1US7B

Complex of hsp90 and p50
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
200
structure length
193
Chain Sequence
HKTFVEKYEKQIKHFGMLRRWDDSQKYLSDNVHLVCEETANYLVIWCIDLEVEEKCALMEQVAHQTIVMQFILELAKSLKVDPRACFRQFFTKIKTADRQYMEGFNDELEAFKERVRGRAKLRIEKAMKEYEEEERKKRLGPGGLDPVEVYESLPEELQKCMLQDAISKMDPTDAKYHMQRCIDSGLWVPNSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Mechanism of Hsp90 Regulation by the Protein Kinase-Specific Cochaperone p50(Cdc37)
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Chaperone
molecule keywords HEAT SHOCK PROTEIN HSP82
total genus 73
structure length 193
sequence length 200
ec nomenclature
pdb deposition date 2003-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF08564 CDC37_C Cdc37 C terminal domain
B PF08565 CDC37_M Cdc37 Hsp90 binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.610 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 1us7B01
1US7B 2W0GA 2K5BB
chains in the Genus database with same CATH superfamily
1OWAA 4ZI2C 2YDQA 5E0OA 3C4WA 1JNRA 2D2SA 1UK5A 1WYBA 3I0OA 4NUUA 2DLRA 5LBQB 3ZYKA 1ZV4X 4DIDB 4TNVA 4IIJE 3NRYA 3N9OA 3L39A 3FBLA 4DR1T 3L8RA 3C64A 3VRBA 3ESLA 5KMGP 1S94A 2J1DG 2D0TA 5HXHA 2N9DA 2KZ7B 4PNIA 3RYIE 2X0YA 4K0UA 3ZCJA 1UCUA 2NTYA 5FKYA 1J5ET 3M3ZB 3UQ4A 3NWIA 3CWZB 2C5JA 4CZZB 4TZ4C 2NP9A 2BG9C 2SPCA 2JQKA 4EEDA 4YFSA 4X20E 4O2AE 1IZNB 3RC3A 4XBFB 1T7SA 1YQ3A 3ZMUB 3QOFA 5DJQC 5AQQB 4NXMT 5FY0A 5AQMB 3R6NA 1N32T 3T8OA 3AAIA 5LG3A 1FMWA 2E9XA 3FZFB 4EZHA 4ZI3C 3AEDA 3JAEA 5JDLA 3UTKA 3BQLA 2OLTA 2E5VA 4YHJA 4MLKA 1OEDE 2BKOA 4A5XA 3ZT7A 1YW0A 3VR8A 2H89A 4CN1A 4DR7T 3CK6A 5EK2A 1MMNA 2YN6A 2MTQA 4KUMB 2W61A 4IL4A 3FBZA 4AIUA 5AQPB 3RC8A 3UU4A 4O2BE 2W62A 2VKHA 4UELA 5JQGE 5AQJB 3RIFA 2KWIB 4PK5A 3EAMA 4OFZA 3P50A 3GN5A 4L0RA 3B5MA 4X64T 1SUMB 4HFCA 5KDMC 1W0AA 2N1GA 2ODUA 2LRKA 3D0TA 1D0XA 3K3NA 2KWHA 3OYZA 4IE6A 3RH3A 4LFAT 2UXDT 3ZC1A 4DO0A 4Q25A 1YXRA 1BR4A 2WWVA 4PJJA 3ABVA 1WFDA 5JR9C 5LHGB 2W63A 1HNZT 4NXNT 3CMLA 2XUEA 2V7LA 1OEDA 3DJBA 3HKEE 2RP4A 3N9MA 1WR6A 3EVYA 3PURA 4HFVA 5EK3A 3RRWA 3U3IA 4AKGA 5HAXA 4P0AA 2DWKA 2ZM6T 5KX5E 2UUBT 2C0SA 2E8IA 4HGAA 2I59A 4HWDA 4IL9A 3RYHE 2C5IT 3KVAA 4DNDA 2LRLA 5F8PA 1XMOT 2UUAT 4GYSA 2X66A 3HA4A 3P4PA 5GONE 2RPAA 5LNKA 4P1NA 4U2ZA 5FP3A 4DV2T 4DR2T 5EK4A 1US7B 4EB6E 1W9RA 2VURA 3PDYA 5L4HA 2ACZA 2IAKA 3AE1A 1IBKT 1YQ4A 3RPUA 4DUZT 4IE4A 4UVCB 4LF8T 3ZJ1A 1ZP0A 3HKBE 2NW8A 3ONLC 1T72A 3I1AA 3PJAJ 4ZS3A 2QGSA 3RYCE 4ZI2D 5L3BB 4QH1A 2CXDA 2WDQA 2X0HA 1B7TA 2BG9B 2XTLA 4BJNA 5ETWA 1O3XA 1BR1A 5CA0E 3QNUA 3ONJA 4HWCA 2BZBA 3ZT6A 4YSZA 2WBLA 1IJ6A 5H6QB 1HFAA 2WU2A 4A97A 5JR9B 3I9YA 2A3DA 4KX6A 3P4QA 5AQGB 3Q5EA 4EYYR 2XQYA 3OPCA 5L4EA 3PUVF 3AA7B 4ZEYA 3TLUA 1SA0E 4XZCA 2KMFA 5FXZA 4GKJT 2VASA 3JC6C 4ADZA 5L3EB 1H7CA 3CX8B 4YY3T 4ILUA 3WI3A 2CLYB 3B57A 3UU5A 4CN6A 2DL1A 4DV1T 2MAWA 3I9WA 4YJ3E 4BAYB 1IBMT 4JI1T 4ZZBA 5ABHA 2D5UA 1VOMA 2BDEA 4AQYT 1E7PA 3MXZA 1HX1B 2B1EA 2VL0A 5IHYA 4X66T 4P0BA 4WNKA 2LM9A 2IIUA 2XAGB 3LDQB 2VVNA 3HL6A 5HXRA 3VR9A 2W66A 1UUSA 3RIUC 4DV4T 3RI5A 3UT5E 3QUJA 2C5KT 3ZMZB 5JRCA 4L5GA 3ETVA 4ZS2A 3AEEA 4OX9T 4ILAA 3K8PC 3FZMB 3SS1A 2Q9QD 3J9X1 3ZN1B 3NVOA 2XQ9A 3PUGA 4K0KT 4ZHQE 2WDVA 3K1SA 4EIWA 2QRXA 4ISTA 5AQLB 1NENA 2WWUA 3RLFF 1Y64B 1Y01A 2XQ6A 3PUWF 3VHLA 3VKHA 5JTGA 1ZHCA 2UXXB 1KF6A 2CWOA 5A1LA 4U3CA 4CI2B 5LYJE 3OTOT 2CLYC 5FXWA 5JDQA 2J4GA 3ZC0A 3AA1B 4U7YA 4PAGA 3AAAB 4PJMA 3CQCB 2YU1A 2KLQA 4TUYE 4QX8B 4WW0A 3ZLIA 5HEGA 2X9YA 2ZM0A 4NIQA 2V6YA 2WCAA 4QX7B 5CFBA 5J2TE 4AKHA 1IJ5A 3H3MA 2NW7A 5HWXA 4JI4T 2WS3A 3A5XA 1NWMX 3BQKA 3PJAA 3PTRB 3QB5A 5AQTB 3V5SA 4ZZCA 5LJNA 3AAEB 4PJNA 5ADXL 3T1YT 3KV5A 3WAKA 3PUYF 4X1KE 5AQOB 5IYZE 2LHRA 2PBIA 3UUXB 1J1JA 4COFA 5L47A 3HR0A 3OBVE 3LBXA 4ISSA 3ZYLA 3SOLA 2HPLA 4DV5T 4JI6T 2NW9A 4HEAA 3EUHA 4YLHA 5IUXA 4LFCT 2JMHA 2XQ5A 5JR9A 3RF1A 3ZCIA 5LHIB 4TX5A 2V5DA 4UF0B 5LGUB 3P4RA 2HPJA 2X51A 4MALA 2VKJA 2E9XC 5DQWA 1M62A 5LBMA 3VU7H 4ANJA 2UXBT 3GN5B 1YKHB 2V5CA 4JV5T 2FBWA 1NAFA 4DVDA 3KV6A 4LMLA 2CMRA 3FXDB 4IGUA 4UR9A 3I0QA 4HFDA 4LMKA 2LE8A 3ANWB 3V5UA 2CXLA 3HKDE 5CA1E 1T8BA 2OV9A 5LOVE 1CUNA 1VCSA 5LA6E 5AFUL 2IUBA 5F3JA 3CIRA 3EDVA 1ZOYA 4U74A 5LMUT 3ANWA 2E9XB 3F57A 2YK0A 3JC6D 4QH4A 5LCYA 2CHNA 3AE4A 3TLTA 4EV6A 2D0UA 3UUNA 1WRDA 4EYUA 3JAFA 3M65A 5FYMA 3CVRA 2X67A 4KMCA 2LSJA 5AQKB 4F6RC 2KXPB 2YINA 3VRAA 1AJ3A 1Z0PA 4DR4T 5LXTE 5JRCB 2D9DA 4WYVA 2XQ3A 2V1DB 3OYXA 5FXVA 3ZYMA 2HN2A 3GWHA 2YKSA 2V7JA 4TWDA 3ZMVB 2XQAA 3IA3A 2A72A 4PW8A 3KV9A 3ETUA 4QH5A 2F4VT 3KBUA 3AXJA 2A2FX 3KDSE 4JBWF 1HX8A 5LGNB 2IMLA 3HKCE 4YHHT 4O4IE 3P4WA 4OYJA 5HXCA 4AKLA 4AQFC 4ERRA 2BS2A 3CQGB 2X9XA 4CI3B 1SE7A 1HCIA 3CKDA 4DV6T 2KINB 4KHPT 5JVDE 4A56A 3N9QA 1N36T 5HCMA 4AXPA 4LF6T 3PE0A 3AE6A 4HKAA 3N9NA 2NWBA 2X9WA 2KT9A 3B13A 1LRZA 1U4QA 2L8KA 1M7KA 5AQHB 3RIAA 3LJCA 3TLVA 2K9AA 4OHFA 3RYFE 4O4JE 4B3TT 1FJGT 4CXWA 3KINB 4HFEA 2PG8A 3PUSA 2E9XD 3LSVA 3OVUA 4CXYA 3ZKRA 4A98A 3RKGA 1YD8G 2UUCT 2MOZA 5JDNA 1E1HB 3MKDA 3NRXA 4EXTA 5LJMA 2J47A 3AVSA 4H63V 4PFOA 4ZOLE 1SHZC 3ZMSB 3AE8A 4KBMB 5FVKA 5IWAT 4TNWA 4WBNE 2HHHT 3UQ7A 1D1CA 1XZYA 3N2OA 4O4LE 4TWHA 4ZI3D 2XQ4A 3N9PA 2QYWA 1YKEB 3KVBA 4KHZF 3Q5DA 3QB5K 1N33T 5L3DB 4H9QC 1VCTA 2EHOC 2CBIA 4QXCB 3ZSSA 1KNZA 2CBJA 2DHRA 1XMQT 1L0VA 4EEBA 3C4ZA 3FZLB 4HFIA 4UVAB 2P9BA 3FZHB 2NR4A 1HF8A 1UX5A 2BG9A 2WU5A 3BK9A 4QHOA 5FNVE 4ZI7E 2FJBA 2DWGA 5FL1A 3N2GE 4P09A 3TLSA 2H3RA 2XAQB 2XQ8A 2ODVA 4GK5E 1BR0A 3MK7C 1QSDA 3KBTA 4U7IA 1MMDA 3P4SA 4TWFA 3H37A 4I55E 2V6XA 3AB3B 2YDRA 4GK0E 4HTEA 2WB5A 4B3MT 2UU9T 2LSGA 3IHRA 4UXNB 2DNXA 2YU2A 1Z8UA 3QC9A 2PTFA 4U2YA 5HEUA 4LFBT 3GA8A 3Q5XA 4YTMA 2AE9A 4MHCA 5LMNT 3DP7A 1UURA 2LHNA 3F31A 4OYKA 2W2UA 2Q9QA 3PV0F 3P7IA 4IREA 3SFDA 3GMIA 4JUYA 4U33A 5KXJA 4B3ST 2BG9E 3FHNA 3AECA 5AQRB 2AXDS 2BKPA 3EHZA 3K3OA 4IT4A 4PFPA 2VKOA 5ABGA 3ZJ2A 3UFGA 2FJEA 4YTPA 2XY8B 2H7VC 4E7ZA 5C8YE 1MNDA 2CE7A 3TKLB 4EOZB 2FUPA 2KSRA 1LKXA 2BVLA 4GYRA 2LSYA 2XSAA 1G8XA 3LK2B 1WLXA 2VQET 4JI8T 4X1YE 4AI6A 1VRBA 1KEYA 2FJAA 4H9OC 1XNQT 2E5LT 1BR2A 3SFEA 4IE7A 4DV0T 4FI5A 2JMKA 5J1GA 4IDNA 5LP6E 4LMJA 2XSBA 4PJLA 4BA9A 3R84B 3PU3A 1HTJF 3EI0A 4E7SA 3F2EA 2I6HA 5FMNA 4C90A 2LLYA 5ABFA 4DR3T 2ZM8A 1MMAA 4JI7T 1HG5A 3FZKB 2IHR1 2XAJB 2WSSV 3OKQA 2LKGA 2IW5B 2LJLA 5FY7A 4HWHA 4EGWA 3UU8A 2Y48B 5HXEA 2WZIA 3C98B 2BS4A 4I0UA 4N78D 3ZT5A 4DR5T 3ZPOA 2XASB 2V8SV 2W00A 3WAJA 3IF8B 2XM2A 4Z91A 2V26A 2BBHA 2ACXA 3O1IA 2ES0A 4X1IE 4O4HE 5JDHA 2EHOD 1ZEEA 4H9NC 4X65T 4JEHB 4J2CA 4KP3C 2QA7A 3AE7A 2WQYA 4AKRB 1MMGA 1QUUA 2K3WA 5ABEA 5J2UE 2MYSA 4QWNB 2ZMAA 2IC6A 3C4XA 4JLEA 4B6XA 5LG4A 5FL0A 4YT0A 2XAFB 5JDGA 5H6RB 3Q5WA 3P8CD 2BVMA 3NZPA 1IAPA 1J5WA 5DABA 4EZ4A 5L3CB 4WBOA 4NUVA 4JI5T 3NKZA 4L9IA 2YEVC 5CGMA 4TV9E 1OEDB 4YJ2E 4QXHB 1D0ZA 1XDOA 4GOUA 4IDOA 2WM9A 2WP9A 1NEKA 3E22E 3O1HA 3RKOA 4DBQA 3UULA 1CHUA 2WDRA 4YSYA 4QKNA 4PK6A 5BR8T 4JEUB 4KI0F 2V6YB 5TAOA 1HNXT 4UF0A 3FXEB 2DI4A 1LVFA 3O1JA 3KFWX 1I94T 4YXDA 3PUAA 4M1PA 2X68A 4U72A 5AQVB 4DUYT 2EHOB 4HFBA 3DTOA 4GKKT 5FY1A 3LBXB 2LOSA 1XWMA 4LF4T 1KNRA 2W0GA 5C2TA 1JNZA 4I50E 5CJ5A 1LVKA 2XQ7A 5HWYA 5J0ZA 3NBXX 3CQXC 2B76A 2WMOA 4IDZA 5AQUB 5AQFB 4JI2T 4DV3T 2LOPA 4XAXB 1MIWA 2X9HA 1HR0T 2JJ9A 3UU3A 5JDMA 3Q9DA 2FJDA 3SRZA 4LF5T 3EABA 1OXZA 3C50A 4FJOA 2VVSA 3MJXA 3AEGA 1HG2A 3IEEA 4IDPA 3LK3B 4V1Av 2K5BB 5AQNB 1D1AA 2WMNA 3MZKB 4IHJE 4F8HA 2H88A 3C51A 1N34T 2YDSA 5JDFA 3PUXF 1XDPA 2VQFT 1HS7A 4MBQA 4PK4A 4AKIA 2LKHA 4JYAT 2CXFA 2XAHB 4OK0A 3RQWA 1MIVA 2KNDA 2XHEB 3RRCA 3FB2A 1W0BA 2R6GF 5HCJA 5CB4E 4TN7B 3ZN0B 4CQIA 5LHHB 3TLWA 1XNRT 1KK7A 2VL8A 2QVAA 3ONXA 2LEHA 3PUZF 5ABFB 2LSIA 3AA6B 2JIWA 4ILBA 2Y8DA 1T98A 2XJ7A 2ZLYA 1G73A 3QK6A 2CPTA 3S4UA 2Q9QB 3CPZA 2MPKA 1KFYA 5HEJA 4JI3T 3AA0B 2HN1A 3JCFA 2VB6A 4BJMA 4YTNA 1DU2A 2H7OA 5HEHA 4DBRA 2XM1A 2JQQA 4WZXA 3N9LA 2CCQA 5LGTB 4UV9B 1WR0A 5JREA 4DV7T 2CEAA 2GK9A 2X0LB 1FEWA 1E2AA 4X5TA 5AQIB 3AEBA 3HI2A 3UU6A 4UIGA 2A9UA 5BMVE 1I6ZA 5AQSB 1S35A 1D1BA 1WCRA 4Z90A 2LM2A 1QLBA 3L09A 2RA1A 3AEAA 2VKDA 4H9PC 4IE0A 4HN9A 4QXBB 3VKGA 5JH7E 5L2LA 2G0UA 2PFVA 4Z8XA 2M6IA 4AQGA 1WYCA 5DQVA 2BBJA 4MFRA 2MBGA 3RQUA 4TV8E 2Y6XA 3X1DA 3AXJB 3ZSTA 3A7MA 3JADA 3LK42 2L9QA 3UFEA 4C91A 2I0MA 3LFMA 4DMVA 4EAHA 4HE8A 3T1HT 3CX6B 4IDQA 3RGLA 3A8YC 4G63A 3Q2MA 3OJAA 1V9DA 3ZMTB 4GIWA 3O9XA 3E08A 4CI1B 3O4XE 2CWYA 3AEFA 2W4XA 2JRKA 3EDUA 2L3LA 3H3AA 4HWFA 3MA9A 2BKNA 2VWAA 2WAUA 2WZHA 4H9RC 2V7IA 2NTXA 1ZKEA 2CM0A 2W67A 1MNEA 3AE3A 2VK9A 4I4TE 4ILCA 3RIUA 2OA5A 3MACA 4AISA 5F5WA 3PUQA 1W09A 1OEDC 2K24A 3AVRA 3G06A 2V7MA 3N5LA 4UVBB 1FMVA 5L3FB 5L3GB 3RHWA 2K48A 4LF9T 1HNWT 3AE9A 3NZQA 4JI0T 4B3RT 4CXXA 2LSKA 2BS3A 2EHOA 1KNPA 2M67A 2N2NA 2ZM2A 3PU8A 4H9SE 2YOEA 3E0ZA 4U31A 3K3QC 3UUBA 5HYAA 1X79A 2Q9QC 2Z6EA 2HH7A 5C3JA 5HEOA 3BQIA 3KV4A 1X9BA 1UGOA 1R8IA 2JQ9A 2XZEA 4O8SA 4I43B 3ZEFB 1UX4A 5HXSA 2JPFA 4H63H 4DR6T 4NPPA 2DCFA 2IC9A 3N2KE 2IDOB 4UEMA 1MIYA 3L3PA 3LG7A 1EZ3A 1U5PA 2CA5A 3W15B 1D0YA 4UV8B 2PJQA 3SWHA 3RX6A 2LT3A 3CX7B 2E2AA 2J62A 2XPKA 2CRBA 2M6BA 2WY2A 4IE5A 5M4YA 4ASKA 5FXXA 2UXNB 2CHOA 4CN4A 5LB7B 3U78A 2V7KA 5EZYE 4LF7T 4ZXLA 3AE2A 4G2AA 2NOXA 4YSXA 4DMWA 3IBPA 1FIOA 5FVLA 2UXCT 4HFHA 1IBLT 1GQEA 4HWIB 3UUMA 3J7Yq 2JQHA 3AE5A 4AQFA 4X62T
chains in the Genus database with same CATH topology
1OWAA 4ZI2C 5E0OA 3C4WA 5LBQB 2D2SA 1WYBA 3I0OA 4NUUA 2DLRA 1ZV4X 4IIJE 3NRYA 3N9OA 3FBLA 3C64A 3ESLA 5KMGP 1S94A 2J1DG 2D0TA 5HXHA 2N9DA 2KZ7B 4PNIA 3RYIE 4K0UA 3ZCJA 1UCUA 2NTYA 3CWZB 2C5JA 4CZZB 4TZ4C 2NP9A 2SPCA 4YFSA 4X20E 4O2AE 1IZNB 3RC3A 4XBFB 3ZMUB 5DJQC 5FY0A 3R6NA 3T8OA 3AAIA 1FMWA 2E9XA 4EZHA 4ZI3C 5JDLA 3UTKA 3BQLA 4YHJA 4MLKA 1YW0A 5EK2A 1MMNA 2MTQA 4KUMB 2W61A 3FBZA 4O2BE 2W62A 2VKHA 4UELA 5JQGE 2KWIB 4PK5A 4OFZA 3GN5A 4L0RA 5KDMC 2N1GA 2ODUA 3D0TA 3K3NA 1D0XA 3OYZA 2KWHA 4IE6A 3RH3A 3ZC1A 4DO0A 1BR4A 5JR9C 4PJJA 5LHGB 2W63A 3CMLA 2XUEA 2V7LA 3DJBA 3HKEE 3N9MA 2RP4A 3PURA 1WR6A 3EVYA 4HFVA 5EK3A 3RRWA 4AKGA 3U3IA 5HAXA 4P0AA 2DWKA 5KX5E 2C0SA 2E8IA 4HGAA 2I59A 3RYHE 2C5IT 3KVAA 4DNDA 5F8PA 4GYSA 2X66A 3HA4A 5GONE 5LNKA 5FP3A 5EK4A 1US7B 4EB6E 3PDYA 2IAKA 3RPUA 4IE4A 4UVCB 3ZJ1A 3HKBE 4ZS3A 2NW8A 5L3BB 3I1AA 3RYCE 2QGSA 4ZI2D 2CXDA 2XTLA 1B7TA 4BJNA 5ETWA 1O3XA 1BR1A 5CA0E 2BZBA 5JR9B 2WBLA 1IJ6A 5H6QB 1HFAA 3I9YA 2A3DA 4EYYR 2XQYA 3AA7B 1SA0E 4XZCA 2KMFA 5FXZA 2VASA 3JC6C 4ADZA 5L3EB 1H7CA 3CX8B 4ILUA 3WI3A 2CLYB 3B57A 3I9WA 4YJ3E 4BAYB 2D5UA 1VOMA 2BDEA 3MXZA 2B1EA 5IHYA 4P0BA 4WNKA 2LM9A 2XAGB 5HXRA 3HL6A 3UT5E 3QUJA 2C5KT 3ZMZB 5JRCA 4L5GA 3ETVA 4ZS2A 3K8PC 3SS1A 2Q9QD 3J9X1 3ZN1B 3PUGA 4ZHQE 4EIWA 5JRCB 4ISTA 3VKHA 2WWUA 1Y64B 3VHLA 1ZHCA 2UXXB 2CWOA 5A1LA 5LYJE 4CI2B 2CLYC 5FXWA 5JDQA 3ZC0A 3AA1B 4PAGA 3AAAB 4PJMA 3CQCB 2YU1A 2KLQA 4TUYE 4QX8B 4WW0A 3ZLIA 2X9YA 2ZM0A 4QX7B 4AKHA 5J2TE 1IJ5A 5HWXA 2NW7A 3A5XA 3PTRB 1NWMX 3BQKA 3V5SA 5LJNA 3AAEB 4PJNA 5ADXL 3KV5A 3WAKA 4X1KE 5IYZE 2LHRA 2PBIA 3HR0A 3OBVE 3LBXA 4ISSA 3ZYLA 3SOLA 2HPLA 2NW9A 4HEAA 3EUHA 4YLHA 2JMHA 5JR9A 3ZCIA 5LHIB 4TX5A 5LGUB 4UF0B 2HPJA 2X51A 4MALA 2VKJA 2E9XC 5DQWA 5LBMA 3VU7H 4ANJA 3GN5B 1YKHB 1NAFA 4DVDA 3KV6A 2CMRA 3FXDB 4IGUA 3I0QA 2LE8A 3ANWB 3V5UA 2CXLA 3HKDE 5CA1E 5AFUL 5LOVE 5F3JA 1CUNA 5LA6E 3EDVA 4U74A 3ANWA 2E9XB 3F57A 2YK0A 3JC6D 5LCYA 2D0UA 3UUNA 1WRDA 4EYUA 5FYMA 3M65A 3CVRA 2X67A 4KMCA 2LSJA 4F6RC 2KXPB 2YINA 1AJ3A 1Z0PA 5LXTE 3ZYMA 3RC8A 2V1DB 3OYXA 5FXVA 3ZMVB 3GWHA 2V7JA 2A72A 4PW8A 3KV9A 3ETUA 3KBUA 2A2FX 3KDSE 1HX8A 5LGNB 3HKCE 4O4IE 4OYJA 5HXCA 4AKLA 4AQFC 4ERRA 3CQGB 2X9XA 4CI3B 1HCIA 3CKDA 2KINB 5JVDE 4A56A 3N9QA 4AXPA 3PE0A 4HKAA 3N9NA 2NWBA 2X9WA 2KT9A 3B13A 1LRZA 1U4QA 2L8KA 3LJCA 2K9AA 4OHFA 3RYFE 4O4JE 4CXWA 3KINB 2PG8A 3PUSA 2E9XD 4CXYA 1YD8G 2MOZA 5JDNA 1E1HB 3MKDA 3NRXA 4EXTA 5LJMA 3AVSA 4H63V 4PFOA 4ZOLE 3ZMSB 1SHZC 4KBMB 4WBNE 1D1CA 3N2OA 4O4LE 4ZI3D 3N9PA 3KVBA 1YKEB 5L3DB 4H9QC 2EHOC 4QXCB 1KNZA 2DHRA 3C4ZA 4UVAB 2P9BA 1HF8A 1UX5A 3BK9A 4QHOA 5FNVE 4ZI7E 2DWGA 3N2GE 4P09A 2H3RA 2XAQB 4GK5E 2ODVA 1BR0A 3MK7C 1QSDA 3KBTA 1MMDA 3H37A 4I55E 3AB3B 4GK0E 4HTEA 2LSGA 3IHRA 4UXNB 2DNXA 2YU2A 3QC9A 3GA8A 3Q5XA 4MHCA 3DP7A 2LHNA 3F31A 4OYKA 4TN7B 3ZYKA 2Q9QA 3P7IA 3GMIA 4JUYA 3FHNA 4BA9A 4EAHA 3K3OA 4PFPA 2VKOA 3ZJ2A 2H7VC 4E7ZA 5C8YE 1MNDA 2CE7A 3TKLB 4EOZB 1LKXA 2BVLA 4GYRA 2LSYA 1G8XA 3LK2B 1WLXA 4X1YE 4AI6A 1VRBA 4H9OC 1BR2A 4IE7A 4FI5A 2JMKA 5J1GA 5LP6E 4PJLA 3R84B 3PU3A 1HTJF 4E7SA 3F2EA 5FMNA 4C90A 2ZM8A 1MMAA 1HG5A 2XAJB 2WSSV 3OKQA 2IW5B 2LJLA 5FY7A 2Y48B 5HXEA 3C98B 4N78D 3ZPOA 2XASB 2W00A 3WAJA 3IF8B 2V26A 3O1IA 2ACXA 2ES0A 4X1IE 4O4HE 5JDHA 2EHOD 1ZEEA 4H9NC 4JEHB 4J2CA 4KP3C 2QA7A 4AKRB 1MMGA 1QUUA 5J2UE 2MYSA 4QWNB 2ZMAA 2IC6A 3C4XA 4JLEA 4B6XA 5LG4A 2XAFB 5JDGA 5H6RB 3Q5WA 3P8CD 2BVMA 3NZPA 1IAPA 5DABA 4EZ4A 5L3CB 4WBOA 4NUVA 4L9IA 2YEVC 4TV9E 4YJ2E 4QXHB 1D0ZA 4GOUA 2WM9A 3E22E 3O1HA 3RKOA 4DBQA 3UULA 4QKNA 4PK6A 4JEUB 5TAOA 4UF0A 3FXEB 2DI4A 1LVFA 3O1JA 3KFWX 3PUAA 4M1PA 2X68A 4U72A 2EHOB 3DTOA 5FY1A 3LBXB 2LOSA 2W0GA 4I50E 1LVKA 5HWYA 3NBXX 3CQXC 2WMOA 4IDZA 2LOPA 4XAXB 1MIWA 2X9HA 2JJ9A 5JDMA 3Q9DA 3SRZA 1OXZA 3C50A 4FJOA 3MJXA 1HG2A 3IEEA 3LK3B 4V1Av 2K5BB 1D1AA 2WMNA 3MZKB 4IHJE 3C51A 5JDFA 1HS7A 4MBQA 4PK4A 4AKIA 2CXFA 2XAHB 4OK0A 1MIVA 2KNDA 2XHEB 3RRCA 3FB2A 5LHHB 5CB4E 3ZN0B 4CQIA 1KK7A 2VL8A 3ONXA 2LEHA 2LSIA 3AA6B 2Y8DA 1T98A 2ZLYA 1G73A 3QK6A 3S4UA 2Q9QB 3CPZA 3AA0B 2VB6A 4BJMA 2H7OA 4DBRA 2JQQA 3N9LA 2CCQA 5LGTB 4UV9B 5JREA 2CEAA 2GK9A 2X0LB 1FEWA 3HI2A 4UIGA 5BMVE 1S35A 1D1BA 4IE0A 3L09A 2RA1A 4H9PC 2VKDA 4QXBB 4HN9A 3VKGA 5JH7E 5L2LA 2G0UA 2PFVA 4Z8XA 4AQGA 1WYCA 5DQVA 4MFRA 2MBGA 4TV8E 2Y6XA 3LK42 3UFEA 2L9QA 4C91A 3LFMA 4DMVA 4HE8A 3CX6B 4G63A 3Q2MA 3OJAA 1V9DA 3ZMTB 4GIWA 3O9XA 3E08A 4CI1B 3O4XE 2CWYA 3H3AA 2JRKA 3EDUA 2L3LA 3MA9A 2VWAA 2WAUA 4H9RC 2V7IA 2NTXA 1ZKEA 2CM0A 1MNEA 2VK9A 4I4TE 2OA5A 3MACA 3PUQA 2K24A 3AVRA 3N5LA 2V7MA 4UVBB 5L3FB 1FMVA 5L3GB 2K48A 3NZQA 4CXXA 2LSKA 2EHOA 2M67A 2ZM2A 2N2NA 3PU8A 4H9SE 3UUXB 3E0ZA 3K3QC 5HYAA 1X79A 2Q9QC 2Z6EA 2HH7A 3BQIA 3KV4A 4I43B 3ZEFB 4O8SA 1UX4A 5HXSA 2JPFA 4H63H 2DCFA 2IC9A 3N2KE 4UEMA 1MIYA 3L3PA 3LG7A 1EZ3A 1U5PA 2CA5A 3W15B 1D0YA 4UV8B 2PJQA 3SWHA 3RX6A 2LT3A 3CX7B 5M4YA 4IE5A 4ASKA 5FXXA 2UXNB 3U78A 2V7KA 5EZYE 4G2AA 2NOXA 4DMWA 3IBPA 1FIOA 3UUMA 3J7Yq 4AQFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1US7 B;  2W0G A;  2K5B B; 
#chains in the Genus database with same CATH topology
 1OWA A;  4ZI2 C;  2YDQ A;  5E0O A;  3C4W A;  1JNR A;  2D2S A;  1UK5 A;  1WYB A;  3I0O A;  4NUU A;  2DLR A;  5LBQ B;  3ZYK A;  1ZV4 X;  4DID B;  4TNV A;  4IIJ E;  3NRY A;  3N9O A;  3L39 A;  3FBL A;  4DR1 T;  3L8R A;  3C64 A;  3VRB A;  3ESL A;  5KMG P;  1S94 A;  2J1D G;  2D0T A;  5HXH A;  2N9D A;  2KZ7 B;  4PNI A;  3RYI E;  2X0Y A;  4K0U A;  3ZCJ A;  1UCU A;  2NTY A;  5FKY A;  1J5E T;  3M3Z B;  3UQ4 A;  3NWI A;  3CWZ B;  2C5J A;  4CZZ B;  4TZ4 C;  2NP9 A;  2BG9 C;  2SPC A;  2JQK A;  4EED A;  4YFS A;  4X20 E;  4O2A E;  1IZN B;  3RC3 A;  4XBF B;  1T7S A;  1YQ3 A;  3ZMU B;  3QOF A;  5DJQ C;  5AQQ B;  4NXM T;  5FY0 A;  5AQM B;  3R6N A;  1N32 T;  3T8O A;  3AAI A;  5LG3 A;  1FMW A;  2E9X A;  3FZF B;  4EZH A;  4ZI3 C;  3AED A;  3JAE A;  5JDL A;  3UTK A;  3BQL A;  2OLT A;  2E5V A;  4YHJ A;  4MLK A;  1OED E;  2BKO A;  4A5X A;  3ZT7 A;  1YW0 A;  3VR8 A;  2H89 A;  4CN1 A;  4DR7 T;  3CK6 A;  5EK2 A;  1MMN A;  2YN6 A;  2MTQ A;  4KUM B;  2W61 A;  4IL4 A;  3FBZ A;  4AIU A;  5AQP B;  3RC8 A;  3UU4 A;  4O2B E;  2W62 A;  2VKH A;  4UEL A;  5JQG E;  5AQJ B;  3RIF A;  2KWI B;  4PK5 A;  3EAM A;  4OFZ A;  3P50 A;  3GN5 A;  4L0R A;  3B5M A;  4X64 T;  1SUM B;  4HFC A;  5KDM C;  1W0A A;  2N1G A;  2ODU A;  2LRK A;  3D0T A;  1D0X A;  3K3N A;  2KWH A;  3OYZ A;  4IE6 A;  3RH3 A;  4LFA T;  2UXD T;  3ZC1 A;  4DO0 A;  4Q25 A;  1YXR A;  1BR4 A;  2WWV A;  4PJJ A;  3ABV A;  1WFD A;  5JR9 C;  5LHG B;  2W63 A;  1HNZ T;  4NXN T;  3CML A;  2XUE A;  2V7L A;  1OED A;  3DJB A;  3HKE E;  2RP4 A;  3N9M A;  1WR6 A;  3EVY A;  3PUR A;  4HFV A;  5EK3 A;  3RRW A;  3U3I A;  4AKG A;  5HAX A;  4P0A A;  2DWK A;  2ZM6 T;  5KX5 E;  2UUB T;  2C0S A;  2E8I A;  4HGA A;  2I59 A;  4HWD A;  4IL9 A;  3RYH E;  2C5I T;  3KVA A;  4DND A;  2LRL A;  5F8P A;  1XMO T;  2UUA T;  4GYS A;  2X66 A;  3HA4 A;  3P4P A;  5GON E;  2RPA A;  5LNK A;  4P1N A;  4U2Z A;  5FP3 A;  4DV2 T;  4DR2 T;  5EK4 A;  1US7 B;  4EB6 E;  1W9R A;  2VUR A;  3PDY A;  5L4H A;  2ACZ A;  2IAK A;  3AE1 A;  1IBK T;  1YQ4 A;  3RPU A;  4DUZ T;  4IE4 A;  4UVC B;  4LF8 T;  3ZJ1 A;  1ZP0 A;  3HKB E;  2NW8 A;  3ONL C;  1T72 A;  3I1A A;  3PJA J;  4ZS3 A;  2QGS A;  3RYC E;  4ZI2 D;  5L3B B;  4QH1 A;  2CXD A;  2WDQ A;  2X0H A;  1B7T A;  2BG9 B;  2XTL A;  4BJN A;  5ETW A;  1O3X A;  1BR1 A;  5CA0 E;  3QNU A;  3ONJ A;  4HWC A;  2BZB A;  3ZT6 A;  4YSZ A;  2WBL A;  1IJ6 A;  5H6Q B;  1HFA A;  2WU2 A;  4A97 A;  5JR9 B;  3I9Y A;  2A3D A;  4KX6 A;  3P4Q A;  5AQG B;  3Q5E A;  4EYY R;  2XQY A;  3OPC A;  5L4E A;  3PUV F;  3AA7 B;  4ZEY A;  3TLU A;  1SA0 E;  4XZC A;  2KMF A;  5FXZ A;  4GKJ T;  2VAS A;  3JC6 C;  4ADZ A;  5L3E B;  1H7C A;  3CX8 B;  4YY3 T;  4ILU A;  3WI3 A;  2CLY B;  3B57 A;  3UU5 A;  4CN6 A;  2DL1 A;  4DV1 T;  2MAW A;  3I9W A;  4YJ3 E;  4BAY B;  1IBM T;  4JI1 T;  4ZZB A;  5ABH A;  2D5U A;  1VOM A;  2BDE A;  4AQY T;  1E7P A;  3MXZ A;  1HX1 B;  2B1E A;  2VL0 A;  5IHY A;  4X66 T;  4P0B A;  4WNK A;  2LM9 A;  2IIU A;  2XAG B;  3LDQ B;  2VVN A;  3HL6 A;  5HXR A;  3VR9 A;  2W66 A;  1UUS A;  3RIU C;  4DV4 T;  3RI5 A;  3UT5 E;  3QUJ A;  2C5K T;  3ZMZ B;  5JRC A;  4L5G A;  3ETV A;  4ZS2 A;  3AEE A;  4OX9 T;  4ILA A;  3K8P C;  3FZM B;  3SS1 A;  2Q9Q D;  3J9X 1;  3ZN1 B;  3NVO A;  2XQ9 A;  3PUG A;  4K0K T;  4ZHQ E;  2WDV A;  3K1S A;  4EIW A;  2QRX A;  4IST A;  5AQL B;  1NEN A;  2WWU A;  3RLF F;  1Y64 B;  1Y01 A;  2XQ6 A;  3PUW F;  3VHL A;  3VKH A;  5JTG A;  1ZHC A;  2UXX B;  1KF6 A;  2CWO A;  5A1L A;  4U3C A;  4CI2 B;  5LYJ E;  3OTO T;  2CLY C;  5FXW A;  5JDQ A;  2J4G A;  3ZC0 A;  3AA1 B;  4U7Y A;  4PAG A;  3AAA B;  4PJM A;  3CQC B;  2YU1 A;  2KLQ A;  4TUY E;  4QX8 B;  4WW0 A;  3ZLI A;  5HEG A;  2X9Y A;  2ZM0 A;  4NIQ A;  2V6Y A;  2WCA A;  4QX7 B;  5CFB A;  5J2T E;  4AKH A;  1IJ5 A;  3H3M A;  2NW7 A;  5HWX A;  4JI4 T;  2WS3 A;  3A5X A;  1NWM X;  3BQK A;  3PJA A;  3PTR B;  3QB5 A;  5AQT B;  3V5S A;  4ZZC A;  5LJN A;  3AAE B;  4PJN A;  5ADX L;  3T1Y T;  3KV5 A;  3WAK A;  3PUY F;  4X1K E;  5AQO B;  5IYZ E;  2LHR A;  2PBI A;  3UUX B;  1J1J A;  4COF A;  5L47 A;  3HR0 A;  3OBV E;  3LBX A;  4ISS A;  3ZYL A;  3SOL A;  2HPL A;  4DV5 T;  4JI6 T;  2NW9 A;  4HEA A;  3EUH A;  4YLH A;  5IUX A;  4LFC T;  2JMH A;  2XQ5 A;  5JR9 A;  3RF1 A;  3ZCI A;  5LHI B;  4TX5 A;  2V5D A;  4UF0 B;  5LGU B;  3P4R A;  2HPJ A;  2X51 A;  4MAL A;  2VKJ A;  2E9X C;  5DQW A;  1M62 A;  5LBM A;  3VU7 H;  4ANJ A;  2UXB T;  3GN5 B;  1YKH B;  2V5C A;  4JV5 T;  2FBW A;  1NAF A;  4DVD A;  3KV6 A;  4LML A;  2CMR A;  3FXD B;  4IGU A;  4UR9 A;  3I0Q A;  4HFD A;  4LMK A;  2LE8 A;  3ANW B;  3V5U A;  2CXL A;  3HKD E;  5CA1 E;  1T8B A;  2OV9 A;  5LOV E;  1CUN A;  1VCS A;  5LA6 E;  5AFU L;  2IUB A;  5F3J A;  3CIR A;  3EDV A;  1ZOY A;  4U74 A;  5LMU T;  3ANW A;  2E9X B;  3F57 A;  2YK0 A;  3JC6 D;  4QH4 A;  5LCY A;  2CHN A;  3AE4 A;  3TLT A;  4EV6 A;  2D0U A;  3UUN A;  1WRD A;  4EYU A;  3JAF A;  3M65 A;  5FYM A;  3CVR A;  2X67 A;  4KMC A;  2LSJ A;  5AQK B;  4F6R C;  2KXP B;  2YIN A;  3VRA A;  1AJ3 A;  1Z0P A;  4DR4 T;  5LXT E;  5JRC B;  2D9D A;  4WYV A;  2XQ3 A;  2V1D B;  3OYX A;  5FXV A;  3ZYM A;  2HN2 A;  3GWH A;  2YKS A;  2V7J A;  4TWD A;  3ZMV B;  2XQA A;  3IA3 A;  2A72 A;  4PW8 A;  3KV9 A;  3ETU A;  4QH5 A;  2F4V T;  3KBU A;  3AXJ A;  2A2F X;  3KDS E;  4JBW F;  1HX8 A;  5LGN B;  2IML A;  3HKC E;  4YHH T;  4O4I E;  3P4W A;  4OYJ A;  5HXC A;  4AKL A;  4AQF C;  4ERR A;  2BS2 A;  3CQG B;  2X9X A;  4CI3 B;  1SE7 A;  1HCI A;  3CKD A;  4DV6 T;  2KIN B;  4KHP T;  5JVD E;  4A56 A;  3N9Q A;  1N36 T;  5HCM A;  4AXP A;  4LF6 T;  3PE0 A;  3AE6 A;  4HKA A;  3N9N A;  2NWB A;  2X9W A;  2KT9 A;  3B13 A;  1LRZ A;  1U4Q A;  2L8K A;  1M7K A;  5AQH B;  3RIA A;  3LJC A;  3TLV A;  2K9A A;  4OHF A;  3RYF E;  4O4J E;  4B3T T;  1FJG T;  4CXW A;  3KIN B;  4HFE A;  2PG8 A;  3PUS A;  2E9X D;  3LSV A;  3OVU A;  4CXY A;  3ZKR A;  4A98 A;  3RKG A;  1YD8 G;  2UUC T;  2MOZ A;  5JDN A;  1E1H B;  3MKD A;  3NRX A;  4EXT A;  5LJM A;  2J47 A;  3AVS A;  4H63 V;  4PFO A;  4ZOL E;  1SHZ C;  3ZMS B;  3AE8 A;  4KBM B;  5FVK A;  5IWA T;  4TNW A;  4WBN E;  2HHH T;  3UQ7 A;  1D1C A;  1XZY A;  3N2O A;  4O4L E;  4TWH A;  4ZI3 D;  2XQ4 A;  3N9P A;  2QYW A;  1YKE B;  3KVB A;  4KHZ F;  3Q5D A;  3QB5 K;  1N33 T;  5L3D B;  4H9Q C;  1VCT A;  2EHO C;  2CBI A;  4QXC B;  3ZSS A;  1KNZ A;  2CBJ A;  2DHR A;  1XMQ T;  1L0V A;  4EEB A;  3C4Z A;  3FZL B;  4HFI A;  4UVA B;  2P9B A;  3FZH B;  2NR4 A;  1HF8 A;  1UX5 A;  2BG9 A;  2WU5 A;  3BK9 A;  4QHO A;  5FNV E;  4ZI7 E;  2FJB A;  2DWG A;  5FL1 A;  3N2G E;  4P09 A;  3TLS A;  2H3R A;  2XAQ B;  2XQ8 A;  2ODV A;  4GK5 E;  1BR0 A;  3MK7 C;  1QSD A;  3KBT A;  4U7I A;  1MMD A;  3P4S A;  4TWF A;  3H37 A;  4I55 E;  2V6X A;  3AB3 B;  2YDR A;  4GK0 E;  4HTE A;  2WB5 A;  4B3M T;  2UU9 T;  2LSG A;  3IHR A;  4UXN B;  2DNX A;  2YU2 A;  1Z8U A;  3QC9 A;  2PTF A;  4U2Y A;  5HEU A;  4LFB T;  3GA8 A;  3Q5X A;  4YTM A;  2AE9 A;  4MHC A;  5LMN T;  3DP7 A;  1UUR A;  2LHN A;  3F31 A;  4OYK A;  2W2U A;  2Q9Q A;  3PV0 F;  3P7I A;  4IRE A;  3SFD A;  3GMI A;  4JUY A;  4U33 A;  5KXJ A;  4B3S T;  2BG9 E;  3FHN A;  3AEC A;  5AQR B;  2AXD S;  2BKP A;  3EHZ A;  3K3O A;  4IT4 A;  4PFP A;  2VKO A;  5ABG A;  3ZJ2 A;  3UFG A;  2FJE A;  4YTP A;  2XY8 B;  2H7V C;  4E7Z A;  5C8Y E;  1MND A;  2CE7 A;  3TKL B;  4EOZ B;  2FUP A;  2KSR A;  1LKX A;  2BVL A;  4GYR A;  2LSY A;  2XSA A;  1G8X A;  3LK2 B;  1WLX A;  2VQE T;  4JI8 T;  4X1Y E;  4AI6 A;  1VRB A;  1KEY A;  2FJA A;  4H9O C;  1XNQ T;  2E5L T;  1BR2 A;  3SFE A;  4IE7 A;  4DV0 T;  4FI5 A;  2JMK A;  5J1G A;  4IDN A;  5LP6 E;  4LMJ A;  2XSB A;  4PJL A;  4BA9 A;  3R84 B;  3PU3 A;  1HTJ F;  3EI0 A;  4E7S A;  3F2E A;  2I6H A;  5FMN A;  4C90 A;  2LLY A;  5ABF A;  4DR3 T;  2ZM8 A;  1MMA A;  4JI7 T;  1HG5 A;  3FZK B;  2IHR 1;  2XAJ B;  2WSS V;  3OKQ A;  2LKG A;  2IW5 B;  2LJL A;  5FY7 A;  4HWH A;  4EGW A;  3UU8 A;  2Y48 B;  5HXE A;  2WZI A;  3C98 B;  2BS4 A;  4I0U A;  4N78 D;  3ZT5 A;  4DR5 T;  3ZPO A;  2XAS B;  2V8S V;  2W00 A;  3WAJ A;  3IF8 B;  2XM2 A;  4Z91 A;  2V26 A;  2BBH A;  2ACX A;  3O1I A;  2ES0 A;  4X1I E;  4O4H E;  5JDH A;  2EHO D;  1ZEE A;  4H9N C;  4X65 T;  4JEH B;  4J2C A;  4KP3 C;  2QA7 A;  3AE7 A;  2WQY A;  4AKR B;  1MMG A;  1QUU A;  2K3W A;  5ABE A;  5J2U E;  2MYS A;  4QWN B;  2ZMA A;  2IC6 A;  3C4X A;  4JLE A;  4B6X A;  5LG4 A;  5FL0 A;  4YT0 A;  2XAF B;  5JDG A;  5H6R B;  3Q5W A;  3P8C D;  2BVM A;  3NZP A;  1IAP A;  1J5W A;  5DAB A;  4EZ4 A;  5L3C B;  4WBO A;  4NUV A;  4JI5 T;  3NKZ A;  4L9I A;  2YEV C;  5CGM A;  4TV9 E;  1OED B;  4YJ2 E;  4QXH B;  1D0Z A;  1XDO A;  4GOU A;  4IDO A;  2WM9 A;  2WP9 A;  1NEK A;  3E22 E;  3O1H A;  3RKO A;  4DBQ A;  3UUL A;  1CHU A;  2WDR A;  4YSY A;  4QKN A;  4PK6 A;  5BR8 T;  4JEU B;  4KI0 F;  2V6Y B;  5TAO A;  1HNX T;  4UF0 A;  3FXE B;  2DI4 A;  1LVF A;  3O1J A;  3KFW X;  1I94 T;  4YXD A;  3PUA A;  4M1P A;  2X68 A;  4U72 A;  5AQV B;  4DUY T;  2EHO B;  4HFB A;  3DTO A;  4GKK T;  5FY1 A;  3LBX B;  2LOS A;  1XWM A;  4LF4 T;  1KNR A;  2W0G A;  5C2T A;  1JNZ A;  4I50 E;  5CJ5 A;  1LVK A;  2XQ7 A;  5HWY A;  5J0Z A;  3NBX X;  3CQX C;  2B76 A;  2WMO A;  4IDZ A;  5AQU B;  5AQF B;  4JI2 T;  4DV3 T;  2LOP A;  4XAX B;  1MIW A;  2X9H A;  1HR0 T;  2JJ9 A;  3UU3 A;  5JDM A;  3Q9D A;  2FJD A;  3SRZ A;  4LF5 T;  3EAB A;  1OXZ A;  3C50 A;  4FJO A;  2VVS A;  3MJX A;  3AEG A;  1HG2 A;  3IEE A;  4IDP A;  3LK3 B;  4V1A v;  2K5B B;  5AQN B;  1D1A A;  2WMN A;  3MZK B;  4IHJ E;  4F8H A;  2H88 A;  3C51 A;  1N34 T;  2YDS A;  5JDF A;  3PUX F;  1XDP A;  2VQF T;  1HS7 A;  4MBQ A;  4PK4 A;  4AKI A;  2LKH A;  4JYA T;  2CXF A;  2XAH B;  4OK0 A;  3RQW A;  1MIV A;  2KND A;  2XHE B;  3RRC A;  3FB2 A;  1W0B A;  2R6G F;  5HCJ A;  5CB4 E;  4TN7 B;  3ZN0 B;  4CQI A;  5LHH B;  3TLW A;  1XNR T;  1KK7 A;  2VL8 A;  2QVA A;  3ONX A;  2LEH A;  3PUZ F;  5ABF B;  2LSI A;  3AA6 B;  2JIW A;  4ILB A;  2Y8D A;  1T98 A;  2XJ7 A;  2ZLY A;  1G73 A;  3QK6 A;  2CPT A;  3S4U A;  2Q9Q B;  3CPZ A;  2MPK A;  1KFY A;  5HEJ A;  4JI3 T;  3AA0 B;  2HN1 A;  3JCF A;  2VB6 A;  4BJM A;  4YTN A;  1DU2 A;  2H7O A;  5HEH A;  4DBR A;  2XM1 A;  2JQQ A;  4WZX A;  3N9L A;  2CCQ A;  5LGT B;  4UV9 B;  1WR0 A;  5JRE A;  4DV7 T;  2CEA A;  2GK9 A;  2X0L B;  1FEW A;  1E2A A;  4X5T A;  5AQI B;  3AEB A;  3HI2 A;  3UU6 A;  4UIG A;  2A9U A;  5BMV E;  1I6Z A;  5AQS B;  1S35 A;  1D1B A;  1WCR A;  4Z90 A;  2LM2 A;  1QLB A;  3L09 A;  2RA1 A;  3AEA A;  2VKD A;  4H9P C;  4IE0 A;  4HN9 A;  4QXB B;  3VKG A;  5JH7 E;  5L2L A;  2G0U A;  2PFV A;  4Z8X A;  2M6I A;  4AQG A;  1WYC A;  5DQV A;  2BBJ A;  4MFR A;  2MBG A;  3RQU A;  4TV8 E;  2Y6X A;  3X1D A;  3AXJ B;  3ZST A;  3A7M A;  3JAD A;  3LK4 2;  2L9Q A;  3UFE A;  4C91 A;  2I0M A;  3LFM A;  4DMV A;  4EAH A;  4HE8 A;  3T1H T;  3CX6 B;  4IDQ A;  3RGL A;  3A8Y C;  4G63 A;  3Q2M A;  3OJA A;  1V9D A;  3ZMT B;  4GIW A;  3O9X A;  3E08 A;  4CI1 B;  3O4X E;  2CWY A;  3AEF A;  2W4X A;  2JRK A;  3EDU A;  2L3L A;  3H3A A;  4HWF A;  3MA9 A;  2BKN A;  2VWA A;  2WAU A;  2WZH A;  4H9R C;  2V7I A;  2NTX A;  1ZKE A;  2CM0 A;  2W67 A;  1MNE A;  3AE3 A;  2VK9 A;  4I4T E;  4ILC A;  3RIU A;  2OA5 A;  3MAC A;  4AIS A;  5F5W A;  3PUQ A;  1W09 A;  1OED C;  2K24 A;  3AVR A;  3G06 A;  2V7M A;  3N5L A;  4UVB B;  1FMV A;  5L3F B;  5L3G B;  3RHW A;  2K48 A;  4LF9 T;  1HNW T;  3AE9 A;  3NZQ A;  4JI0 T;  4B3R T;  4CXX A;  2LSK A;  2BS3 A;  2EHO A;  1KNP A;  2M67 A;  2N2N A;  2ZM2 A;  3PU8 A;  4H9S E;  2YOE A;  3E0Z A;  4U31 A;  3K3Q C;  3UUB A;  5HYA A;  1X79 A;  2Q9Q C;  2Z6E A;  2HH7 A;  5C3J A;  5HEO A;  3BQI A;  3KV4 A;  1X9B A;  1UGO A;  1R8I A;  2JQ9 A;  2XZE A;  4O8S A;  4I43 B;  3ZEF B;  1UX4 A;  5HXS A;  2JPF A;  4H63 H;  4DR6 T;  4NPP A;  2DCF A;  2IC9 A;  3N2K E;  2IDO B;  4UEM A;  1MIY A;  3L3P A;  3LG7 A;  1EZ3 A;  1U5P A;  2CA5 A;  3W15 B;  1D0Y A;  4UV8 B;  2PJQ A;  3SWH A;  3RX6 A;  2LT3 A;  3CX7 B;  2E2A A;  2J62 A;  2XPK A;  2CRB A;  2M6B A;  2WY2 A;  4IE5 A;  5M4Y A;  4ASK A;  5FXX A;  2UXN B;  2CHO A;  4CN4 A;  5LB7 B;  3U78 A;  2V7K A;  5EZY E;  4LF7 T;  4ZXL A;  3AE2 A;  4G2A A;  2NOX A;  4YSX A;  4DMW A;  3IBP A;  1FIO A;  5FVL A;  2UXC T;  4HFH A;  1IBL T;  1GQE A;  4HWI B;  3UUM A;  3J7Y q;  2JQH A;  3AE5 A;  4AQF A;  4X62 T; 
#chains in the Genus database with same CATH homology
 1OWA A;  4ZI2 C;  5E0O A;  3C4W A;  5LBQ B;  2D2S A;  1WYB A;  3I0O A;  4NUU A;  2DLR A;  1ZV4 X;  4IIJ E;  3NRY A;  3N9O A;  3FBL A;  3C64 A;  3ESL A;  5KMG P;  1S94 A;  2J1D G;  2D0T A;  5HXH A;  2N9D A;  2KZ7 B;  4PNI A;  3RYI E;  4K0U A;  3ZCJ A;  1UCU A;  2NTY A;  3CWZ B;  2C5J A;  4CZZ B;  4TZ4 C;  2NP9 A;  2SPC A;  4YFS A;  4X20 E;  4O2A E;  1IZN B;  3RC3 A;  4XBF B;  3ZMU B;  5DJQ C;  5FY0 A;  3R6N A;  3T8O A;  3AAI A;  1FMW A;  2E9X A;  4EZH A;  4ZI3 C;  5JDL A;  3UTK A;  3BQL A;  4YHJ A;  4MLK A;  1YW0 A;  5EK2 A;  1MMN A;  2MTQ A;  4KUM B;  2W61 A;  3FBZ A;  4O2B E;  2W62 A;  2VKH A;  4UEL A;  5JQG E;  2KWI B;  4PK5 A;  4OFZ A;  3GN5 A;  4L0R A;  5KDM C;  2N1G A;  2ODU A;  3D0T A;  3K3N A;  1D0X A;  3OYZ A;  2KWH A;  4IE6 A;  3RH3 A;  3ZC1 A;  4DO0 A;  1BR4 A;  5JR9 C;  4PJJ A;  5LHG B;  2W63 A;  3CML A;  2XUE A;  2V7L A;  3DJB A;  3HKE E;  3N9M A;  2RP4 A;  3PUR A;  1WR6 A;  3EVY A;  4HFV A;  5EK3 A;  3RRW A;  4AKG A;  3U3I A;  5HAX A;  4P0A A;  2DWK A;  5KX5 E;  2C0S A;  2E8I A;  4HGA A;  2I59 A;  3RYH E;  2C5I T;  3KVA A;  4DND A;  5F8P A;  4GYS A;  2X66 A;  3HA4 A;  5GON E;  5LNK A;  5FP3 A;  5EK4 A;  1US7 B;  4EB6 E;  3PDY A;  2IAK A;  3RPU A;  4IE4 A;  4UVC B;  3ZJ1 A;  3HKB E;  4ZS3 A;  2NW8 A;  5L3B B;  3I1A A;  3RYC E;  2QGS A;  4ZI2 D;  2CXD A;  2XTL A;  1B7T A;  4BJN A;  5ETW A;  1O3X A;  1BR1 A;  5CA0 E;  2BZB A;  5JR9 B;  2WBL A;  1IJ6 A;  5H6Q B;  1HFA A;  3I9Y A;  2A3D A;  4EYY R;  2XQY A;  3AA7 B;  1SA0 E;  4XZC A;  2KMF A;  5FXZ A;  2VAS A;  3JC6 C;  4ADZ A;  5L3E B;  1H7C A;  3CX8 B;  4ILU A;  3WI3 A;  2CLY B;  3B57 A;  3I9W A;  4YJ3 E;  4BAY B;  2D5U A;  1VOM A;  2BDE A;  3MXZ A;  2B1E A;  5IHY A;  4P0B A;  4WNK A;  2LM9 A;  2XAG B;  5HXR A;  3HL6 A;  3UT5 E;  3QUJ A;  2C5K T;  3ZMZ B;  5JRC A;  4L5G A;  3ETV A;  4ZS2 A;  3K8P C;  3SS1 A;  2Q9Q D;  3J9X 1;  3ZN1 B;  3PUG A;  4ZHQ E;  4EIW A;  5JRC B;  4IST A;  3VKH A;  2WWU A;  1Y64 B;  3VHL A;  1ZHC A;  2UXX B;  2CWO A;  5A1L A;  5LYJ E;  4CI2 B;  2CLY C;  5FXW A;  5JDQ A;  3ZC0 A;  3AA1 B;  4PAG A;  3AAA B;  4PJM A;  3CQC B;  2YU1 A;  2KLQ A;  4TUY E;  4QX8 B;  4WW0 A;  3ZLI A;  2X9Y A;  2ZM0 A;  4QX7 B;  4AKH A;  5J2T E;  1IJ5 A;  5HWX A;  2NW7 A;  3A5X A;  3PTR B;  1NWM X;  3BQK A;  3V5S A;  5LJN A;  3AAE B;  4PJN A;  5ADX L;  3KV5 A;  3WAK A;  4X1K E;  5IYZ E;  2LHR A;  2PBI A;  3HR0 A;  3OBV E;  3LBX A;  4ISS A;  3ZYL A;  3SOL A;  2HPL A;  2NW9 A;  4HEA A;  3EUH A;  4YLH A;  2JMH A;  5JR9 A;  3ZCI A;  5LHI B;  4TX5 A;  5LGU B;  4UF0 B;  2HPJ A;  2X51 A;  4MAL A;  2VKJ A;  2E9X C;  5DQW A;  5LBM A;  3VU7 H;  4ANJ A;  3GN5 B;  1YKH B;  1NAF A;  4DVD A;  3KV6 A;  2CMR A;  3FXD B;  4IGU A;  3I0Q A;  2LE8 A;  3ANW B;  3V5U A;  2CXL A;  3HKD E;  5CA1 E;  5AFU L;  5LOV E;  5F3J A;  1CUN A;  5LA6 E;  3EDV A;  4U74 A;  3ANW A;  2E9X B;  3F57 A;  2YK0 A;  3JC6 D;  5LCY A;  2D0U A;  3UUN A;  1WRD A;  4EYU A;  5FYM A;  3M65 A;  3CVR A;  2X67 A;  4KMC A;  2LSJ A;  4F6R C;  2KXP B;  2YIN A;  1AJ3 A;  1Z0P A;  5LXT E;  3ZYM A;  3RC8 A;  2V1D B;  3OYX A;  5FXV A;  3ZMV B;  3GWH A;  2V7J A;  2A72 A;  4PW8 A;  3KV9 A;  3ETU A;  3KBU A;  2A2F X;  3KDS E;  1HX8 A;  5LGN B;  3HKC E;  4O4I E;  4OYJ A;  5HXC A;  4AKL A;  4AQF C;  4ERR A;  3CQG B;  2X9X A;  4CI3 B;  1HCI A;  3CKD A;  2KIN B;  5JVD E;  4A56 A;  3N9Q A;  4AXP A;  3PE0 A;  4HKA A;  3N9N A;  2NWB A;  2X9W A;  2KT9 A;  3B13 A;  1LRZ A;  1U4Q A;  2L8K A;  3LJC A;  2K9A A;  4OHF A;  3RYF E;  4O4J E;  4CXW A;  3KIN B;  2PG8 A;  3PUS A;  2E9X D;  4CXY A;  1YD8 G;  2MOZ A;  5JDN A;  1E1H B;  3MKD A;  3NRX A;  4EXT A;  5LJM A;  3AVS A;  4H63 V;  4PFO A;  4ZOL E;  3ZMS B;  1SHZ C;  4KBM B;  4WBN E;  1D1C A;  3N2O A;  4O4L E;  4ZI3 D;  3N9P A;  3KVB A;  1YKE B;  5L3D B;  4H9Q C;  2EHO C;  4QXC B;  1KNZ A;  2DHR A;  3C4Z A;  4UVA B;  2P9B A;  1HF8 A;  1UX5 A;  3BK9 A;  4QHO A;  5FNV E;  4ZI7 E;  2DWG A;  3N2G E;  4P09 A;  2H3R A;  2XAQ B;  4GK5 E;  2ODV A;  1BR0 A;  3MK7 C;  1QSD A;  3KBT A;  1MMD A;  3H37 A;  4I55 E;  3AB3 B;  4GK0 E;  4HTE A;  2LSG A;  3IHR A;  4UXN B;  2DNX A;  2YU2 A;  3QC9 A;  3GA8 A;  3Q5X A;  4MHC A;  3DP7 A;  2LHN A;  3F31 A;  4OYK A;  4TN7 B;  3ZYK A;  2Q9Q A;  3P7I A;  3GMI A;  4JUY A;  3FHN A;  4BA9 A;  4EAH A;  3K3O A;  4PFP A;  2VKO A;  3ZJ2 A;  2H7V C;  4E7Z A;  5C8Y E;  1MND A;  2CE7 A;  3TKL B;  4EOZ B;  1LKX A;  2BVL A;  4GYR A;  2LSY A;  1G8X A;  3LK2 B;  1WLX A;  4X1Y E;  4AI6 A;  1VRB A;  4H9O C;  1BR2 A;  4IE7 A;  4FI5 A;  2JMK A;  5J1G A;  5LP6 E;  4PJL A;  3R84 B;  3PU3 A;  1HTJ F;  4E7S A;  3F2E A;  5FMN A;  4C90 A;  2ZM8 A;  1MMA A;  1HG5 A;  2XAJ B;  2WSS V;  3OKQ A;  2IW5 B;  2LJL A;  5FY7 A;  2Y48 B;  5HXE A;  3C98 B;  4N78 D;  3ZPO A;  2XAS B;  2W00 A;  3WAJ A;  3IF8 B;  2V26 A;  3O1I A;  2ACX A;  2ES0 A;  4X1I E;  4O4H E;  5JDH A;  2EHO D;  1ZEE A;  4H9N C;  4JEH B;  4J2C A;  4KP3 C;  2QA7 A;  4AKR B;  1MMG A;  1QUU A;  5J2U E;  2MYS A;  4QWN B;  2ZMA A;  2IC6 A;  3C4X A;  4JLE A;  4B6X A;  5LG4 A;  2XAF B;  5JDG A;  5H6R B;  3Q5W A;  3P8C D;  2BVM A;  3NZP A;  1IAP A;  5DAB A;  4EZ4 A;  5L3C B;  4WBO A;  4NUV A;  4L9I A;  2YEV C;  4TV9 E;  4YJ2 E;  4QXH B;  1D0Z A;  4GOU A;  2WM9 A;  3E22 E;  3O1H A;  3RKO A;  4DBQ A;  3UUL A;  4QKN A;  4PK6 A;  4JEU B;  5TAO A;  4UF0 A;  3FXE B;  2DI4 A;  1LVF A;  3O1J A;  3KFW X;  3PUA A;  4M1P A;  2X68 A;  4U72 A;  2EHO B;  3DTO A;  5FY1 A;  3LBX B;  2LOS A;  2W0G A;  4I50 E;  1LVK A;  5HWY A;  3NBX X;  3CQX C;  2WMO A;  4IDZ A;  2LOP A;  4XAX B;  1MIW A;  2X9H A;  2JJ9 A;  5JDM A;  3Q9D A;  3SRZ A;  1OXZ A;  3C50 A;  4FJO A;  3MJX A;  1HG2 A;  3IEE A;  3LK3 B;  4V1A v;  2K5B B;  1D1A A;  2WMN A;  3MZK B;  4IHJ E;  3C51 A;  5JDF A;  1HS7 A;  4MBQ A;  4PK4 A;  4AKI A;  2CXF A;  2XAH B;  4OK0 A;  1MIV A;  2KND A;  2XHE B;  3RRC A;  3FB2 A;  5LHH B;  5CB4 E;  3ZN0 B;  4CQI A;  1KK7 A;  2VL8 A;  3ONX A;  2LEH A;  2LSI A;  3AA6 B;  2Y8D A;  1T98 A;  2ZLY A;  1G73 A;  3QK6 A;  3S4U A;  2Q9Q B;  3CPZ A;  3AA0 B;  2VB6 A;  4BJM A;  2H7O A;  4DBR A;  2JQQ A;  3N9L A;  2CCQ A;  5LGT B;  4UV9 B;  5JRE A;  2CEA A;  2GK9 A;  2X0L B;  1FEW A;  3HI2 A;  4UIG A;  5BMV E;  1S35 A;  1D1B A;  4IE0 A;  3L09 A;  2RA1 A;  4H9P C;  2VKD A;  4QXB B;  4HN9 A;  3VKG A;  5JH7 E;  5L2L A;  2G0U A;  2PFV A;  4Z8X A;  4AQG A;  1WYC A;  5DQV A;  4MFR A;  2MBG A;  4TV8 E;  2Y6X A;  3LK4 2;  3UFE A;  2L9Q A;  4C91 A;  3LFM A;  4DMV A;  4HE8 A;  3CX6 B;  4G63 A;  3Q2M A;  3OJA A;  1V9D A;  3ZMT B;  4GIW A;  3O9X A;  3E08 A;  4CI1 B;  3O4X E;  2CWY A;  3H3A A;  2JRK A;  3EDU A;  2L3L A;  3MA9 A;  2VWA A;  2WAU A;  4H9R C;  2V7I A;  2NTX A;  1ZKE A;  2CM0 A;  1MNE A;  2VK9 A;  4I4T E;  2OA5 A;  3MAC A;  3PUQ A;  2K24 A;  3AVR A;  3N5L A;  2V7M A;  4UVB B;  5L3F B;  1FMV A;  5L3G B;  2K48 A;  3NZQ A;  4CXX A;  2LSK A;  2EHO A;  2M67 A;  2ZM2 A;  2N2N A;  3PU8 A;  4H9S E;  3UUX B;  3E0Z A;  3K3Q C;  5HYA A;  1X79 A;  2Q9Q C;  2Z6E A;  2HH7 A;  3BQI A;  3KV4 A;  4I43 B;  3ZEF B;  4O8S A;  1UX4 A;  5HXS A;  2JPF A;  4H63 H;  2DCF A;  2IC9 A;  3N2K E;  4UEM A;  1MIY A;  3L3P A;  3LG7 A;  1EZ3 A;  1U5P A;  2CA5 A;  3W15 B;  1D0Y A;  4UV8 B;  2PJQ A;  3SWH A;  3RX6 A;  2LT3 A;  3CX7 B;  5M4Y A;  4IE5 A;  4ASK A;  5FXX A;  2UXN B;  3U78 A;  2V7K A;  5EZY E;  4G2A A;  2NOX A;  4DMW A;  3IBP A;  1FIO A;  3UUM A;  3J7Y q;  4AQF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...