1US7B

Complex of hsp90 and p50
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
200
structure length
193
Chain Sequence
HKTFVEKYEKQIKHFGMLRRWDDSQKYLSDNVHLVCEETANYLVIWCIDLEVEEKCALMEQVAHQTIVMQFILELAKSLKVDPRACFRQFFTKIKTADRQYMEGFNDELEAFKERVRGRAKLRIEKAMKEYEEEERKKRLGPGGLDPVEVYESLPEELQKCMLQDAISKMDPTDAKYHMQRCIDSGLWVPNSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chaperone
molecule keywords HEAT SHOCK PROTEIN HSP82
publication title The Mechanism of Hsp90 Regulation by the Protein Kinase-Specific Cochaperone p50(Cdc37)
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 73
structure length 193
sequence length 200
ec nomenclature
pdb deposition date 2003-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF08564 CDC37_C Cdc37 C terminal domain
B PF08565 CDC37_M Cdc37 Hsp90 binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.610 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 1us7B01
2W0GA 1US7B 2K5BB
chains in the Genus database with same CATH superfamily
4CXYA 2W66A 4KHZF 3FBZA 4JUYA 4GYSA 2KZ7B 4XAXB 5AQJB 2NW8A 2D2SA 4IIJE 3LK42 5JR9A 4ZI3D 1GQEA 2IMLA 4L5GA 4CN1A 2C5JA 2FUPA 2V7KA 3RRCA 4ISSA 3AE5A 4Q25A 4MBQA 2KINB 4OFZA 4X66T 1I6ZA 4JLEA 2CHNA 4AKLA 4YTPA 1O3XA 3AAAB 3RHWA 3KFWX 4X1KE 3LSVA 5HXEA 2ACZA 3NVOA 3EDUA 4CI1B 4LFAT 2D0UA 3ZYKA 2E5VA 3MACA 3JADA 1XNQT 3TKLB 2M6IA 1UCUA 4HN9A 4XZCA 3OYZA 3KV6A 1X9BA 2X0LB 4H9SE 4UIGA 4PJLA 3WAJA 2XAFB 4JI2T 3AE9A 4MFRA 2XAQB 4DV6T 3UFEA 2UXXB 3O9XA 1D0ZA 2XQ5A 4DMWA 3AE1A 5DQVA 2XTLA 2YU2A 2BBJA 2VKHA 5FKYA 2VASA 1LVKA 3VKGA 3C64A 1IBKT 4OHFA 2LSGA 2MYSA 5AFUL 4HFIA 4JI1T 2D0TA 1ZEEA 4QHOA 2M67A 5JDQA 1KNRA 4KP3C 3KV9A 5EK2A 3ZMTB 2J4GA 3K3NA 2K9AA 3L8RA 2JQHA 5C3JA 2LSIA 4ZZBA 2IC6A 2P9BA 3AVRA 4LF5T 3CVRA 3RYIE 4LMJA 2VVNA 4PK4A 3CMLA 3L09A 2MTQA 4HEAA 3PUWF 4EYYR 5IWAT 1IBLT 4PJMA 4DBQA 4TV8E 2HN1A 2V8SV 2AE9A 5EZYE 3RRWA 1FMVA 2XZEA 4ZI7E 3UU3A 2V5DA 1FEWA 4HWCA 2W62A 2XQ7A 2VWAA 2V5CA 3ZN0B 3SRZA 2Q9QC 1FIOA 3OVUA 2N1GA 3TLVA 3WAKA 4ERRA 4G63A 5FVLA 4AI6A 2IIUA 4PAGA 5FY0A 3QNUA 5JR9C 1MIVA 3J9X1 3I1AA 1M7KA 4P0AA 2XASB 2LRKA 2CWYA 2DCFA 3TLWA 2VKDA 3JC6D 1SHZC 2W67A 3M3ZB 3VRAA 5L3FB 1YKEB 1OEDE 5JRCA 4GOUA 3E0ZA 2X51A 3GWHA 4X65T 2HH7A 2F4VT 4B3MT 2QVAA 3RI5A 3OKQA 5EK3A 2L8KA 4UV8B 4WZXA 2QRXA 4LFCT 4KHPT 1D0YA 1T98A 3HI2A 4HFCA 3BQIA 4MLKA 1D1BA 3QK6A 5CB4E 2IUBA 2EHOA 2LSYA 4IDPA 4CXXA 2UUAT 5KMGP 4UF0B 2W61A 1DU2A 4I55E 1QUUA 4TV9E 1B7TA 2CCQA 3ZN1B 4HFDA 5LGUB 3T8OA 2BVMA 3WI3A 4IL4A 2ES0A 2NW9A 3O1IA 5JVDE 3ONXA 4BJNA 5CA0E 2ACXA 1FJGT 2L9QA 5A1LA 2WWUA 1UK5A 4DR2T 2W0GA 5LGNB 3KDSE 4HKAA 2VQFT 1V9DA 4YHJA 1J5ET 4UR9A 4A5XA 5HXRA 4U33A 3ZT7A 5IUXA 4U74A 5ABFA 4QXCB 4IE5A 5KDMC 3FZMB 5AQRB 2CBIA 4DR1T 5C8YE 4A56A 4JEUB 4ILUA 2V7LA 4JV5T 3UU4A 4X5TA 2LKHA 4QKNA 5LHIB 5JTGA 2VVSA 4F6RC 3GMIA 3Q2MA 4HWFA 5AQLB 2RA1A 2D5UA 3KBTA 5LXTE 4DIDB 4QX7B 4UVCB 2JQKA 5TAOA 4LF8T 2WU2A 1MNDA 5CGMA 3VKHA 3SWHA 5H6QB 2K24A 2XAHB 3NKZA 4H9QC 1US7B 4EEBA 5AQQB 1WCRA 2WAUA 4I50E 1BR1A 4DR7T 2WDQA 4JEHB 2YOEA 2CEAA 4OX9T 2WY2A 1NAFA 4H63H 2UXBT 2B1EA 4IE6A 2XQ6A 4IREA 4JI3T 2HHHT 3F31A 3F2EA 3JAFA 1N32T 2DLRA 2LT3A 4X20E 4NUUA 2V6YA 2CWOA 1W0BA 3HKBE 3HKEE 4N78D 1HNWT 2MPKA 4ZS2A 5LJMA 3H3AA 2YDQA 3LBXA 3UFGA 2EHOC 3NBXX 5ABGA 3LK3B 4AKGA 3KINB 4F8HA 2J62A 2G0UA 1AJ3A 4EYUA 3UU8A 3ONLC 5LHHB 3T1HT 4YSZA 1UX4A 4TNVA 3AECA 3P4PA 3UQ4A 1HNZT 4HGAA 3AA6B 4YJ3E 2OLTA 4AKRB 4B6XA 4C90A 2QA7A 1LKXA 1HF8A 4H63V 2LM2A 1ZV4X 5HXSA 2CRBA 3BK9A 3O1JA 3IHRA 4ZI2C 4B3TT 2VQET 2E2AA 3CIRA 3K3QC 3IA3A 4IDNA 2Y48B 4PJNA 2XPKA 4ANJA 4HE8A 4ZI3C 3RX6A 3AB3B 2BKOA 5LCYA 2YINA 4ISTA 3CX8B 2BS3A 2XQ3A 3B57A 3HKCE 2V1DB 3C4ZA 5CJ5A 2VB6A 1W0AA 5LMUT 4WBNE 4TWHA 1LVFA 4CQIA 4L9IA 5AQOB 4PFOA 5LGTB 4DBRA 3I9YA 1W09A 4O4IE 2W00A 4U3CA 2BG9A 4PW8A 4ZXLA 2NTYA 5L2LA 1OEDA 2FJAA 2LEHA 1I94T 4EGWA 3MZKB 2JMHA 2PFVA 5HEHA 2DI4A 4C91A 3P7IA 2XQ4A 4JI7T 2VL0A 1SE7A 3RC3A 1SUMB 5FXXA 3Q5WA 4QXBB 3UULA 1CHUA 3CPZA 3PV0F 2JMKA 1QSDA 2E9XD 3RIUA 2WBLA 4K0KT 3N9QA 3I0QA 1T72A 4IE0A 4HFVA 4EIWA 4DR3T 1Y01A 3DTOA 2NP9A 4EEDA 5BMVE 3HA4A 2IAKA 2CA5A 4H9NC 3SOLA 3A8YC 4JI8T 1JNRA 5L4HA 4KI0F 4QH5A 3FZKB 4G2AA 3UUMA 3EI0A 2LE8A 4P0BA 3FXDB 4TWDA 2A2FX 2WP9A 4DV2T 4PNIA 3PJAA 5AQPB 4H9RC 1NEKA 2NTXA 2KWIB 3GN5B 3R84B 1KNPA 3PUXF 3ZJ1A 2YDSA 5HYAA 2V7IA 1UGOA 3O4XE 4TNWA 4JI4T 1YD8G 5FMNA 3UQ7A 5H6RB 2NR4A 5GONE 5JDMA 1WFDA 1KK7A 3C4WA 3N2KE 4WBOA 4ZHQE 2CLYC 2LJLA 4QWNB 2WZIA 3SFDA 3P8CD 5BR8T 3KVBA 3KV4A 4LF7T 1MIYA 1MMDA 4YY3T 1XDPA 5AQGB 2IW5B 3AAIA 3FBLA 4X1YE 1KEYA 4GKKT 3MJXA 4UVBB 4OYJA 3CKDA 3JAEA 1VCTA 2LOSA 3MA9A 3JC6C 5FL0A 3RPUA 4J2CA 3K3OA 2PTFA 3S4UA 3PURA 1R8IA 3ZMSB 2JQQA 1KFYA 3NWIA 2MAWA 1HG5A 5HXCA 4Z91A 2NW7A 2KMFA 2BG9C 3ZYMA 4EAHA 1OEDC 3W15B 3QOFA 2UU9T 5FVKA 5JH7E 3D0TA 2VURA 4COFA 3ZT5A 3EHZA 4CN6A 3N9MA 1MMAA 3E22E 3LK2B 4CI3B 3AXJB 3ZMZB 4BJMA 4JI0T 4DR6T 2ODUA 3Q9DA 4PK5A 3K1SA 1L0VA 3AA0B 3EUHA 3N9LA 1S94A 2H88A 3BQLA 3FHNA 1KNZA 3C4XA 2RPAA 4A98A 5HEUA 2D9DA 1WRDA 2Q9QD 2LKGA 4GIWA 3B13A 4GK0E 2XSAA 4AQFA 4EZ4A 3AA7B 5M4YA 2WZHA 4MHCA 2VK9A 2YEVC 4BA9A 1NENA 4EZHA 4DV5T 3PE0A 2ZMAA 1HX1B 3HKDE 2E9XB 3L39A 1J1JA 4ILAA 1BR4A 3P4WA 1XWMA 2X9HA 4YSYA 4LF6T 4X64T 4O8SA 2XM1A 4GYRA 2V7MA 1VRBA 3AVSA 2C0SA 2VL8A 4ZOLE 4ZZCA 5E0OA 2A9UA 4ASKA 2W4XA 2Z6EA 2WWVA 2UUBT 1IAPA 3AE4A 5AQIB 3FZFB 1FMWA 1YQ4A 4NUVA 2YKSA 5HCJA 4GKJT 4QH4A 3RLFF 3KVAA 5LMNT 3CX6B 4UF0A 4KMCA 1U4QA 1M62A 3AEGA 4L0RA 5HWYA 1HX8A 5EK4A 3U78A 3IBPA 4U2ZA 2PBIA 5LG4A 2BZBA 3FZLB 2XUEA 4KUMB 2CBJA 2KNDA 2ZLYA 1HFAA 1E7PA 1HCIA 3C98B 1X79A 2BVLA 4DV7T 2H7VC 2HPJA 3L3PA 4LF4T 3NRYA 3UU6A 2BKPA 2FBWA 3PUSA 4PK6A 4YXDA 3ZC1A 2SPCA 3OTOT 3CQXC 3RQUA 3VHLA 1BR0A 3Q5EA 4O2BE 4HWHA 4CI2B 2XAJB 2DL1A 4IE7A 2K48A 4CN4A 3ZCIA 3ZLIA 4AIUA 3N5LA 5L3CB 4DR5T 2GK9A 4NXMT 1D0XA 4I43B 1IZNB 5C2TA 3LJCA 4DV4T 2UXNB 3AEBA 2K3WA 2KT9A 1MMNA 4AKHA 2DNXA 1BR2A 4DV3T 3N2OA 4YTMA 3LDQB 3QB5A 3P50A 5FP3A 4AQFC 4LF9T 4CZZB 2NWBA 2BKNA 2HPLA 2Y6XA 3EDVA 2LSJA 3UU5A 4ILCA 2YK0A 3AEEA 4O4HE 3UUBA 4FJOA 3I0OA 5LB7B 2XQYA 5AQTB 4WYVA 3ZMVB 3NZPA 2KSRA 5CFBA 4U7IA 1ZKEA 4MALA 1EZ3A 2Q9QB 5HEJA 4DUZT 1N34T 5FXZA 3QB5K 4P1NA 4YSXA 4M1PA 2XM2A 2W2UA 2OA5A 1HG2A 4AQYT 3PJAJ 1N33T 3AE6A 2J1DG 1YKHB 2X0YA 2X67A 5JR9B 3ETVA 3P4RA 1CUNA 5J2UE 2EHOD 2H3RA 2MBGA 4NPPA 4Z8XA 2ZM2A 4HWDA 3HR0A 2J47A 4U7YA 4TN7B 3VU7H 3UUXB 3GA8A 3ZYLA 4IDZA 5JDLA 4DV0T 4IT4A 2LM9A 3OJAA 3RKGA 4YHHT 5J1GA 4DMVA 2X9YA 3AE8A 3DP7A 2L3LA 4V1Av 1YXRA 3ZJ2A 4TWFA 2E5LT 1E2AA 2CXLA 4O4LE 1XZYA 4YJ2E 2PJQA 4NXNT 2CPTA 3FZHB 4ZI2D 4IE4A 3U3IA 2WQYA 3ZSTA 2I0MA 4KX6A 4UXNB 3AEFA 4UV9B 1YQ3A 3PU3A 1T8BA 5LP6E 5LBMA 2LLYA 2UUCT 3RIAA 2KXPB 3A7MA 2XQ8A 5IHYA 1G73A 3ZC0A 5KXJA 3J7Yq 3RF1A 5IYZE 2N9DA 2PG8A 4DV1T 2I59A 4O2AE 1MMGA 2FJDA 2XHEB 3VR9A 1IJ5A 3AEAA 1WR6A 3I9WA 2H89A 1UUSA 3E08A 5F3JA 3CQGB 4H9OC 4IDOA 3NZQA 3F57A 3DJBA 4U31A 2WDVA 5AQFB 2VKOA 3ESLA 3KV5A 3O1HA 5AQNB 4KBMB 1UX5A 4X1IE 2K5BB 3QUJA 4DNDA 4IDQA 5HCMA 4HFEA 3PUZF 5FY1A 3SS1A 5F5WA 2BS4A 1H7CA 2IHR1 1MNEA 4QH1A 3N9NA 4WW0A 2YU1A 4IGUA 4OK0A 3AE2A 4EB6E 1XMQT 5F8PA 5LG3A 3VR8A 3FXEB 3B5MA 1JNZA 2WCAA 1VOMA 1WLXA 3CWZB 2E8IA 2CE7A 3Q5DA 1XMOT 4EV6A 3RH3A 4AISA 3UUNA 3GN5A 3RC8A 5HAXA 2X66A 2WB5A 4IL9A 5JRCB 3JCFA 5L3DB 2XQ9A 2WDRA 5DABA 1IJ6A 3R6NA 5FYMA 4UVAB 2KLQA 3PDYA 1J5WA 4DR4T 2UXDT 2A3DA 2XJ7A 1WYBA 2LHNA 4PFPA 1UURA 2A72A 4H9PC 1QLBA 2IC9A 4JI6T 2WU5A 5AQHB 5HWXA 3EVYA 2EHOB 3RYFE 2XY8B 5L3EB 5FL1A 2YDRA 1T7SA 4TUYE 1ZOYA 2XQAA 5AQUB 3UT5E 1HTJF 4IHJE 3BQKA 3PUAA 2DWGA 4HFHA 2DWKA 2H7OA 3QC9A 2R6GF 2ZM6T 3N2GE 2XAGB 3VRBA 3MXZA 3RIUC 5JDHA 2BG9E 1WR0A 4DO0A 5FXWA 4X62T 3ZCJA 2CXDA 4DVDA 3P4QA 3SFEA 1Z8UA 2JIWA 3TLTA 3ZPOA 3LFMA 2BS2A 2V26A 3LG7A 2C5KT 2JRKA 4O4JE 5HEOA 2CMRA 5ABFB 4JBWF 3TLUA 1KF6A 5LOVE 3RQWA 3T1YT 5HEGA 5AQMB 3H37A 4E7SA 5ADXL 2X68A 2CXFA 4HFBA 3RYCE 5L3GB 4A97A 3M65A 3C50A 2DHRA 1S35A 3V5UA 3AXJA 3CK6A 5FXVA 1HS7A 4ILBA 4UEMA 4YFSA 4AKIA 5ABHA 4FI5A 1XNRT 2OV9A 2C5IT 4I4TE 4WNKA 4YTNA 1D1CA 1YW0A 3ETUA 3IF8B 3ZMUB 1Z0PA 2JQ9A 1HNXT 3FB2A 1SA0E 4LMLA 3RYHE 3ANWB 2FJBA 3C51A 1NWMX 3KBUA 3OBVE 3RGLA 2RP4A 5LA6E 4P09A 4LMKA 1U5PA 5JQGE 2LSKA 5ABEA 4ADZA 5LHGB 3TLSA 2BBHA 3PUGA 2HN2A 3G06A 2VKJA 2X0HA 2UXCT 3ABVA 5J2TE 2E9XA 2W63A 3AAEB 3AE3A 5KX5E 1OXZA 5LNKA 1OWAA 5JDFA 3OPCA 2V6YB 5AQSB 5AQVB 3UTKA 3MK7C 4CXWA 4K0UA 1E1HB 3H3MA 2Y8DA 2ODVA 2WMNA 2JJ9A 3LBXB 5LJNA 3PUQA 1MIWA 1D1AA 2B76A 3ANWA 4HWIB 2X9WA 2XSBA 3RIFA 4EOZB 1N36T 2YN6A 3PUYF 4UELA 2LRLA 3N9OA 5JDNA 1VCSA 2M6BA 5FY7A 1ZP0A 3K8PC 4TZ4C 5LYJE 3V5SA 5DJQC 5FNVE 2LHRA 3CQCB 2CLYB 2N2NA 2LOPA 3P4SA 3X1DA 4EXTA 4AXPA 3ONJA 2ZM8A 5ETWA 2CM0A 4JYAT 4AQGA 2WSSV 2V7JA 5LBQB 3HL6A 2WMOA 4QXHB 3N9PA 4JI5T 4GK5E 5J0ZA 2KWHA 3PTRB 2IDOB 2QYWA 2WM9A 4B3RT 2CHOA 5JREA 3RKOA 2V6XA 4OYKA 3ZT6A 3IEEA 4YLHA 5DQWA 1HR0T 2X9XA 3NRXA 2BG9B 1ZHCA 3OYXA 5CA1E 2BDEA 1LRZA 1OEDB 2WS3A 2I6HA 3AA1B 4PJJA 3MKDA 4TX5A 2MOZA 4I0UA 5L4EA 3PUVF 4ZEYA 4QX8B 4U2YA 3ZKRA 4NIQA 4XBFB 5L3BB 2NOXA 1W9RA 4U72A 4HTEA 1IBMT 4BAYB 1G8XA 4DUYT 4LFBT 1Y64B 1XDOA 4Z90A 2JPFA 3ZEFB 4B3ST 2E9XC 2FJEA 3EABA 4ZS3A 1WYCA 5L47A 3AEDA 2ZM0A 3EAMA 3ZSSA 3CX7B 4YT0A 2QGSA 3Q5XA 5JDGA 3AE7A 2Q9QA 3PU8A 5AQKB 4E7ZA 3A5XA 2AXDS 5HXHA
chains in the Genus database with same CATH topology
4CXYA 1WLXA 3FBZA 3CWZB 1BR4A 2DLRA 2LT3A 4JUYA 2E8IA 4X20E 4NUUA 4GYSA 2KZ7B 2CE7A 2X9HA 2CWOA 4XAXB 3HKBE 3HKEE 2NW8A 2D2SA 4N78D 4O8SA 4IIJE 3LK42 3RH3A 5JR9A 4ZI3D 4ZS2A 3UUNA 4GYRA 3GN5A 3RC8A 5LJMA 4L5GA 5HAXA 2X66A 2V7MA 3H3AA 1VRBA 5JRCB 3LBXA 5L3DB 3AVSA 2C5JA 2EHOC 2V7KA 5DABA 3RRCA 1IJ6A 4ISSA 3NBXX 3R6NA 2C0SA 2VL8A 4ZOLE 4UVAB 5E0OA 5FYMA 2KLQA 3LK3B 3PDYA 4ASKA 4AKGA 3KINB 2A3DA 4MBQA 2Z6EA 2KINB 1WYBA 2G0UA 1IAPA 2LHNA 1FMWA 1AJ3A 4EYUA 4OFZA 4PFPA 4NUVA 2A72A 5LHHB 4H9PC 1UX4A 4JLEA 2IC9A 4AKLA 3KVAA 1O3XA 5HWXA 3EVYA 4HGAA 3AAAB 3AA6B 3CX6B 2EHOB 4UF0A 3KFWX 4X1KE 4YJ3E 5HXEA 3RYFE 4KMCA 5L3EB 4AKRB 4B6XA 4C90A 3EDUA 4CI1B 1U4QA 2QA7A 4L0RA 2D0UA 4TUYE 1LKXA 1HX8A 5EK4A 3MACA 5HWYA 3ZYKA 1HF8A 4H63V 3U78A 3IBPA 3TKLB 2PBIA 3UT5E 1HTJF 5EK2A 4IHJE 5LG4A 3BQKA 1UCUA 2BZBA 1ZV4X 3PUAA 2DWGA 4HN9A 5HXSA 2DWKA 2H7OA 3BK9A 3OYZA 4XZCA 3O1JA 3IHRA 3QC9A 3KV6A 4ZI2C 2XUEA 2X0LB 2XAGB 3N2GE 4KUMB 4H9SE 4UIGA 2KNDA 2ZLYA 1HFAA 3MXZA 4PJLA 5JDHA 3WAJA 3K3QC 2Y48B 1HCIA 4DO0A 5FXWA 3C98B 1X79A 2BVLA 4PJNA 2XAFB 3ZCJA 2H7VC 2HPJA 2CXDA 3L3PA 4ANJA 4HE8A 4DVDA 4MFRA 3NRYA 2XAQB 4ZI3C 3UFEA 3RX6A 3AB3B 2UXXB 5LCYA 2YINA 3ZPOA 3O9XA 1D0ZA 3PUSA 3LFMA 4PK6A 3ZC1A 4DMWA 4ISTA 2SPCA 3CX8B 5DQVA 2XTLA 2V26A 2YU2A 3LG7A 2C5KT 3B57A 2VKHA 3CQXC 2VASA 1LVKA 3HKCE 2JRKA 2V1DB 4O4JE 3VKGA 3C4ZA 3VHLA 1BR0A 2CMRA 4O2BE 3C64A 4CI2B 4OHFA 2LSGA 2MYSA 5AFUL 2XAJB 2VB6A 5LOVE 4IE7A 4WBNE 2D0TA 2K48A 1LVFA 1ZEEA 4L9IA 2M67A 4QHOA 4PFOA 4CQIA 5JDQA 5LGTB 4KP3C 3I9YA 3KV9A 3ZCIA 3ZMTB 3ZLIA 3H37A 4DBRA 3K3NA 3N5LA 4E7SA 2K9AA 4O4IE 5ADXL 2W00A 5L3CB 2X68A 2GK9A 2CXFA 2LSIA 4PW8A 2IC6A 2P9BA 3RYCE 5L3GB 1D0XA 2NTYA 3AVRA 5L2LA 3M65A 3C50A 4I43B 2DHRA 2LEHA 1IZNB 1S35A 3CVRA 3V5UA 3LJCA 3RYIE 2UXNB 3MZKB 2JMHA 5FXVA 2KT9A 1HS7A 2PFVA 1MMNA 4PK4A 4UEMA 3CMLA 4AKHA 2DI4A 4YFSA 4AKIA 2DNXA 4FI5A 3L09A 4C91A 3P7IA 2MTQA 4HEAA 2C5IT 4EYYR 4PJMA 3RC3A 4DBQA 4I4TE 4TV8E 4WNKA 1BR2A 5FXXA 1D1CA 1YW0A 3ETUA 3Q5WA 4QXBB 3UULA 5EZYE 3RRWA 3IF8B 3ZMUB 3N2OA 1Z0PA 1FMVA 5FP3A 4AQFC 3CPZA 4ZI7E 3FB2A 3HKDE 1SA0E 3RYHE 4CZZB 1FEWA 2NWBA 3ANWB 3C51A 1NWMX 2HPLA 2W62A 2JMKA 3KBUA 1QSDA 2VWAA 3OBVE 2Y6XA 2E9XD 3ZN0B 3SRZA 3EDVA 2LSJA 2Q9QC 2WBLA 2YK0A 2RP4A 1FIOA 3N9QA 5LA6E 4P09A 2N1GA 4O4HE 3WAKA 4FJOA 4ERRA 4G63A 1U5PA 3I0QA 5JQGE 3I0OA 2LSKA 4ADZA 5LHGB 4AI6A 4PAGA 4IE0A 2XQYA 3PUGA 4HFVA 3ZMVB 2VKJA 3NZPA 5FY0A 4EIWA 3DTOA 2NP9A 2E9XA 1ZKEA 5J2TE 4MALA 2W63A 5JR9C 1MIVA 3HA4A 2IAKA 3AAEB 1EZ3A 2Q9QB 3I1AA 3J9X1 5BMVE 2CA5A 5FXZA 4H9NC 3SOLA 4M1PA 5KX5E 1OXZA 5LNKA 4P0AA 2OA5A 1HG2A 1OWAA 2XASB 2CWYA 2DCFA 5JDFA 4G2AA 2VKDA 3UUMA 3JC6D 3UTKA 1SHZC 2LE8A 1YKEB 3MK7C 4CXWA 5L3FB 2J1DG 4P0BA 3FXDB 4K0UA 1YKHB 2A2FX 4PNIA 5JRCA 4GOUA 2X67A 3E0ZA 2X51A 5JR9B 1E1HB 3ETVA 2NTXA 3GWHA 4H9RC 2KWIB 1CUNA 5J2UE 2EHOD 2H3RA 2Y8DA 3GN5B 3R84B 2ODVA 2HH7A 2WMNA 2MBGA 2JJ9A 3LBXB 4Z8XA 2ZM2A 3OKQA 5EK3A 2L8KA 3HR0A 4UV8B 5LJNA 3PUQA 3ZJ1A 4TN7B 1MIWA 3VU7H 3UUXB 1D0YA 3GA8A 1T98A 3ZYLA 1D1AA 3HI2A 4IDZA 5JDLA 5HYAA 2V7IA 3ANWA 3O4XE 3BQIA 1YD8G 2LM9A 5FMNA 2X9WA 4MLKA 1D1BA 3QK6A 5CB4E 3OJAA 4EOZB 2EHOA 5H6RB 5J1GA 5GONE 4DMVA 5JDMA 2LSYA 4UELA 2X9YA 1KK7A 3C4WA 3N2KE 4CXXA 3DP7A 4WBOA 4ZHQE 2L3LA 4V1Av 2CLYC 2LJLA 3N9OA 4QWNB 5JDNA 5KMGP 4UF0B 3ZJ2A 2W61A 4I55E 2CXLA 5FY7A 4O4LE 1QUUA 3P8CD 4TV9E 4YJ2E 1B7TA 3KVBA 3KV4A 1MIYA 2CCQA 2PJQA 3ZN1B 3K8PC 1MMDA 3T8OA 2BVMA 4TZ4C 3WI3A 5LGUB 5LYJE 4ZI2D 3V5SA 5DJQC 4IE4A 5FNVE 2ES0A 2IW5B 2LHRA 3U3IA 2NW9A 3O1IA 5JVDE 3ONXA 3AAIA 3FBLA 4X1YE 4BJNA 3CQCB 2CLYB 2N2NA 5CA0E 2LOPA 2ACXA 3MJXA 4UVBB 2L9QA 5A1LA 4OYJA 4UXNB 2WWUA 3CKDA 4EXTA 2W0GA 4UV9B 4AXPA 5LGNB 3KDSE 3PU3A 2LOSA 2ZM8A 5ETWA 5LP6E 3MA9A 3JC6C 2CM0A 4HKAA 3RPUA 5LBMA 4J2CA 3K3OA 4AQGA 3S4UA 2WSSV 2KXPB 1V9DA 4YHJA 2V7JA 3PURA 5LBQB 3HL6A 3ZMSB 2JQQA 5IHYA 1G73A 2WMOA 1HG5A 3N9PA 4QXHB 5HXRA 4U74A 5HXCA 3ZC0A 4QXCB 4GK5E 2NW7A 2KMFA 4IE5A 5KDMC 3J7Yq 5IYZE 2KWHA 3PTRB 3ZYMA 2N9DA 4EAHA 2WM9A 5C8YE 4A56A 2PG8A 5JREA 3RKOA 3W15B 2I59A 4O2AE 4JEUB 1MMGA 4ILUA 2V7LA 4OYKA 2XHEB 5JH7E 3D0TA 1IJ5A 3IEEA 4YLHA 5DQWA 1WR6A 4QKNA 3I9WA 5LHIB 2X9XA 3NRXA 3E08A 3GMIA 4F6RC 5F3JA 1VOMA 3Q2MA 1ZHCA 3OYXA 5CA1E 2BDEA 1LRZA 3CQGB 3N9MA 4H9OC 2RA1A 3NZQA 3F57A 2D5UA 3DJBA 1MMAA 3E22E 3LK2B 3AA1B 4CI3B 2VKOA 3ESLA 3MKDA 4PJJA 3ZMZB 4TX5A 4BJMA 2ODUA 3Q9DA 2MOZA 3KBTA 3KV5A 3O1HA 4KBMB 4PK5A 4QX8B 1UX5A 4X1IE 5LXTE 2K5BB 4XBFB 5L3BB 4QX7B 2NOXA 3QUJA 4DNDA 4U72A 3AA0B 4HTEA 5FY1A 3F2EA 3EUHA 3SS1A 3N9LA 4UVCB 1S94A 5TAOA 1H7CA 1MNDA 4BAYB 3BQLA 3VKHA 3FHNA 1G8XA 3SWHA 5H6QB 2K24A 2XAHB 1KNZA 1Y64B 3C4XA 4H9QC 1MNEA 1US7B 3N9NA 2JPFA 4WW0A 2WAUA 1WRDA 2Q9QD 2YU1A 3ZEFB 2E9XC 3B13A 4GIWA 4I50E 4GK0E 4IGUA 4ZS3A 4OK0A 1BR1A 4AQFA 4EZ4A 4JEHB 3AA7B 1WYCA 5M4YA 2CEAA 4EB6E 4MHCA 2ZM0A 1NAFA 4H63H 2VK9A 2YEVC 5F8PA 3FXEB 4BA9A 3CX7B 2QGSA 2B1EA 3Q5XA 4IE6A 5JDGA 2Q9QA 3PU8A 4EZHA 4E7ZA 3PE0A 2ZMAA 3A5XA 3F31A 2E9XB 5HXHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2W0G A;  1US7 B;  2K5B B; 
#chains in the Genus database with same CATH topology
 4CXY A;  2W66 A;  4KHZ F;  3FBZ A;  4JUY A;  4GYS A;  2KZ7 B;  4XAX B;  5AQJ B;  2NW8 A;  2D2S A;  4IIJ E;  3LK4 2;  5JR9 A;  4ZI3 D;  1GQE A;  2IML A;  4L5G A;  4CN1 A;  2C5J A;  2FUP A;  2V7K A;  3RRC A;  4ISS A;  3AE5 A;  4Q25 A;  4MBQ A;  2KIN B;  4OFZ A;  4X66 T;  1I6Z A;  4JLE A;  2CHN A;  4AKL A;  4YTP A;  1O3X A;  3AAA B;  3RHW A;  3KFW X;  4X1K E;  3LSV A;  5HXE A;  2ACZ A;  3NVO A;  3EDU A;  4CI1 B;  4LFA T;  2D0U A;  3ZYK A;  2E5V A;  3MAC A;  3JAD A;  1XNQ T;  3TKL B;  2M6I A;  1UCU A;  4HN9 A;  4XZC A;  3OYZ A;  3KV6 A;  1X9B A;  2X0L B;  4H9S E;  4UIG A;  4PJL A;  3WAJ A;  2XAF B;  4JI2 T;  3AE9 A;  4MFR A;  2XAQ B;  4DV6 T;  3UFE A;  2UXX B;  3O9X A;  1D0Z A;  2XQ5 A;  4DMW A;  3AE1 A;  5DQV A;  2XTL A;  2YU2 A;  2BBJ A;  2VKH A;  5FKY A;  2VAS A;  1LVK A;  3VKG A;  3C64 A;  1IBK T;  4OHF A;  2LSG A;  2MYS A;  5AFU L;  4HFI A;  4JI1 T;  2D0T A;  1ZEE A;  4QHO A;  2M67 A;  5JDQ A;  1KNR A;  4KP3 C;  3KV9 A;  5EK2 A;  3ZMT B;  2J4G A;  3K3N A;  2K9A A;  3L8R A;  2JQH A;  5C3J A;  2LSI A;  4ZZB A;  2IC6 A;  2P9B A;  3AVR A;  4LF5 T;  3CVR A;  3RYI E;  4LMJ A;  2VVN A;  4PK4 A;  3CML A;  3L09 A;  2MTQ A;  4HEA A;  3PUW F;  4EYY R;  5IWA T;  1IBL T;  4PJM A;  4DBQ A;  4TV8 E;  2HN1 A;  2V8S V;  2AE9 A;  5EZY E;  3RRW A;  1FMV A;  2XZE A;  4ZI7 E;  3UU3 A;  2V5D A;  1FEW A;  4HWC A;  2W62 A;  2XQ7 A;  2VWA A;  2V5C A;  3ZN0 B;  3SRZ A;  2Q9Q C;  1FIO A;  3OVU A;  2N1G A;  3TLV A;  3WAK A;  4ERR A;  4G63 A;  5FVL A;  4AI6 A;  2IIU A;  4PAG A;  5FY0 A;  3QNU A;  5JR9 C;  1MIV A;  3J9X 1;  3I1A A;  1M7K A;  4P0A A;  2XAS B;  2LRK A;  2CWY A;  2DCF A;  3TLW A;  2VKD A;  3JC6 D;  1SHZ C;  2W67 A;  3M3Z B;  3VRA A;  5L3F B;  1YKE B;  1OED E;  5JRC A;  4GOU A;  3E0Z A;  2X51 A;  3GWH A;  4X65 T;  2HH7 A;  2F4V T;  4B3M T;  2QVA A;  3RI5 A;  3OKQ A;  5EK3 A;  2L8K A;  4UV8 B;  4WZX A;  2QRX A;  4LFC T;  4KHP T;  1D0Y A;  1T98 A;  3HI2 A;  4HFC A;  3BQI A;  4MLK A;  1D1B A;  3QK6 A;  5CB4 E;  2IUB A;  2EHO A;  2LSY A;  4IDP A;  4CXX A;  2UUA T;  5KMG P;  4UF0 B;  2W61 A;  1DU2 A;  4I55 E;  1QUU A;  4TV9 E;  1B7T A;  2CCQ A;  3ZN1 B;  4HFD A;  5LGU B;  3T8O A;  2BVM A;  3WI3 A;  4IL4 A;  2ES0 A;  2NW9 A;  3O1I A;  5JVD E;  3ONX A;  4BJN A;  5CA0 E;  2ACX A;  1FJG T;  2L9Q A;  5A1L A;  2WWU A;  1UK5 A;  4DR2 T;  2W0G A;  5LGN B;  3KDS E;  4HKA A;  2VQF T;  1V9D A;  4YHJ A;  1J5E T;  4UR9 A;  4A5X A;  5HXR A;  4U33 A;  3ZT7 A;  5IUX A;  4U74 A;  5ABF A;  4QXC B;  4IE5 A;  5KDM C;  3FZM B;  5AQR B;  2CBI A;  4DR1 T;  5C8Y E;  4A56 A;  4JEU B;  4ILU A;  2V7L A;  4JV5 T;  3UU4 A;  4X5T A;  2LKH A;  4QKN A;  5LHI B;  5JTG A;  2VVS A;  4F6R C;  3GMI A;  3Q2M A;  4HWF A;  5AQL B;  2RA1 A;  2D5U A;  3KBT A;  5LXT E;  4DID B;  4QX7 B;  4UVC B;  2JQK A;  5TAO A;  4LF8 T;  2WU2 A;  1MND A;  5CGM A;  3VKH A;  3SWH A;  5H6Q B;  2K24 A;  2XAH B;  3NKZ A;  4H9Q C;  1US7 B;  4EEB A;  5AQQ B;  1WCR A;  2WAU A;  4I50 E;  1BR1 A;  4DR7 T;  2WDQ A;  4JEH B;  2YOE A;  2CEA A;  4OX9 T;  2WY2 A;  1NAF A;  4H63 H;  2UXB T;  2B1E A;  4IE6 A;  2XQ6 A;  4IRE A;  4JI3 T;  2HHH T;  3F31 A;  3F2E A;  3JAF A;  1N32 T;  2DLR A;  2LT3 A;  4X20 E;  4NUU A;  2V6Y A;  2CWO A;  1W0B A;  3HKB E;  3HKE E;  4N78 D;  1HNW T;  2MPK A;  4ZS2 A;  5LJM A;  3H3A A;  2YDQ A;  3LBX A;  3UFG A;  2EHO C;  3NBX X;  5ABG A;  3LK3 B;  4AKG A;  3KIN B;  4F8H A;  2J62 A;  2G0U A;  1AJ3 A;  4EYU A;  3UU8 A;  3ONL C;  5LHH B;  3T1H T;  4YSZ A;  1UX4 A;  4TNV A;  3AEC A;  3P4P A;  3UQ4 A;  1HNZ T;  4HGA A;  3AA6 B;  4YJ3 E;  2OLT A;  4AKR B;  4B6X A;  4C90 A;  2QA7 A;  1LKX A;  1HF8 A;  4H63 V;  2LM2 A;  1ZV4 X;  5HXS A;  2CRB A;  3BK9 A;  3O1J A;  3IHR A;  4ZI2 C;  4B3T T;  2VQE T;  2E2A A;  3CIR A;  3K3Q C;  3IA3 A;  4IDN A;  2Y48 B;  4PJN A;  2XPK A;  4ANJ A;  4HE8 A;  4ZI3 C;  3RX6 A;  3AB3 B;  2BKO A;  5LCY A;  2YIN A;  4IST A;  3CX8 B;  2BS3 A;  2XQ3 A;  3B57 A;  3HKC E;  2V1D B;  3C4Z A;  5CJ5 A;  2VB6 A;  1W0A A;  5LMU T;  4WBN E;  4TWH A;  1LVF A;  4CQI A;  4L9I A;  5AQO B;  4PFO A;  5LGT B;  4DBR A;  3I9Y A;  1W09 A;  4O4I E;  2W00 A;  4U3C A;  2BG9 A;  4PW8 A;  4ZXL A;  2NTY A;  5L2L A;  1OED A;  2FJA A;  2LEH A;  1I94 T;  4EGW A;  3MZK B;  2JMH A;  2PFV A;  5HEH A;  2DI4 A;  4C91 A;  3P7I A;  2XQ4 A;  4JI7 T;  2VL0 A;  1SE7 A;  3RC3 A;  1SUM B;  5FXX A;  3Q5W A;  4QXB B;  3UUL A;  1CHU A;  3CPZ A;  3PV0 F;  2JMK A;  1QSD A;  2E9X D;  3RIU A;  2WBL A;  4K0K T;  3N9Q A;  3I0Q A;  1T72 A;  4IE0 A;  4HFV A;  4EIW A;  4DR3 T;  1Y01 A;  3DTO A;  2NP9 A;  4EED A;  5BMV E;  3HA4 A;  2IAK A;  2CA5 A;  4H9N C;  3SOL A;  3A8Y C;  4JI8 T;  1JNR A;  5L4H A;  4KI0 F;  4QH5 A;  3FZK B;  4G2A A;  3UUM A;  3EI0 A;  2LE8 A;  4P0B A;  3FXD B;  4TWD A;  2A2F X;  2WP9 A;  4DV2 T;  4PNI A;  3PJA A;  5AQP B;  4H9R C;  1NEK A;  2NTX A;  2KWI B;  3GN5 B;  3R84 B;  1KNP A;  3PUX F;  3ZJ1 A;  2YDS A;  5HYA A;  2V7I A;  1UGO A;  3O4X E;  4TNW A;  4JI4 T;  1YD8 G;  5FMN A;  3UQ7 A;  5H6R B;  2NR4 A;  5GON E;  5JDM A;  1WFD A;  1KK7 A;  3C4W A;  3N2K E;  4WBO A;  4ZHQ E;  2CLY C;  2LJL A;  4QWN B;  2WZI A;  3SFD A;  3P8C D;  5BR8 T;  3KVB A;  3KV4 A;  4LF7 T;  1MIY A;  1MMD A;  4YY3 T;  1XDP A;  5AQG B;  2IW5 B;  3AAI A;  3FBL A;  4X1Y E;  1KEY A;  4GKK T;  3MJX A;  4UVB B;  4OYJ A;  3CKD A;  3JAE A;  1VCT A;  2LOS A;  3MA9 A;  3JC6 C;  5FL0 A;  3RPU A;  4J2C A;  3K3O A;  2PTF A;  3S4U A;  3PUR A;  1R8I A;  3ZMS B;  2JQQ A;  1KFY A;  3NWI A;  2MAW A;  1HG5 A;  5HXC A;  4Z91 A;  2NW7 A;  2KMF A;  2BG9 C;  3ZYM A;  4EAH A;  1OED C;  3W15 B;  3QOF A;  2UU9 T;  5FVK A;  5JH7 E;  3D0T A;  2VUR A;  4COF A;  3ZT5 A;  3EHZ A;  4CN6 A;  3N9M A;  1MMA A;  3E22 E;  3LK2 B;  4CI3 B;  3AXJ B;  3ZMZ B;  4BJM A;  4JI0 T;  4DR6 T;  2ODU A;  3Q9D A;  4PK5 A;  3K1S A;  1L0V A;  3AA0 B;  3EUH A;  3N9L A;  1S94 A;  2H88 A;  3BQL A;  3FHN A;  1KNZ A;  3C4X A;  2RPA A;  4A98 A;  5HEU A;  2D9D A;  1WRD A;  2Q9Q D;  2LKG A;  4GIW A;  3B13 A;  4GK0 E;  2XSA A;  4AQF A;  4EZ4 A;  3AA7 B;  5M4Y A;  2WZH A;  4MHC A;  2VK9 A;  2YEV C;  4BA9 A;  1NEN A;  4EZH A;  4DV5 T;  3PE0 A;  2ZMA A;  1HX1 B;  3HKD E;  2E9X B;  3L39 A;  1J1J A;  4ILA A;  1BR4 A;  3P4W A;  1XWM A;  2X9H A;  4YSY A;  4LF6 T;  4X64 T;  4O8S A;  2XM1 A;  4GYR A;  2V7M A;  1VRB A;  3AVS A;  2C0S A;  2VL8 A;  4ZOL E;  4ZZC A;  5E0O A;  2A9U A;  4ASK A;  2W4X A;  2Z6E A;  2WWV A;  2UUB T;  1IAP A;  3AE4 A;  5AQI B;  3FZF B;  1FMW A;  1YQ4 A;  4NUV A;  2YKS A;  5HCJ A;  4GKJ T;  4QH4 A;  3RLF F;  3KVA A;  5LMN T;  3CX6 B;  4UF0 A;  4KMC A;  1U4Q A;  1M62 A;  3AEG A;  4L0R A;  5HWY A;  1HX8 A;  5EK4 A;  3U78 A;  3IBP A;  4U2Z A;  2PBI A;  5LG4 A;  2BZB A;  3FZL B;  2XUE A;  4KUM B;  2CBJ A;  2KND A;  2ZLY A;  1HFA A;  1E7P A;  1HCI A;  3C98 B;  1X79 A;  2BVL A;  4DV7 T;  2H7V C;  2HPJ A;  3L3P A;  4LF4 T;  3NRY A;  3UU6 A;  2BKP A;  2FBW A;  3PUS A;  4PK6 A;  4YXD A;  3ZC1 A;  2SPC A;  3OTO T;  3CQX C;  3RQU A;  3VHL A;  1BR0 A;  3Q5E A;  4O2B E;  4HWH A;  4CI2 B;  2XAJ B;  2DL1 A;  4IE7 A;  2K48 A;  4CN4 A;  3ZCI A;  3ZLI A;  4AIU A;  3N5L A;  5L3C B;  4DR5 T;  2GK9 A;  4NXM T;  1D0X A;  4I43 B;  1IZN B;  5C2T A;  3LJC A;  4DV4 T;  2UXN B;  3AEB A;  2K3W A;  2KT9 A;  1MMN A;  4AKH A;  2DNX A;  1BR2 A;  4DV3 T;  3N2O A;  4YTM A;  3LDQ B;  3QB5 A;  3P50 A;  5FP3 A;  4AQF C;  4LF9 T;  4CZZ B;  2NWB A;  2BKN A;  2HPL A;  2Y6X A;  3EDV A;  2LSJ A;  3UU5 A;  4ILC A;  2YK0 A;  3AEE A;  4O4H E;  3UUB A;  4FJO A;  3I0O A;  5LB7 B;  2XQY A;  5AQT B;  4WYV A;  3ZMV B;  3NZP A;  2KSR A;  5CFB A;  4U7I A;  1ZKE A;  4MAL A;  1EZ3 A;  2Q9Q B;  5HEJ A;  4DUZ T;  1N34 T;  5FXZ A;  3QB5 K;  4P1N A;  4YSX A;  4M1P A;  2XM2 A;  2W2U A;  2OA5 A;  1HG2 A;  4AQY T;  3PJA J;  1N33 T;  3AE6 A;  2J1D G;  1YKH B;  2X0Y A;  2X67 A;  5JR9 B;  3ETV A;  3P4R A;  1CUN A;  5J2U E;  2EHO D;  2H3R A;  2MBG A;  4NPP A;  4Z8X A;  2ZM2 A;  4HWD A;  3HR0 A;  2J47 A;  4U7Y A;  4TN7 B;  3VU7 H;  3UUX B;  3GA8 A;  3ZYL A;  4IDZ A;  5JDL A;  4DV0 T;  4IT4 A;  2LM9 A;  3OJA A;  3RKG A;  4YHH T;  5J1G A;  4DMV A;  2X9Y A;  3AE8 A;  3DP7 A;  2L3L A;  4V1A v;  1YXR A;  3ZJ2 A;  4TWF A;  2E5L T;  1E2A A;  2CXL A;  4O4L E;  1XZY A;  4YJ2 E;  2PJQ A;  4NXN T;  2CPT A;  3FZH B;  4ZI2 D;  4IE4 A;  3U3I A;  2WQY A;  3ZST A;  2I0M A;  4KX6 A;  4UXN B;  3AEF A;  4UV9 B;  1YQ3 A;  3PU3 A;  1T8B A;  5LP6 E;  5LBM A;  2LLY A;  2UUC T;  3RIA A;  2KXP B;  3A7M A;  2XQ8 A;  5IHY A;  1G73 A;  3ZC0 A;  5KXJ A;  3J7Y q;  3RF1 A;  5IYZ E;  2N9D A;  2PG8 A;  4DV1 T;  2I59 A;  4O2A E;  1MMG A;  2FJD A;  2XHE B;  3VR9 A;  1IJ5 A;  3AEA A;  1WR6 A;  3I9W A;  2H89 A;  1UUS A;  3E08 A;  5F3J A;  3CQG B;  4H9O C;  4IDO A;  3NZQ A;  3F57 A;  3DJB A;  4U31 A;  2WDV A;  5AQF B;  2VKO A;  3ESL A;  3KV5 A;  3O1H A;  5AQN B;  4KBM B;  1UX5 A;  4X1I E;  2K5B B;  3QUJ A;  4DND A;  4IDQ A;  5HCM A;  4HFE A;  3PUZ F;  5FY1 A;  3SS1 A;  5F5W A;  2BS4 A;  1H7C A;  2IHR 1;  1MNE A;  4QH1 A;  3N9N A;  4WW0 A;  2YU1 A;  4IGU A;  4OK0 A;  3AE2 A;  4EB6 E;  1XMQ T;  5F8P A;  5LG3 A;  3VR8 A;  3FXE B;  3B5M A;  1JNZ A;  2WCA A;  1VOM A;  1WLX A;  3CWZ B;  2E8I A;  2CE7 A;  3Q5D A;  1XMO T;  4EV6 A;  3RH3 A;  4AIS A;  3UUN A;  3GN5 A;  3RC8 A;  5HAX A;  2X66 A;  2WB5 A;  4IL9 A;  5JRC B;  3JCF A;  5L3D B;  2XQ9 A;  2WDR A;  5DAB A;  1IJ6 A;  3R6N A;  5FYM A;  4UVA B;  2KLQ A;  3PDY A;  1J5W A;  4DR4 T;  2UXD T;  2A3D A;  2XJ7 A;  1WYB A;  2LHN A;  4PFP A;  1UUR A;  2A72 A;  4H9P C;  1QLB A;  2IC9 A;  4JI6 T;  2WU5 A;  5AQH B;  5HWX A;  3EVY A;  2EHO B;  3RYF E;  2XY8 B;  5L3E B;  5FL1 A;  2YDR A;  1T7S A;  4TUY E;  1ZOY A;  2XQA A;  5AQU B;  3UT5 E;  1HTJ F;  4IHJ E;  3BQK A;  3PUA A;  2DWG A;  4HFH A;  2DWK A;  2H7O A;  3QC9 A;  2R6G F;  2ZM6 T;  3N2G E;  2XAG B;  3VRB A;  3MXZ A;  3RIU C;  5JDH A;  2BG9 E;  1WR0 A;  4DO0 A;  5FXW A;  4X62 T;  3ZCJ A;  2CXD A;  4DVD A;  3P4Q A;  3SFE A;  1Z8U A;  2JIW A;  3TLT A;  3ZPO A;  3LFM A;  2BS2 A;  2V26 A;  3LG7 A;  2C5K T;  2JRK A;  4O4J E;  5HEO A;  2CMR A;  5ABF B;  4JBW F;  3TLU A;  1KF6 A;  5LOV E;  3RQW A;  3T1Y T;  5HEG A;  5AQM B;  3H37 A;  4E7S A;  5ADX L;  2X68 A;  2CXF A;  4HFB A;  3RYC E;  5L3G B;  4A97 A;  3M65 A;  3C50 A;  2DHR A;  1S35 A;  3V5U A;  3AXJ A;  3CK6 A;  5FXV A;  1HS7 A;  4ILB A;  4UEM A;  4YFS A;  4AKI A;  5ABH A;  4FI5 A;  1XNR T;  2OV9 A;  2C5I T;  4I4T E;  4WNK A;  4YTN A;  1D1C A;  1YW0 A;  3ETU A;  3IF8 B;  3ZMU B;  1Z0P A;  2JQ9 A;  1HNX T;  3FB2 A;  1SA0 E;  4LML A;  3RYH E;  3ANW B;  2FJB A;  3C51 A;  1NWM X;  3KBU A;  3OBV E;  3RGL A;  2RP4 A;  5LA6 E;  4P09 A;  4LMK A;  1U5P A;  5JQG E;  2LSK A;  5ABE A;  4ADZ A;  5LHG B;  3TLS A;  2BBH A;  3PUG A;  2HN2 A;  3G06 A;  2VKJ A;  2X0H A;  2UXC T;  3ABV A;  5J2T E;  2E9X A;  2W63 A;  3AAE B;  3AE3 A;  5KX5 E;  1OXZ A;  5LNK A;  1OWA A;  5JDF A;  3OPC A;  2V6Y B;  5AQS B;  5AQV B;  3UTK A;  3MK7 C;  4CXW A;  4K0U A;  1E1H B;  3H3M A;  2Y8D A;  2ODV A;  2WMN A;  2JJ9 A;  3LBX B;  5LJN A;  3PUQ A;  1MIW A;  1D1A A;  2B76 A;  3ANW A;  4HWI B;  2X9W A;  2XSB A;  3RIF A;  4EOZ B;  1N36 T;  2YN6 A;  3PUY F;  4UEL A;  2LRL A;  3N9O A;  5JDN A;  1VCS A;  2M6B A;  5FY7 A;  1ZP0 A;  3K8P C;  4TZ4 C;  5LYJ E;  3V5S A;  5DJQ C;  5FNV E;  2LHR A;  3CQC B;  2CLY B;  2N2N A;  2LOP A;  3P4S A;  3X1D A;  4EXT A;  4AXP A;  3ONJ A;  2ZM8 A;  5ETW A;  2CM0 A;  4JYA T;  4AQG A;  2WSS V;  2V7J A;  5LBQ B;  3HL6 A;  2WMO A;  4QXH B;  3N9P A;  4JI5 T;  4GK5 E;  5J0Z A;  2KWH A;  3PTR B;  2IDO B;  2QYW A;  2WM9 A;  4B3R T;  2CHO A;  5JRE A;  3RKO A;  2V6X A;  4OYK A;  3ZT6 A;  3IEE A;  4YLH A;  5DQW A;  1HR0 T;  2X9X A;  3NRX A;  2BG9 B;  1ZHC A;  3OYX A;  5CA1 E;  2BDE A;  1LRZ A;  1OED B;  2WS3 A;  2I6H A;  3AA1 B;  4PJJ A;  3MKD A;  4TX5 A;  2MOZ A;  4I0U A;  5L4E A;  3PUV F;  4ZEY A;  4QX8 B;  4U2Y A;  3ZKR A;  4NIQ A;  4XBF B;  5L3B B;  2NOX A;  1W9R A;  4U72 A;  4HTE A;  1IBM T;  4BAY B;  1G8X A;  4DUY T;  4LFB T;  1Y64 B;  1XDO A;  4Z90 A;  2JPF A;  3ZEF B;  4B3S T;  2E9X C;  2FJE A;  3EAB A;  4ZS3 A;  1WYC A;  5L47 A;  3AED A;  2ZM0 A;  3EAM A;  3ZSS A;  3CX7 B;  4YT0 A;  2QGS A;  3Q5X A;  5JDG A;  3AE7 A;  2Q9Q A;  3PU8 A;  5AQK B;  4E7Z A;  3A5X A;  2AXD S;  5HXH A; 
#chains in the Genus database with same CATH homology
 4CXY A;  1WLX A;  3FBZ A;  3CWZ B;  1BR4 A;  2DLR A;  2LT3 A;  4JUY A;  2E8I A;  4X20 E;  4NUU A;  4GYS A;  2KZ7 B;  2CE7 A;  2X9H A;  2CWO A;  4XAX B;  3HKB E;  3HKE E;  2NW8 A;  2D2S A;  4N78 D;  4O8S A;  4IIJ E;  3LK4 2;  3RH3 A;  5JR9 A;  4ZI3 D;  4ZS2 A;  3UUN A;  4GYR A;  3GN5 A;  3RC8 A;  5LJM A;  4L5G A;  5HAX A;  2X66 A;  2V7M A;  3H3A A;  1VRB A;  5JRC B;  3LBX A;  5L3D B;  3AVS A;  2C5J A;  2EHO C;  2V7K A;  5DAB A;  3RRC A;  1IJ6 A;  4ISS A;  3NBX X;  3R6N A;  2C0S A;  2VL8 A;  4ZOL E;  4UVA B;  5E0O A;  5FYM A;  2KLQ A;  3LK3 B;  3PDY A;  4ASK A;  4AKG A;  3KIN B;  2A3D A;  4MBQ A;  2Z6E A;  2KIN B;  1WYB A;  2G0U A;  1IAP A;  2LHN A;  1FMW A;  1AJ3 A;  4EYU A;  4OFZ A;  4PFP A;  4NUV A;  2A72 A;  5LHH B;  4H9P C;  1UX4 A;  4JLE A;  2IC9 A;  4AKL A;  3KVA A;  1O3X A;  5HWX A;  3EVY A;  4HGA A;  3AAA B;  3AA6 B;  3CX6 B;  2EHO B;  4UF0 A;  3KFW X;  4X1K E;  4YJ3 E;  5HXE A;  3RYF E;  4KMC A;  5L3E B;  4AKR B;  4B6X A;  4C90 A;  3EDU A;  4CI1 B;  1U4Q A;  2QA7 A;  4L0R A;  2D0U A;  4TUY E;  1LKX A;  1HX8 A;  5EK4 A;  3MAC A;  5HWY A;  3ZYK A;  1HF8 A;  4H63 V;  3U78 A;  3IBP A;  3TKL B;  2PBI A;  3UT5 E;  1HTJ F;  5EK2 A;  4IHJ E;  5LG4 A;  3BQK A;  1UCU A;  2BZB A;  1ZV4 X;  3PUA A;  2DWG A;  4HN9 A;  5HXS A;  2DWK A;  2H7O A;  3BK9 A;  3OYZ A;  4XZC A;  3O1J A;  3IHR A;  3QC9 A;  3KV6 A;  4ZI2 C;  2XUE A;  2X0L B;  2XAG B;  3N2G E;  4KUM B;  4H9S E;  4UIG A;  2KND A;  2ZLY A;  1HFA A;  3MXZ A;  4PJL A;  5JDH A;  3WAJ A;  3K3Q C;  2Y48 B;  1HCI A;  4DO0 A;  5FXW A;  3C98 B;  1X79 A;  2BVL A;  4PJN A;  2XAF B;  3ZCJ A;  2H7V C;  2HPJ A;  2CXD A;  3L3P A;  4ANJ A;  4HE8 A;  4DVD A;  4MFR A;  3NRY A;  2XAQ B;  4ZI3 C;  3UFE A;  3RX6 A;  3AB3 B;  2UXX B;  5LCY A;  2YIN A;  3ZPO A;  3O9X A;  1D0Z A;  3PUS A;  3LFM A;  4PK6 A;  3ZC1 A;  4DMW A;  4IST A;  2SPC A;  3CX8 B;  5DQV A;  2XTL A;  2V26 A;  2YU2 A;  3LG7 A;  2C5K T;  3B57 A;  2VKH A;  3CQX C;  2VAS A;  1LVK A;  3HKC E;  2JRK A;  2V1D B;  4O4J E;  3VKG A;  3C4Z A;  3VHL A;  1BR0 A;  2CMR A;  4O2B E;  3C64 A;  4CI2 B;  4OHF A;  2LSG A;  2MYS A;  5AFU L;  2XAJ B;  2VB6 A;  5LOV E;  4IE7 A;  4WBN E;  2D0T A;  2K48 A;  1LVF A;  1ZEE A;  4L9I A;  2M67 A;  4QHO A;  4PFO A;  4CQI A;  5JDQ A;  5LGT B;  4KP3 C;  3I9Y A;  3KV9 A;  3ZCI A;  3ZMT B;  3ZLI A;  3H37 A;  4DBR A;  3K3N A;  3N5L A;  4E7S A;  2K9A A;  4O4I E;  5ADX L;  2W00 A;  5L3C B;  2X68 A;  2GK9 A;  2CXF A;  2LSI A;  4PW8 A;  2IC6 A;  2P9B A;  3RYC E;  5L3G B;  1D0X A;  2NTY A;  3AVR A;  5L2L A;  3M65 A;  3C50 A;  4I43 B;  2DHR A;  2LEH A;  1IZN B;  1S35 A;  3CVR A;  3V5U A;  3LJC A;  3RYI E;  2UXN B;  3MZK B;  2JMH A;  5FXV A;  2KT9 A;  1HS7 A;  2PFV A;  1MMN A;  4PK4 A;  4UEM A;  3CML A;  4AKH A;  2DI4 A;  4YFS A;  4AKI A;  2DNX A;  4FI5 A;  3L09 A;  4C91 A;  3P7I A;  2MTQ A;  4HEA A;  2C5I T;  4EYY R;  4PJM A;  3RC3 A;  4DBQ A;  4I4T E;  4TV8 E;  4WNK A;  1BR2 A;  5FXX A;  1D1C A;  1YW0 A;  3ETU A;  3Q5W A;  4QXB B;  3UUL A;  5EZY E;  3RRW A;  3IF8 B;  3ZMU B;  3N2O A;  1Z0P A;  1FMV A;  5FP3 A;  4AQF C;  3CPZ A;  4ZI7 E;  3FB2 A;  3HKD E;  1SA0 E;  3RYH E;  4CZZ B;  1FEW A;  2NWB A;  3ANW B;  3C51 A;  1NWM X;  2HPL A;  2W62 A;  2JMK A;  3KBU A;  1QSD A;  2VWA A;  3OBV E;  2Y6X A;  2E9X D;  3ZN0 B;  3SRZ A;  3EDV A;  2LSJ A;  2Q9Q C;  2WBL A;  2YK0 A;  2RP4 A;  1FIO A;  3N9Q A;  5LA6 E;  4P09 A;  2N1G A;  4O4H E;  3WAK A;  4FJO A;  4ERR A;  4G63 A;  1U5P A;  3I0Q A;  5JQG E;  3I0O A;  2LSK A;  4ADZ A;  5LHG B;  4AI6 A;  4PAG A;  4IE0 A;  2XQY A;  3PUG A;  4HFV A;  3ZMV B;  2VKJ A;  3NZP A;  5FY0 A;  4EIW A;  3DTO A;  2NP9 A;  2E9X A;  1ZKE A;  5J2T E;  4MAL A;  2W63 A;  5JR9 C;  1MIV A;  3HA4 A;  2IAK A;  3AAE B;  1EZ3 A;  2Q9Q B;  3I1A A;  3J9X 1;  5BMV E;  2CA5 A;  5FXZ A;  4H9N C;  3SOL A;  4M1P A;  5KX5 E;  1OXZ A;  5LNK A;  4P0A A;  2OA5 A;  1HG2 A;  1OWA A;  2XAS B;  2CWY A;  2DCF A;  5JDF A;  4G2A A;  2VKD A;  3UUM A;  3JC6 D;  3UTK A;  1SHZ C;  2LE8 A;  1YKE B;  3MK7 C;  4CXW A;  5L3F B;  2J1D G;  4P0B A;  3FXD B;  4K0U A;  1YKH B;  2A2F X;  4PNI A;  5JRC A;  4GOU A;  2X67 A;  3E0Z A;  2X51 A;  5JR9 B;  1E1H B;  3ETV A;  2NTX A;  3GWH A;  4H9R C;  2KWI B;  1CUN A;  5J2U E;  2EHO D;  2H3R A;  2Y8D A;  3GN5 B;  3R84 B;  2ODV A;  2HH7 A;  2WMN A;  2MBG A;  2JJ9 A;  3LBX B;  4Z8X A;  2ZM2 A;  3OKQ A;  5EK3 A;  2L8K A;  3HR0 A;  4UV8 B;  5LJN A;  3PUQ A;  3ZJ1 A;  4TN7 B;  1MIW A;  3VU7 H;  3UUX B;  1D0Y A;  3GA8 A;  1T98 A;  3ZYL A;  1D1A A;  3HI2 A;  4IDZ A;  5JDL A;  5HYA A;  2V7I A;  3ANW A;  3O4X E;  3BQI A;  1YD8 G;  2LM9 A;  5FMN A;  2X9W A;  4MLK A;  1D1B A;  3QK6 A;  5CB4 E;  3OJA A;  4EOZ B;  2EHO A;  5H6R B;  5J1G A;  5GON E;  4DMV A;  5JDM A;  2LSY A;  4UEL A;  2X9Y A;  1KK7 A;  3C4W A;  3N2K E;  4CXX A;  3DP7 A;  4WBO A;  4ZHQ E;  2L3L A;  4V1A v;  2CLY C;  2LJL A;  3N9O A;  4QWN B;  5JDN A;  5KMG P;  4UF0 B;  3ZJ2 A;  2W61 A;  4I55 E;  2CXL A;  5FY7 A;  4O4L E;  1QUU A;  3P8C D;  4TV9 E;  4YJ2 E;  1B7T A;  3KVB A;  3KV4 A;  1MIY A;  2CCQ A;  2PJQ A;  3ZN1 B;  3K8P C;  1MMD A;  3T8O A;  2BVM A;  4TZ4 C;  3WI3 A;  5LGU B;  5LYJ E;  4ZI2 D;  3V5S A;  5DJQ C;  4IE4 A;  5FNV E;  2ES0 A;  2IW5 B;  2LHR A;  3U3I A;  2NW9 A;  3O1I A;  5JVD E;  3ONX A;  3AAI A;  3FBL A;  4X1Y E;  4BJN A;  3CQC B;  2CLY B;  2N2N A;  5CA0 E;  2LOP A;  2ACX A;  3MJX A;  4UVB B;  2L9Q A;  5A1L A;  4OYJ A;  4UXN B;  2WWU A;  3CKD A;  4EXT A;  2W0G A;  4UV9 B;  4AXP A;  5LGN B;  3KDS E;  3PU3 A;  2LOS A;  2ZM8 A;  5ETW A;  5LP6 E;  3MA9 A;  3JC6 C;  2CM0 A;  4HKA A;  3RPU A;  5LBM A;  4J2C A;  3K3O A;  4AQG A;  3S4U A;  2WSS V;  2KXP B;  1V9D A;  4YHJ A;  2V7J A;  3PUR A;  5LBQ B;  3HL6 A;  3ZMS B;  2JQQ A;  5IHY A;  1G73 A;  2WMO A;  1HG5 A;  3N9P A;  4QXH B;  5HXR A;  4U74 A;  5HXC A;  3ZC0 A;  4QXC B;  4GK5 E;  2NW7 A;  2KMF A;  4IE5 A;  5KDM C;  3J7Y q;  5IYZ E;  2KWH A;  3PTR B;  3ZYM A;  2N9D A;  4EAH A;  2WM9 A;  5C8Y E;  4A56 A;  2PG8 A;  5JRE A;  3RKO A;  3W15 B;  2I59 A;  4O2A E;  4JEU B;  1MMG A;  4ILU A;  2V7L A;  4OYK A;  2XHE B;  5JH7 E;  3D0T A;  1IJ5 A;  3IEE A;  4YLH A;  5DQW A;  1WR6 A;  4QKN A;  3I9W A;  5LHI B;  2X9X A;  3NRX A;  3E08 A;  3GMI A;  4F6R C;  5F3J A;  1VOM A;  3Q2M A;  1ZHC A;  3OYX A;  5CA1 E;  2BDE A;  1LRZ A;  3CQG B;  3N9M A;  4H9O C;  2RA1 A;  3NZQ A;  3F57 A;  2D5U A;  3DJB A;  1MMA A;  3E22 E;  3LK2 B;  3AA1 B;  4CI3 B;  2VKO A;  3ESL A;  3MKD A;  4PJJ A;  3ZMZ B;  4TX5 A;  4BJM A;  2ODU A;  3Q9D A;  2MOZ A;  3KBT A;  3KV5 A;  3O1H A;  4KBM B;  4PK5 A;  4QX8 B;  1UX5 A;  4X1I E;  5LXT E;  2K5B B;  4XBF B;  5L3B B;  4QX7 B;  2NOX A;  3QUJ A;  4DND A;  4U72 A;  3AA0 B;  4HTE A;  5FY1 A;  3F2E A;  3EUH A;  3SS1 A;  3N9L A;  4UVC B;  1S94 A;  5TAO A;  1H7C A;  1MND A;  4BAY B;  3BQL A;  3VKH A;  3FHN A;  1G8X A;  3SWH A;  5H6Q B;  2K24 A;  2XAH B;  1KNZ A;  1Y64 B;  3C4X A;  4H9Q C;  1MNE A;  1US7 B;  3N9N A;  2JPF A;  4WW0 A;  2WAU A;  1WRD A;  2Q9Q D;  2YU1 A;  3ZEF B;  2E9X C;  3B13 A;  4GIW A;  4I50 E;  4GK0 E;  4IGU A;  4ZS3 A;  4OK0 A;  1BR1 A;  4AQF A;  4EZ4 A;  4JEH B;  3AA7 B;  1WYC A;  5M4Y A;  2CEA A;  4EB6 E;  4MHC A;  2ZM0 A;  1NAF A;  4H63 H;  2VK9 A;  2YEV C;  5F8P A;  3FXE B;  4BA9 A;  3CX7 B;  2QGS A;  2B1E A;  3Q5X A;  4IE6 A;  5JDG A;  2Q9Q A;  3PU8 A;  4EZH A;  4E7Z A;  3PE0 A;  2ZMA A;  3A5X A;  3F31 A;  2E9X B;  5HXH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...