JRC B;  3OJA A;  1YKH B;  2DCF A;  4ERR A;  4F6R C;  5A1L A;  2BDE A;  2XAF B;  1FMW A;  2K5B B;  4ZI3 C;  5HWY A;  3LK2 B;  5LGN B;  3EVY A;  5L3E B;  3KV4 A;  3LBX A;  2JJ9 A;  4H63 H;  3H37 A;  3OKQ A;  4UF0 B;  2DWK A;  1EZ3 A;  2EHO D;  3UUM A;  4OK0 A;  2V7M A;  3ESL A;  3P8C D;  3E08 A;  3U3I A;  5TAO A;  4TUY E;  4QHO A;  4UV9 B;  4TN7 B;  3RPU A;  3R84 B;  3UUL A;  4L0R A;  4BJM A;  4OHF A;  4UXN B;  2W00 A;  3IBP A;  2C5I T;  5LHH B;  3ANW A;  2HPJ A;  2DWG A;  1LVK A;  2KND A;  3UUX B;  3ZYL A;  2G0U A;  4EZH A;  1B7T A;  1BR0 A;  1ZEE A;  2VL8 A;  3CQX C;  2IC6 A;  4O4I E;  2VKD A;  2CXD A;  2WM9 A;  4AKI A;  4HFV A;  2Y48 B;  1OWA A;  1HF8 A;  5JDQ A;  3JC6 D;  3I0O A;  4IIJ E;  3C4X A;  5LXT E;  2IC9 A;  5LCY A;  3V5S A;  3ZMZ B;  5IYZ E;  3C4Z A;  4E7Z A;  4PFO A;  2WAU A;  3RYI E;  3MAC A;  1MMA A;  5LP6 E;  4UV8 B;  2V7L A;  4FJO A;  3C51 A;  5ETW A;  4I43 B;  4PK6 A;  3ZMT B;  4HTE A;  4MFR A;  3EUH A;  2V7J A;  2E9X A;  2H3R A;  3K3N A;  3ZPO A;  2K9A A;  3FBZ A;  4TZ4 C;  2V1D B;  1LKX A;  4L5G A;  2KMF A;  3PUG A;  5JDH A;  1D1A A;  2XTL A;  5FY1 A;  4GIW A;  3FXE B;  4BJN A;  5LOV E;  2DNX A;  1T98 A;  2CE7 A;  2NW8 A;  2ZM0 A;  3N2K E;  1H7C A;  4WBO A;  4ZI7 E;  5JR9 B;  3PU8 A;  1MIW A;  3CX7 B;  4U72 A;  4QWN B;  3P7I A;  4QX8 B;  4TX5 A;  3BQL A;  1BR1 A;  5HXE A;  3AAE B;  4G2A A;  5HXS A;  1Z0P A;  3N9Q A;  4EXT A;  3HKB E;  3IF8 B;  5L3C B;  4XBF B;  2XUE A;  5E0O A;  1U4Q A;  4AKL A;  1G73 A;  4O4L E;  3KV9 A;  3LK4 2;  4O8S A;  2EHO C;  5GON E;  2LOP A;  2MYS A;  3N9M A;  4GYS A;  3DJB A;  3KBU A;  2CLY B;  3C64 A;  4ZI2 D;  5FP3 A;  5JRC A;  1VRB A;  2ZM2 A;  4ADZ A;  3HL6 A;  5JH7 E;  3C4W A;  3MA9 A;  2BVL A;  1VOM A;  2CXF A;  2E9X D;  3HKC E;  3MKD A;  3NZQ A;  4YHJ A;  1U5P A;  3F57 A;  4I50 E;  5LGU B;  4UIG A;  4BA9 A;  3N9O A;  4QKN A;  4ZS2 A;  5J2U E;  4UF0 A;  5DQW A;  3BQI A;  2XAJ B;  2LE8 A;  2Y8D A;  2OA5 A;  3VKG A;  3JC6 C;  1G8X A;  4GK0 E;  4JEH B;  5KX5 E;  4PAG A;  3GMI A;  2YU1 A;  4DO0 A;  1UCU A;  2H7O A;  2N1G A;  5L3B B;  2PJQ A;  2XAS B;  4H9R C;  3AB3 B;  4C90 A;  1MNE A;  4DND A;  1NAF A;  4KMC A;  3KV6 A;  4QX7 B;  4ANJ A;  2X9H A;  4YJ3 E;  4IE4 A;  5JDF A;  3UT5 E;  4ILU A;  2L9Q A;  3N5L A;  3LFM A;  3NZP A;  3F31 A;  4AI6 A;  1YW0 A;  5DAB A;  3SWH A;  2A72 A;  2JMH A;  2IW5 B;  2X9W A;  4H63 V;  3PUR A;  2C5J A;  4AXP A;  5FXX A;  4AKG A;  1HG2 A;  5KDM C;  4M1P A;  4WNK A;  5EK3 A;  2CEA A;  2RA1 A;  2X9Y A;  3GWH A;  3RYC E;  2X67 A;  3HA4 A;  4PJJ A;  5CA1 E;  3ZJ1 A;  5JDL A;  2VKO A;  4YJ2 E;  1WLX A;  3KIN B;  4AKH A;  3SOL A;  5JDN A;  2V7I A;  2V7K A;  5AFU L;  4OYJ A;  1SHZ C;  3AAA B;  3TKL B;  4WBN E;  4JEU B;  4ZI2 C;  2W0G A;  1MMG A;  2PBI A;  3CVR A;  4I55 E;  2LSI A;  4CI3 B;  2MOZ A;  2EHO B;  4I4T E;  2E9X C;  3Q5X A;  4YLH A;  1D0Y A;  2LHN A;  2X9X A;  2YIN A;  3FXD B;  2SPC A;  2X66 A;  5JRE A;  3EDV A;  3VU7 H;  3NBX X;  3ZCI A;  1WYC A;  3O1H A;  4AQF A;  3CKD A;  5LA6 E;  2VKJ A;  2XAH B;  2CMR A;  3WI3 A;  3L09 A;  3MXZ A;  4ZS3 A;  2KWH A;  2A2F X;  4KUM B;  2Q9Q A;  4MBQ A;  4CXX A;  3WAK A;  3CWZ B;  3J7Y q;  3VHL A;  4HEA A;  4H9Q C;  2GK9 A;  5F8P A;  5FXZ A;  2ES0 A;  1HTJ F;  2VB6 A;  1HFA A;  1UX5 A;  3AA1 B;  1S35 A;  2KIN B;  2VAS A;  3PUQ A;  4IHJ E;  3PE0 A;  3ZC1 A;  5LNK A;  2P9B A;  4PK4 A;  4H9N C;  2C5K T;  2ZMA A;  2LT3 A;  3OYX A;  1FEW A;  2X68 A;  1E1H B;  2W63 A;  3N9L A;  4DBQ A;  5LJM A;  1D0X A;  3RC8 A;  3R6N A;  4KBM B;  4IST A;  4J2C A;  1LVF A;  3S4U A;  5L3D B;  3LBX B;  2QA7 A;  5JDM A;  3ZEF B;  5ADX L;  2ODV A;  4JLE A;  2XQY A;  2PG8 A;  3GN5 A;  1D1C A;  1CUN A;  4UVB B;  2LSK A;  4H9O C;  4P0B A;  4B6X A;  2H7V C;  4ZHQ E;  4QXC B;  3HR0 A;  3CX6 B;  2HPL A;  5DQV A;  3KDS E;  2CM0 A;  3ANW B;  4O4H E;  2N2N A;  4QXH B;  2Q9Q D;  5FXV A;  5LYJ E;  5EZY E;  1YD8 G;  3J9X 1;  1SA0 E;  3H3A A;  3UFE A;  5JDG A;  5FY7 A;  3MK7 C;  2LOS A;  3N9P A;  5KMG P;  4MLK A;  3C98 B;  2DHR A;  3Q2M A;  3PTR B;  4IE6 A;  2VKH A;  3HKE E;  2Y6X A;  4UVA B;  3I0Q A;  2UXX B;  2KXP B;  1HCI A;  3E22 E;  3ZYK A;  3LJC A;  1IAP A;  2KZ7 B;  3LG7 A;  3I9W A;  4TV9 E;  2K24 A;  1US7 B;  2XAQ B;  3VKH A;  3IHR A;  4GOU A;  2RP4 A;  1ZKE A;  3GA8 A;  3ONX A;  4WW0 A;  5FXW A;  1MMN A;  5LBQ B;  5LJN A;  2E9X B;  3F2E A;  3Q9D A;  5FYM A;  5HXR A;  2A3D A;  4HGA A;  2VK9 A;  4EZ4 A;  2NW9 A;  4CI1 B;  5IHY A;  2WMO A;  4AQG A;  5L2L A;  3K3Q C;  5J2T E;  4PJM A;  4DMV A;  4EIW A;  5FMN A;  3K8P C;  2D0U A;  3UTK A;  2YK0 A;  3HI2 A;  2K48 A;  4EYY R;  4IGU A;  4UEL A;  4PNI A;  3E0Z A;  5H6R B;  1YKE B;  3I1A A;  3NRY A;  4X1K E;  3SS1 A;  2WMN A;  4CZZ B;  4IDZ A;  3O4X E;  3ETU A;  4MAL A;  1ZHC A;  3RKO A;  2NOX A;  3ZYM A;  3L3P A;  4OFZ A;  4YFS A;  2D0T A;  2PFV A;  3AA6 B;  1S94 A;  2I59 A;  4O2B E;  3I9Y A;  4NUU A;  3AA0 B;  4PJL A;  3T8O A;  2B1E A;  3KVB A;  1IJ5 A;  1MMD A;  3N9N A;  4XZC A;  1HX8 A;  3U78 A;  2D5U A;  2X0L B;  3PDY A;  3C50 A;  1MND A;  5FY0 A;  1MIY A;  4N78 D;  4AQF C;  4H9S E;  2W62 A;  2DLR A;  2JMK A;  3CML A;  5JR9 A;  3RC3 A;  3AA7 B;  3KBT A;  4U74 A;  4PFP A;  2CLY C;  1OXZ A;  2Q9Q C;  2WSS V;  4QXB B;  3ZN0 B;  3ZMV B;  2XAG B;  4H9P C;  3QUJ A;  2MTQ A;  2JRK A;  4HN9 A;  3M65 A;  3Q5W A;  3W15 B;  4CXY A;  2ODU A;  3FBL A;  1IJ6 A;  2IAK A;  2LJL A;  3UUN A;  2JPF A;  5CA0 E;  3FB2 A;  3PUA A;  3OYZ A;  5DJQ C;  2UXN B;  4P0A A;  4AKR B;  5M4Y A;  2NP9 A;  2NTY A;  1V9D A;  3ZMU B;  5L3G B;  3NRX A;  4JUY A;  2BVM A;  3BK9 A;  3IEE A;  5EK4 A;  4E7S A;  3AVS A;  3RYH E;  4O4J E;  1IZN B;  3SRZ A;  2KLQ A;  3PUS A;  4PJN A;  2BZB A;  4OYK A;  4PK5 A;  5C8Y E;  4X1Y E;  4V1A v;  1WR6 A;  4NUV A;  2CA5 A;  4CQI A;  2L3L A;  2KWI B;  3B57 A;  2V26 A;  4X1I E;  2KT9 A;  5LBM A;  2LSG A;  1X79 A;  2ACX A;  3K3O A;  3KVA A;  3AVR A;  4EAH A;  1WRD A;  5BMV E;  3RYF E;  1Y64 B;  2DI4 A;  2X51 A;  4ZOL E;  1ZV4 X;  3OBV E;  4BAY B;  3LK3 B;  4O2A E;  4ASK A;  4CXW A;  2ZM8 A;  1HS7 A;  3V5U A;  5HAX A;  3HKD E;  5LHI B;  3ZJ2 A;  4G63 A;  4DMW A;  4KP3 C;  3O1I A;  2L8K A;  4PW8 A;  4ZI3 D;  3DP7 A;  2MBG A;  2HH7 A;  1AJ3 A;  3KV5 A;  3D0T A;  4UEM A;  3ZN1 B;  3N2O A;  2LSY A;  4L9I A;  4K0U A;  3ZMS B;  5HXH A;  3O1J A;  3RX6 A;  4EOZ B;  4XAX B;  2CWY A;  3CQC B;  3EDU A;  1HG5 A;  4EB6 E;  4CI2 B;  2ZLY A;  5JVD E;  4TV8 E;  5CB4 E;  5EK2 A;  3QC9 A;  5JQG E;  3KFW X;  1BR4 A;  2D2S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...