5LJMA

Structure of spata2 pub domain
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
215
structure length
203
Chain Sequence
GPMDTKFKDDLFRKYVQFHESSDECLRVAASTLLSLHKVDPFYRFRLIQFYEVVESSLRSLSSSSLRALHGAFSMLETVGINLFLYPWKKEFRSIKTYTGPFVYYVKSTLLEEDIRAILSCMGYTPELGTAYKLRELVETLQVKMVSFELFLAKVECEQMLEIHSQVKDKGYSELDIVSERKSSAEDVRGCSDALRRRAEGRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Spermatogenesis-associated protein 2
publication title SPATA2 Links CYLD to LUBAC, Activates CYLD, and Controls LUBAC Signaling.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
total genus 83
structure length 203
sequence length 215
ec nomenclature
pdb deposition date 2016-07-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.2190 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 5ljmA00
2HPJA 2CM0A 4OYKA 4JUYA 2D5UA 5LJNA 4P0BA 4P09A 2CCQA 2HPLA 4OYJA 5LJMA 4P0AA
chains in the Genus database with same CATH superfamily
5AQSB 2WWUA 1KNPA 4EOZB 4X20E 3RIUC 3P4PA 3QNUA 1IZNB 3P4SA 4GKKT 1W9RA 2BKNA 1YXRA 4OYJA 2FJDA 2ZLYA 2CXDA 2X9XA 1HTJF 4JUYA 3JAFA 2D0UA 3FZMB 3TLTA 1E7PA 2DNXA 1HNWT 4GIWA 1IBMT 4EYUA 2M67A 4F6RC 2QRXA 4X1KE 3ZCIA 4IE5A 2QA7A 3KV9A 5C2TA 3UULA 5CGMA 4DR1T 2XHEB 4H9QC 3RI5A 3NVOA 2VKOA 3NKZA 2LOSA 3NBXX 5AQMB 3PV0F 3ZCJA 1Z8UA 4KMCA 1T98A 4O2AE 3LK2B 2AXDS 3E0ZA 5HAXA 3VHLA 1FMWA 3UQ7A 3P7IA 3LK42 5FKYA 4Z90A 2W0GA 3EVYA 5HXCA 1V9DA 2N1GA 4I0UA 3FXEB 3A5XA 3PUXF 2HN1A 3VRBA 4HTEA 2HPLA 2EHOB 2C5IT 4BJMA 5J2UE 4UF0B 5JREA 1BR4A 2J47A 3ZYKA 2J4GA 1YKEB 3CQGB 3IBPA 4PJLA 3EABA 4NUUA 5L2LA 1KFYA 4NXMT 3OPCA 1OEDC 3HI2A 5IYZE 2W4XA 4COFA 3UU6A 4ILBA 3JCFA 2V7KA 3ZMZB 3L8RA 5JDHA 2LRKA 1HG2A 2BBHA 1ZOYA 3H37A 5FYMA 3TLSA 4GKJT 4XAXB 2NTYA 3S4UA 3UU3A 3P4QA 3KV4A 4U31A 3AAEB 3RYCE 4X1YE 2V7JA 4X64T 1D1CA 1XDPA 4KUMB 4EYYR 4QXCB 2IUBA 1BR2A 4JI2T 3I1AA 5AQVB 3CX7B 3CKDA 3BQLA 3CQCB 1R8IA 3AVSA 4ZI2C 1WYCA 4J2CA 1UX4A 2DHRA 4IE7A 2EHOA 4WYVA 1GQEA 4DUZT 2VQFT 4UF0A 4HFCA 4UVAB 1XDOA 2CLYC 5C3JA 2X0HA 3RH3A 1OWAA 3P4WA 5L3DB 5JDMA 3N5LA 2BG9C 1KNRA 3AE9A 3EUHA 2BS3A 1MIYA 2WS3A 2OLTA 3MJXA 1UX5A 1T72A 2UUBT 2B76A 4DVDA 4K0KT 3AXJB 3RYIE 2OA5A 3UUNA 3ZLIA 4BAYB 2ZM8A 4HFDA 2MOZA 5H6RB 1OEDE 5HWXA 4DIDB 4DV2T 5FY0A 3RC3A 5HWYA 4IDOA 5L4HA 4DMVA 5FVLA 3AAAB 2V7MA 3AECA 4ILAA 3CX8B 2XTLA 2XAFB 4JYAT 4YHJA 3UUMA 1YD8G 3N2GE 4KI0F 1NAFA 2MPKA 4LF7T 4IE6A 5AQPB 2K3WA 2XAHB 2I59A 4PJMA 4HFVA 4ZOLE 2V6YB 4AIUA 3BQKA 1ZEEA 3A7MA 4ILUA 2E8IA 4PNIA 4CQIA 2CWOA 1NWMX 3ZT7A 3ZMVB 3PUGA 4YFSA 3HR0A 1LKXA 4LMKA 4JBWF 4ISTA 2PFVA 5LHHB 1NENA 5TAOA 1U5PA 1IAPA 4P1NA 3PTRB 3L3PA 5FXWA 2E9XD 4QX7B 2WSSV 5CB4E 3ZC1A 4G2AA 3ZT6A 4YTPA 1WCRA 2XQ3A 1D1BA 4IL9A 3BK9A 1X9BA 2WZIA 5AQLB 4CN1A 2BDEA 3NZPA 3ZJ2A 3AXJA 3IHRA 2V26A 2FUPA 4DR6T 2BG9E 2WU5A 4PK4A 5IUXA 2JQ9A 4UR9A 2UXXB 4HN9A 3RC8A 2Q9QC 4WBNE 3PUAA 3CMLA 3ONLC 2CMRA 1NEKA 1MNEA 3M65A 3P4RA 1FEWA 1LVKA 3DTOA 5DQVA 4B3TT 2VK9A 1ZP0A 1CHUA 5KX5E 3Q5EA 4AQFA 4I43B 3RKGA 2N9DA 2W67A 4HEAA 2V5DA 2DLRA 2W2UA 4AISA 3Q5DA 3NRXA 2JMKA 4IHJE 2V6YA 2CE7A 3HKEE 3Q9DA 1WRDA 5FXXA 5ETWA 4QH4A 3QK6A 3C4XA 2KT9A 3CK6A 3VR9A 1IBLT 3QC9A 3U3IA 3RIAA 4MFRA 4KBMB 1DU2A 4Q25A 1HX1B 1MMAA 2BKOA 4LMLA 2VASA 3UUXB 1J5WA 4GOUA 4DV6T 2XQ7A 1SHZC 2BG9B 4TV9E 5EK4A 5CA1E 3QB5K 4O8SA 2KXPB 3K3OA 4QH5A 4U2ZA 4NUVA 4JI1T 2NP9A 4PAGA 2WDVA 3KVAA 2NTXA 5FP3A 1YQ4A 3AA0B 5LHGB 3IF8B 3WAJA 3FZKB 1FMVA 3VRAA 4XBFB 2NWBA 4U74A 1XWMA 4AKGA 4WBOA 5KMGP 4LMJA 2BVMA 4ASKA 2VVNA 3DJBA 4FI5A 3WAKA 3FBZA 2HPJA 2CM0A 2YDRA 3AEDA 4JLEA 3CVRA 3FB2A 1N33T 3O9XA 5HEGA 4UEMA 3C51A 1UURA 3EHZA 5HXEA 4IE4A 4QH1A 2LHNA 3A8YC 2IAKA 2LT3A 4TNWA 3RGLA 1W0BA 1BR0A 2D9DA 3PDYA 1QUUA 2XM1A 3LDQB 3ZN1B 1QLBA 2VL8A 1WR6A 2SPCA 4QXBB 3JC6D 2CA5A 4L9IA 2ACZA 2BG9A 5DJQC 3I0QA 2X9WA 5LYJE 1N36T 4UIGA 5JTGA 1VOMA 1M7KA 5JR9B 2UXNB 2ACXA 2W62A 3CPZA 2GK9A 4DV7T 2LHRA 4U2YA 3HL6A 2E2AA 3I9WA 2Q9QB 3PJAA 2F4VT 2BS2A 2W00A 3ETUA 2JQHA 5LJNA 2I6HA 5AQFB 2C5JA 2CHOA 3Q5XA 1E2AA 1XMQT 3F57A 4L0RA 1H7CA 3B13A 3H3MA 4DO0A 4UVBB 2NW9A 4DV4T 1MNDA 4EGWA 4AQFC 1VCTA 1MIWA 2BVLA 3C64A 4EIWA 2KNDA 3C98B 2YOEA 2K48A 2YINA 5AFUL 4HWHA 3PUZF 1D0YA 2QYWA 5GONE 4IREA 1E1HB 3C4ZA 2KLQA 2MAWA 3ZMTB 3UU4A 1D0XA 1B7TA 3VKHA 4OYKA 4JI8T 3PURA 4TWFA 2DL1A 3ONJA 3MK7C 2WAUA 5AQTB 4A56A 3GN5B 3ZN0B 2IHR1 2LEHA 1D0ZA 4H63V 3J9X1 3FHNA 3RKOA 5JR9A 5ABEA 2XQ5A 4O4IE 1XZYA 5JRCB 4CN4A 2Q9QA 3LSVA 3UUBA 2XQAA 5HEHA 4H9NC 5LHIB 4CI3B 2BKPA 3ZEFB 1JNZA 2RPAA 2E5VA 2LM9A 2LLYA 3TLUA 5JDQA 1EZ3A 1Y64B 5BMVE 4IDPA 2FJBA 4PJNA 4YXDA 3N9PA 3L39A 4GK5E 5KXJA 4P0BA 1VRBA 2WM9A 4U7IA 3FZLB 4AKRB 2LSKA 4LF9T 4L5GA 4EEDA 3QB5A 4X62T 4LF4T 2UXCT 3MXZA 2G0UA 3MA9A 5LG3A 1G8XA 3T1YT 2BS4A 4X66T 2RP4A 5E0OA 3EI0A 3P8CD 3K3QC 2V8SV 2JIWA 2XM2A 4KHZF 2HHHT 3SOLA 3RQUA 5M4YA 2YEVC 4QKNA 3K1SA 3GN5A 3PJAJ 4BA9A 5HEJA 3CQXC 1HG5A 4O4HE 4F8HA 4U72A 5JRCA 4IIJE 2MTQA 1ZKEA 3N9OA 3ZYLA 3I0OA 5AQUB 3VU7H 3LBXA 1WLXA 4GYRA 4I50E 1MMNA 1S35A 3UQ4A 5F8PA 5AQNB 2FBWA 3KBUA 2KSRA 4B3RT 4EV6A 3F2EA 4JI6T 2ODVA 2LE8A 3AA7B 2CXLA 2IC6A 5CJ5A 1UK5A 5HYAA 2R6GF 4QWNB 2X66A 3ANWA 2CBIA 4IT4A 3ZJ1A 3U78A 3ZT5A 3EDUA 2XSAA 1XMOT 2CWYA 3ZKRA 1JNRA 2M6IA 1HR0T 2IIUA 5JDGA 4MLKA 4X5TA 2LOPA 3LK3B 3VKGA 3MZKB 2UXBT 3FBLA 3UU5A 4TNVA 2VL0A 1J1JA 2BBJA 3G06A 5FY7A 1WFDA 2ZM0A 2K5BB 4B3ST 4DV5T 2H89A 4PFPA 3GMIA 5H6QB 4LFAT 3UU8A 3KFWX 4HWCA 4GK0E 1LRZA 4KP3C 2A72A 1WR0A 4DR3T 1ZV4X 4LF6T 4YJ3E 4CN6A 2QGSA 4YLHA 5JR9C 3P50A 4IE0A 2D0TA 1LVFA 3F31A 3AA6B 3R84B 2J62A 3M3ZB 3HKBE 5LB7B 3V5SA 1S94A 1G73A 1W09A 2XUEA 3AB3B 2D5UA 1UCUA 3DP7A 4UXNB 2EHOD 5LJMA 4DBQA 3PUVF 2XAQB 2XASB 5LMNT 4DR4T 2HH7A 2D2SA 3AE4A 3SRZA 2RA1A 1L0VA 3B57A 3FZFB 4O4LE 3UT5E 2X68A 3SFDA 4HFHA 5CA0E 4UV9B 3AE1A 3PU8A 3QOFA 1YQ3A 2H7OA 4JI7T 5ADXL 2A2FX 5FMNA 4JI5T 4M1PA 4DR2T 2JPFA 1I6ZA 5FL0A 4ZXLA 4ZEYA 1OXZA 4HWDA 5IWAT 2E9XC 4NPPA 4TV8E 4P0AA 2M6BA 3RIFA 2NW7A 4BJNA 4LF5T 3QUJA 4JV5T 2CEAA 4PFOA 2XQ6A 1SUMB 5HCJA 3OYZA 1XNRT 2A9UA 3LG7A 2K9AA 3N9QA 4PK5A 5HXHA 1HF8A 3H3AA 3PUYF 3AVRA 2V7IA 3TKLB 2VB6A 1X79A 4DBRA 5HXRA 2WP9A 3HA4A 2H88A 5IHYA 1U4QA 4OFZA 4ZI3D 4DUYT 2VWAA 3RLFF 3OKQA 4U3CA 1O3XA 3OYXA 5AQQB 5HEUA 1N34T 3PE0A 4AQGA 5JDNA 4K0UA 5JH7E 4WZXA 1HNXT 3EDVA 4ZS2A 1MMDA 3AEAA 2IMLA 2IW5B 1FIOA 2DI4A 4DR5T 2ZMAA 2LKGA 5L3FB 2WCAA 3NRYA 2VURA 3NWIA 1MIVA 5EK2A 4IGUA 2WU2A 4H9PC 4WNKA 4KHPT 5LOVE 1HNZT 4I55E 2E5LT 5EK3A 2XQYA 4AXPA 2UUCT 3AEGA 5LGNB 2WMNA 3L09A 1UUSA 4C90A 4PW8A 3NZQA 1WYBA 5LA6E 4G63A 1MMGA 3ESLA 3TLVA 2JRKA 1KNZA 5FNVE 2ES0A 4ILCA 1KK7A 5LGTB 4ZHQE 4E7ZA 5FY1A 4AKLA 2VKHA 5L3GB 5LBMA 2L3LA 3O1JA 4HWFA 2XZEA 4H9OC 2CHNA 2ZM6T 4CXWA 1VCSA 1KF6A 5L3EB 5LXTE 3KINB 4E7SA 5AQKB 5HEOA 2X0YA 5LNKA 4DV1T 2XY8B 5JVDE 2CPTA 3RYHE 4O4JE 4GYSA 4H9SE 3ABVA 3ZPOA 2YN6A 3ZYMA 3C4WA 2AE9A 3N9MA 4ZS3A 2WWVA 2LJLA 2LKHA 3OBVE 5J1GA 3D0TA 4TX5A 1YW0A 4NIQA 3X1DA 2KWHA 4XZCA 2PG8A 3AEBA 3CWZB 1ZHCA 2J1DG 4LF8T 5JDFA 2WQYA 4DMWA 2W63A 2UXDT 2VKDA 4I4TE 2E9XB 3JC6C 2BZBA 2WDRA 3AE5A 4CXYA 3E22E 2Z6EA 3ZC0A 3Q2MA 3JAEA 5JQGE 4X1IE 4YY3T 2KINB 3AEEA 4JI0T 2A3DA 3AA1B 4CXXA 2XPKA 2L8KA 4DR7T 2XSBA 2LM2A 4ZI2D 4QHOA 5LMUT 4KX6A 4YT0A 3FZHB 3LBXB 1BR1A 4HFBA 3T8OA 2H3RA 2Y6XA 3AE8A 2XQ9A 3N2OA 2JQKA 3K8PC 4O2BE 4OX9T 2CXFA 3T1HT 3N9NA 4EEBA 4AI6A 1IJ6A 3UTKA 4CI1B 2V1DB 3Q5WA 3AE6A 3ZMUB 4H9RC 2VVSA 2K24A 3PU3A 4DNDA 3ANWB 5L4EA 4QXHB 3KDSE 1D1AA 4Z8XA 2E9XA 4HWIB 4C91A 2Y8DA 2IC9A 3TLWA 2XAJB 1IBKT 4AQYT 3RRCA 2MBGA 5ABFB 1J5ET 2PBIA 4EAHA 2ZM2A 2WB5A 5AQGB 3AE3A 3K3NA 3SWHA 1SE7A 4B3MT 4DV3T 3O1HA 1Z0PA 4UVCB 2FJAA 3AE7A 4YSZA 2X9HA 3OJAA 4U33A 1T8BA 3RYFE 2WZHA 2OV9A 2H7VC 1YKHB 4YSXA 3LJCA 3N2KE 4YTNA 4DV0T 4X65T 2W66A 5L3CB 3C50A 3KVBA 2LSYA 1IJ5A 3PUWF 5AQHB 3SFEA 2LSGA 3ETVA 3FXDB 3W15B 4IL4A 3UFEA 5L47A 3SS1A 2V7LA 3E08A 5AQRB 3WI3A 1T7SA 4QX8B 2UUAT 2Q9QD 3B5MA 3MKDA 3OTOT 1XNQT 2LSJA 4EZHA 3N9LA 1FJGT 5LCYA 2VQET 3PUQA 5BR8T 4MHCA 3IA3A 2YDSA 2CRBA 5ABFA 5FVKA 5F5WA 3V5UA 1W0AA 2PJQA 4ZI7E 5HXSA 1HX8A 5J0ZA 4AKIA 4HKAA 2YU2A 3ONXA 4OK0A 5FXZA 3AE2A 3RX6A 5L3BB 4A5XA 2N2NA 4HE8A 5LGUB 4EZ4A 2LRLA 4ISSA 3EAMA 4ZZBA 2X0LB 1I94T 2ODUA 4P09A 4B6XA 2KMFA 2CCQA 5C8YE 4NXNT 5LP6E 4N78D 3RIUA 4U7YA 2XAGB 5AQOB 3I9YA 5FXVA 3PUSA 4TZ4C 4A98A 4CI2B 1N32T 4TWDA 4MALA 1SA0E 5ABHA 4Z91A 4PJJA 5F3JA 4HGAA 3RF1A 2WBLA 3BQIA 1OEDB 3RPUA 3LFMA 4A97A 2C5KT 4IDNA 4JEHB 3VR8A 2C0SA 2WDQA 3ZMSB 4WW0A 4IDZA 2KZ7B 2NOXA 3CX6B 2DWKA 3GA8A 2V5CA 4EXTA 5JDLA 5DQWA 3MACA 2DWGA 2W61A 2YKSA 1HCIA 4ERRA 2V6XA 2CBJA 3GWHA 4TN7B 3J7Yq 4HFIA 2XJ7A 2HN2A 5HCMA 4TWHA 3JADA 2KWIB 4JI3T 2UU9T 2DCFA 2WMOA 2YK0A 5AQIB 5FL1A 4YHHT 2LSIA 4HFEA 4JEUB 3R6NA 2X9YA 3AAIA 2VKJA 5LBQB 1QSDA 2L9QA 3HKCE 2EHOC 1AJ3A 3UFGA 2CLYB 4LFBT 2JMHA 3O1IA 3ZSTA 4CZZB 5KDMC 1UGOA 2PTFA 3AEFA 1OEDA 4LFCT 4YSYA 1M62A 4IDQA 2JJ9A 3RQWA 4UELA 2Y48B 4ZZCA 3RHWA 5AQJB 3IEEA 3OVUA 4UV8B 4V1Av 1HFAA 1Y01A 2XQ8A 4OHFA 2YU1A 2I0MA 4EB6E 2P9BA 2X67A 1HS7A 4AKHA 3CIRA 2IDOB 4FJOA 2WY2A 3KV5A 4YJ2E 2YDQA 2NW8A 5J2TE 3KBTA 4H63H 2NR4A 2XQ4A 3KV6A 5ABGA 5LG4A 3O4XE 5EZYE 4TUYE 5CFBA 2FJEA 3HKDE 1US7B 3ZSSA 2JQQA 3RRWA 2X51A 4ANJA 1CUNA 4PK6A 4ADZA 2QVAA 5A1LA 5DABA 4YTMA 2B1EA 2MYSA 1KEYA 4ZI3C 4JI4T 4MBQA
chains in the Genus database with same CATH topology
3C4XA 3ZJ1A 2KT9A 2H3RA 2Y6XA 3U78A 3EDUA 2WWUA 3N2OA 3K8PC 4O2BE 2CWYA 2CXFA 3QC9A 3N9NA 3U3IA 4EOZB 4AI6A 4MFRA 1IJ6A 4X20E 3UTKA 4CI1B 4KBMB 1IZNB 2V1DB 5JDGA 3Q5WA 4MLKA 2LOPA 3ZMUB 3LK3B 3VKGA 3MZKB 4H9RC 3PU3A 2K24A 4OYJA 3FBLA 4DNDA 3ANWB 2ZLYA 2CXDA 1MMAA 4QXHB 2X9XA 1HTJF 2VASA 1D1AA 3KDSE 3UUXB 4GOUA 4JUYA 4Z8XA 5FY7A 2D0UA 2ZM0A 2E9XA 2K5BB 1SHZC 4C91A 4TV9E 5EK4A 4PFPA 3GMIA 5H6QB 5CA1E 2Y8DA 4MBQA 2IC9A 2DNXA 3KFWX 4O8SA 4GK0E 2KXPB 1LRZA 3K3OA 2XAJB 4KP3C 4GIWA 2A72A 3RRCA 4EYUA 2MBGA 4NUVA 2PBIA 4EAHA 2M67A 2ZM2A 4F6RC 1ZV4X 2NP9A 4PAGA 4YJ3E 3KVAA 3K3NA 2NTXA 3SWHA 4X1KE 2QGSA 3ZCIA 5FP3A 4YLHA 5JR9C 4IE5A 4IE0A 3AA0B 2D0TA 2QA7A 1LVFA 3F31A 3KV9A 3AA6B 3R84B 3O1HA 1Z0PA 5LHGB 3IF8B 3WAJA 3UULA 3HKBE 4UVCB 2XHEB 3V5SA 2X9HA 1S94A 3OJAA 4H9QC 1G73A 2VKOA 2XUEA 3RYFE 3AB3B 2LOSA 3NBXX 1FMVA 2D5UA 1UCUA 3DP7A 4UXNB 4XBFB 2EHOD 1YKHB 2H7VC 2NWBA 5LJMA 4U74A 3ZCJA 4KMCA 4DBQA 4AKGA 1T98A 4WBOA 4O2AE 5KMGP 3LK2B 2BVMA 3LJCA 3N2KE 2XAQB 4ASKA 2XASB 3E0ZA 3DJBA 2HH7A 5HAXA 3VHLA 2D2SA 5L3CB 4FI5A 3SRZA 1FMWA 3WAKA 2RA1A 3FBZA 3C50A 3KVBA 2HPJA 3B57A 2CM0A 3LK42 2LSYA 3P7IA 2W0GA 3EVYA 1IJ5A 5HXCA 4JLEA 4O4LE 3UT5E 2X68A 1V9DA 5CA0E 2N1GA 3CVRA 3FB2A 3O9XA 2LSGA 4UEMA 3ETVA 3FXDB 3FXEB 4UV9B 3C51A 3A5XA 3PU8A 5HXEA 4HTEA 4IE4A 3W15B 2H7OA 2HPLA 2EHOB 2LHNA 2C5IT 5ADXL 3UFEA 2IAKA 4BJMA 2LT3A 5J2UE 2A2FX 4UF0B 3SS1A 5FMNA 2V7LA 1BR4A 4M1PA 3E08A 3ZYKA 5JREA 2JPFA 3WI3A 1BR0A 1OXZA 4QX8B 1YKEB 3CQGB 3IBPA 4PJLA 4NUUA 3PDYA 1QUUA 5L2LA 2E9XC 2Q9QD 2VL8A 1WR6A 3MKDA 4TV8E 3ZN1B 4P0AA 2NW7A 2SPCA 4QXBB 2LSJA 3JC6D 3HI2A 4BJNA 5IYZE 2CA5A 3QUJA 4L9IA 4EZHA 3N9LA 2CEAA 4PFOA 5LCYA 5DJQC 3PUQA 2V7KA 3ZMZB 4MHCA 3OYZA 3I0QA 5JDHA 2X9WA 5LYJE 3LG7A 4UIGA 1HG2A 1VOMA 2K9AA 3H37A 5FYMA 5JR9B 2UXNB 2ACXA 4XAXB 2NTYA 2W62A 3CPZA 3S4UA 2GK9A 3V5UA 2LHRA 2PJQA 3KV4A 3HL6A 3N9QA 4PK5A 3I9WA 3AAEB 4ZI7E 5HXSA 1HX8A 2Q9QB 3RYCE 4AKIA 4HKAA 2YU2A 5HXHA 2W00A 1HF8A 3ETUA 3ONXA 4OK0A 3H3AA 5FXZA 4X1YE 3AVRA 2V7IA 3TKLB 5LJNA 2VB6A 1X79A 2V7JA 4DBRA 5HXRA 3RX6A 5L3BB 2C5JA 3HA4A 1D1CA 3Q5XA 2N2NA 4HE8A 4KUMB 5IHYA 1U4QA 4EYYR 4QXCB 5LGUB 4EZ4A 4OFZA 4ISSA 3F57A 2X0LB 4L0RA 1BR2A 1H7CA 3B13A 4ZI3D 4DO0A 2ODUA 4P09A 4UVBB 2NW9A 4B6XA 2VWAA 1MNDA 2KMFA 3I1AA 3CX7B 3OKQA 4AQFC 1O3XA 3OYXA 2CCQA 3CKDA 5C8YE 3BQLA 3PE0A 3CQCB 4AQGA 5LP6E 1MIWA 2BVLA 4N78D 3C64A 4EIWA 2KNDA 3C98B 5JDNA 3AVSA 4ZI2C 1WYCA 2K48A 4J2CA 2YINA 1UX4A 5AFUL 4K0UA 5JH7E 2DHRA 4IE7A 1D0YA 2EHOA 2XAGB 3EDVA 4ZS2A 1MMDA 2IW5B 3I9YA 5FXVA 3PUSA 4TZ4C 1FIOA 2DI4A 4UF0A 4CI2B 5GONE 4UVAB 4MALA 2CLYC 2ZMAA 1E1HB 1SA0E 3C4ZA 2KLQA 4PJJA 5L3FB 5F3JA 4HGAA 3RH3A 3NRYA 2WBLA 3ZMTB 1OWAA 3BQIA 5L3DB 1D0XA 5JDMA 3RPUA 1B7TA 3VKHA 1MIVA 4OYKA 5EK2A 4IGUA 3N5LA 4H9PC 3LFMA 3PURA 4WNKA 2C5KT 3EUHA 4JEHB 1MIYA 5LOVE 2C0SA 3MJXA 3ZMSB 3MK7C 2WAUA 1UX5A 4WW0A 4I55E 4IDZA 4A56A 5EK3A 2KZ7B 4DVDA 2NOXA 3RYIE 3GN5B 2XQYA 4AXPA 2OA5A 3UUNA 3ZLIA 4BAYB 2ZM8A 3ZN0B 5LGNB 3CX6B 2DWKA 2MOZA 5H6RB 2LEHA 2WMNA 3GA8A 3L09A 4C90A 4EXTA 1D0ZA 4H63V 4PW8A 3NZQA 1WYBA 3FHNA 5LA6E 3J9X1 3RKOA 5JDLA 5DQWA 3MACA 4G63A 5JR9A 5HWXA 1MMGA 3ESLA 2DWGA 2W61A 4O4IE 2JRKA 5FY0A 1HCIA 4ERRA 3RC3A 1KNZA 5FNVE 2ES0A 5HWYA 1KK7A 5LGTB 3GWHA 5JRCB 2Q9QA 4TN7B 5LHIB 4ZHQE 4H9NC 4DMVA 4CI3B 3AAAB 4E7ZA 3J7Yq 2V7MA 3ZEFB 3CX8B 5FY1A 4AKLA 2XTLA 2XAFB 2LM9A 4YHJA 2VKHA 5L3GB 5LBMA 3UUMA 5JDQA 2KWIB 1YD8G 3N2GE 1EZ3A 2L3LA 1NAFA 3O1JA 1Y64B 2DCFA 5BMVE 2WMOA 2YK0A 4PJNA 3N9PA 4IE6A 4H9OC 2LSIA 4GK5E 4CXWA 4JEUB 3R6NA 4P0BA 1VRBA 2WM9A 5L3EB 2X9YA 3AAIA 5LXTE 2VKJA 2XAHB 3KINB 2I59A 5LBQB 4AKRB 4E7SA 4PJMA 2LSKA 1QSDA 2L9QA 3HKCE 5LNKA 4HFVA 4L5GA 4ZOLE 2EHOC 3BQKA 1AJ3A 1ZEEA 5JVDE 4ILUA 2E8IA 4PNIA 3RYHE 4O4JE 4GYSA 4CQIA 4H9SE 2CWOA 1NWMX 3ZMVB 3MXZA 3ZPOA 3PUGA 2G0UA 3ZYMA 2CLYB 3C4WA 3MA9A 4YFSA 3HR0A 1LKXA 2JMHA 4ISTA 2PFVA 1G8XA 3N9MA 5LHHB 4ZS3A 5TAOA 2RP4A 1U5PA 1IAPA 3PTRB 5E0OA 3L3PA 5FXWA 3O1IA 2E9XD 2LJLA 3P8CD 4CZZB 3OBVE 4QX7B 2WSSV 5KDMC 3K3QC 5J1GA 5CB4E 3ZC1A 3D0TA 4G2AA 4TX5A 1YW0A 2KWHA 2JJ9A 4XZCA 4UELA 1D1BA 2Y48B 2PG8A 3SOLA 3BK9A 3IEEA 4UV8B 3CWZB 5M4YA 1ZHCA 2J1DG 2YEVC 4V1Av 4QKNA 2BDEA 3NZPA 3ZJ2A 3IHRA 3GN5A 2V26A 5JDFA 4BA9A 4PK4A 1HFAA 3CQXC 1HG5A 4DMWA 2UXXB 2W63A 4HN9A 4O4HE 4OHFA 2YU1A 3RC8A 2Q9QC 4WBNE 3PUAA 2VKDA 3CMLA 4I4TE 4EB6E 2CMRA 2E9XB 2P9BA 4U72A 2X67A 3JC6C 1HS7A 5JRCA 4AKHA 4IIJE 4FJOA 2BZBA 2MTQA 1MNEA 4CXYA 3E22E 1ZKEA 3M65A 3N9OA 3ZYLA 1FEWA 2Z6EA 1LVKA 3KV5A 4YJ2E 2NW8A 5J2TE 3I0OA 3ZC0A 3DTOA 3KBTA 3Q2MA 4H63H 3VU7H 3LBXA 5JQGE 1WLXA 5DQVA 4X1IE 4GYRA 4I50E 1MMNA 1S35A 3KV6A 2VK9A 2KINB 5F8PA 5LG4A 3O4XE 5EZYE 5KX5E 4TUYE 3KBUA 2A3DA 3AA1B 4CXXA 4AQFA 4I43B 2N9DA 3HKDE 1US7B 2JQQA 2L8KA 4HEAA 3RRWA 3F2EA 2DLRA 2X51A 4ZI2D 3NRXA 4ANJA 1CUNA 2ODVA 4QHOA 4PK6A 4ADZA 2JMKA 2LE8A 4IHJE 5A1LA 2CE7A 3AA7B 2CXLA 2IC6A 5DABA 5HYAA 3HKEE 2B1EA 2MYSA 3Q9DA 1WRDA 5FXXA 3LBXB 4QWNB 4ZI3C 5ETWA 1BR1A 3QK6A 2X66A 3ANWA 3T8OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HPJ A;  2CM0 A;  4OYK A;  4JUY A;  2D5U A;  5LJN A;  4P0B A;  4P09 A;  2CCQ A;  2HPL A;  4OYJ A;  5LJM A;  4P0A A; 
#chains in the Genus database with same CATH topology
 5AQS B;  2WWU A;  1KNP A;  4EOZ B;  4X20 E;  3RIU C;  3P4P A;  3QNU A;  1IZN B;  3P4S A;  4GKK T;  1W9R A;  2BKN A;  1YXR A;  4OYJ A;  2FJD A;  2ZLY A;  2CXD A;  2X9X A;  1HTJ F;  4JUY A;  3JAF A;  2D0U A;  3FZM B;  3TLT A;  1E7P A;  2DNX A;  1HNW T;  4GIW A;  1IBM T;  4EYU A;  2M67 A;  4F6R C;  2QRX A;  4X1K E;  3ZCI A;  4IE5 A;  2QA7 A;  3KV9 A;  5C2T A;  3UUL A;  5CGM A;  4DR1 T;  2XHE B;  4H9Q C;  3RI5 A;  3NVO A;  2VKO A;  3NKZ A;  2LOS A;  3NBX X;  5AQM B;  3PV0 F;  3ZCJ A;  1Z8U A;  4KMC A;  1T98 A;  4O2A E;  3LK2 B;  2AXD S;  3E0Z A;  5HAX A;  3VHL A;  1FMW A;  3UQ7 A;  3P7I A;  3LK4 2;  5FKY A;  4Z90 A;  2W0G A;  3EVY A;  5HXC A;  1V9D A;  2N1G A;  4I0U A;  3FXE B;  3A5X A;  3PUX F;  2HN1 A;  3VRB A;  4HTE A;  2HPL A;  2EHO B;  2C5I T;  4BJM A;  5J2U E;  4UF0 B;  5JRE A;  1BR4 A;  2J47 A;  3ZYK A;  2J4G A;  1YKE B;  3CQG B;  3IBP A;  4PJL A;  3EAB A;  4NUU A;  5L2L A;  1KFY A;  4NXM T;  3OPC A;  1OED C;  3HI2 A;  5IYZ E;  2W4X A;  4COF A;  3UU6 A;  4ILB A;  3JCF A;  2V7K A;  3ZMZ B;  3L8R A;  5JDH A;  2LRK A;  1HG2 A;  2BBH A;  1ZOY A;  3H37 A;  5FYM A;  3TLS A;  4GKJ T;  4XAX B;  2NTY A;  3S4U A;  3UU3 A;  3P4Q A;  3KV4 A;  4U31 A;  3AAE B;  3RYC E;  4X1Y E;  2V7J A;  4X64 T;  1D1C A;  1XDP A;  4KUM B;  4EYY R;  4QXC B;  2IUB A;  1BR2 A;  4JI2 T;  3I1A A;  5AQV B;  3CX7 B;  3CKD A;  3BQL A;  3CQC B;  1R8I A;  3AVS A;  4ZI2 C;  1WYC A;  4J2C A;  1UX4 A;  2DHR A;  4IE7 A;  2EHO A;  4WYV A;  1GQE A;  4DUZ T;  2VQF T;  4UF0 A;  4HFC A;  4UVA B;  1XDO A;  2CLY C;  5C3J A;  2X0H A;  3RH3 A;  1OWA A;  3P4W A;  5L3D B;  5JDM A;  3N5L A;  2BG9 C;  1KNR A;  3AE9 A;  3EUH A;  2BS3 A;  1MIY A;  2WS3 A;  2OLT A;  3MJX A;  1UX5 A;  1T72 A;  2UUB T;  2B76 A;  4DVD A;  4K0K T;  3AXJ B;  3RYI E;  2OA5 A;  3UUN A;  3ZLI A;  4BAY B;  2ZM8 A;  4HFD A;  2MOZ A;  5H6R B;  1OED E;  5HWX A;  4DID B;  4DV2 T;  5FY0 A;  3RC3 A;  5HWY A;  4IDO A;  5L4H A;  4DMV A;  5FVL A;  3AAA B;  2V7M A;  3AEC A;  4ILA A;  3CX8 B;  2XTL A;  2XAF B;  4JYA T;  4YHJ A;  3UUM A;  1YD8 G;  3N2G E;  4KI0 F;  1NAF A;  2MPK A;  4LF7 T;  4IE6 A;  5AQP B;  2K3W A;  2XAH B;  2I59 A;  4PJM A;  4HFV A;  4ZOL E;  2V6Y B;  4AIU A;  3BQK A;  1ZEE A;  3A7M A;  4ILU A;  2E8I A;  4PNI A;  4CQI A;  2CWO A;  1NWM X;  3ZT7 A;  3ZMV B;  3PUG A;  4YFS A;  3HR0 A;  1LKX A;  4LMK A;  4JBW F;  4IST A;  2PFV A;  5LHH B;  1NEN A;  5TAO A;  1U5P A;  1IAP A;  4P1N A;  3PTR B;  3L3P A;  5FXW A;  2E9X D;  4QX7 B;  2WSS V;  5CB4 E;  3ZC1 A;  4G2A A;  3ZT6 A;  4YTP A;  1WCR A;  2XQ3 A;  1D1B A;  4IL9 A;  3BK9 A;  1X9B A;  2WZI A;  5AQL B;  4CN1 A;  2BDE A;  3NZP A;  3ZJ2 A;  3AXJ A;  3IHR A;  2V26 A;  2FUP A;  4DR6 T;  2BG9 E;  2WU5 A;  4PK4 A;  5IUX A;  2JQ9 A;  4UR9 A;  2UXX B;  4HN9 A;  3RC8 A;  2Q9Q C;  4WBN E;  3PUA A;  3CML A;  3ONL C;  2CMR A;  1NEK A;  1MNE A;  3M65 A;  3P4R A;  1FEW A;  1LVK A;  3DTO A;  5DQV A;  4B3T T;  2VK9 A;  1ZP0 A;  1CHU A;  5KX5 E;  3Q5E A;  4AQF A;  4I43 B;  3RKG A;  2N9D A;  2W67 A;  4HEA A;  2V5D A;  2DLR A;  2W2U A;  4AIS A;  3Q5D A;  3NRX A;  2JMK A;  4IHJ E;  2V6Y A;  2CE7 A;  3HKE E;  3Q9D A;  1WRD A;  5FXX A;  5ETW A;  4QH4 A;  3QK6 A;  3C4X A;  2KT9 A;  3CK6 A;  3VR9 A;  1IBL T;  3QC9 A;  3U3I A;  3RIA A;  4MFR A;  4KBM B;  1DU2 A;  4Q25 A;  1HX1 B;  1MMA A;  2BKO A;  4LML A;  2VAS A;  3UUX B;  1J5W A;  4GOU A;  4DV6 T;  2XQ7 A;  1SHZ C;  2BG9 B;  4TV9 E;  5EK4 A;  5CA1 E;  3QB5 K;  4O8S A;  2KXP B;  3K3O A;  4QH5 A;  4U2Z A;  4NUV A;  4JI1 T;  2NP9 A;  4PAG A;  2WDV A;  3KVA A;  2NTX A;  5FP3 A;  1YQ4 A;  3AA0 B;  5LHG B;  3IF8 B;  3WAJ A;  3FZK B;  1FMV A;  3VRA A;  4XBF B;  2NWB A;  4U74 A;  1XWM A;  4AKG A;  4WBO A;  5KMG P;  4LMJ A;  2BVM A;  4ASK A;  2VVN A;  3DJB A;  4FI5 A;  3WAK A;  3FBZ A;  2HPJ A;  2CM0 A;  2YDR A;  3AED A;  4JLE A;  3CVR A;  3FB2 A;  1N33 T;  3O9X A;  5HEG A;  4UEM A;  3C51 A;  1UUR A;  3EHZ A;  5HXE A;  4IE4 A;  4QH1 A;  2LHN A;  3A8Y C;  2IAK A;  2LT3 A;  4TNW A;  3RGL A;  1W0B A;  1BR0 A;  2D9D A;  3PDY A;  1QUU A;  2XM1 A;  3LDQ B;  3ZN1 B;  1QLB A;  2VL8 A;  1WR6 A;  2SPC A;  4QXB B;  3JC6 D;  2CA5 A;  4L9I A;  2ACZ A;  2BG9 A;  5DJQ C;  3I0Q A;  2X9W A;  5LYJ E;  1N36 T;  4UIG A;  5JTG A;  1VOM A;  1M7K A;  5JR9 B;  2UXN B;  2ACX A;  2W62 A;  3CPZ A;  2GK9 A;  4DV7 T;  2LHR A;  4U2Y A;  3HL6 A;  2E2A A;  3I9W A;  2Q9Q B;  3PJA A;  2F4V T;  2BS2 A;  2W00 A;  3ETU A;  2JQH A;  5LJN A;  2I6H A;  5AQF B;  2C5J A;  2CHO A;  3Q5X A;  1E2A A;  1XMQ T;  3F57 A;  4L0R A;  1H7C A;  3B13 A;  3H3M A;  4DO0 A;  4UVB B;  2NW9 A;  4DV4 T;  1MND A;  4EGW A;  4AQF C;  1VCT A;  1MIW A;  2BVL A;  3C64 A;  4EIW A;  2KND A;  3C98 B;  2YOE A;  2K48 A;  2YIN A;  5AFU L;  4HWH A;  3PUZ F;  1D0Y A;  2QYW A;  5GON E;  4IRE A;  1E1H B;  3C4Z A;  2KLQ A;  2MAW A;  3ZMT B;  3UU4 A;  1D0X A;  1B7T A;  3VKH A;  4OYK A;  4JI8 T;  3PUR A;  4TWF A;  2DL1 A;  3ONJ A;  3MK7 C;  2WAU A;  5AQT B;  4A56 A;  3GN5 B;  3ZN0 B;  2IHR 1;  2LEH A;  1D0Z A;  4H63 V;  3J9X 1;  3FHN A;  3RKO A;  5JR9 A;  5ABE A;  2XQ5 A;  4O4I E;  1XZY A;  5JRC B;  4CN4 A;  2Q9Q A;  3LSV A;  3UUB A;  2XQA A;  5HEH A;  4H9N C;  5LHI B;  4CI3 B;  2BKP A;  3ZEF B;  1JNZ A;  2RPA A;  2E5V A;  2LM9 A;  2LLY A;  3TLU A;  5JDQ A;  1EZ3 A;  1Y64 B;  5BMV E;  4IDP A;  2FJB A;  4PJN A;  4YXD A;  3N9P A;  3L39 A;  4GK5 E;  5KXJ A;  4P0B A;  1VRB A;  2WM9 A;  4U7I A;  3FZL B;  4AKR B;  2LSK A;  4LF9 T;  4L5G A;  4EED A;  3QB5 A;  4X62 T;  4LF4 T;  2UXC T;  3MXZ A;  2G0U A;  3MA9 A;  5LG3 A;  1G8X A;  3T1Y T;  2BS4 A;  4X66 T;  2RP4 A;  5E0O A;  3EI0 A;  3P8C D;  3K3Q C;  2V8S V;  2JIW A;  2XM2 A;  4KHZ F;  2HHH T;  3SOL A;  3RQU A;  5M4Y A;  2YEV C;  4QKN A;  3K1S A;  3GN5 A;  3PJA J;  4BA9 A;  5HEJ A;  3CQX C;  1HG5 A;  4O4H E;  4F8H A;  4U72 A;  5JRC A;  4IIJ E;  2MTQ A;  1ZKE A;  3N9O A;  3ZYL A;  3I0O A;  5AQU B;  3VU7 H;  3LBX A;  1WLX A;  4GYR A;  4I50 E;  1MMN A;  1S35 A;  3UQ4 A;  5F8P A;  5AQN B;  2FBW A;  3KBU A;  2KSR A;  4B3R T;  4EV6 A;  3F2E A;  4JI6 T;  2ODV A;  2LE8 A;  3AA7 B;  2CXL A;  2IC6 A;  5CJ5 A;  1UK5 A;  5HYA A;  2R6G F;  4QWN B;  2X66 A;  3ANW A;  2CBI A;  4IT4 A;  3ZJ1 A;  3U78 A;  3ZT5 A;  3EDU A;  2XSA A;  1XMO T;  2CWY A;  3ZKR A;  1JNR A;  2M6I A;  1HR0 T;  2IIU A;  5JDG A;  4MLK A;  4X5T A;  2LOP A;  3LK3 B;  3VKG A;  3MZK B;  2UXB T;  3FBL A;  3UU5 A;  4TNV A;  2VL0 A;  1J1J A;  2BBJ A;  3G06 A;  5FY7 A;  1WFD A;  2ZM0 A;  2K5B B;  4B3S T;  4DV5 T;  2H89 A;  4PFP A;  3GMI A;  5H6Q B;  4LFA T;  3UU8 A;  3KFW X;  4HWC A;  4GK0 E;  1LRZ A;  4KP3 C;  2A72 A;  1WR0 A;  4DR3 T;  1ZV4 X;  4LF6 T;  4YJ3 E;  4CN6 A;  2QGS A;  4YLH A;  5JR9 C;  3P50 A;  4IE0 A;  2D0T A;  1LVF A;  3F31 A;  3AA6 B;  3R84 B;  2J62 A;  3M3Z B;  3HKB E;  5LB7 B;  3V5S A;  1S94 A;  1G73 A;  1W09 A;  2XUE A;  3AB3 B;  2D5U A;  1UCU A;  3DP7 A;  4UXN B;  2EHO D;  5LJM A;  4DBQ A;  3PUV F;  2XAQ B;  2XAS B;  5LMN T;  4DR4 T;  2HH7 A;  2D2S A;  3AE4 A;  3SRZ A;  2RA1 A;  1L0V A;  3B57 A;  3FZF B;  4O4L E;  3UT5 E;  2X68 A;  3SFD A;  4HFH A;  5CA0 E;  4UV9 B;  3AE1 A;  3PU8 A;  3QOF A;  1YQ3 A;  2H7O A;  4JI7 T;  5ADX L;  2A2F X;  5FMN A;  4JI5 T;  4M1P A;  4DR2 T;  2JPF A;  1I6Z A;  5FL0 A;  4ZXL A;  4ZEY A;  1OXZ A;  4HWD A;  5IWA T;  2E9X C;  4NPP A;  4TV8 E;  4P0A A;  2M6B A;  3RIF A;  2NW7 A;  4BJN A;  4LF5 T;  3QUJ A;  4JV5 T;  2CEA A;  4PFO A;  2XQ6 A;  1SUM B;  5HCJ A;  3OYZ A;  1XNR T;  2A9U A;  3LG7 A;  2K9A A;  3N9Q A;  4PK5 A;  5HXH A;  1HF8 A;  3H3A A;  3PUY F;  3AVR A;  2V7I A;  3TKL B;  2VB6 A;  1X79 A;  4DBR A;  5HXR A;  2WP9 A;  3HA4 A;  2H88 A;  5IHY A;  1U4Q A;  4OFZ A;  4ZI3 D;  4DUY T;  2VWA A;  3RLF F;  3OKQ A;  4U3C A;  1O3X A;  3OYX A;  5AQQ B;  5HEU A;  1N34 T;  3PE0 A;  4AQG A;  5JDN A;  4K0U A;  5JH7 E;  4WZX A;  1HNX T;  3EDV A;  4ZS2 A;  1MMD A;  3AEA A;  2IML A;  2IW5 B;  1FIO A;  2DI4 A;  4DR5 T;  2ZMA A;  2LKG A;  5L3F B;  2WCA A;  3NRY A;  2VUR A;  3NWI A;  1MIV A;  5EK2 A;  4IGU A;  2WU2 A;  4H9P C;  4WNK A;  4KHP T;  5LOV E;  1HNZ T;  4I55 E;  2E5L T;  5EK3 A;  2XQY A;  4AXP A;  2UUC T;  3AEG A;  5LGN B;  2WMN A;  3L09 A;  1UUS A;  4C90 A;  4PW8 A;  3NZQ A;  1WYB A;  5LA6 E;  4G63 A;  1MMG A;  3ESL A;  3TLV A;  2JRK A;  1KNZ A;  5FNV E;  2ES0 A;  4ILC A;  1KK7 A;  5LGT B;  4ZHQ E;  4E7Z A;  5FY1 A;  4AKL A;  2VKH A;  5L3G B;  5LBM A;  2L3L A;  3O1J A;  4HWF A;  2XZE A;  4H9O C;  2CHN A;  2ZM6 T;  4CXW A;  1VCS A;  1KF6 A;  5L3E B;  5LXT E;  3KIN B;  4E7S A;  5AQK B;  5HEO A;  2X0Y A;  5LNK A;  4DV1 T;  2XY8 B;  5JVD E;  2CPT A;  3RYH E;  4O4J E;  4GYS A;  4H9S E;  3ABV A;  3ZPO A;  2YN6 A;  3ZYM A;  3C4W A;  2AE9 A;  3N9M A;  4ZS3 A;  2WWV A;  2LJL A;  2LKH A;  3OBV E;  5J1G A;  3D0T A;  4TX5 A;  1YW0 A;  4NIQ A;  3X1D A;  2KWH A;  4XZC A;  2PG8 A;  3AEB A;  3CWZ B;  1ZHC A;  2J1D G;  4LF8 T;  5JDF A;  2WQY A;  4DMW A;  2W63 A;  2UXD T;  2VKD A;  4I4T E;  2E9X B;  3JC6 C;  2BZB A;  2WDR A;  3AE5 A;  4CXY A;  3E22 E;  2Z6E A;  3ZC0 A;  3Q2M A;  3JAE A;  5JQG E;  4X1I E;  4YY3 T;  2KIN B;  3AEE A;  4JI0 T;  2A3D A;  3AA1 B;  4CXX A;  2XPK A;  2L8K A;  4DR7 T;  2XSB A;  2LM2 A;  4ZI2 D;  4QHO A;  5LMU T;  4KX6 A;  4YT0 A;  3FZH B;  3LBX B;  1BR1 A;  4HFB A;  3T8O A;  2H3R A;  2Y6X A;  3AE8 A;  2XQ9 A;  3N2O A;  2JQK A;  3K8P C;  4O2B E;  4OX9 T;  2CXF A;  3T1H T;  3N9N A;  4EEB A;  4AI6 A;  1IJ6 A;  3UTK A;  4CI1 B;  2V1D B;  3Q5W A;  3AE6 A;  3ZMU B;  4H9R C;  2VVS A;  2K24 A;  3PU3 A;  4DND A;  3ANW B;  5L4E A;  4QXH B;  3KDS E;  1D1A A;  4Z8X A;  2E9X A;  4HWI B;  4C91 A;  2Y8D A;  2IC9 A;  3TLW A;  2XAJ B;  1IBK T;  4AQY T;  3RRC A;  2MBG A;  5ABF B;  1J5E T;  2PBI A;  4EAH A;  2ZM2 A;  2WB5 A;  5AQG B;  3AE3 A;  3K3N A;  3SWH A;  1SE7 A;  4B3M T;  4DV3 T;  3O1H A;  1Z0P A;  4UVC B;  2FJA A;  3AE7 A;  4YSZ A;  2X9H A;  3OJA A;  4U33 A;  1T8B A;  3RYF E;  2WZH A;  2OV9 A;  2H7V C;  1YKH B;  4YSX A;  3LJC A;  3N2K E;  4YTN A;  4DV0 T;  4X65 T;  2W66 A;  5L3C B;  3C50 A;  3KVB A;  2LSY A;  1IJ5 A;  3PUW F;  5AQH B;  3SFE A;  2LSG A;  3ETV A;  3FXD B;  3W15 B;  4IL4 A;  3UFE A;  5L47 A;  3SS1 A;  2V7L A;  3E08 A;  5AQR B;  3WI3 A;  1T7S A;  4QX8 B;  2UUA T;  2Q9Q D;  3B5M A;  3MKD A;  3OTO T;  1XNQ T;  2LSJ A;  4EZH A;  3N9L A;  1FJG T;  5LCY A;  2VQE T;  3PUQ A;  5BR8 T;  4MHC A;  3IA3 A;  2YDS A;  2CRB A;  5ABF A;  5FVK A;  5F5W A;  3V5U A;  1W0A A;  2PJQ A;  4ZI7 E;  5HXS A;  1HX8 A;  5J0Z A;  4AKI A;  4HKA A;  2YU2 A;  3ONX A;  4OK0 A;  5FXZ A;  3AE2 A;  3RX6 A;  5L3B B;  4A5X A;  2N2N A;  4HE8 A;  5LGU B;  4EZ4 A;  2LRL A;  4ISS A;  3EAM A;  4ZZB A;  2X0L B;  1I94 T;  2ODU A;  4P09 A;  4B6X A;  2KMF A;  2CCQ A;  5C8Y E;  4NXN T;  5LP6 E;  4N78 D;  3RIU A;  4U7Y A;  2XAG B;  5AQO B;  3I9Y A;  5FXV A;  3PUS A;  4TZ4 C;  4A98 A;  4CI2 B;  1N32 T;  4TWD A;  4MAL A;  1SA0 E;  5ABH A;  4Z91 A;  4PJJ A;  5F3J A;  4HGA A;  3RF1 A;  2WBL A;  3BQI A;  1OED B;  3RPU A;  3LFM A;  4A97 A;  2C5K T;  4IDN A;  4JEH B;  3VR8 A;  2C0S A;  2WDQ A;  3ZMS B;  4WW0 A;  4IDZ A;  2KZ7 B;  2NOX A;  3CX6 B;  2DWK A;  3GA8 A;  2V5C A;  4EXT A;  5JDL A;  5DQW A;  3MAC A;  2DWG A;  2W61 A;  2YKS A;  1HCI A;  4ERR A;  2V6X A;  2CBJ A;  3GWH A;  4TN7 B;  3J7Y q;  4HFI A;  2XJ7 A;  2HN2 A;  5HCM A;  4TWH A;  3JAD A;  2KWI B;  4JI3 T;  2UU9 T;  2DCF A;  2WMO A;  2YK0 A;  5AQI B;  5FL1 A;  4YHH T;  2LSI A;  4HFE A;  4JEU B;  3R6N A;  2X9Y A;  3AAI A;  2VKJ A;  5LBQ B;  1QSD A;  2L9Q A;  3HKC E;  2EHO C;  1AJ3 A;  3UFG A;  2CLY B;  4LFB T;  2JMH A;  3O1I A;  3ZST A;  4CZZ B;  5KDM C;  1UGO A;  2PTF A;  3AEF A;  1OED A;  4LFC T;  4YSY A;  1M62 A;  4IDQ A;  2JJ9 A;  3RQW A;  4UEL A;  2Y48 B;  4ZZC A;  3RHW A;  5AQJ B;  3IEE A;  3OVU A;  4UV8 B;  4V1A v;  1HFA A;  1Y01 A;  2XQ8 A;  4OHF A;  2YU1 A;  2I0M A;  4EB6 E;  2P9B A;  2X67 A;  1HS7 A;  4AKH A;  3CIR A;  2IDO B;  4FJO A;  2WY2 A;  3KV5 A;  4YJ2 E;  2YDQ A;  2NW8 A;  5J2T E;  3KBT A;  4H63 H;  2NR4 A;  2XQ4 A;  3KV6 A;  5ABG A;  5LG4 A;  3O4X E;  5EZY E;  4TUY E;  5CFB A;  2FJE A;  3HKD E;  1US7 B;  3ZSS A;  2JQQ A;  3RRW A;  2X51 A;  4ANJ A;  1CUN A;  4PK6 A;  4ADZ A;  2QVA A;  5A1L A;  5DAB A;  4YTM A;  2B1E A;  2MYS A;  1KEY A;  4ZI3 C;  4JI4 T;  4MBQ A; 
#chains in the Genus database with same CATH homology
 3C4X A;  3ZJ1 A;  2KT9 A;  2H3R A;  2Y6X A;  3U78 A;  3EDU A;  2WWU A;  3N2O A;  3K8P C;  4O2B E;  2CWY A;  2CXF A;  3QC9 A;  3N9N A;  3U3I A;  4EOZ B;  4AI6 A;  4MFR A;  1IJ6 A;  4X20 E;  3UTK A;  4CI1 B;  4KBM B;  1IZN B;  2V1D B;  5JDG A;  3Q5W A;  4MLK A;  2LOP A;  3ZMU B;  3LK3 B;  3VKG A;  3MZK B;  4H9R C;  3PU3 A;  2K24 A;  4OYJ A;  3FBL A;  4DND A;  3ANW B;  2ZLY A;  2CXD A;  1MMA A;  4QXH B;  2X9X A;  1HTJ F;  2VAS A;  1D1A A;  3KDS E;  3UUX B;  4GOU A;  4JUY A;  4Z8X A;  5FY7 A;  2D0U A;  2ZM0 A;  2E9X A;  2K5B B;  1SHZ C;  4C91 A;  4TV9 E;  5EK4 A;  4PFP A;  3GMI A;  5H6Q B;  5CA1 E;  2Y8D A;  4MBQ A;  2IC9 A;  2DNX A;  3KFW X;  4O8S A;  4GK0 E;  2KXP B;  1LRZ A;  3K3O A;  2XAJ B;  4KP3 C;  4GIW A;  2A72 A;  3RRC A;  4EYU A;  2MBG A;  4NUV A;  2PBI A;  4EAH A;  2M67 A;  2ZM2 A;  4F6R C;  1ZV4 X;  2NP9 A;  4PAG A;  4YJ3 E;  3KVA A;  3K3N A;  2NTX A;  3SWH A;  4X1K E;  2QGS A;  3ZCI A;  5FP3 A;  4YLH A;  5JR9 C;  4IE5 A;  4IE0 A;  3AA0 B;  2D0T A;  2QA7 A;  1LVF A;  3F31 A;  3KV9 A;  3AA6 B;  3R84 B;  3O1H A;  1Z0P A;  5LHG B;  3IF8 B;  3WAJ A;  3UUL A;  3HKB E;  4UVC B;  2XHE B;  3V5S A;  2X9H A;  1S94 A;  3OJA A;  4H9Q C;  1G73 A;  2VKO A;  2XUE A;  3RYF E;  3AB3 B;  2LOS A;  3NBX X;  1FMV A;  2D5U A;  1UCU A;  3DP7 A;  4UXN B;  4XBF B;  2EHO D;  1YKH B;  2H7V C;  2NWB A;  5LJM A;  4U74 A;  3ZCJ A;  4KMC A;  4DBQ A;  4AKG A;  1T98 A;  4WBO A;  4O2A E;  5KMG P;  3LK2 B;  2BVM A;  3LJC A;  3N2K E;  2XAQ B;  4ASK A;  2XAS B;  3E0Z A;  3DJB A;  2HH7 A;  5HAX A;  3VHL A;  2D2S A;  5L3C B;  4FI5 A;  3SRZ A;  1FMW A;  3WAK A;  2RA1 A;  3FBZ A;  3C50 A;  3KVB A;  2HPJ A;  3B57 A;  2CM0 A;  3LK4 2;  2LSY A;  3P7I A;  2W0G A;  3EVY A;  1IJ5 A;  5HXC A;  4JLE A;  4O4L E;  3UT5 E;  2X68 A;  1V9D A;  5CA0 E;  2N1G A;  3CVR A;  3FB2 A;  3O9X A;  2LSG A;  4UEM A;  3ETV A;  3FXD B;  3FXE B;  4UV9 B;  3C51 A;  3A5X A;  3PU8 A;  5HXE A;  4HTE A;  4IE4 A;  3W15 B;  2H7O A;  2HPL A;  2EHO B;  2LHN A;  2C5I T;  5ADX L;  3UFE A;  2IAK A;  4BJM A;  2LT3 A;  5J2U E;  2A2F X;  4UF0 B;  3SS1 A;  5FMN A;  2V7L A;  1BR4 A;  4M1P A;  3E08 A;  3ZYK A;  5JRE A;  2JPF A;  3WI3 A;  1BR0 A;  1OXZ A;  4QX8 B;  1YKE B;  3CQG B;  3IBP A;  4PJL A;  4NUU A;  3PDY A;  1QUU A;  5L2L A;  2E9X C;  2Q9Q D;  2VL8 A;  1WR6 A;  3MKD A;  4TV8 E;  3ZN1 B;  4P0A A;  2NW7 A;  2SPC A;  4QXB B;  2LSJ A;  3JC6 D;  3HI2 A;  4BJN A;  5IYZ E;  2CA5 A;  3QUJ A;  4L9I A;  4EZH A;  3N9L A;  2CEA A;  4PFO A;  5LCY A;  5DJQ C;  3PUQ A;  2V7K A;  3ZMZ B;  4MHC A;  3OYZ A;  3I0Q A;  5JDH A;  2X9W A;  5LYJ E;  3LG7 A;  4UIG A;  1HG2 A;  1VOM A;  2K9A A;  3H37 A;  5FYM A;  5JR9 B;  2UXN B;  2ACX A;  4XAX B;  2NTY A;  2W62 A;  3CPZ A;  3S4U A;  2GK9 A;  3V5U A;  2LHR A;  2PJQ A;  3KV4 A;  3HL6 A;  3N9Q A;  4PK5 A;  3I9W A;  3AAE B;  4ZI7 E;  5HXS A;  1HX8 A;  2Q9Q B;  3RYC E;  4AKI A;  4HKA A;  2YU2 A;  5HXH A;  2W00 A;  1HF8 A;  3ETU A;  3ONX A;  4OK0 A;  3H3A A;  5FXZ A;  4X1Y E;  3AVR A;  2V7I A;  3TKL B;  5LJN A;  2VB6 A;  1X79 A;  2V7J A;  4DBR A;  5HXR A;  3RX6 A;  5L3B B;  2C5J A;  3HA4 A;  1D1C A;  3Q5X A;  2N2N A;  4HE8 A;  4KUM B;  5IHY A;  1U4Q A;  4EYY R;  4QXC B;  5LGU B;  4EZ4 A;  4OFZ A;  4ISS A;  3F57 A;  2X0L B;  4L0R A;  1BR2 A;  1H7C A;  3B13 A;  4ZI3 D;  4DO0 A;  2ODU A;  4P09 A;  4UVB B;  2NW9 A;  4B6X A;  2VWA A;  1MND A;  2KMF A;  3I1A A;  3CX7 B;  3OKQ A;  4AQF C;  1O3X A;  3OYX A;  2CCQ A;  3CKD A;  5C8Y E;  3BQL A;  3PE0 A;  3CQC B;  4AQG A;  5LP6 E;  1MIW A;  2BVL A;  4N78 D;  3C64 A;  4EIW A;  2KND A;  3C98 B;  5JDN A;  3AVS A;  4ZI2 C;  1WYC A;  2K48 A;  4J2C A;  2YIN A;  1UX4 A;  5AFU L;  4K0U A;  5JH7 E;  2DHR A;  4IE7 A;  1D0Y A;  2EHO A;  2XAG B;  3EDV A;  4ZS2 A;  1MMD A;  2IW5 B;  3I9Y A;  5FXV A;  3PUS A;  4TZ4 C;  1FIO A;  2DI4 A;  4UF0 A;  4CI2 B;  5GON E;  4UVA B;  4MAL A;  2CLY C;  2ZMA A;  1E1H B;  1SA0 E;  3C4Z A;  2KLQ A;  4PJJ A;  5L3F B;  5F3J A;  4HGA A;  3RH3 A;  3NRY A;  2WBL A;  3ZMT B;  1OWA A;  3BQI A;  5L3D B;  1D0X A;  5JDM A;  3RPU A;  1B7T A;  3VKH A;  1MIV A;  4OYK A;  5EK2 A;  4IGU A;  3N5L A;  4H9P C;  3LFM A;  3PUR A;  4WNK A;  2C5K T;  3EUH A;  4JEH B;  1MIY A;  5LOV E;  2C0S A;  3MJX A;  3ZMS B;  3MK7 C;  2WAU A;  1UX5 A;  4WW0 A;  4I55 E;  4IDZ A;  4A56 A;  5EK3 A;  2KZ7 B;  4DVD A;  2NOX A;  3RYI E;  3GN5 B;  2XQY A;  4AXP A;  2OA5 A;  3UUN A;  3ZLI A;  4BAY B;  2ZM8 A;  3ZN0 B;  5LGN B;  3CX6 B;  2DWK A;  2MOZ A;  5H6R B;  2LEH A;  2WMN A;  3GA8 A;  3L09 A;  4C90 A;  4EXT A;  1D0Z A;  4H63 V;  4PW8 A;  3NZQ A;  1WYB A;  3FHN A;  5LA6 E;  3J9X 1;  3RKO A;  5JDL A;  5DQW A;  3MAC A;  4G63 A;  5JR9 A;  5HWX A;  1MMG A;  3ESL A;  2DWG A;  2W61 A;  4O4I E;  2JRK A;  5FY0 A;  1HCI A;  4ERR A;  3RC3 A;  1KNZ A;  5FNV E;  2ES0 A;  5HWY A;  1KK7 A;  5LGT B;  3GWH A;  5JRC B;  2Q9Q A;  4TN7 B;  5LHI B;  4ZHQ E;  4H9N C;  4DMV A;  4CI3 B;  3AAA B;  4E7Z A;  3J7Y q;  2V7M A;  3ZEF B;  3CX8 B;  5FY1 A;  4AKL A;  2XTL A;  2XAF B;  2LM9 A;  4YHJ A;  2VKH A;  5L3G B;  5LBM A;  3UUM A;  5JDQ A;  2KWI B;  1YD8 G;  3N2G E;  1EZ3 A;  2L3L A;  1NAF A;  3O1J A;  1Y64 B;  2DCF A;  5BMV E;  2WMO A;  2YK0 A;  4PJN A;  3N9P A;  4IE6 A;  4H9O C;  2LSI A;  4GK5 E;  4CXW A;  4JEU B;  3R6N A;  4P0B A;  1VRB A;  2WM9 A;  5L3E B;  2X9Y A;  3AAI A;  5LXT E;  2VKJ A;  2XAH B;  3KIN B;  2I59 A;  5LBQ B;  4AKR B;  4E7S A;  4PJM A;  2LSK A;  1QSD A;  2L9Q A;  3HKC E;  5LNK A;  4HFV A;  4L5G A;  4ZOL E;  2EHO C;  3BQK A;  1AJ3 A;  1ZEE A;  5JVD E;  4ILU A;  2E8I A;  4PNI A;  3RYH E;  4O4J E;  4GYS A;  4CQI A;  4H9S E;  2CWO A;  1NWM X;  3ZMV B;  3MXZ A;  3ZPO A;  3PUG A;  2G0U A;  3ZYM A;  2CLY B;  3C4W A;  3MA9 A;  4YFS A;  3HR0 A;  1LKX A;  2JMH A;  4IST A;  2PFV A;  1G8X A;  3N9M A;  5LHH B;  4ZS3 A;  5TAO A;  2RP4 A;  1U5P A;  1IAP A;  3PTR B;  5E0O A;  3L3P A;  5FXW A;  3O1I A;  2E9X D;  2LJL A;  3P8C D;  4CZZ B;  3OBV E;  4QX7 B;  2WSS V;  5KDM C;  3K3Q C;  5J1G A;  5CB4 E;  3ZC1 A;  3D0T A;  4G2A A;  4TX5 A;  1YW0 A;  2KWH A;  2JJ9 A;  4XZC A;  4UEL A;  1D1B A;  2Y48 B;  2PG8 A;  3SOL A;  3BK9 A;  3IEE A;  4UV8 B;  3CWZ B;  5M4Y A;  1ZHC A;  2J1D G;  2YEV C;  4V1A v;  4QKN A;  2BDE A;  3NZP A;  3ZJ2 A;  3IHR A;  3GN5 A;  2V26 A;  5JDF A;  4BA9 A;  4PK4 A;  1HFA A;  3CQX C;  1HG5 A;  4DMW A;  2UXX B;  2W63 A;  4HN9 A;  4O4H E;  4OHF A;  2YU1 A;  3RC8 A;  2Q9Q C;  4WBN E;  3PUA A;  2VKD A;  3CML A;  4I4T E;  4EB6 E;  2CMR A;  2E9X B;  2P9B A;  4U72 A;  2X67 A;  3JC6 C;  1HS7 A;  5JRC A;  4AKH A;  4IIJ E;  4FJO A;  2BZB A;  2MTQ A;  1MNE A;  4CXY A;  3E22 E;  1ZKE A;  3M65 A;  3N9O A;  3ZYL A;  1FEW A;  2Z6E A;  1LVK A;  3KV5 A;  4YJ2 E;  2NW8 A;  5J2T E;  3I0O A;  3ZC0 A;  3DTO A;  3KBT A;  3Q2M A;  4H63 H;  3VU7 H;  3LBX A;  5JQG E;  1WLX A;  5DQV A;  4X1I E;  4GYR A;  4I50 E;  1MMN A;  1S35 A;  3KV6 A;  2VK9 A;  2KIN B;  5F8P A;  5LG4 A;  3O4X E;  5EZY E;  5KX5 E;  4TUY E;  3KBU A;  2A3D A;  3AA1 B;  4CXX A;  4AQF A;  4I43 B;  2N9D A;  3HKD E;  1US7 B;  2JQQ A;  2L8K A;  4HEA A;  3RRW A;  3F2E A;  2DLR A;  2X51 A;  4ZI2 D;  3NRX A;  4ANJ A;  1CUN A;  2ODV A;  4QHO A;  4PK6 A;  4ADZ A;  2JMK A;  2LE8 A;  4IHJ E;  5A1L A;  2CE7 A;  3AA7 B;  2CXL A;  2IC6 A;  5DAB A;  5HYA A;  3HKE E;  2B1E A;  2MYS A;  3Q9D A;  1WRD A;  5FXX A;  3LBX B;  4QWN B;  4ZI3 C;  5ETW A;  1BR1 A;  3QK6 A;  2X66 A;  3ANW A;  3T8O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...