5LNKA

Entire ovine respiratory complex i
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
115
structure length
115
Chain Sequence
b'MNLMITLLTNFTLATLLVTIAFWLPQLNVYSEKTSPYECGFDPMGSARLPFSMKFFLVAITFLLFDLEIALLLPLPWASQTTNLNTMLTMALLLIFLLAVSLAYEWTQKGLEWTE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitochondrial complex I, 51 kDa subunit
molecule tags Oxidoreductase
publication title Atomic structure of the entire mammalian mitochondrial complex I.
pubmed doi rcsb
total genus 32
structure length 115
sequence length 115
ec nomenclature ec 7.1.1.2: NADH:ubiquinone reductase (H(+)-translocating).
pdb deposition date 2016-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00507 Oxidored_q4 NADH-ubiquinone/plastoquinone oxidoreductase, chain 3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1610 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 5lnkA00
5LNKA 4HEAA 4HE8A 3RKOA
chains in the Genus database with same CATH superfamily
2LSKA 1SHZC 4ZS2A 3TLUA 2I59A 3UFGA 3LG7A 3H37A 1MIWA 3RKOA 4X65T 2XQ6A 1IBKT 1WYBA 1NEKA 3PUWF 4LMJA 3UFEA 4AQFA 3I1AA 1N32T 2QA7A 2X68A 3N2KE 4I50E 2J62A 3LBXA 3VKGA 3GN5A 2DLRA 4NPPA 1SE7A 4UXNB 1U4QA 2CLYC 4AIUA 1FJGT 2NWBA 3ETVA 3IF8B 5JR9A 2LSIA 3QUJA 3SFDA 4JI5T 1IBLT 4AI6A 1UUSA 3AEDA 2NTYA 4YHJA 1V9DA 1SA0E 4ANJA 2I6HA 3NKZA 4NXNT 2Q9QB 2KXPB 2LLYA 2VKHA 2CPTA 2K5BB 2BS3A 3OKQA 3QB5K 4IDPA 4CN6A 5KDMC 5FXXA 3CIRA 2LJLA 2HPJA 4KP3C 3VRBA 2XHEB 4QH4A 4YJ2E 4TV8E 2C5JA 4P1NA 3ZN1B 1G8XA 2E9XC 5ETWA 4LF6T 4CN1A 5C8YE 2HH7A 5LA6E 5L47A 4DR7T 2PFVA 2V6XA 3IHRA 3VU7H 2XAHB 2RA1A 2YU2A 4LMKA 2YOEA 3OTOT 3N5LA 4NXMT 2WS3A 3KFWX 4PW8A 3MXZA 4CI3B 2X0HA 2BZBA 2VWAA 4IE0A 2UUBT 3AEGA 3PTRB 4JUYA 4UV8B 2MPKA 5AQKB 5TAOA 4EZHA 1MNDA 3KV5A 3PUVF 4O4HE 5LG4A 5JDLA 4X64T 2B1EA 5AQNB 4H9NC 4DR5T 3PUSA 2XQ8A 1I94T 1G73A 2BVMA 1XDPA 5F3JA 5FXVA 5IYZE 5EK2A 2CLYB 5EZYE 3C4WA 3HKEE 5AQIB 3CQXC 3HI2A 2VK9A 3AE1A 3CQGB 3FXDB 4YSZA 3RKGA 4LF9T 2H7VC 3A7MA 3N9PA 5JDNA 4UELA 5FP3A 1KNPA 2CMRA 4Z91A 4PNIA 4F8HA 5AFUL 1OEDC 3IBPA 3LK2B 5DQWA 3UQ7A 3PU8A 1YKEB 3WI3A 2WZHA 3RRCA 3P4SA 4CN4A 4OFZA 3ZCJA 1QLBA 3AEBA 2XSBA 3TLWA 4U7YA 4B6XA 2IAKA 5AQRB 3IA3A 4MHCA 3ZN0B 3F31A 2VKDA 4HGAA 5HWXA 5JDGA 3Q2MA 1HR0T 4IDQA 3SS1A 4A56A 3ZCIA 3AEAA 4KHZF 4AKIA 4EEDA 2W66A 4IIJE 3RC3A 4JI8T 4U2ZA 3AA0B 1KNZA 4ZI3D 1EZ3A 3AE2A 2MBGA 4PK4A 5L3FB 4DIDB 3TLSA 2LEHA 3CWZB 4GYSA 5FXZA 4DV2T 5FMNA 3BQLA 2IC6A 2WY2A 2X9HA 3LJCA 5CGMA 5BR8T 2VB6A 5HWYA 4TZ4C 3RIUA 3T1YT 4JI0T 1XWMA 4DUZT 3HR0A 4YTMA 2KWIB 2XQ5A 4OHFA 3CX7B 1NAFA 1MMNA 2QVAA 1XNQT 3E08A 5IWAT 2X66A 1UX5A 4QXCB 2Y6XA 4ILAA 2BS4A 2KINB 3EAMA 3GWHA 3SOLA 4DMVA 4GKJT 2EHOD 3BK9A 3VKHA 3EDVA 2KWHA 4PFPA 4B3MT 2A2FX 1LKXA 3OBVE 4LMLA 4IHJE 5EK3A 4JEHB 4I0UA 1HNXT 3PURA 4H9SE 4B3TT 3AA7B 3AAIA 2PJQA 4P0BA 5JQGE 1L0VA 4H63H 3Q5DA 3SWHA 5LYJE 4I43B 4DR1T 4LF5T 4OK0A 3T8OA 3FB2A 5J0ZA 4IL4A 2E9XB 2Y8DA 5HEGA 4DR3T 1X79A 5KXJA 4CXXA 4QH1A 4EAHA 1M7KA 4I55E 4KBMB 4DV6T 3P4QA 2ZMAA 4EV6A 2LE8A 5LGTB 2PBIA 2KZ7B 3L39A 4K0UA 2PG8A 1UURA 3FBZA 1WCRA 4MBQA 2I0MA 4FI5A 1WYCA 5HXEA 4DUYT 1E7PA 3RIUC 2BDEA 4BJNA 1UX4A 4ZZBA 1MNEA 3ZMVB 5LNKA 1XZYA 2LHNA 1KFYA 4ILBA 4IE6A 4X1IE 4C91A 1HX8A 3E0ZA 2UUCT 2JIWA 1D1AA 3B13A 3OPCA 4EOZB 2E9XD 5H6QB 4EYYR 5LHGB 5AQQB 3GMIA 3N2OA 3NZQA 4PJMA 4ZI2D 1UGOA 2LKGA 2JQKA 3PV0F 4ZI7E 2UUAT 5FY1A 3AEFA 2OA5A 3Q9DA 3C50A 4AQGA 3VR9A 4BJMA 2VL8A 2IUBA 2YDSA 3M65A 2WBLA 5ADXL 2UXBT 3C4ZA 5LCYA 5DABA 2RP4A 2VASA 2W0GA 2V7LA 1BR1A 4HWHA 4J2CA 2VKOA 3ZYLA 4DNDA 4YTNA 3ZSSA 5FKYA 2QYWA 2JMKA 3HA4A 2X9WA 1KK7A 4IDOA 2W62A 3QOFA 3RRWA 3UUBA 1N33T 3AAAB 5KX5E 5L4EA 1WR0A 3OJAA 2NOXA 3FZLB 3KV4A 3RQUA 5C3JA 3PE0A 3I9WA 2LRKA 1YD8G 2CE7A 2NW8A 3CQCB 2MYSA 5L3DB 3OVUA 2BG9C 2Q9QA 2A9UA 5L3BB 4DR6T 3HKBE 2PTFA 4YHHT 1MMAA 2JQQA 2UXXB 3BQIA 4N78D 3MK7C 3MKDA 4P09A 4ZI2C 3FZFB 5CA0E 4EZ4A 4X62T 3LBXB 2V5CA 4NIQA 5ABEA 2CXFA 1YW0A 4HFDA 2YK0A 1XMOT 3AE8A 5BMVE 2H3RA 4AQYT 4LFCT 2LOSA 3UU5A 4ZEYA 3BQKA 3FZKB 3PUYF 2E5LT 4KUMB 3KBTA 2CCQA 1FMWA 2VVSA 2WWUA 3KBUA 2X9YA 3KVAA 1CHUA 3E22E 2QGSA 3OYZA 1Z8UA 4YY3T 2XAQB 4PFOA 4CQIA 3EABA 2EHOA 1S35A 5L2LA 2W00A 2M6BA 4XBFB 1JNRA 5FYMA 4H63V 1IJ5A 2Z6EA 3MACA 3CPZA 2BKNA 2DHRA 2AE9A 5AQMB 4EIWA 5FL1A 5JDMA 3L8RA 1D1BA 3H3AA 4AXPA 1MIVA 2YU1A 1OEDA 3UU6A 4YLHA 3ZC1A 5JDQA 2XAFB 4QHOA 3QNUA 3UT5E 1HFAA 2IMLA 4O8SA 3ZPOA 5JR9C 2K48A 4X66T 1IBMT 1LRZA 2OV9A 5JDFA 5JH7E 2EHOC 2L3LA 3O1JA 4TWFA 5L4HA 4ZOLE 1FEWA 5HXCA 3FHNA 1KF6A 4HFHA 5ABFA 4X1KE 5DJQC 4B3ST 1D1CA 2DCFA 3FBLA 5HEHA 5GONE 2EHOB 3ZEFB 2ZM2A 4PK5A 1W0BA 2FUPA 5AQVB 1BR4A 1HCIA 1FIOA 3Q5EA 2XQAA 4OYJA 2C5IT 2VQET 2E5VA 4TWDA 3Q5XA 4PK6A 4F6RC 3ZMUB 4HTEA 5CJ5A 2IW5B 2XQ3A 1WFDA 2FJEA 1LVKA 1W0AA 2ES0A 3AE7A 3ZKRA 4HN9A 4WYVA 5HYAA 5ABFB 2ZM6T 2NTXA 3DTOA 3N2GE 3ZT6A 1GQEA 5LBQB 4FJOA 2WM9A 4U2YA 3WAKA 4TNVA 3AXJA 2BKOA 5HEJA 3QB5A 1W09A 4P0AA 2CHOA 4QXBB 4HFBA 4G2AA 2NR4A 3SFEA 2VURA 1IAPA 1CUNA 2JRKA 5ABGA 5KMGP 5LP6E 3AA1B 4TV9E 4GKKT 4X20E 3RX6A 4LF4T 3ZYKA 3PUXF 2XASB 3RI5A 5AQUB 4QKNA 4DO0A 4DBQA 3ZC0A 4DV0T 2VL0A 4UR9A 4JI2T 2LSYA 4JYAT 1IJ6A 1HS7A 3UULA 3LK3B 3U78A 3P4RA 4K0KT 2M6IA 1OEDB 3O1HA 5L3EB 2CM0A 3RYFE 4HEAA 4HE8A 5LHHB 2FJAA 3AAEB 3AB3B 4ZS3A 2WU5A 3RYIE 4LFBT 4TNWA 4DV5T 3ESLA 3K3QC 5C2TA 4ILUA 3LDQB 2KLQA 2N1GA 3JCFA 5A1LA 4JI1T 4O2BE 4EGWA 1YKHB 2XQ7A 4PAGA 4PJJA 5LBMA 4CZZB 4EXTA 4DBRA 2JQHA 2VKJA 2BS2A 3I0QA 3UUNA 2UXDT 1XNRT 2J47A 3PJAA 5JDHA 1DU2A 4AKHA 1HX1B 2KMFA 1N34T 4JBWF 3O9XA 3N9OA 4GK0E 1ZEEA 2E8IA 2R6GF 2XAGB 1XMQT 3PU3A 2LM2A 3LFMA 2WQYA 4LF7T 3AEEA 2MTQA 5CB4E 4WBNE 3T1HT 1FMVA 5AQGB 5LGUB 3G06A 4DV1T 2YDQA 1MIYA 2KSRA 3DJBA 4QX8B 5AQFB 3AVSA 2CXDA 2VVNA 4YT0A 1D0XA 3MA9A 5LG3A 3P4WA 2WB5A 3AVRA 5LXTE 4L5GA 3CK6A 4ILCA 4HFVA 1J5ET 2CA5A 3F2EA 5HAXA 3ZT7A 4U31A 2XUEA 4WZXA 3C51A 2OLTA 2V1DB 3S4UA 2RPAA 3V5UA 1YXRA 2G0UA 5HXSA 3UTKA 4U74A 2FJDA 4U33A 3PJAJ 2XJ7A 4BAYB 5L3GB 3PUAA 2K3WA 4DR2T 2K9AA 3IEEA 2H88A 4YSYA 5M4YA 3ZYMA 5FNVE 5FXWA 3TKLB 2WMNA 2X0LB 5LMNT 3Q5WA 2XM2A 4XAXB 4H9OC 4JLEA 3ONJA 2DNXA 4DV7T 4TX5A 3P50A 4E7SA 2XQ4A 5AQTB 1ZHCA 3W15B 4H9QC 5AQJB 3NVOA 1HG5A 1IZNB 2V6YB 1J1JA 2BBHA 5JREA 5JRCA 5J2UE 5J1GA 3A8YC 5AQPB 5HCJA 3A5XA 1X9BA 2JPFA 5CFBA 4JI7T 1D0ZA 1QSDA 5AQLB 2NW9A 4MFRA 1I6ZA 3CVRA 3K3NA 4GK5E 3CX8B 4GIWA 5E0OA 3PUZF 3RYCE 2V5DA 3HL6A 4KI0F 1HG2A 3RIAA 4DMWA 1ZOYA 1E2AA 3ZMTB 4L9IA 1ZP0A 4NUVA 5HXHA 4CXYA 4O4JE 4BA9A 3LSVA 1VCSA 2SPCA 3H3MA 4JI6T 5FVKA 2NP9A 2HPLA 4LF8T 2A3DA 1VCTA 1Y01A 4OX9T 3LK42 2IIUA 4G63A 3KVBA 2N2NA 3R6NA 4EEBA 3J7Yq 3JAFA 5EK4A 3K1SA 5HEUA 2X67A 3R84B 5L3CB 1AJ3A 2W4XA 5LMUT 2L9QA 3RPUA 4JI3T 2MAWA 4UF0B 4EB6E 2DWKA 3FXEB 4ZHQE 3L09A 4U72A 2V7MA 3ABVA 4ASKA 4CI2B 3JAEA 5CA1E 1MMDA 2WCAA 4COFA 5JTGA 3TLTA 4ZZCA 4H9RC 4HFIA 4ISTA 4IL9A 3RC8A 2IDOB 2X9XA 2YINA 4GOUA 3B57A 3M3ZB 1KNRA 2BG9B 3NWIA 1NENA 3NBXX 4PJNA 4IGUA 5F5WA 3ZSTA 2BVLA 2W63A 3ANWB 1W9RA 3F57A 3K3OA 1QUUA 3KV6A 2HHHT 1WR6A 3NRYA 2WP9A 2JJ9A 5AQOB 3RF1A 4WBOA 3AE4A 4I4TE 5F8PA 3VHLA 4A98A 1Y64B 3ZMZB 2ACZA 1R8IA 1T7SA 2WSSV 3EI0A 3KDSE 4KMCA 2ZM0A 5HEOA 2JQ9A 3ZMSB 4V1Av 5J2TE 2UXCT 3P8CD 2XAJB 2V8SV 3KINB 3P7IA 4IE7A 4ZI3C 1O3XA 3O4XE 5LJMA 3OYXA 5FVLA 1XDOA 1T72A 4IDZA 2W67A 2V26A 3ONLC 2ODVA 4C90A 5IHYA 1HNWT 2CEAA 2XY8B 4B3RT 3MJXA 2ZLYA 5H6RB 2WDVA 3ZJ2A 4LFAT 2WWVA 2LM9A 2J1DG 3D0TA 2IHR1 1YQ3A 2JMHA 2LSGA 4O4IE 5FY0A 4AQFC 1M62A 2B76A 2LKHA 2WMOA 1HTJF 5LGNB 2V6YA 5JRCB 2X0YA 3UQ4A 3GN5B 3QC9A 3C98B 4AKGA 3UUXB 2WDQA 2A72A 2LHRA 4GYRA 2IC9A 2ZM8A 2ODUA 3I0OA 3UU3A 5LJNA 2MOZA 1LVFA 4KX6A 2UU9T 1OXZA 3N9QA 2BBJA 3HKCE 1YQ4A 2W61A 3PUQA 1OWAA 1ZV4X 3EVYA 4E7ZA 2CBJA 2Q9QC 1D0YA 1U5PA 3I9YA 4HFCA 3AE9A 4IREA 4Q25A 4U7IA 2ACXA 3ETUA 2BG9E 2Y48B 2XQ9A 3JC6C 3RH3A 2C0SA 4UF0A 1E1HB 4DVDA 1SUMB 1OEDE 4EYUA 3U3IA 2E9XA 3PDYA 4OYKA 4UV9B 4KHPT 2L8KA 4QWNB 3NZPA 4TWHA 2C5KT 2GK9A 3AECA 3JADA 4NUUA 3ZT5A 4HKAA 4TUYE 3K8PC 4YSXA 4JV5T 2NW7A 3EHZA 3J9X1 1Z0PA 4IE5A 4WNKA 1S94A 2QRXA 4PJLA 3FZMB 2CWOA 2XPKA 3NRXA 3SRZA 2E2AA 1MMGA 2BG9A 3ZJ1A 4UVBB 1VOMA 3AE3A 4ZXLA 4UEMA 4ADZA 2YDRA 5LB7B 4A5XA 5HCMA 2BKPA 5JVDE 3KV9A 1VRBA 2D5UA 4QX7B 4Z90A 3AE6A 3CX6B 2Q9QD 2F4VT 1JNZA 2CXLA 2N9DA 2V7KA 2XM1A 3ZLIA 1HF8A 3B5MA 4UIGA 3PUGA 4M1PA 3VR8A 2WAUA 3C64A 4HFEA 3TLVA 3DP7A 3N9NA 5IUXA 1H7CA 2YKSA 2YN6A 3UU4A 2FJBA 4AKRB 1NWMX 2D9DA 4O2AE 4CXWA 1US7B 2XZEA 3QK6A 1HNZT 4JI4T 4X5TA 3CMLA 4U3CA 1T8BA 2W2UA 5FL0A 2LSJA 5ABHA 4IE4A 4IDNA 2CHNA 2WU2A 3CKDA 1WRDA 4O4LE 4YFSA 5FY7A 3JC6D 4DR4T 1B7TA 4TN7B 2XTLA 3VRAA 1T98A 1WLXA 2J4GA 4QH5A 4UVAB 3UUMA 3V5SA 3P4PA 2CRBA 1UCUA 4HWFA 2XSAA 2LOPA 2D0TA 3FZHB 1BR2A 4YXDA 4L0RA 5JR9B 4YJ3E 3RLFF 3ANWA 3N9MA 4H9PC 4JEUB 4AISA 2X51A 2K24A 4MLKA 3RGLA 2UXNB 3AA6B 3C4XA 4HWCA 3AXJB 4MALA 4HWIB 4X1YE 4AKLA 4ERRA 4A97A 2CBIA 5LHIB 2DL1A 1N36T 3AE5A 2P9BA 1J5WA 3GA8A 3RIFA 4IT4A 3WAJA 4DV3T 3N9LA 2LRLA 4Z8XA 5DQVA 2H7OA 2LT3A 4XZCA 5AQHB 5LOVE 2CWYA 4CI1B 3UU8A 4DV4T 4QXHB 2KT9A 5AQSB 3HKDE 2KNDA 1KEYA 2WDRA 2HN1A 1ZKEA 3MZKB 2XQYA 2D2SA 2HN2A 4ISSA 4UVCB 5HXRA 2VQFT 3L3PA 2M67A 4HWDA 3EDUA 2YEVC 2AXDS 2D0UA 2WZIA 3O1IA 3RQWA 1BR0A 2V7JA 3RYHE 2DWGA 3EUHA 3ONXA 3RHWA 1UK5A 2FBWA 2H89A 3X1DA 2V7IA 4YTPA 2DI4A 4WW0A
chains in the Genus database with same CATH topology
2LSKA 1SHZC 4ZS2A 2I59A 3LG7A 3H37A 1MIWA 3RKOA 1WYBA 3UFEA 4AQFA 3I1AA 2QA7A 2X68A 3N2KE 4I50E 3LBXA 3VKGA 3GN5A 2DLRA 4UXNB 1U4QA 2CLYC 2NWBA 3ETVA 3IF8B 5JR9A 2LSIA 3QUJA 4AI6A 2NTYA 4YHJA 1V9DA 1SA0E 4ANJA 2Q9QB 2KXPB 2VKHA 2K5BB 3OKQA 5KDMC 5FXXA 2LJLA 2HPJA 4KP3C 2XHEB 4YJ2E 4TV8E 2C5JA 3ZN1B 1G8XA 2E9XC 5ETWA 5C8YE 2HH7A 5LA6E 2PFVA 3VU7H 3IHRA 2XAHB 2RA1A 2YU2A 3N5LA 3KFWX 4PW8A 3MXZA 2BZBA 2VWAA 4IE0A 3PTRB 4JUYA 4UV8B 4EZHA 5TAOA 1MNDA 3KV5A 4O4HE 5LG4A 5JDLA 2B1EA 4H9NC 3PUSA 1G73A 2BVMA 5F3JA 5FXVA 5IYZE 5EK2A 2CLYB 5EZYE 3C4WA 3HKEE 3CQXC 3HI2A 2VK9A 3CQGB 3FXDB 2H7VC 3N9PA 5JDNA 4UELA 5FP3A 2CMRA 5AFUL 4PNIA 3IBPA 3LK2B 5DQWA 3PU8A 1YKEB 3WI3A 3RRCA 4OFZA 3ZCJA 4B6XA 2IAKA 5HWXA 4MHCA 5JDGA 3ZN0B 3F31A 2VKDA 4HGAA 3Q2MA 3SS1A 4A56A 3ZCIA 4AKIA 3RC3A 4IIJE 3AA0B 1KNZA 4ZI3D 1EZ3A 2MBGA 4PK4A 2LEHA 3CWZB 4GYSA 5FXZA 5FMNA 3BQLA 2IC6A 2X9HA 3LJCA 2VB6A 5HWYA 4TZ4C 3HR0A 2KWIB 4OHFA 3CX7B 1NAFA 1MMNA 3E08A 2X66A 1UX5A 4QXCB 2Y6XA 3SOLA 4DMVA 2KINB 3GWHA 3VKHA 2EHOD 3BK9A 3EDVA 2KWHA 4PFPA 2A2FX 1LKXA 3OBVE 4IHJE 5EK3A 4JEHB 3PURA 4H9SE 3AA7B 3AAIA 2PJQA 4P0BA 5JQGE 4H63H 3SWHA 5LYJE 4I43B 4OK0A 3T8OA 3FB2A 2E9XB 2Y8DA 1X79A 4CXXA 4EAHA 4I55E 4KBMB 2ZMAA 2LE8A 5LGTB 2PBIA 2KZ7B 4K0UA 2PG8A 3FBZA 4MBQA 4FI5A 1WYCA 5HXEA 2BDEA 4BJNA 1UX4A 1MNEA 3ZMVB 5LNKA 2LHNA 4C91A 4IE6A 4X1IE 1HX8A 3E0ZA 1D1AA 3B13A 4EOZB 2E9XD 5H6QB 4EYYR 5LHGB 3GMIA 3N2OA 3NZQA 4PJMA 4ZI2D 4ZI7E 5FY1A 2OA5A 3Q9DA 3C50A 4AQGA 4BJMA 2VL8A 3M65A 2WBLA 5ADXL 3C4ZA 5LCYA 5DABA 2RP4A 2VASA 2W0GA 2V7LA 1BR1A 4J2CA 4DNDA 2VKOA 5L3FB 2JMKA 3HA4A 2X9WA 1KK7A 2W62A 3RRWA 3AAAB 5KX5E 3OJAA 2NOXA 3KV4A 3PE0A 3I9WA 1YD8G 2CE7A 2NW8A 3CQCB 2MYSA 5L3DB 2Q9QA 5L3BB 3HKBE 1MMAA 2JQQA 2UXXB 3BQIA 4N78D 3MK7C 3MKDA 4P09A 4ZI2C 5CA0E 4EZ4A 3LBXB 2CXFA 1YW0A 2YK0A 5BMVE 2H3RA 2LOSA 3BQKA 4KUMB 3KBTA 2CCQA 1FMWA 3KBUA 2WWUA 2X9YA 3KVAA 3E22E 2QGSA 3OYZA 2XAQB 4PFOA 4CQIA 2EHOA 1S35A 5L2LA 2W00A 4XBFB 5FYMA 4H63V 1IJ5A 2Z6EA 3MACA 3CPZA 2DHRA 4EIWA 5JDMA 1D1BA 3H3AA 4AXPA 1MIVA 2YU1A 3ZC1A 4YLHA 5JDQA 2XAFB 4QHOA 3ZPOA 3UT5E 1HFAA 4O8SA 5JR9C 2K48A 1LRZA 5JDFA 5JH7E 2EHOC 2L3LA 3O1JA 4ZOLE 1FEWA 5HXCA 3FHNA 4X1KE 5DJQC 1D1CA 2DCFA 3FBLA 5GONE 2EHOB 3ZEFB 2ZM2A 4PK5A 1BR4A 1HCIA 1FIOA 4OYJA 2C5IT 3Q5XA 4PK6A 4F6RC 3ZMUB 4HTEA 2IW5B 1LVKA 2ES0A 4HN9A 5HYAA 2NTXA 3DTOA 3N2GE 5LBQB 4FJOA 2WM9A 3WAKA 4P0AA 4QXBB 4G2AA 1IAPA 1CUNA 2JRKA 5KMGP 5LP6E 3AA1B 4TV9E 4X20E 3RX6A 3ZYKA 2XASB 4DO0A 4QKNA 4DBQA 3ZC0A 2LSYA 1IJ6A 1HS7A 3UULA 3LK3B 3U78A 3O1HA 5L3EB 2CM0A 3RYFE 4HEAA 4HE8A 5LHHB 3AAEB 3AB3B 4ZS3A 3RYIE 3ESLA 3K3QC 4ILUA 2KLQA 2N1GA 5A1LA 4O2BE 1YKHB 4PAGA 4PJJA 5LBMA 4CZZB 4EXTA 4DBRA 2VKJA 3I0QA 3UUNA 5JDHA 4AKHA 2KMFA 3O9XA 3N9OA 4GK0E 1ZEEA 2E8IA 2XAGB 3PU3A 3LFMA 2MTQA 5CB4E 4WBNE 1FMVA 5LGUB 1MIYA 3DJBA 4QX8B 3AVSA 2CXDA 1D0XA 3MA9A 3AVRA 5LXTE 4L5GA 4HFVA 2CA5A 3F2EA 5HAXA 2XUEA 3S4UA 3C51A 2V1DB 3V5UA 2G0UA 5HXSA 3UTKA 4U74A 4BAYB 5L3GB 3PUAA 2K9AA 3IEEA 5M4YA 3ZYMA 5FNVE 5FXWA 3TKLB 2WMNA 2X0LB 3Q5WA 4XAXB 4H9OC 4JLEA 2DNXA 4TX5A 4E7SA 1ZHCA 3W15B 4H9QC 5JREA 1HG5A 1IZNB 5JRCA 5J2UE 5J1GA 3A5XA 2JPFA 1D0ZA 1QSDA 2NW9A 4MFRA 3CVRA 3K3NA 4GK5E 3CX8B 4GIWA 5E0OA 3RYCE 3HL6A 4DMWA 1HG2A 3ZMTB 4L9IA 4NUVA 4CXYA 4O4JE 4BA9A 2SPCA 2NP9A 2HPLA 2A3DA 3LK42 4G63A 3J7Yq 3KVBA 2N2NA 3R6NA 5EK4A 3R84B 5L3CB 2X67A 1AJ3A 2L9QA 3RPUA 4UF0B 4EB6E 2DWKA 3FXEB 4ZHQE 3L09A 4U72A 2V7MA 4ASKA 4CI2B 5CA1E 1MMDA 4H9RC 4ISTA 3RC8A 2X9XA 2YINA 4GOUA 3B57A 4PJNA 3NBXX 4IGUA 2BVLA 2W63A 3ANWB 3F57A 3K3OA 1QUUA 3KV6A 1WR6A 3NRYA 2JJ9A 4WBOA 4I4TE 5F8PA 3VHLA 1Y64B 3ZMZB 2WSSV 3KDSE 4KMCA 2ZM0A 3ZMSB 4V1Av 5J2TE 3P8CD 2XAJB 3KINB 4IE7A 3P7IA 4ZI3C 1O3XA 3O4XE 5LJMA 3OYXA 4IDZA 2V26A 2ODVA 4C90A 5IHYA 2CEAA 3MJXA 2ZLYA 5H6RB 3ZJ2A 2LM9A 2J1DG 3D0TA 2JMHA 2LSGA 4O4IE 5FY0A 4AQFC 2WMOA 5LGNB 1HTJF 5JRCB 3GN5B 3QC9A 3C98B 4AKGA 3UUXB 2A72A 2LHRA 4GYRA 2IC9A 2ZM8A 2ODUA 3I0OA 5LJNA 2MOZA 1LVFA 1OXZA 3N9QA 3HKCE 3PUQA 2W61A 4E7ZA 5HXHA 1OWAA 1ZV4X 3EVYA 2Q9QC 1D0YA 1U5PA 3I9YA 4CI3B 2ACXA 3ETUA 3JC6C 2Y48B 3RH3A 4DVDA 2C0SA 4UF0A 1E1HB 4EYUA 3U3IA 2E9XA 3PDYA 4OYKA 4UV9B 2L8KA 4QWNB 3NZPA 2C5KT 2GK9A 4NUUA 4HKAA 4TUYE 3K8PC 2NW7A 3J9X1 1Z0PA 4IE5A 4WNKA 1S94A 4PJLA 2CWOA 3NRXA 3SRZA 1MMGA 3ZJ1A 4UVBB 1VOMA 4UEMA 4ADZA 5JVDE 3KV9A 1VRBA 2D5UA 4QX7B 3CX6B 2Q9QD 3ZLIA 2CXLA 2N9DA 2V7KA 1HF8A 4UIGA 3PUGA 4M1PA 2WAUA 3C64A 3DP7A 3N9NA 1H7CA 4AKRB 4CXWA 1NWMX 4O2AE 1US7B 3QK6A 3CMLA 2LSJA 4IE4A 3CKDA 4O4LE 1WRDA 4YFSA 5FY7A 3JC6D 1B7TA 4TN7B 2XTLA 1T98A 1WLXA 4UVAB 3UUMA 3V5SA 1UCUA 2LOPA 2D0TA 1BR2A 4L0RA 5JR9B 4YJ3E 3ANWA 3N9MA 4H9PC 4JEUB 2X51A 2K24A 4MLKA 2UXNB 3AA6B 3C4XA 4ERRA 4MALA 4X1YE 4AKLA 5LHIB 2P9BA 3GA8A 3WAJA 3N9LA 5LOVE 4Z8XA 5DQVA 2H7OA 2LT3A 4XZCA 2CWYA 4CI1B 4QXHB 2KT9A 3HKDE 2KNDA 3MZKB 3ZYLA 1ZKEA 2XQYA 2D2SA 4ISSA 5HXRA 4UVCB 3L3PA 2M67A 3EDUA 2YEVC 2D0UA 3O1IA 1BR0A 2V7JA 3RYHE 2DWGA 3EUHA 3ONXA 2V7IA 2DI4A 4WW0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LNK A;  4HEA A;  4HE8 A;  3RKO A; 
#chains in the Genus database with same CATH topology
 2LSK A;  1SHZ C;  4ZS2 A;  3TLU A;  2I59 A;  3UFG A;  3LG7 A;  3H37 A;  1MIW A;  3RKO A;  4X65 T;  2XQ6 A;  1IBK T;  1WYB A;  1NEK A;  3PUW F;  4LMJ A;  3UFE A;  4AQF A;  3I1A A;  1N32 T;  2QA7 A;  2X68 A;  3N2K E;  4I50 E;  2J62 A;  3LBX A;  3VKG A;  3GN5 A;  2DLR A;  4NPP A;  1SE7 A;  4UXN B;  1U4Q A;  2CLY C;  4AIU A;  1FJG T;  2NWB A;  3ETV A;  3IF8 B;  5JR9 A;  2LSI A;  3QUJ A;  3SFD A;  4JI5 T;  1IBL T;  4AI6 A;  1UUS A;  3AED A;  2NTY A;  4YHJ A;  1V9D A;  1SA0 E;  4ANJ A;  2I6H A;  3NKZ A;  4NXN T;  2Q9Q B;  2KXP B;  2LLY A;  2VKH A;  2CPT A;  2K5B B;  2BS3 A;  3OKQ A;  3QB5 K;  4IDP A;  4CN6 A;  5KDM C;  5FXX A;  3CIR A;  2LJL A;  2HPJ A;  4KP3 C;  3VRB A;  2XHE B;  4QH4 A;  4YJ2 E;  4TV8 E;  2C5J A;  4P1N A;  3ZN1 B;  1G8X A;  2E9X C;  5ETW A;  4LF6 T;  4CN1 A;  5C8Y E;  2HH7 A;  5LA6 E;  5L47 A;  4DR7 T;  2PFV A;  2V6X A;  3IHR A;  3VU7 H;  2XAH B;  2RA1 A;  2YU2 A;  4LMK A;  2YOE A;  3OTO T;  3N5L A;  4NXM T;  2WS3 A;  3KFW X;  4PW8 A;  3MXZ A;  4CI3 B;  2X0H A;  2BZB A;  2VWA A;  4IE0 A;  2UUB T;  3AEG A;  3PTR B;  4JUY A;  4UV8 B;  2MPK A;  5AQK B;  5TAO A;  4EZH A;  1MND A;  3KV5 A;  3PUV F;  4O4H E;  5LG4 A;  5JDL A;  4X64 T;  2B1E A;  5AQN B;  4H9N C;  4DR5 T;  3PUS A;  2XQ8 A;  1I94 T;  1G73 A;  2BVM A;  1XDP A;  5F3J A;  5FXV A;  5IYZ E;  5EK2 A;  2CLY B;  5EZY E;  3C4W A;  3HKE E;  5AQI B;  3CQX C;  3HI2 A;  2VK9 A;  3AE1 A;  3CQG B;  3FXD B;  4YSZ A;  3RKG A;  4LF9 T;  2H7V C;  3A7M A;  3N9P A;  5JDN A;  4UEL A;  5FP3 A;  1KNP A;  2CMR A;  4Z91 A;  4PNI A;  4F8H A;  5AFU L;  1OED C;  3IBP A;  3LK2 B;  5DQW A;  3UQ7 A;  3PU8 A;  1YKE B;  3WI3 A;  2WZH A;  3RRC A;  3P4S A;  4CN4 A;  4OFZ A;  3ZCJ A;  1QLB A;  3AEB A;  2XSB A;  3TLW A;  4U7Y A;  4B6X A;  2IAK A;  5AQR B;  3IA3 A;  4MHC A;  3ZN0 B;  3F31 A;  2VKD A;  4HGA A;  5HWX A;  5JDG A;  3Q2M A;  1HR0 T;  4IDQ A;  3SS1 A;  4A56 A;  3ZCI A;  3AEA A;  4KHZ F;  4AKI A;  4EED A;  2W66 A;  4IIJ E;  3RC3 A;  4JI8 T;  4U2Z A;  3AA0 B;  1KNZ A;  4ZI3 D;  1EZ3 A;  3AE2 A;  2MBG A;  4PK4 A;  5L3F B;  4DID B;  3TLS A;  2LEH A;  3CWZ B;  4GYS A;  5FXZ A;  4DV2 T;  5FMN A;  3BQL A;  2IC6 A;  2WY2 A;  2X9H A;  3LJC A;  5CGM A;  5BR8 T;  2VB6 A;  5HWY A;  4TZ4 C;  3RIU A;  3T1Y T;  4JI0 T;  1XWM A;  4DUZ T;  3HR0 A;  4YTM A;  2KWI B;  2XQ5 A;  4OHF A;  3CX7 B;  1NAF A;  1MMN A;  2QVA A;  1XNQ T;  3E08 A;  5IWA T;  2X66 A;  1UX5 A;  4QXC B;  2Y6X A;  4ILA A;  2BS4 A;  2KIN B;  3EAM A;  3GWH A;  3SOL A;  4DMV A;  4GKJ T;  2EHO D;  3BK9 A;  3VKH A;  3EDV A;  2KWH A;  4PFP A;  4B3M T;  2A2F X;  1LKX A;  3OBV E;  4LML A;  4IHJ E;  5EK3 A;  4JEH B;  4I0U A;  1HNX T;  3PUR A;  4H9S E;  4B3T T;  3AA7 B;  3AAI A;  2PJQ A;  4P0B A;  5JQG E;  1L0V A;  4H63 H;  3Q5D A;  3SWH A;  5LYJ E;  4I43 B;  4DR1 T;  4LF5 T;  4OK0 A;  3T8O A;  3FB2 A;  5J0Z A;  4IL4 A;  2E9X B;  2Y8D A;  5HEG A;  4DR3 T;  1X79 A;  5KXJ A;  4CXX A;  4QH1 A;  4EAH A;  1M7K A;  4I55 E;  4KBM B;  4DV6 T;  3P4Q A;  2ZMA A;  4EV6 A;  2LE8 A;  5LGT B;  2PBI A;  2KZ7 B;  3L39 A;  4K0U A;  2PG8 A;  1UUR A;  3FBZ A;  1WCR A;  4MBQ A;  2I0M A;  4FI5 A;  1WYC A;  5HXE A;  4DUY T;  1E7P A;  3RIU C;  2BDE A;  4BJN A;  1UX4 A;  4ZZB A;  1MNE A;  3ZMV B;  5LNK A;  1XZY A;  2LHN A;  1KFY A;  4ILB A;  4IE6 A;  4X1I E;  4C91 A;  1HX8 A;  3E0Z A;  2UUC T;  2JIW A;  1D1A A;  3B13 A;  3OPC A;  4EOZ B;  2E9X D;  5H6Q B;  4EYY R;  5LHG B;  5AQQ B;  3GMI A;  3N2O A;  3NZQ A;  4PJM A;  4ZI2 D;  1UGO A;  2LKG A;  2JQK A;  3PV0 F;  4ZI7 E;  2UUA T;  5FY1 A;  3AEF A;  2OA5 A;  3Q9D A;  3C50 A;  4AQG A;  3VR9 A;  4BJM A;  2VL8 A;  2IUB A;  2YDS A;  3M65 A;  2WBL A;  5ADX L;  2UXB T;  3C4Z A;  5LCY A;  5DAB A;  2RP4 A;  2VAS A;  2W0G A;  2V7L A;  1BR1 A;  4HWH A;  4J2C A;  2VKO A;  3ZYL A;  4DND A;  4YTN A;  3ZSS A;  5FKY A;  2QYW A;  2JMK A;  3HA4 A;  2X9W A;  1KK7 A;  4IDO A;  2W62 A;  3QOF A;  3RRW A;  3UUB A;  1N33 T;  3AAA B;  5KX5 E;  5L4E A;  1WR0 A;  3OJA A;  2NOX A;  3FZL B;  3KV4 A;  3RQU A;  5C3J A;  3PE0 A;  3I9W A;  2LRK A;  1YD8 G;  2CE7 A;  2NW8 A;  3CQC B;  2MYS A;  5L3D B;  3OVU A;  2BG9 C;  2Q9Q A;  2A9U A;  5L3B B;  4DR6 T;  3HKB E;  2PTF A;  4YHH T;  1MMA A;  2JQQ A;  2UXX B;  3BQI A;  4N78 D;  3MK7 C;  3MKD A;  4P09 A;  4ZI2 C;  3FZF B;  5CA0 E;  4EZ4 A;  4X62 T;  3LBX B;  2V5C A;  4NIQ A;  5ABE A;  2CXF A;  1YW0 A;  4HFD A;  2YK0 A;  1XMO T;  3AE8 A;  5BMV E;  2H3R A;  4AQY T;  4LFC T;  2LOS A;  3UU5 A;  4ZEY A;  3BQK A;  3FZK B;  3PUY F;  2E5L T;  4KUM B;  3KBT A;  2CCQ A;  1FMW A;  2VVS A;  2WWU A;  3KBU A;  2X9Y A;  3KVA A;  1CHU A;  3E22 E;  2QGS A;  3OYZ A;  1Z8U A;  4YY3 T;  2XAQ B;  4PFO A;  4CQI A;  3EAB A;  2EHO A;  1S35 A;  5L2L A;  2W00 A;  2M6B A;  4XBF B;  1JNR A;  5FYM A;  4H63 V;  1IJ5 A;  2Z6E A;  3MAC A;  3CPZ A;  2BKN A;  2DHR A;  2AE9 A;  5AQM B;  4EIW A;  5FL1 A;  5JDM A;  3L8R A;  1D1B A;  3H3A A;  4AXP A;  1MIV A;  2YU1 A;  1OED A;  3UU6 A;  4YLH A;  3ZC1 A;  5JDQ A;  2XAF B;  4QHO A;  3QNU A;  3UT5 E;  1HFA A;  2IML A;  4O8S A;  3ZPO A;  5JR9 C;  2K48 A;  4X66 T;  1IBM T;  1LRZ A;  2OV9 A;  5JDF A;  5JH7 E;  2EHO C;  2L3L A;  3O1J A;  4TWF A;  5L4H A;  4ZOL E;  1FEW A;  5HXC A;  3FHN A;  1KF6 A;  4HFH A;  5ABF A;  4X1K E;  5DJQ C;  4B3S T;  1D1C A;  2DCF A;  3FBL A;  5HEH A;  5GON E;  2EHO B;  3ZEF B;  2ZM2 A;  4PK5 A;  1W0B A;  2FUP A;  5AQV B;  1BR4 A;  1HCI A;  1FIO A;  3Q5E A;  2XQA A;  4OYJ A;  2C5I T;  2VQE T;  2E5V A;  4TWD A;  3Q5X A;  4PK6 A;  4F6R C;  3ZMU B;  4HTE A;  5CJ5 A;  2IW5 B;  2XQ3 A;  1WFD A;  2FJE A;  1LVK A;  1W0A A;  2ES0 A;  3AE7 A;  3ZKR A;  4HN9 A;  4WYV A;  5HYA A;  5ABF B;  2ZM6 T;  2NTX A;  3DTO A;  3N2G E;  3ZT6 A;  1GQE A;  5LBQ B;  4FJO A;  2WM9 A;  4U2Y A;  3WAK A;  4TNV A;  3AXJ A;  2BKO A;  5HEJ A;  3QB5 A;  1W09 A;  4P0A A;  2CHO A;  4QXB B;  4HFB A;  4G2A A;  2NR4 A;  3SFE A;  2VUR A;  1IAP A;  1CUN A;  2JRK A;  5ABG A;  5KMG P;  5LP6 E;  3AA1 B;  4TV9 E;  4GKK T;  4X20 E;  3RX6 A;  4LF4 T;  3ZYK A;  3PUX F;  2XAS B;  3RI5 A;  5AQU B;  4QKN A;  4DO0 A;  4DBQ A;  3ZC0 A;  4DV0 T;  2VL0 A;  4UR9 A;  4JI2 T;  2LSY A;  4JYA T;  1IJ6 A;  1HS7 A;  3UUL A;  3LK3 B;  3U78 A;  3P4R A;  4K0K T;  2M6I A;  1OED B;  3O1H A;  5L3E B;  2CM0 A;  3RYF E;  4HEA A;  4HE8 A;  5LHH B;  2FJA A;  3AAE B;  3AB3 B;  4ZS3 A;  2WU5 A;  3RYI E;  4LFB T;  4TNW A;  4DV5 T;  3ESL A;  3K3Q C;  5C2T A;  4ILU A;  3LDQ B;  2KLQ A;  2N1G A;  3JCF A;  5A1L A;  4JI1 T;  4O2B E;  4EGW A;  1YKH B;  2XQ7 A;  4PAG A;  4PJJ A;  5LBM A;  4CZZ B;  4EXT A;  4DBR A;  2JQH A;  2VKJ A;  2BS2 A;  3I0Q A;  3UUN A;  2UXD T;  1XNR T;  2J47 A;  3PJA A;  5JDH A;  1DU2 A;  4AKH A;  1HX1 B;  2KMF A;  1N34 T;  4JBW F;  3O9X A;  3N9O A;  4GK0 E;  1ZEE A;  2E8I A;  2R6G F;  2XAG B;  1XMQ T;  3PU3 A;  2LM2 A;  3LFM A;  2WQY A;  4LF7 T;  3AEE A;  2MTQ A;  5CB4 E;  4WBN E;  3T1H T;  1FMV A;  5AQG B;  5LGU B;  3G06 A;  4DV1 T;  2YDQ A;  1MIY A;  2KSR A;  3DJB A;  4QX8 B;  5AQF B;  3AVS A;  2CXD A;  2VVN A;  4YT0 A;  1D0X A;  3MA9 A;  5LG3 A;  3P4W A;  2WB5 A;  3AVR A;  5LXT E;  4L5G A;  3CK6 A;  4ILC A;  4HFV A;  1J5E T;  2CA5 A;  3F2E A;  5HAX A;  3ZT7 A;  4U31 A;  2XUE A;  4WZX A;  3C51 A;  2OLT A;  2V1D B;  3S4U A;  2RPA A;  3V5U A;  1YXR A;  2G0U A;  5HXS A;  3UTK A;  4U74 A;  2FJD A;  4U33 A;  3PJA J;  2XJ7 A;  4BAY B;  5L3G B;  3PUA A;  2K3W A;  4DR2 T;  2K9A A;  3IEE A;  2H88 A;  4YSY A;  5M4Y A;  3ZYM A;  5FNV E;  5FXW A;  3TKL B;  2WMN A;  2X0L B;  5LMN T;  3Q5W A;  2XM2 A;  4XAX B;  4H9O C;  4JLE A;  3ONJ A;  2DNX A;  4DV7 T;  4TX5 A;  3P50 A;  4E7S A;  2XQ4 A;  5AQT B;  1ZHC A;  3W15 B;  4H9Q C;  5AQJ B;  3NVO A;  1HG5 A;  1IZN B;  2V6Y B;  1J1J A;  2BBH A;  5JRE A;  5JRC A;  5J2U E;  5J1G A;  3A8Y C;  5AQP B;  5HCJ A;  3A5X A;  1X9B A;  2JPF A;  5CFB A;  4JI7 T;  1D0Z A;  1QSD A;  5AQL B;  2NW9 A;  4MFR A;  1I6Z A;  3CVR A;  3K3N A;  4GK5 E;  3CX8 B;  4GIW A;  5E0O A;  3PUZ F;  3RYC E;  2V5D A;  3HL6 A;  4KI0 F;  1HG2 A;  3RIA A;  4DMW A;  1ZOY A;  1E2A A;  3ZMT B;  4L9I A;  1ZP0 A;  4NUV A;  5HXH A;  4CXY A;  4O4J E;  4BA9 A;  3LSV A;  1VCS A;  2SPC A;  3H3M A;  4JI6 T;  5FVK A;  2NP9 A;  2HPL A;  4LF8 T;  2A3D A;  1VCT A;  1Y01 A;  4OX9 T;  3LK4 2;  2IIU A;  4G63 A;  3KVB A;  2N2N A;  3R6N A;  4EEB A;  3J7Y q;  3JAF A;  5EK4 A;  3K1S A;  5HEU A;  2X67 A;  3R84 B;  5L3C B;  1AJ3 A;  2W4X A;  5LMU T;  2L9Q A;  3RPU A;  4JI3 T;  2MAW A;  4UF0 B;  4EB6 E;  2DWK A;  3FXE B;  4ZHQ E;  3L09 A;  4U72 A;  2V7M A;  3ABV A;  4ASK A;  4CI2 B;  3JAE A;  5CA1 E;  1MMD A;  2WCA A;  4COF A;  5JTG A;  3TLT A;  4ZZC A;  4H9R C;  4HFI A;  4IST A;  4IL9 A;  3RC8 A;  2IDO B;  2X9X A;  2YIN A;  4GOU A;  3B57 A;  3M3Z B;  1KNR A;  2BG9 B;  3NWI A;  1NEN A;  3NBX X;  4PJN A;  4IGU A;  5F5W A;  3ZST A;  2BVL A;  2W63 A;  3ANW B;  1W9R A;  3F57 A;  3K3O A;  1QUU A;  3KV6 A;  2HHH T;  1WR6 A;  3NRY A;  2WP9 A;  2JJ9 A;  5AQO B;  3RF1 A;  4WBO A;  3AE4 A;  4I4T E;  5F8P A;  3VHL A;  4A98 A;  1Y64 B;  3ZMZ B;  2ACZ A;  1R8I A;  1T7S A;  2WSS V;  3EI0 A;  3KDS E;  4KMC A;  2ZM0 A;  5HEO A;  2JQ9 A;  3ZMS B;  4V1A v;  5J2T E;  2UXC T;  3P8C D;  2XAJ B;  2V8S V;  3KIN B;  3P7I A;  4IE7 A;  4ZI3 C;  1O3X A;  3O4X E;  5LJM A;  3OYX A;  5FVL A;  1XDO A;  1T72 A;  4IDZ A;  2W67 A;  2V26 A;  3ONL C;  2ODV A;  4C90 A;  5IHY A;  1HNW T;  2CEA A;  2XY8 B;  4B3R T;  3MJX A;  2ZLY A;  5H6R B;  2WDV A;  3ZJ2 A;  4LFA T;  2WWV A;  2LM9 A;  2J1D G;  3D0T A;  2IHR 1;  1YQ3 A;  2JMH A;  2LSG A;  4O4I E;  5FY0 A;  4AQF C;  1M62 A;  2B76 A;  2LKH A;  2WMO A;  1HTJ F;  5LGN B;  2V6Y A;  5JRC B;  2X0Y A;  3UQ4 A;  3GN5 B;  3QC9 A;  3C98 B;  4AKG A;  3UUX B;  2WDQ A;  2A72 A;  2LHR A;  4GYR A;  2IC9 A;  2ZM8 A;  2ODU A;  3I0O A;  3UU3 A;  5LJN A;  2MOZ A;  1LVF A;  4KX6 A;  2UU9 T;  1OXZ A;  3N9Q A;  2BBJ A;  3HKC E;  1YQ4 A;  2W61 A;  3PUQ A;  1OWA A;  1ZV4 X;  3EVY A;  4E7Z A;  2CBJ A;  2Q9Q C;  1D0Y A;  1U5P A;  3I9Y A;  4HFC A;  3AE9 A;  4IRE A;  4Q25 A;  4U7I A;  2ACX A;  3ETU A;  2BG9 E;  2Y48 B;  2XQ9 A;  3JC6 C;  3RH3 A;  2C0S A;  4UF0 A;  1E1H B;  4DVD A;  1SUM B;  1OED E;  4EYU A;  3U3I A;  2E9X A;  3PDY A;  4OYK A;  4UV9 B;  4KHP T;  2L8K A;  4QWN B;  3NZP A;  4TWH A;  2C5K T;  2GK9 A;  3AEC A;  3JAD A;  4NUU A;  3ZT5 A;  4HKA A;  4TUY E;  3K8P C;  4YSX A;  4JV5 T;  2NW7 A;  3EHZ A;  3J9X 1;  1Z0P A;  4IE5 A;  4WNK A;  1S94 A;  2QRX A;  4PJL A;  3FZM B;  2CWO A;  2XPK A;  3NRX A;  3SRZ A;  2E2A A;  1MMG A;  2BG9 A;  3ZJ1 A;  4UVB B;  1VOM A;  3AE3 A;  4ZXL A;  4UEM A;  4ADZ A;  2YDR A;  5LB7 B;  4A5X A;  5HCM A;  2BKP A;  5JVD E;  3KV9 A;  1VRB A;  2D5U A;  4QX7 B;  4Z90 A;  3AE6 A;  3CX6 B;  2Q9Q D;  2F4V T;  1JNZ A;  2CXL A;  2N9D A;  2V7K A;  2XM1 A;  3ZLI A;  1HF8 A;  3B5M A;  4UIG A;  3PUG A;  4M1P A;  3VR8 A;  2WAU A;  3C64 A;  4HFE A;  3TLV A;  3DP7 A;  3N9N A;  5IUX A;  1H7C A;  2YKS A;  2YN6 A;  3UU4 A;  2FJB A;  4AKR B;  1NWM X;  2D9D A;  4O2A E;  4CXW A;  1US7 B;  2XZE A;  3QK6 A;  1HNZ T;  4JI4 T;  4X5T A;  3CML A;  4U3C A;  1T8B A;  2W2U A;  5FL0 A;  2LSJ A;  5ABH A;  4IE4 A;  4IDN A;  2CHN A;  2WU2 A;  3CKD A;  1WRD A;  4O4L E;  4YFS A;  5FY7 A;  3JC6 D;  4DR4 T;  1B7T A;  4TN7 B;  2XTL A;  3VRA A;  1T98 A;  1WLX A;  2J4G A;  4QH5 A;  4UVA B;  3UUM A;  3V5S A;  3P4P A;  2CRB A;  1UCU A;  4HWF A;  2XSA A;  2LOP A;  2D0T A;  3FZH B;  1BR2 A;  4YXD A;  4L0R A;  5JR9 B;  4YJ3 E;  3RLF F;  3ANW A;  3N9M A;  4H9P C;  4JEU B;  4AIS A;  2X51 A;  2K24 A;  4MLK A;  3RGL A;  2UXN B;  3AA6 B;  3C4X A;  4HWC A;  3AXJ B;  4MAL A;  4HWI B;  4X1Y E;  4AKL A;  4ERR A;  4A97 A;  2CBI A;  5LHI B;  2DL1 A;  1N36 T;  3AE5 A;  2P9B A;  1J5W A;  3GA8 A;  3RIF A;  4IT4 A;  3WAJ A;  4DV3 T;  3N9L A;  2LRL A;  4Z8X A;  5DQV A;  2H7O A;  2LT3 A;  4XZC A;  5AQH B;  5LOV E;  2CWY A;  4CI1 B;  3UU8 A;  4DV4 T;  4QXH B;  2KT9 A;  5AQS B;  3HKD E;  2KND A;  1KEY A;  2WDR A;  2HN1 A;  1ZKE A;  3MZK B;  2XQY A;  2D2S A;  2HN2 A;  4ISS A;  4UVC B;  5HXR A;  2VQF T;  3L3P A;  2M67 A;  4HWD A;  3EDU A;  2YEV C;  2AXD S;  2D0U A;  2WZI A;  3O1I A;  3RQW A;  1BR0 A;  2V7J A;  3RYH E;  2DWG A;  3EUH A;  3ONX A;  3RHW A;  1UK5 A;  2FBW A;  2H89 A;  3X1D A;  2V7I A;  4YTP A;  2DI4 A;  4WW0 A; 
#chains in the Genus database with same CATH homology
 2LSK A;  1SHZ C;  4ZS2 A;  2I59 A;  3LG7 A;  3H37 A;  1MIW A;  3RKO A;  1WYB A;  3UFE A;  4AQF A;  3I1A A;  2QA7 A;  2X68 A;  3N2K E;  4I50 E;  3LBX A;  3VKG A;  3GN5 A;  2DLR A;  4UXN B;  1U4Q A;  2CLY C;  2NWB A;  3ETV A;  3IF8 B;  5JR9 A;  2LSI A;  3QUJ A;  4AI6 A;  2NTY A;  4YHJ A;  1V9D A;  1SA0 E;  4ANJ A;  2Q9Q B;  2KXP B;  2VKH A;  2K5B B;  3OKQ A;  5KDM C;  5FXX A;  2LJL A;  2HPJ A;  4KP3 C;  2XHE B;  4YJ2 E;  4TV8 E;  2C5J A;  3ZN1 B;  1G8X A;  2E9X C;  5ETW A;  5C8Y E;  2HH7 A;  5LA6 E;  2PFV A;  3VU7 H;  3IHR A;  2XAH B;  2RA1 A;  2YU2 A;  3N5L A;  3KFW X;  4PW8 A;  3MXZ A;  2BZB A;  2VWA A;  4IE0 A;  3PTR B;  4JUY A;  4UV8 B;  4EZH A;  5TAO A;  1MND A;  3KV5 A;  4O4H E;  5LG4 A;  5JDL A;  2B1E A;  4H9N C;  3PUS A;  1G73 A;  2BVM A;  5F3J A;  5FXV A;  5IYZ E;  5EK2 A;  2CLY B;  5EZY E;  3C4W A;  3HKE E;  3CQX C;  3HI2 A;  2VK9 A;  3CQG B;  3FXD B;  2H7V C;  3N9P A;  5JDN A;  4UEL A;  5FP3 A;  2CMR A;  5AFU L;  4PNI A;  3IBP A;  3LK2 B;  5DQW A;  3PU8 A;  1YKE B;  3WI3 A;  3RRC A;  4OFZ A;  3ZCJ A;  4B6X A;  2IAK A;  5HWX A;  4MHC A;  5JDG A;  3ZN0 B;  3F31 A;  2VKD A;  4HGA A;  3Q2M A;  3SS1 A;  4A56 A;  3ZCI A;  4AKI A;  3RC3 A;  4IIJ E;  3AA0 B;  1KNZ A;  4ZI3 D;  1EZ3 A;  2MBG A;  4PK4 A;  2LEH A;  3CWZ B;  4GYS A;  5FXZ A;  5FMN A;  3BQL A;  2IC6 A;  2X9H A;  3LJC A;  2VB6 A;  5HWY A;  4TZ4 C;  3HR0 A;  2KWI B;  4OHF A;  3CX7 B;  1NAF A;  1MMN A;  3E08 A;  2X66 A;  1UX5 A;  4QXC B;  2Y6X A;  3SOL A;  4DMV A;  2KIN B;  3GWH A;  3VKH A;  2EHO D;  3BK9 A;  3EDV A;  2KWH A;  4PFP A;  2A2F X;  1LKX A;  3OBV E;  4IHJ E;  5EK3 A;  4JEH B;  3PUR A;  4H9S E;  3AA7 B;  3AAI A;  2PJQ A;  4P0B A;  5JQG E;  4H63 H;  3SWH A;  5LYJ E;  4I43 B;  4OK0 A;  3T8O A;  3FB2 A;  2E9X B;  2Y8D A;  1X79 A;  4CXX A;  4EAH A;  4I55 E;  4KBM B;  2ZMA A;  2LE8 A;  5LGT B;  2PBI A;  2KZ7 B;  4K0U A;  2PG8 A;  3FBZ A;  4MBQ A;  4FI5 A;  1WYC A;  5HXE A;  2BDE A;  4BJN A;  1UX4 A;  1MNE A;  3ZMV B;  5LNK A;  2LHN A;  4C91 A;  4IE6 A;  4X1I E;  1HX8 A;  3E0Z A;  1D1A A;  3B13 A;  4EOZ B;  2E9X D;  5H6Q B;  4EYY R;  5LHG B;  3GMI A;  3N2O A;  3NZQ A;  4PJM A;  4ZI2 D;  4ZI7 E;  5FY1 A;  2OA5 A;  3Q9D A;  3C50 A;  4AQG A;  4BJM A;  2VL8 A;  3M65 A;  2WBL A;  5ADX L;  3C4Z A;  5LCY A;  5DAB A;  2RP4 A;  2VAS A;  2W0G A;  2V7L A;  1BR1 A;  4J2C A;  4DND A;  2VKO A;  5L3F B;  2JMK A;  3HA4 A;  2X9W A;  1KK7 A;  2W62 A;  3RRW A;  3AAA B;  5KX5 E;  3OJA A;  2NOX A;  3KV4 A;  3PE0 A;  3I9W A;  1YD8 G;  2CE7 A;  2NW8 A;  3CQC B;  2MYS A;  5L3D B;  2Q9Q A;  5L3B B;  3HKB E;  1MMA A;  2JQQ A;  2UXX B;  3BQI A;  4N78 D;  3MK7 C;  3MKD A;  4P09 A;  4ZI2 C;  5CA0 E;  4EZ4 A;  3LBX B;  2CXF A;  1YW0 A;  2YK0 A;  5BMV E;  2H3R A;  2LOS A;  3BQK A;  4KUM B;  3KBT A;  2CCQ A;  1FMW A;  3KBU A;  2WWU A;  2X9Y A;  3KVA A;  3E22 E;  2QGS A;  3OYZ A;  2XAQ B;  4PFO A;  4CQI A;  2EHO A;  1S35 A;  5L2L A;  2W00 A;  4XBF B;  5FYM A;  4H63 V;  1IJ5 A;  2Z6E A;  3MAC A;  3CPZ A;  2DHR A;  4EIW A;  5JDM A;  1D1B A;  3H3A A;  4AXP A;  1MIV A;  2YU1 A;  3ZC1 A;  4YLH A;  5JDQ A;  2XAF B;  4QHO A;  3ZPO A;  3UT5 E;  1HFA A;  4O8S A;  5JR9 C;  2K48 A;  1LRZ A;  5JDF A;  5JH7 E;  2EHO C;  2L3L A;  3O1J A;  4ZOL E;  1FEW A;  5HXC A;  3FHN A;  4X1K E;  5DJQ C;  1D1C A;  2DCF A;  3FBL A;  5GON E;  2EHO B;  3ZEF B;  2ZM2 A;  4PK5 A;  1BR4 A;  1HCI A;  1FIO A;  4OYJ A;  2C5I T;  3Q5X A;  4PK6 A;  4F6R C;  3ZMU B;  4HTE A;  2IW5 B;  1LVK A;  2ES0 A;  4HN9 A;  5HYA A;  2NTX A;  3DTO A;  3N2G E;  5LBQ B;  4FJO A;  2WM9 A;  3WAK A;  4P0A A;  4QXB B;  4G2A A;  1IAP A;  1CUN A;  2JRK A;  5KMG P;  5LP6 E;  3AA1 B;  4TV9 E;  4X20 E;  3RX6 A;  3ZYK A;  2XAS B;  4DO0 A;  4QKN A;  4DBQ A;  3ZC0 A;  2LSY A;  1IJ6 A;  1HS7 A;  3UUL A;  3LK3 B;  3U78 A;  3O1H A;  5L3E B;  2CM0 A;  3RYF E;  4HEA A;  4HE8 A;  5LHH B;  3AAE B;  3AB3 B;  4ZS3 A;  3RYI E;  3ESL A;  3K3Q C;  4ILU A;  2KLQ A;  2N1G A;  5A1L A;  4O2B E;  1YKH B;  4PAG A;  4PJJ A;  5LBM A;  4CZZ B;  4EXT A;  4DBR A;  2VKJ A;  3I0Q A;  3UUN A;  5JDH A;  4AKH A;  2KMF A;  3O9X A;  3N9O A;  4GK0 E;  1ZEE A;  2E8I A;  2XAG B;  3PU3 A;  3LFM A;  2MTQ A;  5CB4 E;  4WBN E;  1FMV A;  5LGU B;  1MIY A;  3DJB A;  4QX8 B;  3AVS A;  2CXD A;  1D0X A;  3MA9 A;  3AVR A;  5LXT E;  4L5G A;  4HFV A;  2CA5 A;  3F2E A;  5HAX A;  2XUE A;  3S4U A;  3C51 A;  2V1D B;  3V5U A;  2G0U A;  5HXS A;  3UTK A;  4U74 A;  4BAY B;  5L3G B;  3PUA A;  2K9A A;  3IEE A;  5M4Y A;  3ZYM A;  5FNV E;  5FXW A;  3TKL B;  2WMN A;  2X0L B;  3Q5W A;  4XAX B;  4H9O C;  4JLE A;  2DNX A;  4TX5 A;  4E7S A;  1ZHC A;  3W15 B;  4H9Q C;  5JRE A;  1HG5 A;  1IZN B;  5JRC A;  5J2U E;  5J1G A;  3A5X A;  2JPF A;  1D0Z A;  1QSD A;  2NW9 A;  4MFR A;  3CVR A;  3K3N A;  4GK5 E;  3CX8 B;  4GIW A;  5E0O A;  3RYC E;  3HL6 A;  4DMW A;  1HG2 A;  3ZMT B;  4L9I A;  4NUV A;  4CXY A;  4O4J E;  4BA9 A;  2SPC A;  2NP9 A;  2HPL A;  2A3D A;  3LK4 2;  4G63 A;  3J7Y q;  3KVB A;  2N2N A;  3R6N A;  5EK4 A;  3R84 B;  5L3C B;  2X67 A;  1AJ3 A;  2L9Q A;  3RPU A;  4UF0 B;  4EB6 E;  2DWK A;  3FXE B;  4ZHQ E;  3L09 A;  4U72 A;  2V7M A;  4ASK A;  4CI2 B;  5CA1 E;  1MMD A;  4H9R C;  4IST A;  3RC8 A;  2X9X A;  2YIN A;  4GOU A;  3B57 A;  4PJN A;  3NBX X;  4IGU A;  2BVL A;  2W63 A;  3ANW B;  3F57 A;  3K3O A;  1QUU A;  3KV6 A;  1WR6 A;  3NRY A;  2JJ9 A;  4WBO A;  4I4T E;  5F8P A;  3VHL A;  1Y64 B;  3ZMZ B;  2WSS V;  3KDS E;  4KMC A;  2ZM0 A;  3ZMS B;  4V1A v;  5J2T E;  3P8C D;  2XAJ B;  3KIN B;  4IE7 A;  3P7I A;  4ZI3 C;  1O3X A;  3O4X E;  5LJM A;  3OYX A;  4IDZ A;  2V26 A;  2ODV A;  4C90 A;  5IHY A;  2CEA A;  3MJX A;  2ZLY A;  5H6R B;  3ZJ2 A;  2LM9 A;  2J1D G;  3D0T A;  2JMH A;  2LSG A;  4O4I E;  5FY0 A;  4AQF C;  2WMO A;  5LGN B;  1HTJ F;  5JRC B;  3GN5 B;  3QC9 A;  3C98 B;  4AKG A;  3UUX B;  2A72 A;  2LHR A;  4GYR A;  2IC9 A;  2ZM8 A;  2ODU A;  3I0O A;  5LJN A;  2MOZ A;  1LVF A;  1OXZ A;  3N9Q A;  3HKC E;  3PUQ A;  2W61 A;  4E7Z A;  5HXH A;  1OWA A;  1ZV4 X;  3EVY A;  2Q9Q C;  1D0Y A;  1U5P A;  3I9Y A;  4CI3 B;  2ACX A;  3ETU A;  3JC6 C;  2Y48 B;  3RH3 A;  4DVD A;  2C0S A;  4UF0 A;  1E1H B;  4EYU A;  3U3I A;  2E9X A;  3PDY A;  4OYK A;  4UV9 B;  2L8K A;  4QWN B;  3NZP A;  2C5K T;  2GK9 A;  4NUU A;  4HKA A;  4TUY E;  3K8P C;  2NW7 A;  3J9X 1;  1Z0P A;  4IE5 A;  4WNK A;  1S94 A;  4PJL A;  2CWO A;  3NRX A;  3SRZ A;  1MMG A;  3ZJ1 A;  4UVB B;  1VOM A;  4UEM A;  4ADZ A;  5JVD E;  3KV9 A;  1VRB A;  2D5U A;  4QX7 B;  3CX6 B;  2Q9Q D;  3ZLI A;  2CXL A;  2N9D A;  2V7K A;  1HF8 A;  4UIG A;  3PUG A;  4M1P A;  2WAU A;  3C64 A;  3DP7 A;  3N9N A;  1H7C A;  4AKR B;  4CXW A;  1NWM X;  4O2A E;  1US7 B;  3QK6 A;  3CML A;  2LSJ A;  4IE4 A;  3CKD A;  4O4L E;  1WRD A;  4YFS A;  5FY7 A;  3JC6 D;  1B7T A;  4TN7 B;  2XTL A;  1T98 A;  1WLX A;  4UVA B;  3UUM A;  3V5S A;  1UCU A;  2LOP A;  2D0T A;  1BR2 A;  4L0R A;  5JR9 B;  4YJ3 E;  3ANW A;  3N9M A;  4H9P C;  4JEU B;  2X51 A;  2K24 A;  4MLK A;  2UXN B;  3AA6 B;  3C4X A;  4ERR A;  4MAL A;  4X1Y E;  4AKL A;  5LHI B;  2P9B A;  3GA8 A;  3WAJ A;  3N9L A;  5LOV E;  4Z8X A;  5DQV A;  2H7O A;  2LT3 A;  4XZC A;  2CWY A;  4CI1 B;  4QXH B;  2KT9 A;  3HKD E;  2KND A;  3MZK B;  3ZYL A;  1ZKE A;  2XQY A;  2D2S A;  4ISS A;  5HXR A;  4UVC B;  3L3P A;  2M67 A;  3EDU A;  2YEV C;  2D0U A;  3O1I A;  1BR0 A;  2V7J A;  3RYH E;  2DWG A;  3EUH A;  3ONX A;  2V7I A;  2DI4 A;  4WW0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...