1WCRA

Trimeric structure of the enzyme iia from escherichia coli phosphotransferase system specific for n,n'-diacetylchitobiose
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
103
structure length
103
Chain Sequence
AEELEEVVMGLIINSGQARSLAYAALKQAKQGDFAAAKAMMDQSRMALNEAHLVQTKLIEGDAGEGKMKVSLVLVHAQLHLMTSMLARELITELIELHEKLKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords PTS SYSTEM, N, N'-DIACETYLCHITOBIOSE-SPECIFIC IIA COMPONENT
publication title Solution Structure of Enzyme Iiachitobiose from the N,N'-Diacetylchitobiose Branch of the Escherichia Coli Phosphotransferase System
pubmed doi rcsb
source organism Escherichia coli
total genus 41
structure length 103
sequence length 103
chains with identical sequence B, C
ec nomenclature ec 2.7.1.69: Transferred entry: 2.7.1.191, 2.7.1.192, 2.7.1.193, 2.7.1.194, 2.7.1.195,
pdb deposition date 2004-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02255 PTS_IIA PTS system, Lactose/Cellobiose specific IIA subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.280 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Hypothetical protein 1500032h18. 1wcrA00
5LB7B 5CJ5A 4U3CA 2JQ9A 2WY2A 4U7YA 3ZT6A 3ZT7A 2XZEA 2RPAA 4IT4A 2A9UA 2LRKA 4U2YA 4P1NA 1WCRA 2CPTA 4U33A 4WZXA 4CN1A 2CRBA 2JQHA 5FVLA 4CN4A 2K3WA 2V6YB 3EABA 5FVKA 4ZEYA 4U2ZA 1YXRA 2LRLA 2DL1A 2V6XA 3ZSTA 4U7IA 5CGMA 3ZSSA 2V6YA 4A5XA 3K1SA 1WFDA 4U31A 4CN6A 2MPKA 1WR0A 2W2UA 3ZT5A 2JQKA 4NIQA 2WWVA
chains in the Genus database with same CATH superfamily
3CQGB 2X9WA 4B3RT 3RF1A 2BBHA 2NR4A 3V5SA 2J47A 4X62T 4N78D 2KWIB 3VHLA 1M7KA 2CMRA 4DBQA 5HCMA 2XQAA 2W63A 4QH5A 3P4RA 1HNXT 4JI6T 3ANWB 3L09A 4AKLA 2A72A 5ADXL 3P7IA 3PJAJ 1KNZA 2MTQA 4U2ZA 4YXDA 3C64A 4ASKA 3RYFE 3B57A 2VK9A 4AI6A 1W9RA 4O4JE 4X20E 4GKKT 2IMLA 2H3RA 3ETUA 1KK7A 4JEHB 2XASB 2DLRA 4UR9A 4ZEYA 4EEDA 5CGMA 1D1CA 3RH3A 4O2BE 4DV5T 1MNEA 1HF8A 3CPZA 4U3CA 4X1KE 5J1GA 1CHUA 3O4XE 4V1Av 4QXHB 3LDQB 2D0UA 3KDSE 4WYVA 2VKHA 2WWUA 1HR0T 2SPCA 5JDNA 3ZJ2A 2W61A 3E08A 3AEDA 5LHGB 4IT4A 1KEYA 4O4HE 3PUWF 5LHHB 5L3FB 2YU1A 5JQGE 3FZHB 2V8SV 3MJXA 5LCYA 4LFBT 5HXEA 2CA5A 2NTXA 3I1AA 2Q9QC 2WDQA 3LK3B 1E2AA 4UF0B 3N9QA 5LMNT 4EEBA 2FJDA 4OHFA 4G63A 2UXXB 4YJ3E 3UFGA 4NXMT 2CBIA 3RYHE 4IE4A 2WBLA 5CB4E 3PTRB 5KDMC 2GK9A 5JR9C 4IDZA 5LG4A 5LOVE 3OYZA 3MA9A 4DV0T 2MPKA 1MMAA 4HWFA 5HAXA 5HEJA 1J5ET 3GMIA 2YDRA 1UX5A 2A9UA 4BA9A 1HCIA 2M67A 3P50A 2JQHA 4ZI2D 2RP4A 5M4YA 4ZZBA 4JI0T 2V6YA 1BR2A 2A3DA 4ISTA 2BKNA 4DIDB 1HNZT 4FI5A 2C5IT 4PK6A 2X0LB 2NOXA 2V7KA 1N34T 5LBMA 4QX7B 2BBJA 3ETVA 4CN1A 2WB5A 4HGAA 4H9QC 2XQYA 2IIUA 4EOZB 3SS1A 3MK7C 3FXEB 5LB7B 3UUNA 2IUBA 1IZNB 4O4IE 2M6IA 1VRBA 5IYZE 3IHRA 3PV0F 4F6RC 4HFDA 2WP9A 3RPUA 1MIVA 3AA7B 2UUCT 2B1EA 2XQ7A 5HYAA 2UXNB 2X9XA 5ETWA 3ONJA 5HXCA 3SRZA 1US7B 3RRWA 4PAGA 5AQTB 4YSYA 2V5DA 1BR0A 2CXFA 4H9PC 3CX7B 2XM2A 2PFVA 3VRAA 1XMQT 2F4VT 2CRBA 1IJ6A 3RIFA 4PJMA 4GOUA 5LMUT 4JI2T 2DWGA 4Z90A 2XY8B 3AE7A 5LBQB 4JI8T 2WDVA 4ZS2A 4AQGA 1Z8UA 4QWNB 3HI2A 4A56A 4ZI3C 4X5TA 4IREA 4LF9T 1IBLT 3AEGA 5AQQB 1XNQT 3VKGA 1JNRA 3SWHA 4EZ4A 4HKAA 3K3NA 1LVKA 2XPKA 3PU8A 3I9WA 4PFPA 4YJ2E 1IBMT 5DJQC 2VURA 3ZMZB 5FXZA 4J2CA 4K0UA 5IUXA 4YTPA 4LF7T 3UT5E 3CX6B 4IL4A 3P4QA 1JNZA 5L47A 4UELA 2B76A 1WLXA 2RA1A 1ZHCA 3D0TA 5JTGA 4ILCA 4UV9B 5ABGA 3BK9A 1VOMA 2V1DB 3TLSA 2FJEA 3FBLA 5AQNB 2N2NA 1OEDC 1WR0A 2JJ9A 1H7CA 3Q5WA 1YD8G 1E1HB 3LK42 3MXZA 2UUAT 3TLWA 2YOEA 3MZKB 2UXDT 5DQWA 2K48A 3HKEE 4P0BA 2YDSA 4PK5A 4QHOA 3N9OA 4XAXB 3ZC0A 1W0BA 4QH1A 2XQ8A 3TKLB 3RLFF 4LF5T 2G0UA 1WR6A 5JDMA 3R6NA 4QX8B 4IL9A 1WCRA 5FNVE 3BQKA 4IE6A 4UV8B 1NWMX 3S4UA 2E9XD 4CZZB 4MALA 5AQFB 3A5XA 2RPAA 2WQYA 1IJ5A 4IHJE 2VL0A 2BVMA 4A98A 2XJ7A 3RIUC 3NBXX 2KINB 5CA1E 4ERRA 2V6XA 2DI4A 3KV9A 4IE7A 5CFBA 2XQ9A 2ZM0A 4XZCA 1D0YA 3ZMSB 4IDOA 4EZHA 2VWAA 1V9DA 4EIWA 4DR5T 4JLEA 3CX8B 2MAWA 5CJ5A 1MMNA 4U7YA 4K0KT 3ONXA 5JRCB 5AQLB 2X66A 4AXPA 3MACA 3AE2A 3PUVF 5EK3A 3HL6A 4U33A 5FVLA 5HEUA 4ZOLE 3RYIE 1UK5A 2DWKA 2EHOC 4I55E 1HG5A 3M65A 4IDQA 5AQKB 5H6RB 1VCSA 5A1LA 5JDFA 1UX4A 4HFIA 1LRZA 5AQHB 2WU5A 2ACZA 2VKJA 4OYKA 2K3WA 2YINA 4AKRB 3K1SA 2CXLA 2FUPA 3H3MA 4HWCA 3RI5A 3ZLIA 4Z8XA 3ZEFB 1FMWA 3GN5A 2E9XA 2K24A 4EB6E 3UUBA 2KMFA 2PG8A 3UQ4A 3KV4A 5JDQA 4ILAA 4KBMB 3LSVA 2HN1A 2R6GF 3K3QC 2UXCT 3H37A 5FMNA 2A2FX 4IGUA 2HN2A 2VB6A 2W00A 2P9BA 3AE9A 3JC6C 2X68A 2WSSV 3L3PA 3NRXA 2KWHA 2VL8A 3ZSTA 4ISSA 2CHNA 3N9PA 3A8YC 2NP9A 2WY2A 3AVSA 4LMJA 4U74A 2WS3A 2LSYA 3PUXF 4TNVA 2IDOB 2BG9C 3BQLA 4U2YA 2K5BB 1U5PA 2HPJA 5J2UE 1N33T 3CK6A 3CQCB 3OPCA 2X9YA 2DL1A 2KT9A 3SFDA 1D1BA 1ZV4X 5IHYA 3RRCA 4XBFB 4UVCB 3FZKB 2Q9QD 1XDOA 2LKGA 3PU3A 4BJMA 2CLYB 2LRKA 1LVFA 1L0VA 2E5VA 5CA0E 4Z91A 4TNWA 2LLYA 3GN5B 1KNPA 3PURA 5LGUB 4QKNA 3CMLA 1SUMB 3KINB 4X1YE 1YKHB 4H63H 4GYRA 2HH7A 4ILBA 4UVBB 3WAJA 4YY3T 5EK4A 3UUMA 2NW7A 3UU4A 5C2TA 2W0GA 3N2KE 4MLKA 2UUBT 4JI1T 1QSDA 1R8IA 4C90A 3B13A 4DNDA 2JQ9A 3LG7A 2BDEA 3O9XA 2E2AA 3AEEA 4O2AE 2LE8A 3EABA 2ZMAA 2L3LA 3RX6A 3HKCE 3ZSSA 1SHZC 4QXCB 5JVDE 1UCUA 4NPPA 1G8XA 5FXVA 5HWYA 1Y01A 2IC9A 3AEFA 5KX5E 3O1HA 2W66A 5AQGB 3KBUA 1YW0A 4I50E 4UVAB 1YQ3A 5LA6E 3PUZF 3AA1B 3KFWX 5AQIB 4DR2T 5HEGA 3HKBE 2BKPA 3KVAA 3F57A 2Q9QA 5BR8T 3PJAA 3UU5A 4CXXA 5LXTE 3C51A 3PUGA 4DV7T 5L4HA 5FL0A 2OA5A 3ZMTB 1YQ4A 4GK0E 4B3MT 4WBOA 5FY7A 1KNRA 4I43B 4EAHA 2CCQA 2FJAA 2YU2A 3EAMA 2ODVA 3Q2MA 4DR3T 5JR9A 5C3JA 4O4LE 3NZPA 4B6XA 2Y6XA 5ABEA 3BQIA 1M62A 4A5XA 4CI3B 3AVRA 4H9RC 2QA7A 4PJLA 4COFA 1HS7A 2YKSA 3EHZA 2YEVC 3Q5XA 3AEAA 2LSKA 1UURA 1X79A 5H6QB 3KBTA 3MKDA 5FXXA 4TWDA 3C50A 1X9BA 3ZPOA 3UFEA 5LGTB 4BAYB 3P8CD 4IE0A 4L0RA 4P09A 2IW5B 3C4ZA 2XM1A 4ZI3D 2QYWA 3C98B 4TZ4C 4DO0A 4P0AA 2VKDA 5DQVA 4JYAT 3B5MA 2WAUA 3F2EA 2V6YB 4ZS3A 2VVNA 3RC3A 2NW9A 2Q9QB 1I6ZA 3DJBA 4EXTA 4E7SA 3UUXB 2AXDS 3K8PC 3PUAA 4KHPT 4QXBB 3LJCA 2KSRA 3TLUA 5HXHA 4PJNA 3X1DA 1KFYA 4NXNT 4DUYT 4U31A 4KHZF 4TWHA 2JQKA 4AQFC 1U4QA 3L39A 2NTYA 3FZFB 5LJMA 3ESLA 4DUZT 2CWYA 4PFOA 2XAFB 4WZXA 3VR9A 4LFCT 3CWZB 4C91A 4HEAA 4HFVA 3GWHA 1J5WA 4CI1B 1KF6A 3KV6A 2WZHA 4X64T 2XUEA 3OTOT 4X65T 2VVSA 4DV2T 3CVRA 2BS2A 2I0MA 4X66T 3RQWA 2NW8A 2D2SA 5F3JA 4EV6A 5BMVE 5AQSB 4AQFA 4GK5E 5TAOA 2VASA 1IBKT 3ZMVB 4AIUA 3ZT6A 4DV6T 4DMVA 3UU3A 2OLTA 1LKXA 4IDPA 5C8YE 3LK2B 3I0OA 1E7PA 2PTFA 2WM9A 3JADA 4TN7B 2H7VC 4DR4T 4JI3T 5E0OA 1N36T 4KX6A 2ACXA 3FHNA 3UQ7A 5ABFA 2H89A 4YFSA 3SFEA 5AQVB 3AXJA 3G06A 3CKDA 3LBXA 1MMDA 2ZLYA 2MYSA 3PDYA 4NIQA 2CWOA 4AKGA 2N1GA 4KP3C 5LYJE 2V7LA 5L2LA 1D0XA 1YKEB 4P1NA 2LSGA 1OEDA 2V7MA 3P4PA 5EK2A 3PUQA 3HA4A 2QRXA 3ZKRA 1ZKEA 2ZM6T 1SE7A 4PJJA 3TLVA 2X0YA 3N9LA 1XDPA 2EHOD 2XTLA 3ANWA 3EI0A 1ZOYA 1T7SA 2CE7A 3RIAA 2L8KA 3Q5DA 3OYXA 5HXRA 4MHCA 3NKZA 2CLYC 1Z0PA 3AE6A 2KXPB 2J1DG 3K3OA 1GQEA 2C0SA 5AQMB 5AFUL 4DR7T 1I94T 1UUSA 2LJLA 4IDNA 1XWMA 5ABFB 2ZM8A 3RHWA 4ZXLA 3RIUA 4JUYA 4YHHT 1S35A 4F8HA 2V7JA 4LMKA 3RYCE 3Q5EA 2XAQB 3QB5K 4JBWF 3RKGA 3KV5A 3I9YA 3LBXB 1O3XA 2ES0A 5AQOB 4L5GA 4JV5T 2H7OA 5AQPB 3WI3A 2MOZA 3EDVA 4TV8E 2CXDA 2W62A 1NENA 2VQFT 4YT0A 1OEDB 3JC6D 2XZEA 2I6HA 3T1YT 5J2TE 1YXRA 2Z6EA 2Y8DA 3E22E 2FBWA 5LHIB 2QGSA 4ZI7E 2IHR1 3ZC1A 2XQ4A 5HEHA 1FIOA 4OFZA 3ZT7A 4EYUA 3J7Yq 2EHOA 3QK6A 2BS4A 2JQQA 3EVYA 4IIJE 5F5WA 2I59A 2BS3A 4DV3T 3KVBA 2ODUA 4UF0A 4AKHA 4PNIA 2WCAA 3IF8B 4LF6T 3AE3A 2VQET 4DV1T 2J4GA 4BJNA 2YK0A 2WZIA 3AA0B 2PBIA 3VRBA 2W2UA 2UU9T 4KMCA 2NWBA 4ANJA 1G73A 2K9AA 3GA8A 2YDQA 4HE8A 4LF4T 3T1HT 1OEDE 3TLTA 4TWFA 3RQUA 1MMGA 2X9HA 4U7IA 3ZCJA 4DBRA 3N2GE 5AQJB 2HPLA 3UULA 1WYBA 4WNKA 2E9XB 4KI0F 1HFAA 2W4XA 5JH7E 1D0ZA 2N9DA 4PK4A 4HWDA 2JMKA 4B3ST 4TX5A 3NVOA 4YSXA 4OYJA 3Q9DA 4ILUA 5FP3A 1OWAA 2KZ7B 2KLQA 3WAKA 2BG9A 2VKOA 5HXSA 2EHOB 2JMHA 2XQ3A 3U78A 5JREA 2CPTA 4AKIA 4AISA 2LKHA 5KXJA 3QOFA 4HWHA 4DR6T 2LT3A 3ZN0B 2LEHA 5LNKA 5HEOA 3N5LA 5L3CB 4DMWA 2LOPA 5GONE 5L3DB 4ZHQE 2WDRA 2D9DA 4EGWA 2LM2A 3ZYKA 3HKDE 2BVLA 4GIWA 2HHHT 3U3IA 1CUNA 1J1JA 3AA6B 3AECA 2XHEB 2LHRA 3IA3A 2QVAA 1NAFA 3OVUA 3AE5A 5L3EB 5HCJA 3SOLA 4DVDA 4QH4A 1MIWA 4Q25A 4I0UA 2LHNA 2D5UA 2AE9A 1HG2A 2ZM2A 3ZYMA 5LP6E 4LMLA 4I4TE 3ZCIA 3CIRA 4O8SA 2DCFA 1ZEEA 3L8RA 2BZBA 2BG9B 1NEKA 3QNUA 4ZI2C 3N9NA 2V5CA 5LJNA 1WRDA 1AJ3A 2XAHB 3AB3B 3ZMUB 5DABA 4MFRA 1W0AA 4UEMA 3AE8A 3LFMA 4HTEA 1FJGT 5FVKA 4YTMA 3QC9A 2LM9A 3PE0A 3EUHA 3UU6A 4FJOA 2X67A 3R84B 2CM0A 4GKJT 4H9OC 3C4WA 3ZT5A 2CHOA 2XQ6A 4ADZA 3FB2A 1W09A 3VR8A 3P4SA 2UXBT 3H3AA 2X51A 5L3BB 3IBPA 1UGOA 2XAGB 1XNRT 2FJBA 3FXDB 2JRKA 4H63V 1QUUA 3OBVE 2BG9E 5JR9B 5EZYE 4WBNE 2XQ5A 3NZQA 2XSBA 4HWIB 2V7IA 3AE1A 1IAPA 3C4XA 1T8BA 4LFAT 1VCTA 2E8IA 3JAEA 4HFBA 5LGNB 2OV9A 3DTOA 3JCFA 1Y64B 3HR0A 1HX1B 4JI5T 4YTNA 4TV9E 3T8OA 2J62A 3QB5A 5AQUB 3RGLA 3FZLB 4UXNB 5FY0A 3EDUA 4HFCA 4KUMB 1BR1A 4WW0A 2MBGA 3NWIA 3UU8A 5F8PA 1EZ3A 3AEBA 2KNDA 1S94A 3AAAB 4G2AA 2Y48B 5JDHA 4CXWA 5JDLA 3ABVA 3OKQA 4ZZCA 4X1IE 4A97A 4L9IA 5KMGP 4HN9A 4NUVA 1MNDA 4PW8A 2XAJB 2C5JA 2LSIA 3ZN1B 1D1AA 3OJAA 1HX8A 5FY1A 5FYMA 3E0ZA 1MIYA 1WYCA 3VKHA 3RKOA 1HNWT 4YSZA 1HTJF 3A7MA 2PJQA 4CN6A 2WU2A 3PUYF 2JPFA 3AAEB 3V5UA 3FBZA 3QUJA 3I0QA 1DU2A 1ZP0A 5JRCA 4JI7T 2LSJA 4H9SE 2M6BA 4EYYR 2E5LT 1XZYA 2JIWA 3UTKA 5HWXA 1OXZA 3JAFA 4HFHA 3IEEA 4LF8T 2LRLA 5L4EA 4OK0A 3O1IA 4DV4T 4YLHA 3F31A 1T72A 4JEUB 1QLBA 3N2OA 3ZYLA 5J0ZA 3RC8A 1T98A 2X0HA 5FKYA 3J9X1 1BR4A 3O1JA 2DHRA 4CXYA 5LG3A 5ABHA 2D0TA 3FZMB 4U72A 4JI4T 2BKOA 4TUYE 2WWVA 1XMOT 4HFEA 4H9NC 5AQRB 4M1PA 5JDGA 2CEAA 2LOSA 3AAIA 3VU7H 4CN4A 2CBJA 2YN6A 4AQYT 4GYSA 4E7ZA 2WMNA 5IWAT 1FMVA 4UIGA 2C5KT 2H88A 1FEWA 4IE5A 3AE4A 3M3ZB 3ONLC 2XSAA 2V26A 2WMOA 3W15B 2E9XC 2IAKA 2W67A 2IC6A 1N32T 4CQIA 4MBQA 3PUSA 4OX9T 3DP7A 1B7TA 3N9MA 3ZJ1A 5FL1A 3NRYA 3AXJB 5FXWA 3P4WA 4NUUA 2L9QA 4B3TT 4CI2B 5L3GB 4YHJA 3CQXC 1SA0E 1WFDA 2DNXA 4DR1T
chains in the Genus database with same CATH topology
5LB7B 5CJ5A 4U3CA 2JQ9A 2WY2A 4U7YA 3ZT6A 3ZT7A 2XZEA 2RPAA 4IT4A 2A9UA 2LRKA 4U2YA 4P1NA 1WCRA 2CPTA 4U33A 4WZXA 4CN1A 2CRBA 2JQHA 5FVLA 4CN4A 2K3WA 2V6YB 3EABA 5FVKA 4ZEYA 4U2ZA 1YXRA 2LRLA 2DL1A 2V6XA 3ZSTA 4U7IA 5CGMA 3ZSSA 2V6YA 4A5XA 3K1SA 1WFDA 4U31A 4CN6A 2MPKA 1WR0A 2W2UA 3ZT5A 2JQKA 4NIQA 2WWVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LB7 B;  5CJ5 A;  4U3C A;  2JQ9 A;  2WY2 A;  4U7Y A;  3ZT6 A;  3ZT7 A;  2XZE A;  2RPA A;  4IT4 A;  2A9U A;  2LRK A;  4U2Y A;  4P1N A;  1WCR A;  2CPT A;  4U33 A;  4WZX A;  4CN1 A;  2CRB A;  2JQH A;  5FVL A;  4CN4 A;  2K3W A;  2V6Y B;  3EAB A;  5FVK A;  4ZEY A;  4U2Z A;  1YXR A;  2LRL A;  2DL1 A;  2V6X A;  3ZST A;  4U7I A;  5CGM A;  3ZSS A;  2V6Y A;  4A5X A;  3K1S A;  1WFD A;  4U31 A;  4CN6 A;  2MPK A;  1WR0 A;  2W2U A;  3ZT5 A;  2JQK A;  4NIQ A;  2WWV A; 
#chains in the Genus database with same CATH topology
 3CQG B;  2X9W A;  4B3R T;  3RF1 A;  2BBH A;  2NR4 A;  3V5S A;  2J47 A;  4X62 T;  4N78 D;  2KWI B;  3VHL A;  1M7K A;  2CMR A;  4DBQ A;  5HCM A;  2XQA A;  2W63 A;  4QH5 A;  3P4R A;  1HNX T;  4JI6 T;  3ANW B;  3L09 A;  4AKL A;  2A72 A;  5ADX L;  3P7I A;  3PJA J;  1KNZ A;  2MTQ A;  4U2Z A;  4YXD A;  3C64 A;  4ASK A;  3RYF E;  3B57 A;  2VK9 A;  4AI6 A;  1W9R A;  4O4J E;  4X20 E;  4GKK T;  2IML A;  2H3R A;  3ETU A;  1KK7 A;  4JEH B;  2XAS B;  2DLR A;  4UR9 A;  4ZEY A;  4EED A;  5CGM A;  1D1C A;  3RH3 A;  4O2B E;  4DV5 T;  1MNE A;  1HF8 A;  3CPZ A;  4U3C A;  4X1K E;  5J1G A;  1CHU A;  3O4X E;  4V1A v;  4QXH B;  3LDQ B;  2D0U A;  3KDS E;  4WYV A;  2VKH A;  2WWU A;  1HR0 T;  2SPC A;  5JDN A;  3ZJ2 A;  2W61 A;  3E08 A;  3AED A;  5LHG B;  4IT4 A;  1KEY A;  4O4H E;  3PUW F;  5LHH B;  5L3F B;  2YU1 A;  5JQG E;  3FZH B;  2V8S V;  3MJX A;  5LCY A;  4LFB T;  5HXE A;  2CA5 A;  2NTX A;  3I1A A;  2Q9Q C;  2WDQ A;  3LK3 B;  1E2A A;  4UF0 B;  3N9Q A;  5LMN T;  4EEB A;  2FJD A;  4OHF A;  4G63 A;  2UXX B;  4YJ3 E;  3UFG A;  4NXM T;  2CBI A;  3RYH E;  4IE4 A;  2WBL A;  5CB4 E;  3PTR B;  5KDM C;  2GK9 A;  5JR9 C;  4IDZ A;  5LG4 A;  5LOV E;  3OYZ A;  3MA9 A;  4DV0 T;  2MPK A;  1MMA A;  4HWF A;  5HAX A;  5HEJ A;  1J5E T;  3GMI A;  2YDR A;  1UX5 A;  2A9U A;  4BA9 A;  1HCI A;  2M67 A;  3P50 A;  2JQH A;  4ZI2 D;  2RP4 A;  5M4Y A;  4ZZB A;  4JI0 T;  2V6Y A;  1BR2 A;  2A3D A;  4IST A;  2BKN A;  4DID B;  1HNZ T;  4FI5 A;  2C5I T;  4PK6 A;  2X0L B;  2NOX A;  2V7K A;  1N34 T;  5LBM A;  4QX7 B;  2BBJ A;  3ETV A;  4CN1 A;  2WB5 A;  4HGA A;  4H9Q C;  2XQY A;  2IIU A;  4EOZ B;  3SS1 A;  3MK7 C;  3FXE B;  5LB7 B;  3UUN A;  2IUB A;  1IZN B;  4O4I E;  2M6I A;  1VRB A;  5IYZ E;  3IHR A;  3PV0 F;  4F6R C;  4HFD A;  2WP9 A;  3RPU A;  1MIV A;  3AA7 B;  2UUC T;  2B1E A;  2XQ7 A;  5HYA A;  2UXN B;  2X9X A;  5ETW A;  3ONJ A;  5HXC A;  3SRZ A;  1US7 B;  3RRW A;  4PAG A;  5AQT B;  4YSY A;  2V5D A;  1BR0 A;  2CXF A;  4H9P C;  3CX7 B;  2XM2 A;  2PFV A;  3VRA A;  1XMQ T;  2F4V T;  2CRB A;  1IJ6 A;  3RIF A;  4PJM A;  4GOU A;  5LMU T;  4JI2 T;  2DWG A;  4Z90 A;  2XY8 B;  3AE7 A;  5LBQ B;  4JI8 T;  2WDV A;  4ZS2 A;  4AQG A;  1Z8U A;  4QWN B;  3HI2 A;  4A56 A;  4ZI3 C;  4X5T A;  4IRE A;  4LF9 T;  1IBL T;  3AEG A;  5AQQ B;  1XNQ T;  3VKG A;  1JNR A;  3SWH A;  4EZ4 A;  4HKA A;  3K3N A;  1LVK A;  2XPK A;  3PU8 A;  3I9W A;  4PFP A;  4YJ2 E;  1IBM T;  5DJQ C;  2VUR A;  3ZMZ B;  5FXZ A;  4J2C A;  4K0U A;  5IUX A;  4YTP A;  4LF7 T;  3UT5 E;  3CX6 B;  4IL4 A;  3P4Q A;  1JNZ A;  5L47 A;  4UEL A;  2B76 A;  1WLX A;  2RA1 A;  1ZHC A;  3D0T A;  5JTG A;  4ILC A;  4UV9 B;  5ABG A;  3BK9 A;  1VOM A;  2V1D B;  3TLS A;  2FJE A;  3FBL A;  5AQN B;  2N2N A;  1OED C;  1WR0 A;  2JJ9 A;  1H7C A;  3Q5W A;  1YD8 G;  1E1H B;  3LK4 2;  3MXZ A;  2UUA T;  3TLW A;  2YOE A;  3MZK B;  2UXD T;  5DQW A;  2K48 A;  3HKE E;  4P0B A;  2YDS A;  4PK5 A;  4QHO A;  3N9O A;  4XAX B;  3ZC0 A;  1W0B A;  4QH1 A;  2XQ8 A;  3TKL B;  3RLF F;  4LF5 T;  2G0U A;  1WR6 A;  5JDM A;  3R6N A;  4QX8 B;  4IL9 A;  1WCR A;  5FNV E;  3BQK A;  4IE6 A;  4UV8 B;  1NWM X;  3S4U A;  2E9X D;  4CZZ B;  4MAL A;  5AQF B;  3A5X A;  2RPA A;  2WQY A;  1IJ5 A;  4IHJ E;  2VL0 A;  2BVM A;  4A98 A;  2XJ7 A;  3RIU C;  3NBX X;  2KIN B;  5CA1 E;  4ERR A;  2V6X A;  2DI4 A;  3KV9 A;  4IE7 A;  5CFB A;  2XQ9 A;  2ZM0 A;  4XZC A;  1D0Y A;  3ZMS B;  4IDO A;  4EZH A;  2VWA A;  1V9D A;  4EIW A;  4DR5 T;  4JLE A;  3CX8 B;  2MAW A;  5CJ5 A;  1MMN A;  4U7Y A;  4K0K T;  3ONX A;  5JRC B;  5AQL B;  2X66 A;  4AXP A;  3MAC A;  3AE2 A;  3PUV F;  5EK3 A;  3HL6 A;  4U33 A;  5FVL A;  5HEU A;  4ZOL E;  3RYI E;  1UK5 A;  2DWK A;  2EHO C;  4I55 E;  1HG5 A;  3M65 A;  4IDQ A;  5AQK B;  5H6R B;  1VCS A;  5A1L A;  5JDF A;  1UX4 A;  4HFI A;  1LRZ A;  5AQH B;  2WU5 A;  2ACZ A;  2VKJ A;  4OYK A;  2K3W A;  2YIN A;  4AKR B;  3K1S A;  2CXL A;  2FUP A;  3H3M A;  4HWC A;  3RI5 A;  3ZLI A;  4Z8X A;  3ZEF B;  1FMW A;  3GN5 A;  2E9X A;  2K24 A;  4EB6 E;  3UUB A;  2KMF A;  2PG8 A;  3UQ4 A;  3KV4 A;  5JDQ A;  4ILA A;  4KBM B;  3LSV A;  2HN1 A;  2R6G F;  3K3Q C;  2UXC T;  3H37 A;  5FMN A;  2A2F X;  4IGU A;  2HN2 A;  2VB6 A;  2W00 A;  2P9B A;  3AE9 A;  3JC6 C;  2X68 A;  2WSS V;  3L3P A;  3NRX A;  2KWH A;  2VL8 A;  3ZST A;  4ISS A;  2CHN A;  3N9P A;  3A8Y C;  2NP9 A;  2WY2 A;  3AVS A;  4LMJ A;  4U74 A;  2WS3 A;  2LSY A;  3PUX F;  4TNV A;  2IDO B;  2BG9 C;  3BQL A;  4U2Y A;  2K5B B;  1U5P A;  2HPJ A;  5J2U E;  1N33 T;  3CK6 A;  3CQC B;  3OPC A;  2X9Y A;  2DL1 A;  2KT9 A;  3SFD A;  1D1B A;  1ZV4 X;  5IHY A;  3RRC A;  4XBF B;  4UVC B;  3FZK B;  2Q9Q D;  1XDO A;  2LKG A;  3PU3 A;  4BJM A;  2CLY B;  2LRK A;  1LVF A;  1L0V A;  2E5V A;  5CA0 E;  4Z91 A;  4TNW A;  2LLY A;  3GN5 B;  1KNP A;  3PUR A;  5LGU B;  4QKN A;  3CML A;  1SUM B;  3KIN B;  4X1Y E;  1YKH B;  4H63 H;  4GYR A;  2HH7 A;  4ILB A;  4UVB B;  3WAJ A;  4YY3 T;  5EK4 A;  3UUM A;  2NW7 A;  3UU4 A;  5C2T A;  2W0G A;  3N2K E;  4MLK A;  2UUB T;  4JI1 T;  1QSD A;  1R8I A;  4C90 A;  3B13 A;  4DND A;  2JQ9 A;  3LG7 A;  2BDE A;  3O9X A;  2E2A A;  3AEE A;  4O2A E;  2LE8 A;  3EAB A;  2ZMA A;  2L3L A;  3RX6 A;  3HKC E;  3ZSS A;  1SHZ C;  4QXC B;  5JVD E;  1UCU A;  4NPP A;  1G8X A;  5FXV A;  5HWY A;  1Y01 A;  2IC9 A;  3AEF A;  5KX5 E;  3O1H A;  2W66 A;  5AQG B;  3KBU A;  1YW0 A;  4I50 E;  4UVA B;  1YQ3 A;  5LA6 E;  3PUZ F;  3AA1 B;  3KFW X;  5AQI B;  4DR2 T;  5HEG A;  3HKB E;  2BKP A;  3KVA A;  3F57 A;  2Q9Q A;  5BR8 T;  3PJA A;  3UU5 A;  4CXX A;  5LXT E;  3C51 A;  3PUG A;  4DV7 T;  5L4H A;  5FL0 A;  2OA5 A;  3ZMT B;  1YQ4 A;  4GK0 E;  4B3M T;  4WBO A;  5FY7 A;  1KNR A;  4I43 B;  4EAH A;  2CCQ A;  2FJA A;  2YU2 A;  3EAM A;  2ODV A;  3Q2M A;  4DR3 T;  5JR9 A;  5C3J A;  4O4L E;  3NZP A;  4B6X A;  2Y6X A;  5ABE A;  3BQI A;  1M62 A;  4A5X A;  4CI3 B;  3AVR A;  4H9R C;  2QA7 A;  4PJL A;  4COF A;  1HS7 A;  2YKS A;  3EHZ A;  2YEV C;  3Q5X A;  3AEA A;  2LSK A;  1UUR A;  1X79 A;  5H6Q B;  3KBT A;  3MKD A;  5FXX A;  4TWD A;  3C50 A;  1X9B A;  3ZPO A;  3UFE A;  5LGT B;  4BAY B;  3P8C D;  4IE0 A;  4L0R A;  4P09 A;  2IW5 B;  3C4Z A;  2XM1 A;  4ZI3 D;  2QYW A;  3C98 B;  4TZ4 C;  4DO0 A;  4P0A A;  2VKD A;  5DQV A;  4JYA T;  3B5M A;  2WAU A;  3F2E A;  2V6Y B;  4ZS3 A;  2VVN A;  3RC3 A;  2NW9 A;  2Q9Q B;  1I6Z A;  3DJB A;  4EXT A;  4E7S A;  3UUX B;  2AXD S;  3K8P C;  3PUA A;  4KHP T;  4QXB B;  3LJC A;  2KSR A;  3TLU A;  5HXH A;  4PJN A;  3X1D A;  1KFY A;  4NXN T;  4DUY T;  4U31 A;  4KHZ F;  4TWH A;  2JQK A;  4AQF C;  1U4Q A;  3L39 A;  2NTY A;  3FZF B;  5LJM A;  3ESL A;  4DUZ T;  2CWY A;  4PFO A;  2XAF B;  4WZX A;  3VR9 A;  4LFC T;  3CWZ B;  4C91 A;  4HEA A;  4HFV A;  3GWH A;  1J5W A;  4CI1 B;  1KF6 A;  3KV6 A;  2WZH A;  4X64 T;  2XUE A;  3OTO T;  4X65 T;  2VVS A;  4DV2 T;  3CVR A;  2BS2 A;  2I0M A;  4X66 T;  3RQW A;  2NW8 A;  2D2S A;  5F3J A;  4EV6 A;  5BMV E;  5AQS B;  4AQF A;  4GK5 E;  5TAO A;  2VAS A;  1IBK T;  3ZMV B;  4AIU A;  3ZT6 A;  4DV6 T;  4DMV A;  3UU3 A;  2OLT A;  1LKX A;  4IDP A;  5C8Y E;  3LK2 B;  3I0O A;  1E7P A;  2PTF A;  2WM9 A;  3JAD A;  4TN7 B;  2H7V C;  4DR4 T;  4JI3 T;  5E0O A;  1N36 T;  4KX6 A;  2ACX A;  3FHN A;  3UQ7 A;  5ABF A;  2H89 A;  4YFS A;  3SFE A;  5AQV B;  3AXJ A;  3G06 A;  3CKD A;  3LBX A;  1MMD A;  2ZLY A;  2MYS A;  3PDY A;  4NIQ A;  2CWO A;  4AKG A;  2N1G A;  4KP3 C;  5LYJ E;  2V7L A;  5L2L A;  1D0X A;  1YKE B;  4P1N A;  2LSG A;  1OED A;  2V7M A;  3P4P A;  5EK2 A;  3PUQ A;  3HA4 A;  2QRX A;  3ZKR A;  1ZKE A;  2ZM6 T;  1SE7 A;  4PJJ A;  3TLV A;  2X0Y A;  3N9L A;  1XDP A;  2EHO D;  2XTL A;  3ANW A;  3EI0 A;  1ZOY A;  1T7S A;  2CE7 A;  3RIA A;  2L8K A;  3Q5D A;  3OYX A;  5HXR A;  4MHC A;  3NKZ A;  2CLY C;  1Z0P A;  3AE6 A;  2KXP B;  2J1D G;  3K3O A;  1GQE A;  2C0S A;  5AQM B;  5AFU L;  4DR7 T;  1I94 T;  1UUS A;  2LJL A;  4IDN A;  1XWM A;  5ABF B;  2ZM8 A;  3RHW A;  4ZXL A;  3RIU A;  4JUY A;  4YHH T;  1S35 A;  4F8H A;  2V7J A;  4LMK A;  3RYC E;  3Q5E A;  2XAQ B;  3QB5 K;  4JBW F;  3RKG A;  3KV5 A;  3I9Y A;  3LBX B;  1O3X A;  2ES0 A;  5AQO B;  4L5G A;  4JV5 T;  2H7O A;  5AQP B;  3WI3 A;  2MOZ A;  3EDV A;  4TV8 E;  2CXD A;  2W62 A;  1NEN A;  2VQF T;  4YT0 A;  1OED B;  3JC6 D;  2XZE A;  2I6H A;  3T1Y T;  5J2T E;  1YXR A;  2Z6E A;  2Y8D A;  3E22 E;  2FBW A;  5LHI B;  2QGS A;  4ZI7 E;  2IHR 1;  3ZC1 A;  2XQ4 A;  5HEH A;  1FIO A;  4OFZ A;  3ZT7 A;  4EYU A;  3J7Y q;  2EHO A;  3QK6 A;  2BS4 A;  2JQQ A;  3EVY A;  4IIJ E;  5F5W A;  2I59 A;  2BS3 A;  4DV3 T;  3KVB A;  2ODU A;  4UF0 A;  4AKH A;  4PNI A;  2WCA A;  3IF8 B;  4LF6 T;  3AE3 A;  2VQE T;  4DV1 T;  2J4G A;  4BJN A;  2YK0 A;  2WZI A;  3AA0 B;  2PBI A;  3VRB A;  2W2U A;  2UU9 T;  4KMC A;  2NWB A;  4ANJ A;  1G73 A;  2K9A A;  3GA8 A;  2YDQ A;  4HE8 A;  4LF4 T;  3T1H T;  1OED E;  3TLT A;  4TWF A;  3RQU A;  1MMG A;  2X9H A;  4U7I A;  3ZCJ A;  4DBR A;  3N2G E;  5AQJ B;  2HPL A;  3UUL A;  1WYB A;  4WNK A;  2E9X B;  4KI0 F;  1HFA A;  2W4X A;  5JH7 E;  1D0Z A;  2N9D A;  4PK4 A;  4HWD A;  2JMK A;  4B3S T;  4TX5 A;  3NVO A;  4YSX A;  4OYJ A;  3Q9D A;  4ILU A;  5FP3 A;  1OWA A;  2KZ7 B;  2KLQ A;  3WAK A;  2BG9 A;  2VKO A;  5HXS A;  2EHO B;  2JMH A;  2XQ3 A;  3U78 A;  5JRE A;  2CPT A;  4AKI A;  4AIS A;  2LKH A;  5KXJ A;  3QOF A;  4HWH A;  4DR6 T;  2LT3 A;  3ZN0 B;  2LEH A;  5LNK A;  5HEO A;  3N5L A;  5L3C B;  4DMW A;  2LOP A;  5GON E;  5L3D B;  4ZHQ E;  2WDR A;  2D9D A;  4EGW A;  2LM2 A;  3ZYK A;  3HKD E;  2BVL A;  4GIW A;  2HHH T;  3U3I A;  1CUN A;  1J1J A;  3AA6 B;  3AEC A;  2XHE B;  2LHR A;  3IA3 A;  2QVA A;  1NAF A;  3OVU A;  3AE5 A;  5L3E B;  5HCJ A;  3SOL A;  4DVD A;  4QH4 A;  1MIW A;  4Q25 A;  4I0U A;  2LHN A;  2D5U A;  2AE9 A;  1HG2 A;  2ZM2 A;  3ZYM A;  5LP6 E;  4LML A;  4I4T E;  3ZCI A;  3CIR A;  4O8S A;  2DCF A;  1ZEE A;  3L8R A;  2BZB A;  2BG9 B;  1NEK A;  3QNU A;  4ZI2 C;  3N9N A;  2V5C A;  5LJN A;  1WRD A;  1AJ3 A;  2XAH B;  3AB3 B;  3ZMU B;  5DAB A;  4MFR A;  1W0A A;  4UEM A;  3AE8 A;  3LFM A;  4HTE A;  1FJG T;  5FVK A;  4YTM A;  3QC9 A;  2LM9 A;  3PE0 A;  3EUH A;  3UU6 A;  4FJO A;  2X67 A;  3R84 B;  2CM0 A;  4GKJ T;  4H9O C;  3C4W A;  3ZT5 A;  2CHO A;  2XQ6 A;  4ADZ A;  3FB2 A;  1W09 A;  3VR8 A;  3P4S A;  2UXB T;  3H3A A;  2X51 A;  5L3B B;  3IBP A;  1UGO A;  2XAG B;  1XNR T;  2FJB A;  3FXD B;  2JRK A;  4H63 V;  1QUU A;  3OBV E;  2BG9 E;  5JR9 B;  5EZY E;  4WBN E;  2XQ5 A;  3NZQ A;  2XSB A;  4HWI B;  2V7I A;  3AE1 A;  1IAP A;  3C4X A;  1T8B A;  4LFA T;  1VCT A;  2E8I A;  3JAE A;  4HFB A;  5LGN B;  2OV9 A;  3DTO A;  3JCF A;  1Y64 B;  3HR0 A;  1HX1 B;  4JI5 T;  4YTN A;  4TV9 E;  3T8O A;  2J62 A;  3QB5 A;  5AQU B;  3RGL A;  3FZL B;  4UXN B;  5FY0 A;  3EDU A;  4HFC A;  4KUM B;  1BR1 A;  4WW0 A;  2MBG A;  3NWI A;  3UU8 A;  5F8P A;  1EZ3 A;  3AEB A;  2KND A;  1S94 A;  3AAA B;  4G2A A;  2Y48 B;  5JDH A;  4CXW A;  5JDL A;  3ABV A;  3OKQ A;  4ZZC A;  4X1I E;  4A97 A;  4L9I A;  5KMG P;  4HN9 A;  4NUV A;  1MND A;  4PW8 A;  2XAJ B;  2C5J A;  2LSI A;  3ZN1 B;  1D1A A;  3OJA A;  1HX8 A;  5FY1 A;  5FYM A;  3E0Z A;  1MIY A;  1WYC A;  3VKH A;  3RKO A;  1HNW T;  4YSZ A;  1HTJ F;  3A7M A;  2PJQ A;  4CN6 A;  2WU2 A;  3PUY F;  2JPF A;  3AAE B;  3V5U A;  3FBZ A;  3QUJ A;  3I0Q A;  1DU2 A;  1ZP0 A;  5JRC A;  4JI7 T;  2LSJ A;  4H9S E;  2M6B A;  4EYY R;  2E5L T;  1XZY A;  2JIW A;  3UTK A;  5HWX A;  1OXZ A;  3JAF A;  4HFH A;  3IEE A;  4LF8 T;  2LRL A;  5L4E A;  4OK0 A;  3O1I A;  4DV4 T;  4YLH A;  3F31 A;  1T72 A;  4JEU B;  1QLB A;  3N2O A;  3ZYL A;  5J0Z A;  3RC8 A;  1T98 A;  2X0H A;  5FKY A;  3J9X 1;  1BR4 A;  3O1J A;  2DHR A;  4CXY A;  5LG3 A;  5ABH A;  2D0T A;  3FZM B;  4U72 A;  4JI4 T;  2BKO A;  4TUY E;  2WWV A;  1XMO T;  4HFE A;  4H9N C;  5AQR B;  4M1P A;  5JDG A;  2CEA A;  2LOS A;  3AAI A;  3VU7 H;  4CN4 A;  2CBJ A;  2YN6 A;  4AQY T;  4GYS A;  4E7Z A;  2WMN A;  5IWA T;  1FMV A;  4UIG A;  2C5K T;  2H88 A;  1FEW A;  4IE5 A;  3AE4 A;  3M3Z B;  3ONL C;  2XSA A;  2V26 A;  2WMO A;  3W15 B;  2E9X C;  2IAK A;  2W67 A;  2IC6 A;  1N32 T;  4CQI A;  4MBQ A;  3PUS A;  4OX9 T;  3DP7 A;  1B7T A;  3N9M A;  3ZJ1 A;  5FL1 A;  3NRY A;  3AXJ B;  5FXW A;  3P4W A;  4NUU A;  2L9Q A;  4B3T T;  4CI2 B;  5L3G B;  4YHJ A;  3CQX C;  1SA0 E;  1WFD A;  2DNX A;  4DR1 T; 
#chains in the Genus database with same CATH homology
 5LB7 B;  5CJ5 A;  4U3C A;  2JQ9 A;  2WY2 A;  4U7Y A;  3ZT6 A;  3ZT7 A;  2XZE A;  2RPA A;  4IT4 A;  2A9U A;  2LRK A;  4U2Y A;  4P1N A;  1WCR A;  2CPT A;  4U33 A;  4WZX A;  4CN1 A;  2CRB A;  2JQH A;  5FVL A;  4CN4 A;  2K3W A;  2V6Y B;  3EAB A;  5FVK A;  4ZEY A;  4U2Z A;  1YXR A;  2LRL A;  2DL1 A;  2V6X A;  3ZST A;  4U7I A;  5CGM A;  3ZSS A;  2V6Y A;  4A5X A;  3K1S A;  1WFD A;  4U31 A;  4CN6 A;  2MPK A;  1WR0 A;  2W2U A;  3ZT5 A;  2JQK A;  4NIQ A;  2WWV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...