1US7B

Complex of hsp90 and p50
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
200
structure length
193
Chain Sequence
HKTFVEKYEKQIKHFGMLRRWDDSQKYLSDNVHLVCEETANYLVIWCIDLEVEEKCALMEQVAHQTIVMQFILELAKSLKVDPRACFRQFFTKIKTADRQYMEGFNDELEAFKERVRGRAKLRIEKAMKEYEEEERKKRLGPGGLDPVEVYESLPEELQKCMLQDAISKMDPTDAKYHMQRCIDSGLWVPNSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Mechanism of Hsp90 Regulation by the Protein Kinase-Specific Cochaperone p50(Cdc37)
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Chaperone
molecule keywords HEAT SHOCK PROTEIN HSP82
total genus 73
structure length 193
sequence length 200
ec nomenclature
pdb deposition date 2003-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF08564 CDC37_C Cdc37 C terminal domain
B PF08565 CDC37_M Cdc37 Hsp90 binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.610 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 1us7B01
1US7B 2K5BB 2W0GA
chains in the Genus database with same CATH superfamily
5FVKA 4GYSA 4DR5T 4Q25A 2NR4A 2ODUA 5CA1E 3LG7A 3RKOA 1MIVA 5AQMB 3O1JA 4IE5A 3MK7C 2CXLA 2QRXA 3IHRA 4ILBA 4AKLA 5LMUT 4B3ST 4O8SA 4NUVA 2LLYA 4H9QC 4ASKA 4DIDB 1EZ3A 2K5BB 4EZ4A 1S35A 4HE8A 3EDUA 4I50E 2KXPB 4N78D 2Q9QA 3LJCA 2E2AA 2BZBA 3AE3A 1MNEA 4UIGA 5DJQC 4OK0A 3ZSSA 5LHHB 3ZC0A 3TLSA 5JDQA 3P50A 4JI1T 2ES0A 2V5CA 1US7B 5LNKA 3F31A 3UUXB 1L0VA 2LSGA 5AQVB 1ZV4X 3AAAB 3WI3A 3WAKA 3C4WA 3AVRA 3M65A 4B6XA 4LFAT 1BR0A 3K1SA 3P4WA 3KBUA 4MBQA 4U33A 3ZT7A 2IW5B 4MALA 4Z90A 4DUZT 4AKHA 4MLKA 4EAHA 2CXFA 4NXNT 4CXYA 5J0ZA 3PUVF 5L3BB 1KFYA 3PUXF 2LE8A 3RQWA 3O9XA 2SPCA 2CM0A 2YINA 3ZJ2A 2W67A 2W63A 1IZNB 1V9DA 5JDHA 5L2LA 4O2AE 5HXCA 4Z8XA 1OEDC 2KINB 2PFVA 3UQ4A 2DL1A 3RIFA 5JDLA 3CVRA 4CXXA 4ZI3D 1MMNA 2JQQA 1D0XA 4J2CA 1HNXT 5HXSA 3P4PA 1SE7A 1J1JA 3KVAA 1SUMB 2V8SV 3PTRB 1UCUA 2Y48B 3AE7A 4EYUA 5LG3A 4DR6T 1JNRA 3GA8A 1E7PA 3CPZA 5EZYE 1UGOA 5AQSB 3RKGA 4U31A 1MIWA 2MYSA 2KT9A 3ZKRA 2CRBA 2K9AA 3RHWA 3OJAA 3BQIA 4PNIA 4JI8T 2W61A 3GWHA 5FXVA 1MNDA 2JMKA 2P9BA 4DV0T 4YY3T 3NZQA 2JIWA 4I0UA 2CCQA 4IT4A 2X9YA 2PJQA 2NOXA 3HKDE 2BVMA 3F57A 5HXRA 3H3MA 4IIJE 2CBIA 2XQ9A 2W2UA 4ZEYA 2V7KA 1HNZT 2MAWA 2NTYA 3RGLA 4TUYE 4JYAT 3VKHA 4FI5A 4DR3T 2XM1A 2BKNA 4X65T 1UX5A 3AE6A 1I6ZA 3UU4A 4L0RA 2X67A 1WRDA 4ILAA 3SWHA 5JRCB 2VVSA 4QHOA 4ZXLA 3JAEA 4BJMA 2WS3A 4DV1T 4DMWA 3OYZA 2EHOC 3PJAA 2IMLA 2RP4A 2C5KT 1J5WA 2XQ4A 2XAFB 5HEGA 2YEVC 4B3TT 4ZI3C 3PU8A 2KWHA 4YHJA 3PE0A 3LFMA 2XQ6A 2B76A 2DWKA 2CA5A 2YDRA 1WLXA 2KNDA 3CMLA 3FHNA 3FXEB 2WQYA 5FYMA 4AQFA 3HI2A 4TNVA 2G0UA 3C64A 3FZHB 3DP7A 2VKDA 4QH1A 2DLRA 4UR9A 5AQFB 5JDMA 2N2NA 5JR9B 5LXTE 4NIQA 5HWYA 4PFOA 5BMVE 4X1IE 3IEEA 4G63A 3EABA 1XWMA 3S4UA 2WDVA 1QUUA 2V26A 4EYYR 2AE9A 4ZI7E 2VB6A 4YXDA 4GK5E 5C2TA 3B5MA 1HG5A 5AQPB 4QX7B 5F3JA 4YT0A 2V1DB 1LKXA 3AEEA 4HGAA 4ILUA 2W0GA 4UV9B 2ZLYA 4A98A 5AFUL 2HN1A 2QA7A 2ODVA 3EI0A 3KBTA 4HFCA 2YKSA 5HAXA 5J1GA 4HFDA 1E2AA 2W4XA 2W00A 2XAQB 3MXZA 3CX8B 5H6QB 3VRBA 2DHRA 2ZM8A 5LJNA 5LA6E 4JI6T 3JADA 3OVUA 2D5UA 3TLWA 2M67A 1I94T 3ZMUB 4H9RC 4KX6A 3P8CD 4GKKT 1W0AA 2D0UA 2C0SA 2KWIB 3JAFA 2C5JA 4CI3B 4XBFB 4DV3T 4KBMB 2E8IA 2YU2A 2WMOA 2V6YA 2K48A 5JDFA 5LGNB 1HG2A 1W0BA 3ZYMA 2VKJA 3A8YC 4CI1B 5IUXA 4UVBB 4KMCA 5AQIB 2E5VA 4JUYA 2BG9B 3V5SA 4A97A 1G73A 2YDSA 2VURA 2IC9A 4ZZCA 2WBLA 3CX7B 4PK5A 5LB7B 2XQAA 5JQGE 4P0AA 2HPLA 2BDEA 2WSSV 3SFEA 2E9XD 1UUSA 4L9IA 4WBOA 3ZYKA 3KV5A 4X1KE 1J5ET 4YHHT 2V7IA 4MFRA 4U2YA 4AQYT 3AE8A 3TLTA 3UUBA 4LF7T 3N9MA 3N5LA 1D0YA 3N9OA 3FBZA 2D0TA 3ONLC 4P09A 5EK4A 3KV9A 4LF9T 2YN6A 3T1YT 5A1LA 4U7IA 5HEHA 1KNRA 4LMJA 3Q9DA 2EHOA 1VCSA 2WU2A 3FZMB 3PUQA 4ISSA 2WZHA 4U2ZA 2W62A 2H88A 1HF8A 4YJ3E 4F8HA 4HWFA 1AJ3A 1SA0E 2WM9A 3JC6D 2CWOA 1U5PA 3CQGB 2WB5A 3JCFA 4LFBT 3O4XE 4HN9A 4AQGA 4IDZA 2XSAA 3ONXA 3O1HA 4X1YE 1HCIA 5HCJA 5ETWA 2UXXB 2V7JA 3BK9A 1FEWA 2NWBA 4P1NA 3ETUA 4KHPT 3ZCJA 2LHNA 3RC3A 3AAIA 2Z6EA 4QXHB 3UTKA 2E5LT 4JV5T 4M1PA 4HWHA 1ZHCA 3MA9A 4OYKA 3N9LA 2WMNA 4QH5A 5H6RB 5C3JA 3I0QA 3MZKB 2K3WA 3BQLA 4QH4A 4UELA 2FJAA 2VK9A 1QSDA 2JRKA 3LK3B 5AQQB 1D1CA 3F2EA 1S94A 2JQKA 2NW7A 3KFWX 3ZT6A 3KVBA 4JEUB 4NUUA 3UU6A 3AA0B 2OA5A 2NTXA 5AQLB 4XZCA 5IYZE 3NBXX 4NPPA 4LF6T 2J1DG 4TX5A 5HEUA 3ABVA 4JI0T 2JMHA 2VKOA 2VVNA 3AEBA 1B7TA 3RRCA 4IDQA 5CA0E 3NKZA 1LRZA 5LP6E 3HA4A 4BJNA 4QX8B 2XQ8A 2YK0A 1VCTA 4HWCA 2LHRA 2NW9A 4EEBA 3G06A 2WDQA 5HXHA 2CLYC 3ZN1B 2X66A 3CKDA 1U4QA 2Y8DA 5L3GB 2ZM6T 2XAJB 4H9PC 4EXTA 3ANWA 3AEFA 3BQKA 4K0UA 4X20E 3R84B 4CXWA 2WCAA 3I0OA 3OKQA 4LMLA 3MKDA 4YFSA 4ZZBA 1IBLT 3RLFF 3K3OA 2YU1A 3FBLA 5DQVA 3HKBE 4AKRB 4AQFC 4BAYB 4ERRA 3P7IA 4HWDA 5FXZA 5LGTB 4UV8B 3NRXA 5LBQB 3DJBA 2IUBA 2WDRA 2A2FX 3O1IA 2XZEA 3EUHA 2H89A 4ZOLE 5F5WA 3AA7B 3U78A 1MIYA 1VOMA 2BS3A 2X68A 5EK3A 1N36T 1W9RA 2V7MA 3KV6A 1VRBA 3VRAA 3ETVA 4DNDA 3L3PA 4ZI2C 4AISA 3P4RA 4IL9A 4F6RC 2CPTA 5AQGB 5ABHA 1FJGT 2UXDT 2X9WA 2IAKA 2UUAT 3K3NA 4OYJA 2QVAA 2W66A 3FZFB 5HEOA 3RIAA 4ZHQE 4DR1T 3AB3B 3N2OA 4JBWF 5TAOA 3EDVA 2CXDA 3A5XA 2VWAA 1CHUA 4IE6A 2N1GA 3MACA 3E0ZA 3H37A 3T8OA 4YTMA 3SRZA 4EB6E 4DV5T 1N34T 2OV9A 4GKJT 1FMVA 3AE9A 4UVCB 2H3RA 2LM2A 3B57A 5FNVE 1IBKT 4IL4A 3UU8A 2Q9QB 2X0LB 5J2TE 3N2GE 2IC6A 2XM2A 1Y64B 2BBHA 3C4ZA 3AEAA 2ACXA 4P0BA 3P4SA 1IBMT 4CN4A 2B1EA 2HH7A 3N2KE 1XDPA 4KUMB 2CBJA 3AE4A 2LRLA 3QB5K 3ZLIA 5AQUB 1WYBA 4I43B 1IJ5A 2HPJA 4AIUA 3CIRA 5ABGA 2LSYA 4NXMT 2H7VC 2IIUA 4EV6A 5FL0A 2VL8A 3OPCA 2NW8A 3KV4A 3C51A 4QXBB 5ABFB 4AI6A 2E9XB 1HS7A 1JNZA 3LBXB 3K3QC 5DQWA 5L47A 4CZZB 1X79A 2LEHA 2QGSA 2QYWA 2PG8A 4H63H 4PK4A 4DR2T 1XDOA 5FP3A 2MTQA 4G2AA 2C5IT 4IE0A 4TWDA 3T1HT 4JI4T 2XY8B 2DNXA 1BR4A 1YXRA 1WCRA 2YOEA 2DI4A 4PAGA 4I55E 4OX9T 5L4HA 4TWHA 3RIUC 4GK0E 5L3EB 4EEDA 4GOUA 1G8XA 1Z8UA 4DV2T 4GYRA 2L3LA 2BKPA 4WW0A 2V6YB 4UEMA 5FVLA 4JI5T 2CWYA 2I59A 3IF8B 3Q2MA 5AQTB 3QNUA 3CX6B 1FMWA 5CJ5A 3VR8A 1YQ3A 2AXDS 5AQJB 2OLTA 1NENA 4WBNE 2LSJA 2ZMAA 2ZM0A 3V5UA 1M62A 2A72A 1BR1A 1IJ6A 1HR0T 2E9XA 2JJ9A 3NVOA 3Q5XA 3I9WA 2YDQA 4A56A 5AQOB 3AA6B 3ZSTA 3LDQB 5ABFA 4EGWA 3QB5A 2XQ7A 4WZXA 5FY1A 2X9XA 1XZYA 2Q9QD 2XQ3A 3AE1A 3Q5DA 5EK2A 4X62T 2CEAA 4KP3C 1T72A 2RA1A 3LSVA 3FZLB 5M4YA 2HHHT 3VR9A 1WFDA 4U74A 3UT5E 4IGUA 2EHOD 5LGUB 2X9HA 4PJLA 3HR0A 4O4LE 4U3CA 4ANJA 2KMFA 3EAMA 4EIWA 4B3MT 2GK9A 1ZEEA 4TWFA 3GMIA 5DABA 3KINB 2JPFA 3Q5WA 3L09A 4HFHA 1KF6A 2BVLA 3AXJB 2BS2A 1YD8G 1W09A 4IHJE 5AQNB 3TKLB 2UUBT 1D1AA 1YKHB 4JLEA 2LKHA 4DUYT 1BR2A 3L8RA 4O4HE 4TNWA 3EHZA 5CB4E 3CQXC 4C91A 3PUSA 4K0KT 3I1AA 2MPKA 3ZT5A 3ZCIA 5KXJA 1Z0PA 2Y6XA 3L39A 4UF0B 3RF1A 2J4GA 3TLVA 3UU3A 5JRCA 1Y01A 2I0MA 1X9BA 3PJAJ 5KMGP 5FXWA 5JTGA 5JR9C 3HKCE 5L3DB 4L5GA 3A7MA 3RYCE 4O4IE 3AEDA 3RC8A 3CK6A 3I9YA 2FJBA 3UUMA 5C8YE 2NP9A 3ZYLA 2Q9QC 3OYXA 2J62A 3K8PC 3W15B 2UXBT 5FY0A 5JDNA 3UULA 4DR4T 5CGMA 1E1HB 3FZKB 3HKEE 4JI2T 2MOZA 1HFAA 2XQ5A 3D0TA 5LCYA 1MMDA 3SFDA 1KK7A 5KX5E 5AQRB 3ZMVB 4BA9A 3HL6A 3RIUA 4LF5T 4YSXA 3N9PA 2XASB 2VKHA 3NZPA 4DV6T 2X0YA 2F4VT 1XMOT 5FKYA 3VKGA 1D0ZA 2WWVA 2WP9A 4WNKA 4Z91A 3U3IA 3NWIA 1UURA 4DMVA 3C98B 2XQYA 3ZEFB 3UQ7A 1HNWT 4UVAB 1UK5A 3M3ZB 2LOSA 1CUNA 4CQIA 1YQ4A 5LHGB 2LKGA 5L3CB 2N9DA 2DCFA 3QC9A 3GN5B 3AA1B 4ILCA 1UX4A 5ADXL 4KHZF 3RX6A 2E9XC 5FL1A 4AXPA 3PURA 4DBQA 2KSRA 4JI3T 3ESLA 4WYVA 5KDMC 4YLHA 3B13A 3J7Yq 4HWIB 1ZOYA 2XSBA 5J2UE 1N33T 1OXZA 5FY7A 2UXNB 4TV8E 3N9NA 2A3DA 4E7ZA 4U72A 1HTJF 2LSKA 3ZJ1A 3GN5A 4O4JE 3UFGA 1YKEB 4OFZA 4I4TE 3C4XA 2K24A 1R8IA 2LT3A 2VL0A 3OBVE 4PJNA 2V7LA 4YTNA 1LVFA 2CLYB 2X51A 3PV0F 2M6IA 3ZN0B 2JQ9A 1HX1B 4HFBA 5CFBA 1NWMX 2ACZA 5FXXA 2PTFA 3LK42 4QXCB 4XAXB 3AECA 1XMQT 4LFCT 4X66T 5LYJE 4IDPA 4QWNB 2VASA 3ANWB 3P4QA 3PU3A 1T7SA 5HWXA 5LMNT 2XAGB 4DR7T 3J9X1 3RQUA 3QK6A 2RPAA 2WU5A 4FJOA 4MHCA 2VQET 1SHZC 1M7KA 2LSIA 1T98A 2BS4A 1IAPA 2LRKA 1MMAA 4IDOA 4TV9E 4X5TA 5GONE 2FJEA 4HKAA 2IDOB 4ISTA 2XJ7A 3RRWA 2FJDA 3SS1A 4CI2B 1H7CA 5HXEA 1DU2A 4LMKA 2WWUA 1LVKA 4DVDA 3WAJA 4H63V 5AQKB 3CWZB 3LK2B 2UU9T 4UXNB 4V1Av 2H7OA 2HN2A 1MMGA 1N32T 3FB2A 1WYCA 3X1DA 4TN7B 4UF0A 2CHNA 2LOPA 3FXDB 3JC6C 4CN1A 3ONJA 2CE7A 4IE4A 1OEDE 5LOVE 4EOZB 4YJ2E 3Q5EA 2XPKA 3H3AA 3QOFA 4H9SE 4PK6A 5E0OA 2BKOA 3MJXA 3NRYA 4TZ4C 1GQEA 3RYIE 4QKNA 1OWAA 2BG9E 3AXJA 4HTEA 3E08A 5JDGA 1O3XA 1ZP0A 1WR0A 4YSYA 5HEJA 2DWGA 3AEGA 2V5DA 3RH3A 2X0HA 3PUWF 3AE2A 2CMRA 5HCMA 3ZMTB 2L9QA 4YTPA 5FMNA 4PW8A 1XNQT 2UXCT 2UUCT 1OEDB 4ZS3A 3QUJA 1HX8A 4DV7T 3C50A 5JH7E 4PJJA 2BG9C 2KLQA 4DBRA 5L3FB 4O2BE 3N9QA 2EHOB 4IE7A 4EZHA 5JREA 3KDSE 2J47A 3AE5A 3CQCB 4U7YA 5IHYA 4GIWA 4COFA 4AKIA 4CN6A 1NEKA 3AVSA 3IA3A 2D9DA 2PBIA 1YW0A 4JI7T 1KEYA 4H9NC 4YSZA 3RYFE 4B3RT 3PUYF 2WY2A 3PUGA 3RYHE 3UFEA 2L8KA 3PUAA 3UUNA 3VHLA 2D2SA 1KNZA 5LJMA 5F8PA 1OEDA 2KZ7B 4PJMA 1FIOA 2CHOA 1T8BA 2I6HA 5L4EA 5LG4A 5IWAT 3SOLA 3DTOA 2BBJA 4ADZA 2XTLA 3RPUA 2A9UA 4IREA 4HFIA 2BG9A 3EVYA 1D1BA 2FBWA 4HEAA 5JR9A 3RI5A 3UU5A 5LBMA 4X64T 3ZPOA 5BR8T 2WZIA 4IDNA 3ZMSB 1KNPA 3TLUA 5AQHB 3E22E 4C90A 1QLBA 2FUPA 2V6XA 2WAUA 4OHFA 2R6GF 2XAHB 4HFEA 2XUEA 1ZKEA 4PFPA 1XNRT 4JEHB 3VU7H 2LM9A 4DO0A 5HYAA 3PDYA 2M6BA 1WR6A 4DV4T 4LF8T 4ZI2D 2JQHA 2LJLA 4LF4T 2XHEB 3LBXA 4A5XA 3AAEB 2IHR1 3ZC1A 3ZMZB 2ZM2A 4KI0F 3R6NA 3IBPA 4AKGA 3PUZF 5LHIB 5ABEA 2MBGA 4HFVA 1NAFA 4H9OC 3OTOT 4E7SA 5JVDE 4ZS2A 2VQFT
chains in the Genus database with same CATH topology
4GYSA 2ODUA 5CA1E 3LG7A 3RKOA 1MIVA 3O1JA 4IE5A 3MK7C 2CXLA 3IHRA 4AKLA 4O8SA 4NUVA 4H9QC 4ASKA 4EZ4A 1EZ3A 2K5BB 1S35A 4HE8A 3EDUA 4I50E 2KXPB 4N78D 2Q9QA 3LJCA 4UIGA 2BZBA 5HXRA 1MNEA 5DJQC 5LHHB 4OK0A 3ZC0A 5JDQA 2ES0A 1US7B 5LNKA 3F31A 3UUXB 2LSGA 1ZV4X 3AAAB 3WI3A 3WAKA 3C4WA 3AVRA 3M65A 4B6XA 3KBUA 4MBQA 2IW5B 4MALA 4AKHA 4MLKA 4EAHA 2CXFA 4CXYA 5L3BB 2LE8A 3O9XA 2SPCA 2CM0A 2YINA 3ZJ2A 2W63A 1IZNB 1V9DA 5JDHA 5L2LA 4O2AE 5HXCA 4Z8XA 2KINB 2PFVA 5JDLA 3CVRA 4CXXA 4ZI3D 1MMNA 2JQQA 1D0XA 4J2CA 5HXSA 3KVAA 3PTRB 1UCUA 2Y48B 4EYUA 5EZYE 3GA8A 5LJMA 3CPZA 1MIWA 2MYSA 2KT9A 2K9AA 3OJAA 3BQIA 4PNIA 2W61A 3GWHA 5FXVA 1MNDA 2JMKA 2P9BA 3NZQA 2CCQA 2X9YA 2PJQA 2NOXA 3HKDE 2BVMA 3F57A 4IIJE 2V7KA 2NTYA 4TUYE 3VKHA 4FI5A 1UX5A 4L0RA 2X67A 1WRDA 3SWHA 5JRCB 4QHOA 4BJMA 4DMWA 3OYZA 2EHOC 2RP4A 2C5KT 2XAFB 2YEVC 4ZI3C 3PU8A 2KWHA 4YHJA 3PE0A 3LFMA 4UEMA 2DWKA 2CA5A 3CMLA 1WLXA 2KNDA 3FHNA 3FXEB 5FYMA 4AQFA 3HI2A 2G0UA 3C64A 3DP7A 2VKDA 2DLRA 5JDMA 5JR9B 2N2NA 5BMVE 5HWYA 4PFOA 4X1IE 3IEEA 4G63A 3S4UA 4EYYR 4ZI7E 1QUUA 2V26A 2VB6A 4GK5E 1HG5A 4QX7B 5F3JA 2V1DB 1LKXA 4HGAA 4ILUA 2W0GA 4UV9B 2ZLYA 5AFUL 2QA7A 2ODVA 3KBTA 5J1GA 5HAXA 2W00A 3MXZA 2XAQB 5H6QB 3CX8B 2DHRA 2ZM8A 5LJNA 5LA6E 2D5UA 2M67A 3ZMUB 4H9RC 3P8CD 4CI3B 2D0UA 2C0SA 2KWIB 4XBFB 2C5JA 4KBMB 2E8IA 2YU2A 2WMOA 2K48A 5JDFA 5LGNB 1HG2A 3ZYMA 2VKJA 4CI1B 4UVBB 4KMCA 4JUYA 3V5SA 1G73A 2IC9A 2WBLA 3CX7B 4PK5A 5JQGE 4P0AA 2HPLA 2BDEA 2WSSV 3ZYKA 2E9XD 4L9IA 4WBOA 3KV5A 4X1KE 2V7IA 4MFRA 3N9MA 3N5LA 1D0YA 3N9OA 3FBZA 2D0TA 4P09A 5EK4A 3KV9A 5A1LA 3Q9DA 2EHOA 4ISSA 3PUQA 4YJ3E 2W62A 1AJ3A 1HF8A 1SA0E 2WM9A 3JC6D 2CWOA 1U5PA 3CQGB 3O4XE 4HN9A 4AQGA 4IDZA 4X1YE 3ONXA 3O1HA 1HCIA 5ETWA 2UXXB 2V7JA 3BK9A 1FEWA 2NWBA 3ETUA 3ZCJA 2LHNA 3RC3A 3AAIA 2Z6EA 4QXHB 3UTKA 4M1PA 5H6RB 1ZHCA 3MA9A 4OYKA 3N9LA 2WMNA 3I0QA 3MZKB 3BQLA 4UELA 2VK9A 1QSDA 2JRKA 3LK3B 1D1CA 3F2EA 1S94A 2NW7A 3KFWX 3KVBA 4JEUB 4NUUA 3AA0B 2OA5A 2NTXA 5IYZE 4XZCA 3NBXX 2J1DG 4TX5A 2JMHA 2VKOA 3RRCA 5LP6E 1B7TA 5CA0E 1LRZA 3HA4A 4BJNA 4QX8B 2YK0A 2NW9A 2LHRA 5HXHA 2CLYC 3ZN1B 2X66A 3CKDA 1U4QA 2Y8DA 5L3GB 2XAJB 4H9PC 3ANWA 3BQKA 4K0UA 4X20E 3R84B 4CXWA 3I0OA 3OKQA 4YFSA 3MKDA 4AQFC 3K3OA 2YU1A 3FBLA 5DQVA 3HKBE 4AKRB 4BAYB 4ERRA 3P7IA 5FXZA 5LGTB 4UV8B 3NRXA 5LBQB 3DJBA 2A2FX 3O1IA 3EUHA 4ZOLE 3AA7B 3U78A 1MIYA 1VOMA 2X68A 5EK3A 2V7MA 3KV6A 1VRBA 3ETVA 4DNDA 3L3PA 4ZI2C 4F6RC 2X9WA 2IAKA 3K3NA 4OYJA 4ZHQE 3AB3B 3N2OA 5TAOA 3EDVA 2CXDA 3A5XA 2VWAA 4IE6A 2N1GA 3MACA 3E0ZA 3H37A 3T8OA 4EB6E 3SRZA 1FMVA 4UVCB 2H3RA 3B57A 5FNVE 2Q9QB 2X0LB 5J2TE 3N2GE 2IC6A 1Y64B 3C4ZA 2ACXA 4P0BA 2B1EA 2HH7A 3N2KE 4KUMB 3ZLIA 1WYBA 4I43B 1IJ5A 2HPJA 2LSYA 2H7VC 2VL8A 2NW8A 3KV4A 3C51A 4QXBB 4AI6A 2E9XB 1HS7A 3LBXB 3K3QC 5DQWA 4CZZB 1X79A 2LEHA 2QGSA 2PG8A 4H63H 4PK4A 5FP3A 2MTQA 4G2AA 2C5IT 4IE0A 2DNXA 1BR4A 2DI4A 4PAGA 4I55E 4GK0E 5L3EB 4GOUA 1G8XA 4GYRA 2L3LA 4WW0A 2CWYA 2I59A 3IF8B 3Q2MA 3CX6B 1FMWA 4WBNE 2LSJA 2ZMAA 2ZM0A 3V5UA 2A72A 1BR1A 1IJ6A 2E9XA 2JJ9A 3Q5XA 3I9WA 4A56A 3AA6B 5FY1A 2X9XA 2Q9QD 5EK2A 2CEAA 4KP3C 2RA1A 5M4YA 4U74A 3UT5E 4IGUA 2EHOD 5LGUB 2X9HA 4PJLA 3HR0A 4O4LE 4ANJA 4EIWA 2KMFA 2GK9A 1ZEEA 3GMIA 5DABA 3KINB 2JPFA 3Q5WA 3L09A 2BVLA 1YD8G 4IHJE 3TKLB 1D1AA 1YKHB 4JLEA 1BR2A 4O4HE 5CB4E 3CQXC 4C91A 3PUSA 3I1AA 3ZCIA 1Z0PA 2Y6XA 4UF0B 5JRCA 5KMGP 5FXWA 5JR9C 3HKCE 5L3DB 4L5GA 3RYCE 4O4IE 3RC8A 3I9YA 3UUMA 5C8YE 2NP9A 3ZYLA 2Q9QC 3OYXA 3K8PC 3W15B 5FY0A 5JDNA 3UULA 1E1HB 3HKEE 2MOZA 1HFAA 3D0TA 5LCYA 1MMDA 5KX5E 1KK7A 3ZMVB 4BA9A 3HL6A 3N9PA 2XASB 2VKHA 3NZPA 3VKGA 1D0ZA 4WNKA 3U3IA 4DMVA 3ZEFB 3C98B 2XQYA 4UVAB 2LOSA 1CUNA 4CQIA 5LHGB 5L3CB 2N9DA 2DCFA 3QC9A 3GN5B 3AA1B 1UX4A 5ADXL 3RX6A 2E9XC 4AXPA 3PURA 4DBQA 3ESLA 5KDMC 4YLHA 3B13A 3J7Yq 5J2UE 1OXZA 5FY7A 2UXNB 4TV8E 3N9NA 2A3DA 4E7ZA 4U72A 1HTJF 2LSKA 3ZJ1A 3GN5A 4O4JE 5LXTE 1YKEB 4OFZA 4I4TE 3C4XA 2K24A 2LT3A 4PJNA 4EXTA 3OBVE 1BR0A 2V7LA 1LVFA 2CLYB 2X51A 3ZN0B 1NWMX 5FXXA 3LK42 4QXCB 4XAXB 5LYJE 4QWNB 2VASA 3ANWB 5HWXA 3PU3A 2XAGB 3J9X1 3QK6A 4FJOA 4MHCA 1SHZC 2LSIA 1T98A 4TV9E 1IAPA 1MMAA 5GONE 4HKAA 4ISTA 3SS1A 3RRWA 4CI2B 5HXEA 1H7CA 2WWUA 1LVKA 4DVDA 3WAJA 4H63V 3CWZB 3LK2B 4UXNB 4V1Av 2H7OA 1MMGA 3FB2A 1WYCA 4TN7B 4UF0A 3FXDB 2LOPA 3JC6C 2CE7A 4IE4A 5LOVE 4YJ2E 4EOZB 4H9SE 3H3AA 4PK6A 5E0OA 3MJXA 3NRYA 4TZ4C 3RYIE 4QKNA 1OWAA 4HTEA 3E08A 5JDGA 1O3XA 2DWGA 3RH3A 2CMRA 3ZMTB 2L9QA 5FMNA 4PW8A 4ZS3A 3QUJA 1HX8A 3C50A 5JH7E 4PJJA 2KLQA 4DBRA 5L3FB 4O2BE 3N9QA 2EHOB 4IE7A 4EZHA 5JREA 3KDSE 3CQCB 5IHYA 4GIWA 4AKIA 3AVSA 2PBIA 1YW0A 4H9NC 3RYFE 3RYHE 3PUGA 3UFEA 2L8KA 3PUAA 3UUNA 3VHLA 2D2SA 1KNZA 5F8PA 2KZ7B 4PJMA 1FIOA 5LG4A 3SOLA 3DTOA 4ADZA 2XTLA 3RPUA 5JR9A 3EVYA 4HEAA 1D1BA 5LBMA 3ZPOA 3ZMSB 4C90A 3E22E 2WAUA 4OHFA 2XAHB 2XUEA 1ZKEA 4PFPA 4JEHB 3VU7H 2LM9A 4DO0A 5HYAA 3PDYA 1WR6A 4ZI2D 2LJLA 2XHEB 3LBXA 3AAEB 3ZC1A 3ZMZB 2ZM2A 3R6NA 3IBPA 4AKGA 5LHIB 2MBGA 4HFVA 1NAFA 4H9OC 4E7SA 5JVDE 4ZS2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1US7 B;  2K5B B;  2W0G A; 
#chains in the Genus database with same CATH topology
 5FVK A;  4GYS A;  4DR5 T;  4Q25 A;  2NR4 A;  2ODU A;  5CA1 E;  3LG7 A;  3RKO A;  1MIV A;  5AQM B;  3O1J A;  4IE5 A;  3MK7 C;  2CXL A;  2QRX A;  3IHR A;  4ILB A;  4AKL A;  5LMU T;  4B3S T;  4O8S A;  4NUV A;  2LLY A;  4H9Q C;  4ASK A;  4DID B;  1EZ3 A;  2K5B B;  4EZ4 A;  1S35 A;  4HE8 A;  3EDU A;  4I50 E;  2KXP B;  4N78 D;  2Q9Q A;  3LJC A;  2E2A A;  2BZB A;  3AE3 A;  1MNE A;  4UIG A;  5DJQ C;  4OK0 A;  3ZSS A;  5LHH B;  3ZC0 A;  3TLS A;  5JDQ A;  3P50 A;  4JI1 T;  2ES0 A;  2V5C A;  1US7 B;  5LNK A;  3F31 A;  3UUX B;  1L0V A;  2LSG A;  5AQV B;  1ZV4 X;  3AAA B;  3WI3 A;  3WAK A;  3C4W A;  3AVR A;  3M65 A;  4B6X A;  4LFA T;  1BR0 A;  3K1S A;  3P4W A;  3KBU A;  4MBQ A;  4U33 A;  3ZT7 A;  2IW5 B;  4MAL A;  4Z90 A;  4DUZ T;  4AKH A;  4MLK A;  4EAH A;  2CXF A;  4NXN T;  4CXY A;  5J0Z A;  3PUV F;  5L3B B;  1KFY A;  3PUX F;  2LE8 A;  3RQW A;  3O9X A;  2SPC A;  2CM0 A;  2YIN A;  3ZJ2 A;  2W67 A;  2W63 A;  1IZN B;  1V9D A;  5JDH A;  5L2L A;  4O2A E;  5HXC A;  4Z8X A;  1OED C;  2KIN B;  2PFV A;  3UQ4 A;  2DL1 A;  3RIF A;  5JDL A;  3CVR A;  4CXX A;  4ZI3 D;  1MMN A;  2JQQ A;  1D0X A;  4J2C A;  1HNX T;  5HXS A;  3P4P A;  1SE7 A;  1J1J A;  3KVA A;  1SUM B;  2V8S V;  3PTR B;  1UCU A;  2Y48 B;  3AE7 A;  4EYU A;  5LG3 A;  4DR6 T;  1JNR A;  3GA8 A;  1E7P A;  3CPZ A;  5EZY E;  1UGO A;  5AQS B;  3RKG A;  4U31 A;  1MIW A;  2MYS A;  2KT9 A;  3ZKR A;  2CRB A;  2K9A A;  3RHW A;  3OJA A;  3BQI A;  4PNI A;  4JI8 T;  2W61 A;  3GWH A;  5FXV A;  1MND A;  2JMK A;  2P9B A;  4DV0 T;  4YY3 T;  3NZQ A;  2JIW A;  4I0U A;  2CCQ A;  4IT4 A;  2X9Y A;  2PJQ A;  2NOX A;  3HKD E;  2BVM A;  3F57 A;  5HXR A;  3H3M A;  4IIJ E;  2CBI A;  2XQ9 A;  2W2U A;  4ZEY A;  2V7K A;  1HNZ T;  2MAW A;  2NTY A;  3RGL A;  4TUY E;  4JYA T;  3VKH A;  4FI5 A;  4DR3 T;  2XM1 A;  2BKN A;  4X65 T;  1UX5 A;  3AE6 A;  1I6Z A;  3UU4 A;  4L0R A;  2X67 A;  1WRD A;  4ILA A;  3SWH A;  5JRC B;  2VVS A;  4QHO A;  4ZXL A;  3JAE A;  4BJM A;  2WS3 A;  4DV1 T;  4DMW A;  3OYZ A;  2EHO C;  3PJA A;  2IML A;  2RP4 A;  2C5K T;  1J5W A;  2XQ4 A;  2XAF B;  5HEG A;  2YEV C;  4B3T T;  4ZI3 C;  3PU8 A;  2KWH A;  4YHJ A;  3PE0 A;  3LFM A;  2XQ6 A;  2B76 A;  2DWK A;  2CA5 A;  2YDR A;  1WLX A;  2KND A;  3CML A;  3FHN A;  3FXE B;  2WQY A;  5FYM A;  4AQF A;  3HI2 A;  4TNV A;  2G0U A;  3C64 A;  3FZH B;  3DP7 A;  2VKD A;  4QH1 A;  2DLR A;  4UR9 A;  5AQF B;  5JDM A;  2N2N A;  5JR9 B;  5LXT E;  4NIQ A;  5HWY A;  4PFO A;  5BMV E;  4X1I E;  3IEE A;  4G63 A;  3EAB A;  1XWM A;  3S4U A;  2WDV A;  1QUU A;  2V26 A;  4EYY R;  2AE9 A;  4ZI7 E;  2VB6 A;  4YXD A;  4GK5 E;  5C2T A;  3B5M A;  1HG5 A;  5AQP B;  4QX7 B;  5F3J A;  4YT0 A;  2V1D B;  1LKX A;  3AEE A;  4HGA A;  4ILU A;  2W0G A;  4UV9 B;  2ZLY A;  4A98 A;  5AFU L;  2HN1 A;  2QA7 A;  2ODV A;  3EI0 A;  3KBT A;  4HFC A;  2YKS A;  5HAX A;  5J1G A;  4HFD A;  1E2A A;  2W4X A;  2W00 A;  2XAQ B;  3MXZ A;  3CX8 B;  5H6Q B;  3VRB A;  2DHR A;  2ZM8 A;  5LJN A;  5LA6 E;  4JI6 T;  3JAD A;  3OVU A;  2D5U A;  3TLW A;  2M67 A;  1I94 T;  3ZMU B;  4H9R C;  4KX6 A;  3P8C D;  4GKK T;  1W0A A;  2D0U A;  2C0S A;  2KWI B;  3JAF A;  2C5J A;  4CI3 B;  4XBF B;  4DV3 T;  4KBM B;  2E8I A;  2YU2 A;  2WMO A;  2V6Y A;  2K48 A;  5JDF A;  5LGN B;  1HG2 A;  1W0B A;  3ZYM A;  2VKJ A;  3A8Y C;  4CI1 B;  5IUX A;  4UVB B;  4KMC A;  5AQI B;  2E5V A;  4JUY A;  2BG9 B;  3V5S A;  4A97 A;  1G73 A;  2YDS A;  2VUR A;  2IC9 A;  4ZZC A;  2WBL A;  3CX7 B;  4PK5 A;  5LB7 B;  2XQA A;  5JQG E;  4P0A A;  2HPL A;  2BDE A;  2WSS V;  3SFE A;  2E9X D;  1UUS A;  4L9I A;  4WBO A;  3ZYK A;  3KV5 A;  4X1K E;  1J5E T;  4YHH T;  2V7I A;  4MFR A;  4U2Y A;  4AQY T;  3AE8 A;  3TLT A;  3UUB A;  4LF7 T;  3N9M A;  3N5L A;  1D0Y A;  3N9O A;  3FBZ A;  2D0T A;  3ONL C;  4P09 A;  5EK4 A;  3KV9 A;  4LF9 T;  2YN6 A;  3T1Y T;  5A1L A;  4U7I A;  5HEH A;  1KNR A;  4LMJ A;  3Q9D A;  2EHO A;  1VCS A;  2WU2 A;  3FZM B;  3PUQ A;  4ISS A;  2WZH A;  4U2Z A;  2W62 A;  2H88 A;  1HF8 A;  4YJ3 E;  4F8H A;  4HWF A;  1AJ3 A;  1SA0 E;  2WM9 A;  3JC6 D;  2CWO A;  1U5P A;  3CQG B;  2WB5 A;  3JCF A;  4LFB T;  3O4X E;  4HN9 A;  4AQG A;  4IDZ A;  2XSA A;  3ONX A;  3O1H A;  4X1Y E;  1HCI A;  5HCJ A;  5ETW A;  2UXX B;  2V7J A;  3BK9 A;  1FEW A;  2NWB A;  4P1N A;  3ETU A;  4KHP T;  3ZCJ A;  2LHN A;  3RC3 A;  3AAI A;  2Z6E A;  4QXH B;  3UTK A;  2E5L T;  4JV5 T;  4M1P A;  4HWH A;  1ZHC A;  3MA9 A;  4OYK A;  3N9L A;  2WMN A;  4QH5 A;  5H6R B;  5C3J A;  3I0Q A;  3MZK B;  2K3W A;  3BQL A;  4QH4 A;  4UEL A;  2FJA A;  2VK9 A;  1QSD A;  2JRK A;  3LK3 B;  5AQQ B;  1D1C A;  3F2E A;  1S94 A;  2JQK A;  2NW7 A;  3KFW X;  3ZT6 A;  3KVB A;  4JEU B;  4NUU A;  3UU6 A;  3AA0 B;  2OA5 A;  2NTX A;  5AQL B;  4XZC A;  5IYZ E;  3NBX X;  4NPP A;  4LF6 T;  2J1D G;  4TX5 A;  5HEU A;  3ABV A;  4JI0 T;  2JMH A;  2VKO A;  2VVN A;  3AEB A;  1B7T A;  3RRC A;  4IDQ A;  5CA0 E;  3NKZ A;  1LRZ A;  5LP6 E;  3HA4 A;  4BJN A;  4QX8 B;  2XQ8 A;  2YK0 A;  1VCT A;  4HWC A;  2LHR A;  2NW9 A;  4EEB A;  3G06 A;  2WDQ A;  5HXH A;  2CLY C;  3ZN1 B;  2X66 A;  3CKD A;  1U4Q A;  2Y8D A;  5L3G B;  2ZM6 T;  2XAJ B;  4H9P C;  4EXT A;  3ANW A;  3AEF A;  3BQK A;  4K0U A;  4X20 E;  3R84 B;  4CXW A;  2WCA A;  3I0O A;  3OKQ A;  4LML A;  3MKD A;  4YFS A;  4ZZB A;  1IBL T;  3RLF F;  3K3O A;  2YU1 A;  3FBL A;  5DQV A;  3HKB E;  4AKR B;  4AQF C;  4BAY B;  4ERR A;  3P7I A;  4HWD A;  5FXZ A;  5LGT B;  4UV8 B;  3NRX A;  5LBQ B;  3DJB A;  2IUB A;  2WDR A;  2A2F X;  3O1I A;  2XZE A;  3EUH A;  2H89 A;  4ZOL E;  5F5W A;  3AA7 B;  3U78 A;  1MIY A;  1VOM A;  2BS3 A;  2X68 A;  5EK3 A;  1N36 T;  1W9R A;  2V7M A;  3KV6 A;  1VRB A;  3VRA A;  3ETV A;  4DND A;  3L3P A;  4ZI2 C;  4AIS A;  3P4R A;  4IL9 A;  4F6R C;  2CPT A;  5AQG B;  5ABH A;  1FJG T;  2UXD T;  2X9W A;  2IAK A;  2UUA T;  3K3N A;  4OYJ A;  2QVA A;  2W66 A;  3FZF B;  5HEO A;  3RIA A;  4ZHQ E;  4DR1 T;  3AB3 B;  3N2O A;  4JBW F;  5TAO A;  3EDV A;  2CXD A;  3A5X A;  2VWA A;  1CHU A;  4IE6 A;  2N1G A;  3MAC A;  3E0Z A;  3H37 A;  3T8O A;  4YTM A;  3SRZ A;  4EB6 E;  4DV5 T;  1N34 T;  2OV9 A;  4GKJ T;  1FMV A;  3AE9 A;  4UVC B;  2H3R A;  2LM2 A;  3B57 A;  5FNV E;  1IBK T;  4IL4 A;  3UU8 A;  2Q9Q B;  2X0L B;  5J2T E;  3N2G E;  2IC6 A;  2XM2 A;  1Y64 B;  2BBH A;  3C4Z A;  3AEA A;  2ACX A;  4P0B A;  3P4S A;  1IBM T;  4CN4 A;  2B1E A;  2HH7 A;  3N2K E;  1XDP A;  4KUM B;  2CBJ A;  3AE4 A;  2LRL A;  3QB5 K;  3ZLI A;  5AQU B;  1WYB A;  4I43 B;  1IJ5 A;  2HPJ A;  4AIU A;  3CIR A;  5ABG A;  2LSY A;  4NXM T;  2H7V C;  2IIU A;  4EV6 A;  5FL0 A;  2VL8 A;  3OPC A;  2NW8 A;  3KV4 A;  3C51 A;  4QXB B;  5ABF B;  4AI6 A;  2E9X B;  1HS7 A;  1JNZ A;  3LBX B;  3K3Q C;  5DQW A;  5L47 A;  4CZZ B;  1X79 A;  2LEH A;  2QGS A;  2QYW A;  2PG8 A;  4H63 H;  4PK4 A;  4DR2 T;  1XDO A;  5FP3 A;  2MTQ A;  4G2A A;  2C5I T;  4IE0 A;  4TWD A;  3T1H T;  4JI4 T;  2XY8 B;  2DNX A;  1BR4 A;  1YXR A;  1WCR A;  2YOE A;  2DI4 A;  4PAG A;  4I55 E;  4OX9 T;  5L4H A;  4TWH A;  3RIU C;  4GK0 E;  5L3E B;  4EED A;  4GOU A;  1G8X A;  1Z8U A;  4DV2 T;  4GYR A;  2L3L A;  2BKP A;  4WW0 A;  2V6Y B;  4UEM A;  5FVL A;  4JI5 T;  2CWY A;  2I59 A;  3IF8 B;  3Q2M A;  5AQT B;  3QNU A;  3CX6 B;  1FMW A;  5CJ5 A;  3VR8 A;  1YQ3 A;  2AXD S;  5AQJ B;  2OLT A;  1NEN A;  4WBN E;  2LSJ A;  2ZMA A;  2ZM0 A;  3V5U A;  1M62 A;  2A72 A;  1BR1 A;  1IJ6 A;  1HR0 T;  2E9X A;  2JJ9 A;  3NVO A;  3Q5X A;  3I9W A;  2YDQ A;  4A56 A;  5AQO B;  3AA6 B;  3ZST A;  3LDQ B;  5ABF A;  4EGW A;  3QB5 A;  2XQ7 A;  4WZX A;  5FY1 A;  2X9X A;  1XZY A;  2Q9Q D;  2XQ3 A;  3AE1 A;  3Q5D A;  5EK2 A;  4X62 T;  2CEA A;  4KP3 C;  1T72 A;  2RA1 A;  3LSV A;  3FZL B;  5M4Y A;  2HHH T;  3VR9 A;  1WFD A;  4U74 A;  3UT5 E;  4IGU A;  2EHO D;  5LGU B;  2X9H A;  4PJL A;  3HR0 A;  4O4L E;  4U3C A;  4ANJ A;  2KMF A;  3EAM A;  4EIW A;  4B3M T;  2GK9 A;  1ZEE A;  4TWF A;  3GMI A;  5DAB A;  3KIN B;  2JPF A;  3Q5W A;  3L09 A;  4HFH A;  1KF6 A;  2BVL A;  3AXJ B;  2BS2 A;  1YD8 G;  1W09 A;  4IHJ E;  5AQN B;  3TKL B;  2UUB T;  1D1A A;  1YKH B;  4JLE A;  2LKH A;  4DUY T;  1BR2 A;  3L8R A;  4O4H E;  4TNW A;  3EHZ A;  5CB4 E;  3CQX C;  4C91 A;  3PUS A;  4K0K T;  3I1A A;  2MPK A;  3ZT5 A;  3ZCI A;  5KXJ A;  1Z0P A;  2Y6X A;  3L39 A;  4UF0 B;  3RF1 A;  2J4G A;  3TLV A;  3UU3 A;  5JRC A;  1Y01 A;  2I0M A;  1X9B A;  3PJA J;  5KMG P;  5FXW A;  5JTG A;  5JR9 C;  3HKC E;  5L3D B;  4L5G A;  3A7M A;  3RYC E;  4O4I E;  3AED A;  3RC8 A;  3CK6 A;  3I9Y A;  2FJB A;  3UUM A;  5C8Y E;  2NP9 A;  3ZYL A;  2Q9Q C;  3OYX A;  2J62 A;  3K8P C;  3W15 B;  2UXB T;  5FY0 A;  5JDN A;  3UUL A;  4DR4 T;  5CGM A;  1E1H B;  3FZK B;  3HKE E;  4JI2 T;  2MOZ A;  1HFA A;  2XQ5 A;  3D0T A;  5LCY A;  1MMD A;  3SFD A;  1KK7 A;  5KX5 E;  5AQR B;  3ZMV B;  4BA9 A;  3HL6 A;  3RIU A;  4LF5 T;  4YSX A;  3N9P A;  2XAS B;  2VKH A;  3NZP A;  4DV6 T;  2X0Y A;  2F4V T;  1XMO T;  5FKY A;  3VKG A;  1D0Z A;  2WWV A;  2WP9 A;  4WNK A;  4Z91 A;  3U3I A;  3NWI A;  1UUR A;  4DMV A;  3C98 B;  2XQY A;  3ZEF B;  3UQ7 A;  1HNW T;  4UVA B;  1UK5 A;  3M3Z B;  2LOS A;  1CUN A;  4CQI A;  1YQ4 A;  5LHG B;  2LKG A;  5L3C B;  2N9D A;  2DCF A;  3QC9 A;  3GN5 B;  3AA1 B;  4ILC A;  1UX4 A;  5ADX L;  4KHZ F;  3RX6 A;  2E9X C;  5FL1 A;  4AXP A;  3PUR A;  4DBQ A;  2KSR A;  4JI3 T;  3ESL A;  4WYV A;  5KDM C;  4YLH A;  3B13 A;  3J7Y q;  4HWI B;  1ZOY A;  2XSB A;  5J2U E;  1N33 T;  1OXZ A;  5FY7 A;  2UXN B;  4TV8 E;  3N9N A;  2A3D A;  4E7Z A;  4U72 A;  1HTJ F;  2LSK A;  3ZJ1 A;  3GN5 A;  4O4J E;  3UFG A;  1YKE B;  4OFZ A;  4I4T E;  3C4X A;  2K24 A;  1R8I A;  2LT3 A;  2VL0 A;  3OBV E;  4PJN A;  2V7L A;  4YTN A;  1LVF A;  2CLY B;  2X51 A;  3PV0 F;  2M6I A;  3ZN0 B;  2JQ9 A;  1HX1 B;  4HFB A;  5CFB A;  1NWM X;  2ACZ A;  5FXX A;  2PTF A;  3LK4 2;  4QXC B;  4XAX B;  3AEC A;  1XMQ T;  4LFC T;  4X66 T;  5LYJ E;  4IDP A;  4QWN B;  2VAS A;  3ANW B;  3P4Q A;  3PU3 A;  1T7S A;  5HWX A;  5LMN T;  2XAG B;  4DR7 T;  3J9X 1;  3RQU A;  3QK6 A;  2RPA A;  2WU5 A;  4FJO A;  4MHC A;  2VQE T;  1SHZ C;  1M7K A;  2LSI A;  1T98 A;  2BS4 A;  1IAP A;  2LRK A;  1MMA A;  4IDO A;  4TV9 E;  4X5T A;  5GON E;  2FJE A;  4HKA A;  2IDO B;  4IST A;  2XJ7 A;  3RRW A;  2FJD A;  3SS1 A;  4CI2 B;  1H7C A;  5HXE A;  1DU2 A;  4LMK A;  2WWU A;  1LVK A;  4DVD A;  3WAJ A;  4H63 V;  5AQK B;  3CWZ B;  3LK2 B;  2UU9 T;  4UXN B;  4V1A v;  2H7O A;  2HN2 A;  1MMG A;  1N32 T;  3FB2 A;  1WYC A;  3X1D A;  4TN7 B;  4UF0 A;  2CHN A;  2LOP A;  3FXD B;  3JC6 C;  4CN1 A;  3ONJ A;  2CE7 A;  4IE4 A;  1OED E;  5LOV E;  4EOZ B;  4YJ2 E;  3Q5E A;  2XPK A;  3H3A A;  3QOF A;  4H9S E;  4PK6 A;  5E0O A;  2BKO A;  3MJX A;  3NRY A;  4TZ4 C;  1GQE A;  3RYI E;  4QKN A;  1OWA A;  2BG9 E;  3AXJ A;  4HTE A;  3E08 A;  5JDG A;  1O3X A;  1ZP0 A;  1WR0 A;  4YSY A;  5HEJ A;  2DWG A;  3AEG A;  2V5D A;  3RH3 A;  2X0H A;  3PUW F;  3AE2 A;  2CMR A;  5HCM A;  3ZMT B;  2L9Q A;  4YTP A;  5FMN A;  4PW8 A;  1XNQ T;  2UXC T;  2UUC T;  1OED B;  4ZS3 A;  3QUJ A;  1HX8 A;  4DV7 T;  3C50 A;  5JH7 E;  4PJJ A;  2BG9 C;  2KLQ A;  4DBR A;  5L3F B;  4O2B E;  3N9Q A;  2EHO B;  4IE7 A;  4EZH A;  5JRE A;  3KDS E;  2J47 A;  3AE5 A;  3CQC B;  4U7Y A;  5IHY A;  4GIW A;  4COF A;  4AKI A;  4CN6 A;  1NEK A;  3AVS A;  3IA3 A;  2D9D A;  2PBI A;  1YW0 A;  4JI7 T;  1KEY A;  4H9N C;  4YSZ A;  3RYF E;  4B3R T;  3PUY F;  2WY2 A;  3PUG A;  3RYH E;  3UFE A;  2L8K A;  3PUA A;  3UUN A;  3VHL A;  2D2S A;  1KNZ A;  5LJM A;  5F8P A;  1OED A;  2KZ7 B;  4PJM A;  1FIO A;  2CHO A;  1T8B A;  2I6H A;  5L4E A;  5LG4 A;  5IWA T;  3SOL A;  3DTO A;  2BBJ A;  4ADZ A;  2XTL A;  3RPU A;  2A9U A;  4IRE A;  4HFI A;  2BG9 A;  3EVY A;  1D1B A;  2FBW A;  4HEA A;  5JR9 A;  3RI5 A;  3UU5 A;  5LBM A;  4X64 T;  3ZPO A;  5BR8 T;  2WZI A;  4IDN A;  3ZMS B;  1KNP A;  3TLU A;  5AQH B;  3E22 E;  4C90 A;  1QLB A;  2FUP A;  2V6X A;  2WAU A;  4OHF A;  2R6G F;  2XAH B;  4HFE A;  2XUE A;  1ZKE A;  4PFP A;  1XNR T;  4JEH B;  3VU7 H;  2LM9 A;  4DO0 A;  5HYA A;  3PDY A;  2M6B A;  1WR6 A;  4DV4 T;  4LF8 T;  4ZI2 D;  2JQH A;  2LJL A;  4LF4 T;  2XHE B;  3LBX A;  4A5X A;  3AAE B;  2IHR 1;  3ZC1 A;  3ZMZ B;  2ZM2 A;  4KI0 F;  3R6N A;  3IBP A;  4AKG A;  3PUZ F;  5LHI B;  5ABE A;  2MBG A;  4HFV A;  1NAF A;  4H9O C;  3OTO T;  4E7S A;  5JVD E;  4ZS2 A;  2VQF T; 
#chains in the Genus database with same CATH homology
 4GYS A;  2ODU A;  5CA1 E;  3LG7 A;  3RKO A;  1MIV A;  3O1J A;  4IE5 A;  3MK7 C;  2CXL A;  3IHR A;  4AKL A;  4O8S A;  4NUV A;  4H9Q C;  4ASK A;  4EZ4 A;  1EZ3 A;  2K5B B;  1S35 A;  4HE8 A;  3EDU A;  4I50 E;  2KXP B;  4N78 D;  2Q9Q A;  3LJC A;  4UIG A;  2BZB A;  5HXR A;  1MNE A;  5DJQ C;  5LHH B;  4OK0 A;  3ZC0 A;  5JDQ A;  2ES0 A;  1US7 B;  5LNK A;  3F31 A;  3UUX B;  2LSG A;  1ZV4 X;  3AAA B;  3WI3 A;  3WAK A;  3C4W A;  3AVR A;  3M65 A;  4B6X A;  3KBU A;  4MBQ A;  2IW5 B;  4MAL A;  4AKH A;  4MLK A;  4EAH A;  2CXF A;  4CXY A;  5L3B B;  2LE8 A;  3O9X A;  2SPC A;  2CM0 A;  2YIN A;  3ZJ2 A;  2W63 A;  1IZN B;  1V9D A;  5JDH A;  5L2L A;  4O2A E;  5HXC A;  4Z8X A;  2KIN B;  2PFV A;  5JDL A;  3CVR A;  4CXX A;  4ZI3 D;  1MMN A;  2JQQ A;  1D0X A;  4J2C A;  5HXS A;  3KVA A;  3PTR B;  1UCU A;  2Y48 B;  4EYU A;  5EZY E;  3GA8 A;  5LJM A;  3CPZ A;  1MIW A;  2MYS A;  2KT9 A;  2K9A A;  3OJA A;  3BQI A;  4PNI A;  2W61 A;  3GWH A;  5FXV A;  1MND A;  2JMK A;  2P9B A;  3NZQ A;  2CCQ A;  2X9Y A;  2PJQ A;  2NOX A;  3HKD E;  2BVM A;  3F57 A;  4IIJ E;  2V7K A;  2NTY A;  4TUY E;  3VKH A;  4FI5 A;  1UX5 A;  4L0R A;  2X67 A;  1WRD A;  3SWH A;  5JRC B;  4QHO A;  4BJM A;  4DMW A;  3OYZ A;  2EHO C;  2RP4 A;  2C5K T;  2XAF B;  2YEV C;  4ZI3 C;  3PU8 A;  2KWH A;  4YHJ A;  3PE0 A;  3LFM A;  4UEM A;  2DWK A;  2CA5 A;  3CML A;  1WLX A;  2KND A;  3FHN A;  3FXE B;  5FYM A;  4AQF A;  3HI2 A;  2G0U A;  3C64 A;  3DP7 A;  2VKD A;  2DLR A;  5JDM A;  5JR9 B;  2N2N A;  5BMV E;  5HWY A;  4PFO A;  4X1I E;  3IEE A;  4G63 A;  3S4U A;  4EYY R;  4ZI7 E;  1QUU A;  2V26 A;  2VB6 A;  4GK5 E;  1HG5 A;  4QX7 B;  5F3J A;  2V1D B;  1LKX A;  4HGA A;  4ILU A;  2W0G A;  4UV9 B;  2ZLY A;  5AFU L;  2QA7 A;  2ODV A;  3KBT A;  5J1G A;  5HAX A;  2W00 A;  3MXZ A;  2XAQ B;  5H6Q B;  3CX8 B;  2DHR A;  2ZM8 A;  5LJN A;  5LA6 E;  2D5U A;  2M67 A;  3ZMU B;  4H9R C;  3P8C D;  4CI3 B;  2D0U A;  2C0S A;  2KWI B;  4XBF B;  2C5J A;  4KBM B;  2E8I A;  2YU2 A;  2WMO A;  2K48 A;  5JDF A;  5LGN B;  1HG2 A;  3ZYM A;  2VKJ A;  4CI1 B;  4UVB B;  4KMC A;  4JUY A;  3V5S A;  1G73 A;  2IC9 A;  2WBL A;  3CX7 B;  4PK5 A;  5JQG E;  4P0A A;  2HPL A;  2BDE A;  2WSS V;  3ZYK A;  2E9X D;  4L9I A;  4WBO A;  3KV5 A;  4X1K E;  2V7I A;  4MFR A;  3N9M A;  3N5L A;  1D0Y A;  3N9O A;  3FBZ A;  2D0T A;  4P09 A;  5EK4 A;  3KV9 A;  5A1L A;  3Q9D A;  2EHO A;  4ISS A;  3PUQ A;  4YJ3 E;  2W62 A;  1AJ3 A;  1HF8 A;  1SA0 E;  2WM9 A;  3JC6 D;  2CWO A;  1U5P A;  3CQG B;  3O4X E;  4HN9 A;  4AQG A;  4IDZ A;  4X1Y E;  3ONX A;  3O1H A;  1HCI A;  5ETW A;  2UXX B;  2V7J A;  3BK9 A;  1FEW A;  2NWB A;  3ETU A;  3ZCJ A;  2LHN A;  3RC3 A;  3AAI A;  2Z6E A;  4QXH B;  3UTK A;  4M1P A;  5H6R B;  1ZHC A;  3MA9 A;  4OYK A;  3N9L A;  2WMN A;  3I0Q A;  3MZK B;  3BQL A;  4UEL A;  2VK9 A;  1QSD A;  2JRK A;  3LK3 B;  1D1C A;  3F2E A;  1S94 A;  2NW7 A;  3KFW X;  3KVB A;  4JEU B;  4NUU A;  3AA0 B;  2OA5 A;  2NTX A;  5IYZ E;  4XZC A;  3NBX X;  2J1D G;  4TX5 A;  2JMH A;  2VKO A;  3RRC A;  5LP6 E;  1B7T A;  5CA0 E;  1LRZ A;  3HA4 A;  4BJN A;  4QX8 B;  2YK0 A;  2NW9 A;  2LHR A;  5HXH A;  2CLY C;  3ZN1 B;  2X66 A;  3CKD A;  1U4Q A;  2Y8D A;  5L3G B;  2XAJ B;  4H9P C;  3ANW A;  3BQK A;  4K0U A;  4X20 E;  3R84 B;  4CXW A;  3I0O A;  3OKQ A;  4YFS A;  3MKD A;  4AQF C;  3K3O A;  2YU1 A;  3FBL A;  5DQV A;  3HKB E;  4AKR B;  4BAY B;  4ERR A;  3P7I A;  5FXZ A;  5LGT B;  4UV8 B;  3NRX A;  5LBQ B;  3DJB A;  2A2F X;  3O1I A;  3EUH A;  4ZOL E;  3AA7 B;  3U78 A;  1MIY A;  1VOM A;  2X68 A;  5EK3 A;  2V7M A;  3KV6 A;  1VRB A;  3ETV A;  4DND A;  3L3P A;  4ZI2 C;  4F6R C;  2X9W A;  2IAK A;  3K3N A;  4OYJ A;  4ZHQ E;  3AB3 B;  3N2O A;  5TAO A;  3EDV A;  2CXD A;  3A5X A;  2VWA A;  4IE6 A;  2N1G A;  3MAC A;  3E0Z A;  3H37 A;  3T8O A;  4EB6 E;  3SRZ A;  1FMV A;  4UVC B;  2H3R A;  3B57 A;  5FNV E;  2Q9Q B;  2X0L B;  5J2T E;  3N2G E;  2IC6 A;  1Y64 B;  3C4Z A;  2ACX A;  4P0B A;  2B1E A;  2HH7 A;  3N2K E;  4KUM B;  3ZLI A;  1WYB A;  4I43 B;  1IJ5 A;  2HPJ A;  2LSY A;  2H7V C;  2VL8 A;  2NW8 A;  3KV4 A;  3C51 A;  4QXB B;  4AI6 A;  2E9X B;  1HS7 A;  3LBX B;  3K3Q C;  5DQW A;  4CZZ B;  1X79 A;  2LEH A;  2QGS A;  2PG8 A;  4H63 H;  4PK4 A;  5FP3 A;  2MTQ A;  4G2A A;  2C5I T;  4IE0 A;  2DNX A;  1BR4 A;  2DI4 A;  4PAG A;  4I55 E;  4GK0 E;  5L3E B;  4GOU A;  1G8X A;  4GYR A;  2L3L A;  4WW0 A;  2CWY A;  2I59 A;  3IF8 B;  3Q2M A;  3CX6 B;  1FMW A;  4WBN E;  2LSJ A;  2ZMA A;  2ZM0 A;  3V5U A;  2A72 A;  1BR1 A;  1IJ6 A;  2E9X A;  2JJ9 A;  3Q5X A;  3I9W A;  4A56 A;  3AA6 B;  5FY1 A;  2X9X A;  2Q9Q D;  5EK2 A;  2CEA A;  4KP3 C;  2RA1 A;  5M4Y A;  4U74 A;  3UT5 E;  4IGU A;  2EHO D;  5LGU B;  2X9H A;  4PJL A;  3HR0 A;  4O4L E;  4ANJ A;  4EIW A;  2KMF A;  2GK9 A;  1ZEE A;  3GMI A;  5DAB A;  3KIN B;  2JPF A;  3Q5W A;  3L09 A;  2BVL A;  1YD8 G;  4IHJ E;  3TKL B;  1D1A A;  1YKH B;  4JLE A;  1BR2 A;  4O4H E;  5CB4 E;  3CQX C;  4C91 A;  3PUS A;  3I1A A;  3ZCI A;  1Z0P A;  2Y6X A;  4UF0 B;  5JRC A;  5KMG P;  5FXW A;  5JR9 C;  3HKC E;  5L3D B;  4L5G A;  3RYC E;  4O4I E;  3RC8 A;  3I9Y A;  3UUM A;  5C8Y E;  2NP9 A;  3ZYL A;  2Q9Q C;  3OYX A;  3K8P C;  3W15 B;  5FY0 A;  5JDN A;  3UUL A;  1E1H B;  3HKE E;  2MOZ A;  1HFA A;  3D0T A;  5LCY A;  1MMD A;  5KX5 E;  1KK7 A;  3ZMV B;  4BA9 A;  3HL6 A;  3N9P A;  2XAS B;  2VKH A;  3NZP A;  3VKG A;  1D0Z A;  4WNK A;  3U3I A;  4DMV A;  3ZEF B;  3C98 B;  2XQY A;  4UVA B;  2LOS A;  1CUN A;  4CQI A;  5LHG B;  5L3C B;  2N9D A;  2DCF A;  3QC9 A;  3GN5 B;  3AA1 B;  1UX4 A;  5ADX L;  3RX6 A;  2E9X C;  4AXP A;  3PUR A;  4DBQ A;  3ESL A;  5KDM C;  4YLH A;  3B13 A;  3J7Y q;  5J2U E;  1OXZ A;  5FY7 A;  2UXN B;  4TV8 E;  3N9N A;  2A3D A;  4E7Z A;  4U72 A;  1HTJ F;  2LSK A;  3ZJ1 A;  3GN5 A;  4O4J E;  5LXT E;  1YKE B;  4OFZ A;  4I4T E;  3C4X A;  2K24 A;  2LT3 A;  4PJN A;  4EXT A;  3OBV E;  1BR0 A;  2V7L A;  1LVF A;  2CLY B;  2X51 A;  3ZN0 B;  1NWM X;  5FXX A;  3LK4 2;  4QXC B;  4XAX B;  5LYJ E;  4QWN B;  2VAS A;  3ANW B;  5HWX A;  3PU3 A;  2XAG B;  3J9X 1;  3QK6 A;  4FJO A;  4MHC A;  1SHZ C;  2LSI A;  1T98 A;  4TV9 E;  1IAP A;  1MMA A;  5GON E;  4HKA A;  4IST A;  3SS1 A;  3RRW A;  4CI2 B;  5HXE A;  1H7C A;  2WWU A;  1LVK A;  4DVD A;  3WAJ A;  4H63 V;  3CWZ B;  3LK2 B;  4UXN B;  4V1A v;  2H7O A;  1MMG A;  3FB2 A;  1WYC A;  4TN7 B;  4UF0 A;  3FXD B;  2LOP A;  3JC6 C;  2CE7 A;  4IE4 A;  5LOV E;  4YJ2 E;  4EOZ B;  4H9S E;  3H3A A;  4PK6 A;  5E0O A;  3MJX A;  3NRY A;  4TZ4 C;  3RYI E;  4QKN A;  1OWA A;  4HTE A;  3E08 A;  5JDG A;  1O3X A;  2DWG A;  3RH3 A;  2CMR A;  3ZMT B;  2L9Q A;  5FMN A;  4PW8 A;  4ZS3 A;  3QUJ A;  1HX8 A;  3C50 A;  5JH7 E;  4PJJ A;  2KLQ A;  4DBR A;  5L3F B;  4O2B E;  3N9Q A;  2EHO B;  4IE7 A;  4EZH A;  5JRE A;  3KDS E;  3CQC B;  5IHY A;  4GIW A;  4AKI A;  3AVS A;  2PBI A;  1YW0 A;  4H9N C;  3RYF E;  3RYH E;  3PUG A;  3UFE A;  2L8K A;  3PUA A;  3UUN A;  3VHL A;  2D2S A;  1KNZ A;  5F8P A;  2KZ7 B;  4PJM A;  1FIO A;  5LG4 A;  3SOL A;  3DTO A;  4ADZ A;  2XTL A;  3RPU A;  5JR9 A;  3EVY A;  4HEA A;  1D1B A;  5LBM A;  3ZPO A;  3ZMS B;  4C90 A;  3E22 E;  2WAU A;  4OHF A;  2XAH B;  2XUE A;  1ZKE A;  4PFP A;  4JEH B;  3VU7 H;  2LM9 A;  4DO0 A;  5HYA A;  3PDY A;  1WR6 A;  4ZI2 D;  2LJL A;  2XHE B;  3LBX A;  3AAE B;  3ZC1 A;  3ZMZ B;  2ZM2 A;  3R6N A;  3IBP A;  4AKG A;  5LHI B;  2MBG A;  4HFV A;  1NAF A;  4H9O C;  4E7S A;  5JVD E;  4ZS2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...