5LJMA

Structure of spata2 pub domain
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
215
structure length
203
Chain Sequence
GPMDTKFKDDLFRKYVQFHESSDECLRVAASTLLSLHKVDPFYRFRLIQFYEVVESSLRSLSSSSLRALHGAFSMLETVGINLFLYPWKKEFRSIKTYTGPFVYYVKSTLLEEDIRAILSCMGYTPELGTAYKLRELVETLQVKMVSFELFLAKVECEQMLEIHSQVKDKGYSELDIVSERKSSAEDVRGCSDALRRRAEGRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title SPATA2 Links CYLD to LUBAC, Activates CYLD, and Controls LUBAC Signaling.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
molecule keywords Spermatogenesis-associated protein 2
total genus 83
structure length 203
sequence length 215
ec nomenclature
pdb deposition date 2016-07-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.2190 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 5ljmA00
4OYKA 2CCQA 2D5UA 5LJMA 4OYJA 4P0BA 5LJNA 4JUYA 4P09A 2CM0A 4P0AA 2HPJA 2HPLA
chains in the Genus database with same CATH superfamily
4OYKA 5DQWA 3PUVF 2XPKA 4TWFA 2LKGA 4DR3T 4JUYA 4QX8B 2IC6A 3DTOA 4L9IA 3ZSSA 2W61A 2CA5A 4O2BE 5FP3A 5H6RB 3RF1A 1HNXT 3PUWF 4L5GA 2UXCT 4G63A 4IREA 4MHCA 2XAHB 2A9UA 2LHNA 2CEAA 3PV0F 4OYJA 4DO0A 4YSXA 2CMRA 4U2YA 1XMQT 3N9MA 3CPZA 4LF6T 4DV3T 2YDQA 3UUXB 2NW8A 3UQ4A 3MACA 5LHIB 2BKOA 2PJQA 3RKGA 2VVSA 2WU5A 3F57A 3JC6C 3K3OA 3I9YA 1D0XA 3ZCIA 3UU3A 2BDEA 4EGWA 1IBKT 3NWIA 2BKPA 2H7VC 3EHZA 1FEWA 3C98B 3PUYF 2YOEA 4J2CA 3UULA 2C5JA 5CB4E 4DV6T 1Y64B 3AE9A 3FZMB 3BQKA 5BMVE 2H89A 2VB6A 3J7Yq 2WY2A 5EK2A 3P4QA 2VKHA 3ETUA 3PJAA 5ABFB 2VVNA 1N32T 2M6BA 3O1JA 4HFEA 4TN7B 4X5TA 5C2TA 5JDQA 1XMOT 4QKNA 5IYZE 1HS7A 2C5KT 4OX9T 5AQFB 3AEAA 4ZHQE 1IBMT 1D0ZA 1M62A 3Q5WA 3ZSTA 3UT5E 4YFSA 4IDQA 4KX6A 4DR6T 1EZ3A 3V5SA 4JI4T 3IEEA 4UV8B 3WAJA 2YU2A 3L8RA 3Q5EA 4UELA 2VURA 4WW0A 3RI5A 4X65T 3C4WA 3V5UA 3FZKB 2LM2A 2XASB 4ASKA 4PK5A 5EZYE 3PUXF 5JRCB 2XZEA 3I0OA 2V7IA 4CXXA 5L4EA 3EUHA 1IJ5A 4HTEA 2VL8A 3AEEA 1ZV4X 3GMIA 3RIFA 3FXDB 4TV9E 3EAMA 1HFAA 1MNEA 2KWHA 4IT4A 4PNIA 2E5LT 1N36T 3OVUA 3ZYKA 2VASA 3RYHE 3PURA 3Q5XA 5C8YE 3RRCA 4C91A 2E5VA 2X9WA 2CXFA 3KV4A 3NVOA 3HR0A 4BA9A 1M7KA 3ZPOA 1QLBA 4CZZB 1W0BA 3HA4A 4H9NC 2XQ4A 4PW8A 5AQVB 1Z0PA 4ZS3A 4V1Av 4CI2B 2YK0A 2X9YA 2LKHA 2W63A 1S35A 1UCUA 2OLTA 2ZM2A 4O4IE 4PAGA 5FXVA 3PJAJ 2ZM8A 2MTQA 2WSSV 4H9PC 3VU7H 4X64T 4H9QC 4UVAB 3ZT5A 2LM9A 1B7TA 4QH1A 4EIWA 2R6GF 2FJDA 1WLXA 4I0UA 5LGTB 2ACZA 2YN6A 4TWHA 4KHZF 3F2EA 3JAFA 4E7SA 5HXEA 5L3GB 2X67A 3IA3A 4DUYT 1AJ3A 4XBFB 4EYYR 1MNDA 3SWHA 4EEBA 4ZI7E 2UUBT 4B3MT 2W67A 4KI0F 3UU5A 5FL1A 2HHHT 3VKGA 1OEDC 2V8SV 2Q9QD 2DNXA 2XJ7A 5JQGE 2VL0A 2XSAA 5HYAA 3SS1A 2RPAA 2H3RA 3A8YC 3LDQB 3QUJA 3TLWA 4EEDA 4KHPT 2IAKA 3ZEFB 4CI1B 4QX7B 3AE4A 3WI3A 2CRBA 4IE7A 4UEMA 1SUMB 4GKJT 3OJAA 1VRBA 5FY0A 4P0AA 2KWIB 2LLYA 2KMFA 4O4HE 2IIUA 2IC9A 4JLEA 4JEHB 2CXLA 3JADA 1UURA 3NZPA 1IAPA 2MAWA 3RLFF 4LF7T 1X9BA 1ZP0A 2NWBA 2VKOA 3ZN1B 5AQNB 2VKJA 3SFDA 4NXMT 2UXNB 3ANWB 3DJBA 3RQWA 2EHOD 1US7B 2E9XC 2N9DA 1E2AA 4YTNA 4G2AA 3AAIA 4FI5A 2LE8A 2DWKA 1NWMX 5AQQB 4JI6T 4B6XA 4ZI3C 3NRXA 3CVRA 3VR9A 3F31A 3CIRA 1QUUA 2HN1A 2ODVA 3ONJA 2N2NA 4HWIB 4UV9B 5JDHA 2WZIA 3M65A 2HPLA 2EHOA 4ZZCA 2BG9B 2WMNA 1HNWT 1D0YA 3B57A 4DV0T 3L39A 5FXWA 5L3CB 3HKEE 3UU8A 5AQIB 4DR4T 1KNRA 4BJMA 2JJ9A 2LHRA 2XQYA 2NR4A 1HG2A 4HFDA 3VKHA 4I55E 2WM9A 2P9BA 5HEUA 2NW9A 4DBRA 2DHRA 4YY3T 2IHR1 2JQKA 2X66A 5ABEA 4GIWA 4ZS2A 2LEHA 3K3QC 3TKLB 2W00A 3GN5A 4YTPA 1ZHCA 5A1LA 1FJGT 1W9RA 3KBUA 3ONXA 4ANJA 2WU2A 4CN6A 5KDMC 2Q9QB 3KV9A 4DR7T 2F4VT 5LJNA 3R6NA 4Z90A 3FZHB 2BS3A 5FY7A 2V7LA 3AXJB 2CXDA 1HTJF 2LOSA 3AEBA 3MZKB 3SOLA 1UUSA 3N9OA 3AE2A 2BVLA 3PUAA 1KK7A 3GN5B 4GYRA 4GYSA 4HEAA 4DUZT 1E7PA 5AQGB 3B13A 4AIUA 5L3FB 3AE1A 4KMCA 3NBXX 3ETVA 2WS3A 2XAFB 1X79A 1DU2A 3BK9A 1FIOA 1U4QA 3N9NA 2K5BB 3IBPA 3O4XE 1OWAA 5IHYA 3ZN0B 2EHOC 2LRLA 5HWXA 4GK5E 2E9XD 2JMKA 4M1PA 4P09A 3KV5A 2V26A 4U72A 2J4GA 2I6HA 2X9XA 3AA7B 5FNVE 4A98A 3LFMA 3ZYLA 5LHHB 3MJXA 2IUBA 4DR2T 4JI7T 4A97A 5FL0A 5HEGA 2G0UA 4U2ZA 5CFBA 4ADZA 3PUZF 4HKAA 4WNKA 3R84B 3ZMUB 1J5WA 2N1GA 2QVAA 4ISTA 2JQ9A 3Q9DA 1UK5A 1KFYA 5HXCA 3T1HT 2MBGA 3AECA 4YXDA 3N2KE 3KBTA 3QC9A 4U7IA 2V7MA 5CA0E 5AQLB 4IHJE 1GQEA 3HL6A 2YDRA 2ES0A 3O9XA 2OA5A 2VWAA 4IE6A 3H37A 2QYWA 3N9LA 1U5PA 2X9HA 5JDFA 4Z8XA 3L3PA 3EI0A 2XQ8A 4WBNE 5LA6E 5FY1A 2Q9QA 3LK2B 3G06A 4DMWA 1T72A 2QA7A 4F6RC 1WFDA 4LMJA 2L8KA 1KF6A 3ZMTB 3FBZA 1XWMA 2XQAA 3LK42 4H63V 1XNQT 4CQIA 3ZJ2A 4DBQA 3I1AA 2D2SA 1D1CA 2WZHA 2DCFA 3ZCJA 4HWHA 3KV6A 3PU3A 2J62A 4AKLA 3HI2A 4TZ4C 2M67A 3LK3B 3Q2MA 4N78D 2X0HA 2W0GA 2V7JA 4OHFA 2JQHA 2X0YA 5HEHA 1ZOYA 3UFGA 1JNRA 2EHOB 4YT0A 4H9OC 4JEUB 4ILBA 3ABVA 1D1AA 5DQVA 2XAGB 2L9QA 4LF8T 2H88A 1V9DA 1E1HB 2XQ9A 1HF8A 4QXCB 3DP7A 4HFBA 1T98A 4IE4A 4X20E 1N33T 1I94T 3K1SA 5F5WA 1LVFA 1T8BA 2K48A 3CQCB 2L3LA 4UF0A 3EABA 3UUMA 5M4YA 2V6YA 4JYAT 1IZNB 2FUPA 4DNDA 5JDGA 1BR2A 1MIVA 2YU1A 3ZLIA 3I0QA 1MMNA 2VK9A 4YHHT 3U78A 4C90A 5L47A 1KNPA 3AVRA 4LF5T 4AXPA 4LFBT 3LJCA 1VCTA 3HKBE 4O2AE 4XAXB 5J1GA 2DLRA 2CLYC 3CKDA 3H3AA 5FKYA 1QSDA 1UGOA 5L3EB 2JPFA 5HXHA 2BS2A 2J47A 4DV4T 3PE0A 2W4XA 2Y48B 4PJMA 3UU6A 5JH7E 5L2LA 4A5XA 2K24A 2BKNA 3PU8A 4QXBB 2LOPA 4QH4A 5LBMA 4ZEYA 2GK9A 3IHRA 5J0ZA 3I9WA 1XDOA 4K0UA 4HFVA 4YSZA 1MMAA 3AE5A 3CX6B 3W15B 2ZM6T 2V7KA 1W09A 2XAJB 4P0BA 4UXNB 5BR8T 5IUXA 2LSIA 2WP9A 2XQ3A 5F8PA 4ILUA 4KP3C 5LXTE 2AXDS 4IDPA 1WRDA 5L3BB 3AAAB 2XQ6A 4JI5T 1MIWA 2WDQA 4TWDA 3QOFA 5ABFA 2PTFA 2A2FX 4O4JE 4QXHB 4AISA 3KDSE 3QB5K 1N34T 3MXZA 3BQLA 1FMVA 2SPCA 2LT3A 3C64A 3C4ZA 1HX1B 5HXRA 2JRKA 3AEFA 4I43B 2CPTA 5DABA 2B76A 4EAHA 1S94A 2NTYA 2WDRA 2DWGA 2LSGA 1WYCA 4B3TT 2PG8A 3AVSA 5HCMA 4WYVA 3EDVA 4LF4T 2NW7A 4YJ3E 5FVKA 2HH7A 3PUSA 4K0KT 1WR0A 2CLYB 2KNDA 3OPCA 4AQFC 4TX5A 2LSYA 2LSJA 2YKSA 3FZFB 3ZC1A 1BR4A 3K8PC 4PFPA 1YQ4A 2WWUA 3C51A 3L09A 4H63H 1YXRA 4JI2T 3CQGB 4DR5T 2UU9T 4COFA 2LSKA 2IMLA 4KBMB 4U7YA 2UXBT 3FHNA 4A56A 1H7CA 4PK4A 3CK6A 3QK6A 3NKZA 3QNUA 4CXWA 4CN1A 5J2TE 3AA0B 4NUUA 3T1YT 1D1BA 2CBIA 3VR8A 5LG4A 1LRZA 5LCYA 5LHGB 2UUCT 3RH3A 5L4HA 5FVLA 4AKGA 3OBVE 2OV9A 4PFOA 5AQPB 5HCJA 3ZYMA 5GONE 2V5DA 5HEOA 4HE8A 4U3CA 4X1IE 2BVMA 2XM2A 4MALA 5AQJB 5HWYA 4YJ2E 3AE7A 4MLKA 1HCIA 4IDOA 1SE7A 2CM0A 2MYSA 4HGAA 4LMKA 4TNVA 3ZMSB 1NEKA 1MMDA 2V5CA 2BBJA 5HAXA 5LOVE 2LRKA 5LMUT 5F3JA 5JTGA 1SA0E 3TLUA 2V6XA 3ZMVB 3TLVA 4JI8T 2FJAA 3OYZA 2V1DB 3PDYA 3UUNA 2ODUA 4DMVA 5EK4A 4CN4A 4LMLA 1G8XA 4Z91A 4AQGA 1JNZA 4IIJE 2D0TA 3KVBA 3LG7A 3ZT6A 1HNZT 3UTKA 4ZI2D 3AA6B 5JREA 2KINB 2IDOB 2WB5A 3H3MA 5TAOA 3GWHA 2H7OA 1XZYA 2C5IT 3N2OA 3OYXA 3AXJA 4QHOA 1L0VA 5HEJA 3CX7B 4EZHA 4PK6A 5AQUB 4X62T 2V6YB 3EDUA 3QB5A 3RQUA 5AQKB 3RC3A 4DV2T 5J2UE 4YTMA 2XTLA 4ILCA 2E9XA 3CWZB 4ILAA 3S4UA 1BR0A 4AI6A 4AQYT 2Z6EA 2E8IA 3N9QA 2FJEA 2CCQA 3AB3B 2E2AA 2BG9C 5LBQB 3KFWX 3J9X1 3RYIE 2CHOA 3E0ZA 2CBJA 1ZKEA 2XQ5A 3ZT7A 2BBHA 3RIUA 5JR9C 2BZBA 1ZEEA 1IBLT 4U33A 3FZLB 3N5LA 3VHLA 2UUAT 1OEDB 2WCAA 2CHNA 4ISSA 3SFEA 1MIYA 1WCRA 1BR1A 3Q5DA 4TNWA 3ZMZB 4DV7T 3U3IA 4DR1T 5KXJA 3AE6A 5ETWA 2LJLA 4MBQA 4O4LE 4UR9A 1HX8A 4Q25A 2W2UA 3IF8B 2WWVA 1R8IA 4X66T 2J1DG 2JIWA 3KINB 4IE5A 5AQHB 5KMGP 1CHUA 3PTRB 1J1JA 2CWOA 4HN9A 3P4PA 2AE9A 2XAQB 4HFIA 2QGSA 3ZKRA 1XDPA 4HFHA 1YW0A 4JV5T 3RGLA 2I0MA 3HKDE 1UX5A 2A72A 1NAFA 1WR6A 2YDSA 1T7SA 2BG9E 3JC6D 5LNKA 3ANWA 2KZ7B 2XUEA 1YD8G 4WZXA 3VRAA 4YSYA 4B3ST 3RHWA 3UU4A 2XHEB 1YQ3A 4E7ZA 2CWYA 4HFCA 2K3WA 2KT9A 4X1YE 3RYCE 5E0OA 5LJMA 2QRXA 3FB2A 3UQ7A 2NP9A 1I6ZA 4ZI2C 1CUNA 4U74A 3ONLC 5ABHA 3FBLA 3LBXB 3WAKA 4QH5A 2UXXB 5DJQC 3O1HA 5LP6E 1HG5A 4GK0E 2WDVA 3AAEB 4WBOA 5JDNA 2UXDT 3JCFA 1KEYA 4JBWF 5JVDE 4GOUA 4DVDA 5JDLA 2NOXA 2K9AA 2X51A 4EV6A 3E08A 3AE3A 2X68A 4NIQA 2B1EA 5CA1E 2MPKA 2VQFT 3P4WA 1UX4A 2IW5B 3K3NA 3CMLA 2YEVC 3B5MA 5JR9B 1OEDA 1G73A 1YKHB 2WQYA 2XQ7A 2FJBA 3AEDA 3CQXC 4X1KE 5ABGA 3UUBA 4I50E 3P7IA 4LFAT 4ERRA 3ZC0A 4JI0T 4LFCT 2KXPB 2DL1A 3N9PA 4CI3B 1LVKA 4KUMB 1KNZA 4JI3T 4L0RA 3E22E 3M3ZB 2I59A 3MK7C 3BQIA 4MFRA 4UF0B 3RPUA 4EXTA 2VQET 1HR0T 3P4RA 2D5UA 3RC8A 4O8SA 4HWFA 3EVYA 2A3DA 4IDNA 2PFVA 1XNRT 1OXZA 3LSVA 3D0TA 5AQMB 2WBLA 4DIDB 1FMWA 4H9SE 3MKDA 4HWCA 3RRWA 4AKRB 5FMNA 2W66A 3O1IA 4FJOA 3GA8A 4OK0A 4UVCB 3TLTA 5CJ5A 5LG3A 2Y6XA 4UIGA 2ACXA 5IWAT 2RA1A 1W0AA 4AQFA 5LMNT 2D0UA 4DV1T 2CE7A 4F8HA 4IGUA 4AKIA 2MOZA 4NUVA 2VKDA 5FXXA 5JR9A 4QWNB 3RIAA 3RYFE 2ZM0A 3P4SA 2XSBA 2ZLYA 5C3JA 5HXSA 3T8OA 4TUYE 3CX8B 5AQTB 4YLHA 2BG9A 2Y8DA 3VRBA 2W62A 4GKKT 5ADXL 3AEGA 3ESLA 5L3DB 4DV5T 4PJJA 5JRCA 1IJ6A 1WYBA 4H9RC 4I4TE 4BJNA 4OFZA 5AFUL 2FBWA 3A5XA 4U31A 4ZZBA 2D9DA 2E9XB 3RKOA 4IDZA 1SHZC 3UFEA 2HN2A 3A7MA 5AQOB 1O3XA 4ZXLA 3AA1B 3OKQA 4ZOLE 3TLSA 2JQQA 2Q9QC 2BS4A 2JMHA 4AKHA 1VOMA 1VCSA 3X1DA 1LKXA 3SRZA 3RX6A 4BAYB 3NZQA 3MA9A 3KVAA 3C50A 3PUGA 4NPPA 4LF9T 4PJNA 5LB7B 1OEDE 4TV8E 4EOZB 3OTOT 5LGUB 2HPJA 2RP4A 3ZJ1A 2KSRA 4P1NA 1Y01A 5EK3A 4JI1T 4PJLA 2ZMAA 4B3RT 4IL9A 4UVBB 5LYJE 3P8CD 5FXZA 5LGNB 1NENA 2M6IA 4EB6E 5CGMA 2PBIA 3P50A 4CXYA 4EYUA 1Z8UA 2XM1A 3NRYA 1MMGA 4HWDA 4IE0A 3HKCE 3N2GE 4YHJA 5AQRB 2YINA 5H6QB 2WAUA 3FXEB 4EZ4A 3C4XA 5KX5E 3JAEA 5FYMA 2KLQA 3AE8A 1YKEB 2DI4A 3LBXA 3PUQA 5JDMA 2C0SA 4IL4A 2XY8B 5AQSB 4ZI3D 4NXNT 4XZCA 2WMOA 1J5ET 3RIUC 2NTXA 2X0LB
chains in the Genus database with same CATH topology
4OYKA 5DQWA 4JUYA 4QX8B 2IC6A 3DTOA 4L9IA 3ZEFB 2W61A 2CA5A 4O2BE 5FP3A 5H6RB 4L5GA 4G63A 4OYJA 4MHCA 2XAHB 2LHNA 2CEAA 4DO0A 2CMRA 3N9MA 3CPZA 3UUXB 2NW8A 3MACA 5LHIB 2PJQA 3F57A 3JC6C 3K3OA 3I9YA 1D0XA 3ZCIA 2BDEA 4J2CA 2H7VC 3UULA 1FEWA 3C98B 2C5JA 5CB4E 1Y64B 5BMVE 3BQKA 2VB6A 2VKHA 3ETUA 5JDQA 3O1JA 4TN7B 4QKNA 5IYZE 1HS7A 2C5KT 4ZHQE 1D0ZA 3Q5WA 3UT5E 4YFSA 1EZ3A 3V5SA 3IEEA 4UV8B 3WAJA 2YU2A 4UELA 4WW0A 3C4WA 3V5UA 2XASB 4ASKA 4PK5A 5EZYE 5JRCB 3I0OA 2V7IA 4CXXA 3EUHA 1IJ5A 4HTEA 2VL8A 1ZV4X 3GMIA 3FXDB 4TV9E 1HFAA 1MNEA 2KWHA 4PNIA 3ZYKA 2VASA 3RYHE 3PURA 3Q5XA 5C8YE 3RRCA 4C91A 2X9WA 2CXFA 3KV4A 3HR0A 4BA9A 3ZPOA 4CZZB 3HA4A 4H9NC 4PW8A 1Z0PA 4ZS3A 4V1Av 4CI2B 2YK0A 2X9YA 2W63A 2ZM2A 1S35A 1UCUA 4O4IE 4PAGA 5FXVA 4CI3B 4H9PC 2ZM8A 2MTQA 2WSSV 3VU7H 4H9QC 4UVAB 2LM9A 1B7TA 4EIWA 1WLXA 5LGTB 5L3GB 5HXEA 3F2EA 4E7SA 2X67A 1AJ3A 4EYYR 1MNDA 3SWHA 4ZI7E 3VKGA 2Q9QD 2DNXA 5JQGE 5HYAA 3SS1A 2H3RA 3QUJA 2IAKA 4CI1B 4QX7B 3WI3A 4IE7A 4UEMA 3OJAA 1VRBA 5FY0A 4P0AA 2KWIB 2KMFA 4O4HE 2IC9A 4JLEA 4JEHB 2CXLA 3NZPA 1IAPA 2NWBA 2VKOA 3ZN1B 2VKJA 2UXNB 3ANWB 3DJBA 2EHOD 1US7B 2E9XC 2N9DA 4G2AA 3AAIA 4FI5A 2LE8A 2DWKA 1NWMX 4B6XA 4ZI3C 3NRXA 3CVRA 3F31A 1QUUA 4UV9B 2ODVA 2N2NA 5JDHA 3M65A 2HPLA 2EHOA 2WMNA 1D0YA 3B57A 5FXWA 5L3CB 3HKEE 4BJMA 2JJ9A 2LHRA 2XQYA 3VKHA 1HG2A 4I55E 2WM9A 2P9BA 2NW9A 4DBRA 2DHRA 2X66A 4GIWA 4ZS2A 2LEHA 3K3QC 3TKLB 2W00A 3GN5A 1ZHCA 5A1LA 3KBUA 3ONXA 4ANJA 5KDMC 2Q9QB 3KV9A 5LJNA 3R6NA 5FY7A 2V7LA 3MZKB 2CXDA 1HTJF 2LOSA 3SOLA 3J7Yq 4JEUB 3N9OA 3PUAA 2BVLA 4GYRA 1KK7A 3GN5B 4GYSA 4HEAA 3B13A 5L3FB 4KMCA 3NBXX 3ETVA 2XAFB 1X79A 3BK9A 1FIOA 1U4QA 3N9NA 2K5BB 3IBPA 3O4XE 1OWAA 5IHYA 3ZN0B 2EHOC 5HWXA 4GK5E 2E9XD 2JMKA 4M1PA 4P09A 3KV5A 2V26A 4U72A 5EK2A 2X9XA 3AA7B 5FNVE 5LHHB 3LFMA 3ZYLA 3MJXA 2G0UA 4ADZA 3ZMUB 4HKAA 4WNKA 3R84B 2N1GA 4ISTA 3Q9DA 5HXCA 2MBGA 3N2KE 3KBTA 3QC9A 5CA0E 2V7MA 4IHJE 3HL6A 3O9XA 2ES0A 2OA5A 2VWAA 4IE6A 3H37A 3N9LA 1U5PA 2X9HA 5JDFA 4Z8XA 3L3PA 4WBNE 5LA6E 5FY1A 2Q9QA 3LK2B 4DMWA 2QA7A 4F6RC 3ZMTB 2L8KA 3FBZA 3LK42 4H63V 4CQIA 3ZJ2A 4DBQA 3I1AA 2D2SA 1D1CA 2DCFA 3ZCJA 3KV6A 3PU3A 4AKLA 3HI2A 4TZ4C 2M67A 3LK3B 3Q2MA 4N78D 2W0GA 2V7JA 4OHFA 2EHOB 4H9OC 1D1AA 5DQVA 2XAGB 2L9QA 1V9DA 1E1HB 1HF8A 4QXCB 3DP7A 1T98A 4IE4A 4X20E 1LVFA 2K48A 3CQCB 4UF0A 2L3LA 3UUMA 5M4YA 1IZNB 4DNDA 5JDGA 1BR2A 1MIVA 2YU1A 3ZLIA 3I0QA 1MMNA 2VK9A 3U78A 4C90A 3AVRA 4AXPA 3LJCA 3HKBE 4XAXB 4O2AE 5J1GA 2DLRA 2CLYC 3CKDA 3H3AA 1QSDA 5L3EB 2JPFA 5HXHA 3PE0A 2Y48B 4PJMA 5JH7E 5L2LA 2K24A 3PU8A 4QXBB 2LOPA 5LBMA 2GK9A 3IHRA 3I9WA 4K0UA 4HFVA 1MMAA 3CX6B 3W15B 2V7KA 2XAJB 4P0BA 4UXNB 2LSIA 5F8PA 4ILUA 4KP3C 5LXTE 1WRDA 5L3BB 3AAAB 1MIWA 2A2FX 4O4JE 4QXHB 3KDSE 4XBFB 3MXZA 3BQLA 1FMVA 2SPCA 2LT3A 3C64A 3C4ZA 5HXRA 2JRKA 4I43B 5DABA 4EAHA 1S94A 2NTYA 2DWGA 2LSGA 1WYCA 2PG8A 3AVSA 3EDVA 2NW7A 4YJ3E 2HH7A 3PUSA 2CLYB 2KNDA 4AQFC 4TX5A 2LSYA 2LSJA 3ZC1A 1BR4A 3K8PC 4PFPA 4H63H 2WWUA 3C51A 3L09A 3CQGB 2LSKA 4KBMB 3FHNA 4A56A 1H7CA 4PK4A 3QK6A 4CXWA 5J2TE 3AA0B 4NUUA 1D1BA 5LG4A 1LRZA 5LCYA 5LHGB 3RH3A 4AKGA 3OBVE 4PFOA 3ZYMA 5GONE 4HE8A 4X1IE 5HWYA 2BVMA 4MALA 4YJ2E 4MLKA 1HCIA 2CM0A 2MYSA 4HGAA 3ZMSB 1MMDA 5HAXA 5LOVE 5F3JA 1SA0E 3ZMVB 3OYZA 2V1DB 3PDYA 3UUNA 2ODUA 4DMVA 5EK4A 1G8XA 4AQGA 4IIJE 2D0TA 3KVBA 3LG7A 3UTKA 4ZI2D 3AA6B 5JREA 2KINB 5TAOA 3GWHA 2H7OA 2C5IT 3N2OA 3OYXA 4QHOA 3CX7B 4EZHA 4PK6A 3EDUA 3RC3A 5J2UE 2XTLA 2E9XA 3CWZB 3S4UA 1BR0A 4AI6A 2Z6EA 2E8IA 3N9QA 2CCQA 3AB3B 5LBQB 3KFWX 3J9X1 3RYIE 3E0ZA 1ZKEA 5JR9C 2BZBA 1ZEEA 3N5LA 3VHLA 4ISSA 1MIYA 1BR1A 3ZMZB 3U3IA 5ETWA 2LJLA 4MBQA 4O4LE 1HX8A 3IF8B 2J1DG 4IE5A 3KINB 5KMGP 3PTRB 2CWOA 4HN9A 2XAQB 2QGSA 1YW0A 3HKDE 1UX5A 2A72A 1NAFA 1WR6A 3JC6D 5LNKA 3ANWA 2KZ7B 2XUEA 1YD8G 2XHEB 4E7ZA 2CWYA 2KT9A 4X1YE 3RYCE 5LJMA 5E0OA 3FB2A 2NP9A 4ZI2C 1CUNA 4U74A 3FBLA 3LBXB 3WAKA 2UXXB 5DJQC 3O1HA 5LP6E 1HG5A 4GK0E 3AAEB 4WBOA 5JDNA 5JVDE 4GOUA 4DVDA 5JDLA 2NOXA 2K9AA 2X51A 3E08A 2X68A 5CA1E 2B1EA 1UX4A 2IW5B 3K3NA 3CMLA 2YEVC 5JR9B 1YKHB 1G73A 4X1KE 3CQXC 4I50E 3P7IA 4ERRA 3ZC0A 2KXPB 3N9PA 1LVKA 4KUMB 1KNZA 4L0RA 3E22E 3MK7C 2I59A 4MFRA 3BQIA 4UF0B 3RPUA 4EXTA 2D5UA 3RC8A 4O8SA 3EVYA 2A3DA 2PFVA 1OXZA 3D0TA 2WBLA 1FMWA 4H9SE 3MKDA 4AKRB 3RRWA 5FMNA 3O1IA 4FJOA 4OK0A 3GA8A 4UVCB 2Y6XA 4UIGA 2ACXA 2RA1A 4AQFA 4AKIA 2D0UA 2CE7A 4IGUA 2MOZA 4NUVA 2VKDA 5FXXA 5JR9A 4QWNB 3RYFE 2ZM0A 5HXSA 2ZLYA 3T8OA 4TUYE 3CX8B 4YLHA 2Y8DA 2W62A 5ADXL 3ESLA 5L3DB 4PJJA 5JRCA 1IJ6A 1WYBA 4H9RC 4I4TE 4BJNA 4OFZA 5AFUL 3A5XA 2E9XB 3RKOA 4IDZA 1SHZC 3UFEA 1O3XA 3AA1B 3OKQA 4ZOLE 2JQQA 2Q9QC 2JMHA 4AKHA 1VOMA 1LKXA 3SRZA 3RX6A 4BAYB 3NZQA 3MA9A 3KVAA 3C50A 3PUGA 4PJNA 4TV8E 4EOZB 5LGUB 2HPJA 2RP4A 3ZJ1A 5EK3A 4PJLA 2ZMAA 4UVBB 5LYJE 3P8CD 5FXZA 5LGNB 4EB6E 2PBIA 4CXYA 4EYUA 3NRYA 4IE0A 4YHJA 1MMGA 4EZ4A 3HKCE 3N2GE 5KX5E 5H6QB 2YINA 2WAUA 3FXEB 3C4XA 5FYMA 2KLQA 1YKEB 2DI4A 3LBXA 3PUQA 5JDMA 2C0SA 4ZI3D 4XZCA 2WMOA 2NTXA 2X0LB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OYK A;  2CCQ A;  2D5U A;  5LJM A;  4OYJ A;  4P0B A;  5LJN A;  4JUY A;  4P09 A;  2CM0 A;  4P0A A;  2HPJ A;  2HPL A; 
#chains in the Genus database with same CATH topology
 4OYK A;  5DQW A;  3PUV F;  2XPK A;  4TWF A;  2LKG A;  4DR3 T;  4JUY A;  4QX8 B;  2IC6 A;  3DTO A;  4L9I A;  3ZSS A;  2W61 A;  2CA5 A;  4O2B E;  5FP3 A;  5H6R B;  3RF1 A;  1HNX T;  3PUW F;  4L5G A;  2UXC T;  4G63 A;  4IRE A;  4MHC A;  2XAH B;  2A9U A;  2LHN A;  2CEA A;  3PV0 F;  4OYJ A;  4DO0 A;  4YSX A;  2CMR A;  4U2Y A;  1XMQ T;  3N9M A;  3CPZ A;  4LF6 T;  4DV3 T;  2YDQ A;  3UUX B;  2NW8 A;  3UQ4 A;  3MAC A;  5LHI B;  2BKO A;  2PJQ A;  3RKG A;  2VVS A;  2WU5 A;  3F57 A;  3JC6 C;  3K3O A;  3I9Y A;  1D0X A;  3ZCI A;  3UU3 A;  2BDE A;  4EGW A;  1IBK T;  3NWI A;  2BKP A;  2H7V C;  3EHZ A;  1FEW A;  3C98 B;  3PUY F;  2YOE A;  4J2C A;  3UUL A;  2C5J A;  5CB4 E;  4DV6 T;  1Y64 B;  3AE9 A;  3FZM B;  3BQK A;  5BMV E;  2H89 A;  2VB6 A;  3J7Y q;  2WY2 A;  5EK2 A;  3P4Q A;  2VKH A;  3ETU A;  3PJA A;  5ABF B;  2VVN A;  1N32 T;  2M6B A;  3O1J A;  4HFE A;  4TN7 B;  4X5T A;  5C2T A;  5JDQ A;  1XMO T;  4QKN A;  5IYZ E;  1HS7 A;  2C5K T;  4OX9 T;  5AQF B;  3AEA A;  4ZHQ E;  1IBM T;  1D0Z A;  1M62 A;  3Q5W A;  3ZST A;  3UT5 E;  4YFS A;  4IDQ A;  4KX6 A;  4DR6 T;  1EZ3 A;  3V5S A;  4JI4 T;  3IEE A;  4UV8 B;  3WAJ A;  2YU2 A;  3L8R A;  3Q5E A;  4UEL A;  2VUR A;  4WW0 A;  3RI5 A;  4X65 T;  3C4W A;  3V5U A;  3FZK B;  2LM2 A;  2XAS B;  4ASK A;  4PK5 A;  5EZY E;  3PUX F;  5JRC B;  2XZE A;  3I0O A;  2V7I A;  4CXX A;  5L4E A;  3EUH A;  1IJ5 A;  4HTE A;  2VL8 A;  3AEE A;  1ZV4 X;  3GMI A;  3RIF A;  3FXD B;  4TV9 E;  3EAM A;  1HFA A;  1MNE A;  2KWH A;  4IT4 A;  4PNI A;  2E5L T;  1N36 T;  3OVU A;  3ZYK A;  2VAS A;  3RYH E;  3PUR A;  3Q5X A;  5C8Y E;  3RRC A;  4C91 A;  2E5V A;  2X9W A;  2CXF A;  3KV4 A;  3NVO A;  3HR0 A;  4BA9 A;  1M7K A;  3ZPO A;  1QLB A;  4CZZ B;  1W0B A;  3HA4 A;  4H9N C;  2XQ4 A;  4PW8 A;  5AQV B;  1Z0P A;  4ZS3 A;  4V1A v;  4CI2 B;  2YK0 A;  2X9Y A;  2LKH A;  2W63 A;  1S35 A;  1UCU A;  2OLT A;  2ZM2 A;  4O4I E;  4PAG A;  5FXV A;  3PJA J;  2ZM8 A;  2MTQ A;  2WSS V;  4H9P C;  3VU7 H;  4X64 T;  4H9Q C;  4UVA B;  3ZT5 A;  2LM9 A;  1B7T A;  4QH1 A;  4EIW A;  2R6G F;  2FJD A;  1WLX A;  4I0U A;  5LGT B;  2ACZ A;  2YN6 A;  4TWH A;  4KHZ F;  3F2E A;  3JAF A;  4E7S A;  5HXE A;  5L3G B;  2X67 A;  3IA3 A;  4DUY T;  1AJ3 A;  4XBF B;  4EYY R;  1MND A;  3SWH A;  4EEB A;  4ZI7 E;  2UUB T;  4B3M T;  2W67 A;  4KI0 F;  3UU5 A;  5FL1 A;  2HHH T;  3VKG A;  1OED C;  2V8S V;  2Q9Q D;  2DNX A;  2XJ7 A;  5JQG E;  2VL0 A;  2XSA A;  5HYA A;  3SS1 A;  2RPA A;  2H3R A;  3A8Y C;  3LDQ B;  3QUJ A;  3TLW A;  4EED A;  4KHP T;  2IAK A;  3ZEF B;  4CI1 B;  4QX7 B;  3AE4 A;  3WI3 A;  2CRB A;  4IE7 A;  4UEM A;  1SUM B;  4GKJ T;  3OJA A;  1VRB A;  5FY0 A;  4P0A A;  2KWI B;  2LLY A;  2KMF A;  4O4H E;  2IIU A;  2IC9 A;  4JLE A;  4JEH B;  2CXL A;  3JAD A;  1UUR A;  3NZP A;  1IAP A;  2MAW A;  3RLF F;  4LF7 T;  1X9B A;  1ZP0 A;  2NWB A;  2VKO A;  3ZN1 B;  5AQN B;  2VKJ A;  3SFD A;  4NXM T;  2UXN B;  3ANW B;  3DJB A;  3RQW A;  2EHO D;  1US7 B;  2E9X C;  2N9D A;  1E2A A;  4YTN A;  4G2A A;  3AAI A;  4FI5 A;  2LE8 A;  2DWK A;  1NWM X;  5AQQ B;  4JI6 T;  4B6X A;  4ZI3 C;  3NRX A;  3CVR A;  3VR9 A;  3F31 A;  3CIR A;  1QUU A;  2HN1 A;  2ODV A;  3ONJ A;  2N2N A;  4HWI B;  4UV9 B;  5JDH A;  2WZI A;  3M65 A;  2HPL A;  2EHO A;  4ZZC A;  2BG9 B;  2WMN A;  1HNW T;  1D0Y A;  3B57 A;  4DV0 T;  3L39 A;  5FXW A;  5L3C B;  3HKE E;  3UU8 A;  5AQI B;  4DR4 T;  1KNR A;  4BJM A;  2JJ9 A;  2LHR A;  2XQY A;  2NR4 A;  1HG2 A;  4HFD A;  3VKH A;  4I55 E;  2WM9 A;  2P9B A;  5HEU A;  2NW9 A;  4DBR A;  2DHR A;  4YY3 T;  2IHR 1;  2JQK A;  2X66 A;  5ABE A;  4GIW A;  4ZS2 A;  2LEH A;  3K3Q C;  3TKL B;  2W00 A;  3GN5 A;  4YTP A;  1ZHC A;  5A1L A;  1FJG T;  1W9R A;  3KBU A;  3ONX A;  4ANJ A;  2WU2 A;  4CN6 A;  5KDM C;  2Q9Q B;  3KV9 A;  4DR7 T;  2F4V T;  5LJN A;  3R6N A;  4Z90 A;  3FZH B;  2BS3 A;  5FY7 A;  2V7L A;  3AXJ B;  2CXD A;  1HTJ F;  2LOS A;  3AEB A;  3MZK B;  3SOL A;  1UUS A;  3N9O A;  3AE2 A;  2BVL A;  3PUA A;  1KK7 A;  3GN5 B;  4GYR A;  4GYS A;  4HEA A;  4DUZ T;  1E7P A;  5AQG B;  3B13 A;  4AIU A;  5L3F B;  3AE1 A;  4KMC A;  3NBX X;  3ETV A;  2WS3 A;  2XAF B;  1X79 A;  1DU2 A;  3BK9 A;  1FIO A;  1U4Q A;  3N9N A;  2K5B B;  3IBP A;  3O4X E;  1OWA A;  5IHY A;  3ZN0 B;  2EHO C;  2LRL A;  5HWX A;  4GK5 E;  2E9X D;  2JMK A;  4M1P A;  4P09 A;  3KV5 A;  2V26 A;  4U72 A;  2J4G A;  2I6H A;  2X9X A;  3AA7 B;  5FNV E;  4A98 A;  3LFM A;  3ZYL A;  5LHH B;  3MJX A;  2IUB A;  4DR2 T;  4JI7 T;  4A97 A;  5FL0 A;  5HEG A;  2G0U A;  4U2Z A;  5CFB A;  4ADZ A;  3PUZ F;  4HKA A;  4WNK A;  3R84 B;  3ZMU B;  1J5W A;  2N1G A;  2QVA A;  4IST A;  2JQ9 A;  3Q9D A;  1UK5 A;  1KFY A;  5HXC A;  3T1H T;  2MBG A;  3AEC A;  4YXD A;  3N2K E;  3KBT A;  3QC9 A;  4U7I A;  2V7M A;  5CA0 E;  5AQL B;  4IHJ E;  1GQE A;  3HL6 A;  2YDR A;  2ES0 A;  3O9X A;  2OA5 A;  2VWA A;  4IE6 A;  3H37 A;  2QYW A;  3N9L A;  1U5P A;  2X9H A;  5JDF A;  4Z8X A;  3L3P A;  3EI0 A;  2XQ8 A;  4WBN E;  5LA6 E;  5FY1 A;  2Q9Q A;  3LK2 B;  3G06 A;  4DMW A;  1T72 A;  2QA7 A;  4F6R C;  1WFD A;  4LMJ A;  2L8K A;  1KF6 A;  3ZMT B;  3FBZ A;  1XWM A;  2XQA A;  3LK4 2;  4H63 V;  1XNQ T;  4CQI A;  3ZJ2 A;  4DBQ A;  3I1A A;  2D2S A;  1D1C A;  2WZH A;  2DCF A;  3ZCJ A;  4HWH A;  3KV6 A;  3PU3 A;  2J62 A;  4AKL A;  3HI2 A;  4TZ4 C;  2M67 A;  3LK3 B;  3Q2M A;  4N78 D;  2X0H A;  2W0G A;  2V7J A;  4OHF A;  2JQH A;  2X0Y A;  5HEH A;  1ZOY A;  3UFG A;  1JNR A;  2EHO B;  4YT0 A;  4H9O C;  4JEU B;  4ILB A;  3ABV A;  1D1A A;  5DQV A;  2XAG B;  2L9Q A;  4LF8 T;  2H88 A;  1V9D A;  1E1H B;  2XQ9 A;  1HF8 A;  4QXC B;  3DP7 A;  4HFB A;  1T98 A;  4IE4 A;  4X20 E;  1N33 T;  1I94 T;  3K1S A;  5F5W A;  1LVF A;  1T8B A;  2K48 A;  3CQC B;  2L3L A;  4UF0 A;  3EAB A;  3UUM A;  5M4Y A;  2V6Y A;  4JYA T;  1IZN B;  2FUP A;  4DND A;  5JDG A;  1BR2 A;  1MIV A;  2YU1 A;  3ZLI A;  3I0Q A;  1MMN A;  2VK9 A;  4YHH T;  3U78 A;  4C90 A;  5L47 A;  1KNP A;  3AVR A;  4LF5 T;  4AXP A;  4LFB T;  3LJC A;  1VCT A;  3HKB E;  4O2A E;  4XAX B;  5J1G A;  2DLR A;  2CLY C;  3CKD A;  3H3A A;  5FKY A;  1QSD A;  1UGO A;  5L3E B;  2JPF A;  5HXH A;  2BS2 A;  2J47 A;  4DV4 T;  3PE0 A;  2W4X A;  2Y48 B;  4PJM A;  3UU6 A;  5JH7 E;  5L2L A;  4A5X A;  2K24 A;  2BKN A;  3PU8 A;  4QXB B;  2LOP A;  4QH4 A;  5LBM A;  4ZEY A;  2GK9 A;  3IHR A;  5J0Z A;  3I9W A;  1XDO A;  4K0U A;  4HFV A;  4YSZ A;  1MMA A;  3AE5 A;  3CX6 B;  3W15 B;  2ZM6 T;  2V7K A;  1W09 A;  2XAJ B;  4P0B A;  4UXN B;  5BR8 T;  5IUX A;  2LSI A;  2WP9 A;  2XQ3 A;  5F8P A;  4ILU A;  4KP3 C;  5LXT E;  2AXD S;  4IDP A;  1WRD A;  5L3B B;  3AAA B;  2XQ6 A;  4JI5 T;  1MIW A;  2WDQ A;  4TWD A;  3QOF A;  5ABF A;  2PTF A;  2A2F X;  4O4J E;  4QXH B;  4AIS A;  3KDS E;  3QB5 K;  1N34 T;  3MXZ A;  3BQL A;  1FMV A;  2SPC A;  2LT3 A;  3C64 A;  3C4Z A;  1HX1 B;  5HXR A;  2JRK A;  3AEF A;  4I43 B;  2CPT A;  5DAB A;  2B76 A;  4EAH A;  1S94 A;  2NTY A;  2WDR A;  2DWG A;  2LSG A;  1WYC A;  4B3T T;  2PG8 A;  3AVS A;  5HCM A;  4WYV A;  3EDV A;  4LF4 T;  2NW7 A;  4YJ3 E;  5FVK A;  2HH7 A;  3PUS A;  4K0K T;  1WR0 A;  2CLY B;  2KND A;  3OPC A;  4AQF C;  4TX5 A;  2LSY A;  2LSJ A;  2YKS A;  3FZF B;  3ZC1 A;  1BR4 A;  3K8P C;  4PFP A;  1YQ4 A;  2WWU A;  3C51 A;  3L09 A;  4H63 H;  1YXR A;  4JI2 T;  3CQG B;  4DR5 T;  2UU9 T;  4COF A;  2LSK A;  2IML A;  4KBM B;  4U7Y A;  2UXB T;  3FHN A;  4A56 A;  1H7C A;  4PK4 A;  3CK6 A;  3QK6 A;  3NKZ A;  3QNU A;  4CXW A;  4CN1 A;  5J2T E;  3AA0 B;  4NUU A;  3T1Y T;  1D1B A;  2CBI A;  3VR8 A;  5LG4 A;  1LRZ A;  5LCY A;  5LHG B;  2UUC T;  3RH3 A;  5L4H A;  5FVL A;  4AKG A;  3OBV E;  2OV9 A;  4PFO A;  5AQP B;  5HCJ A;  3ZYM A;  5GON E;  2V5D A;  5HEO A;  4HE8 A;  4U3C A;  4X1I E;  2BVM A;  2XM2 A;  4MAL A;  5AQJ B;  5HWY A;  4YJ2 E;  3AE7 A;  4MLK A;  1HCI A;  4IDO A;  1SE7 A;  2CM0 A;  2MYS A;  4HGA A;  4LMK A;  4TNV A;  3ZMS B;  1NEK A;  1MMD A;  2V5C A;  2BBJ A;  5HAX A;  5LOV E;  2LRK A;  5LMU T;  5F3J A;  5JTG A;  1SA0 E;  3TLU A;  2V6X A;  3ZMV B;  3TLV A;  4JI8 T;  2FJA A;  3OYZ A;  2V1D B;  3PDY A;  3UUN A;  2ODU A;  4DMV A;  5EK4 A;  4CN4 A;  4LML A;  1G8X A;  4Z91 A;  4AQG A;  1JNZ A;  4IIJ E;  2D0T A;  3KVB A;  3LG7 A;  3ZT6 A;  1HNZ T;  3UTK A;  4ZI2 D;  3AA6 B;  5JRE A;  2KIN B;  2IDO B;  2WB5 A;  3H3M A;  5TAO A;  3GWH A;  2H7O A;  1XZY A;  2C5I T;  3N2O A;  3OYX A;  3AXJ A;  4QHO A;  1L0V A;  5HEJ A;  3CX7 B;  4EZH A;  4PK6 A;  5AQU B;  4X62 T;  2V6Y B;  3EDU A;  3QB5 A;  3RQU A;  5AQK B;  3RC3 A;  4DV2 T;  5J2U E;  4YTM A;  2XTL A;  4ILC A;  2E9X A;  3CWZ B;  4ILA A;  3S4U A;  1BR0 A;  4AI6 A;  4AQY T;  2Z6E A;  2E8I A;  3N9Q A;  2FJE A;  2CCQ A;  3AB3 B;  2E2A A;  2BG9 C;  5LBQ B;  3KFW X;  3J9X 1;  3RYI E;  2CHO A;  3E0Z A;  2CBJ A;  1ZKE A;  2XQ5 A;  3ZT7 A;  2BBH A;  3RIU A;  5JR9 C;  2BZB A;  1ZEE A;  1IBL T;  4U33 A;  3FZL B;  3N5L A;  3VHL A;  2UUA T;  1OED B;  2WCA A;  2CHN A;  4ISS A;  3SFE A;  1MIY A;  1WCR A;  1BR1 A;  3Q5D A;  4TNW A;  3ZMZ B;  4DV7 T;  3U3I A;  4DR1 T;  5KXJ A;  3AE6 A;  5ETW A;  2LJL A;  4MBQ A;  4O4L E;  4UR9 A;  1HX8 A;  4Q25 A;  2W2U A;  3IF8 B;  2WWV A;  1R8I A;  4X66 T;  2J1D G;  2JIW A;  3KIN B;  4IE5 A;  5AQH B;  5KMG P;  1CHU A;  3PTR B;  1J1J A;  2CWO A;  4HN9 A;  3P4P A;  2AE9 A;  2XAQ B;  4HFI A;  2QGS A;  3ZKR A;  1XDP A;  4HFH A;  1YW0 A;  4JV5 T;  3RGL A;  2I0M A;  3HKD E;  1UX5 A;  2A72 A;  1NAF A;  1WR6 A;  2YDS A;  1T7S A;  2BG9 E;  3JC6 D;  5LNK A;  3ANW A;  2KZ7 B;  2XUE A;  1YD8 G;  4WZX A;  3VRA A;  4YSY A;  4B3S T;  3RHW A;  3UU4 A;  2XHE B;  1YQ3 A;  4E7Z A;  2CWY A;  4HFC A;  2K3W A;  2KT9 A;  4X1Y E;  3RYC E;  5E0O A;  5LJM A;  2QRX A;  3FB2 A;  3UQ7 A;  2NP9 A;  1I6Z A;  4ZI2 C;  1CUN A;  4U74 A;  3ONL C;  5ABH A;  3FBL A;  3LBX B;  3WAK A;  4QH5 A;  2UXX B;  5DJQ C;  3O1H A;  5LP6 E;  1HG5 A;  4GK0 E;  2WDV A;  3AAE B;  4WBO A;  5JDN A;  2UXD T;  3JCF A;  1KEY A;  4JBW F;  5JVD E;  4GOU A;  4DVD A;  5JDL A;  2NOX A;  2K9A A;  2X51 A;  4EV6 A;  3E08 A;  3AE3 A;  2X68 A;  4NIQ A;  2B1E A;  5CA1 E;  2MPK A;  2VQF T;  3P4W A;  1UX4 A;  2IW5 B;  3K3N A;  3CML A;  2YEV C;  3B5M A;  5JR9 B;  1OED A;  1G73 A;  1YKH B;  2WQY A;  2XQ7 A;  2FJB A;  3AED A;  3CQX C;  4X1K E;  5ABG A;  3UUB A;  4I50 E;  3P7I A;  4LFA T;  4ERR A;  3ZC0 A;  4JI0 T;  4LFC T;  2KXP B;  2DL1 A;  3N9P A;  4CI3 B;  1LVK A;  4KUM B;  1KNZ A;  4JI3 T;  4L0R A;  3E22 E;  3M3Z B;  2I59 A;  3MK7 C;  3BQI A;  4MFR A;  4UF0 B;  3RPU A;  4EXT A;  2VQE T;  1HR0 T;  3P4R A;  2D5U A;  3RC8 A;  4O8S A;  4HWF A;  3EVY A;  2A3D A;  4IDN A;  2PFV A;  1XNR T;  1OXZ A;  3LSV A;  3D0T A;  5AQM B;  2WBL A;  4DID B;  1FMW A;  4H9S E;  3MKD A;  4HWC A;  3RRW A;  4AKR B;  5FMN A;  2W66 A;  3O1I A;  4FJO A;  3GA8 A;  4OK0 A;  4UVC B;  3TLT A;  5CJ5 A;  5LG3 A;  2Y6X A;  4UIG A;  2ACX A;  5IWA T;  2RA1 A;  1W0A A;  4AQF A;  5LMN T;  2D0U A;  4DV1 T;  2CE7 A;  4F8H A;  4IGU A;  4AKI A;  2MOZ A;  4NUV A;  2VKD A;  5FXX A;  5JR9 A;  4QWN B;  3RIA A;  3RYF E;  2ZM0 A;  3P4S A;  2XSB A;  2ZLY A;  5C3J A;  5HXS A;  3T8O A;  4TUY E;  3CX8 B;  5AQT B;  4YLH A;  2BG9 A;  2Y8D A;  3VRB A;  2W62 A;  4GKK T;  5ADX L;  3AEG A;  3ESL A;  5L3D B;  4DV5 T;  4PJJ A;  5JRC A;  1IJ6 A;  1WYB A;  4H9R C;  4I4T E;  4BJN A;  4OFZ A;  5AFU L;  2FBW A;  3A5X A;  4U31 A;  4ZZB A;  2D9D A;  2E9X B;  3RKO A;  4IDZ A;  1SHZ C;  3UFE A;  2HN2 A;  3A7M A;  5AQO B;  1O3X A;  4ZXL A;  3AA1 B;  3OKQ A;  4ZOL E;  3TLS A;  2JQQ A;  2Q9Q C;  2BS4 A;  2JMH A;  4AKH A;  1VOM A;  1VCS A;  3X1D A;  1LKX A;  3SRZ A;  3RX6 A;  4BAY B;  3NZQ A;  3MA9 A;  3KVA A;  3C50 A;  3PUG A;  4NPP A;  4LF9 T;  4PJN A;  5LB7 B;  1OED E;  4TV8 E;  4EOZ B;  3OTO T;  5LGU B;  2HPJ A;  2RP4 A;  3ZJ1 A;  2KSR A;  4P1N A;  1Y01 A;  5EK3 A;  4JI1 T;  4PJL A;  2ZMA A;  4B3R T;  4IL9 A;  4UVB B;  5LYJ E;  3P8C D;  5FXZ A;  5LGN B;  1NEN A;  2M6I A;  4EB6 E;  5CGM A;  2PBI A;  3P50 A;  4CXY A;  4EYU A;  1Z8U A;  2XM1 A;  3NRY A;  1MMG A;  4HWD A;  4IE0 A;  3HKC E;  3N2G E;  4YHJ A;  5AQR B;  2YIN A;  5H6Q B;  2WAU A;  3FXE B;  4EZ4 A;  3C4X A;  5KX5 E;  3JAE A;  5FYM A;  2KLQ A;  3AE8 A;  1YKE B;  2DI4 A;  3LBX A;  3PUQ A;  5JDM A;  2C0S A;  4IL4 A;  2XY8 B;  5AQS B;  4ZI3 D;  4NXN T;  4XZC A;  2WMO A;  1J5E T;  3RIU C;  2NTX A;  2X0L B; 
#chains in the Genus database with same CATH homology
 4OYK A;  5DQW A;  4JUY A;  4QX8 B;  2IC6 A;  3DTO A;  4L9I A;  3ZEF B;  2W61 A;  2CA5 A;  4O2B E;  5FP3 A;  5H6R B;  4L5G A;  4G63 A;  4OYJ A;  4MHC A;  2XAH B;  2LHN A;  2CEA A;  4DO0 A;  2CMR A;  3N9M A;  3CPZ A;  3UUX B;  2NW8 A;  3MAC A;  5LHI B;  2PJQ A;  3F57 A;  3JC6 C;  3K3O A;  3I9Y A;  1D0X A;  3ZCI A;  2BDE A;  4J2C A;  2H7V C;  3UUL A;  1FEW A;  3C98 B;  2C5J A;  5CB4 E;  1Y64 B;  5BMV E;  3BQK A;  2VB6 A;  2VKH A;  3ETU A;  5JDQ A;  3O1J A;  4TN7 B;  4QKN A;  5IYZ E;  1HS7 A;  2C5K T;  4ZHQ E;  1D0Z A;  3Q5W A;  3UT5 E;  4YFS A;  1EZ3 A;  3V5S A;  3IEE A;  4UV8 B;  3WAJ A;  2YU2 A;  4UEL A;  4WW0 A;  3C4W A;  3V5U A;  2XAS B;  4ASK A;  4PK5 A;  5EZY E;  5JRC B;  3I0O A;  2V7I A;  4CXX A;  3EUH A;  1IJ5 A;  4HTE A;  2VL8 A;  1ZV4 X;  3GMI A;  3FXD B;  4TV9 E;  1HFA A;  1MNE A;  2KWH A;  4PNI A;  3ZYK A;  2VAS A;  3RYH E;  3PUR A;  3Q5X A;  5C8Y E;  3RRC A;  4C91 A;  2X9W A;  2CXF A;  3KV4 A;  3HR0 A;  4BA9 A;  3ZPO A;  4CZZ B;  3HA4 A;  4H9N C;  4PW8 A;  1Z0P A;  4ZS3 A;  4V1A v;  4CI2 B;  2YK0 A;  2X9Y A;  2W63 A;  2ZM2 A;  1S35 A;  1UCU A;  4O4I E;  4PAG A;  5FXV A;  4CI3 B;  4H9P C;  2ZM8 A;  2MTQ A;  2WSS V;  3VU7 H;  4H9Q C;  4UVA B;  2LM9 A;  1B7T A;  4EIW A;  1WLX A;  5LGT B;  5L3G B;  5HXE A;  3F2E A;  4E7S A;  2X67 A;  1AJ3 A;  4EYY R;  1MND A;  3SWH A;  4ZI7 E;  3VKG A;  2Q9Q D;  2DNX A;  5JQG E;  5HYA A;  3SS1 A;  2H3R A;  3QUJ A;  2IAK A;  4CI1 B;  4QX7 B;  3WI3 A;  4IE7 A;  4UEM A;  3OJA A;  1VRB A;  5FY0 A;  4P0A A;  2KWI B;  2KMF A;  4O4H E;  2IC9 A;  4JLE A;  4JEH B;  2CXL A;  3NZP A;  1IAP A;  2NWB A;  2VKO A;  3ZN1 B;  2VKJ A;  2UXN B;  3ANW B;  3DJB A;  2EHO D;  1US7 B;  2E9X C;  2N9D A;  4G2A A;  3AAI A;  4FI5 A;  2LE8 A;  2DWK A;  1NWM X;  4B6X A;  4ZI3 C;  3NRX A;  3CVR A;  3F31 A;  1QUU A;  4UV9 B;  2ODV A;  2N2N A;  5JDH A;  3M65 A;  2HPL A;  2EHO A;  2WMN A;  1D0Y A;  3B57 A;  5FXW A;  5L3C B;  3HKE E;  4BJM A;  2JJ9 A;  2LHR A;  2XQY A;  3VKH A;  1HG2 A;  4I55 E;  2WM9 A;  2P9B A;  2NW9 A;  4DBR A;  2DHR A;  2X66 A;  4GIW A;  4ZS2 A;  2LEH A;  3K3Q C;  3TKL B;  2W00 A;  3GN5 A;  1ZHC A;  5A1L A;  3KBU A;  3ONX A;  4ANJ A;  5KDM C;  2Q9Q B;  3KV9 A;  5LJN A;  3R6N A;  5FY7 A;  2V7L A;  3MZK B;  2CXD A;  1HTJ F;  2LOS A;  3SOL A;  3J7Y q;  4JEU B;  3N9O A;  3PUA A;  2BVL A;  4GYR A;  1KK7 A;  3GN5 B;  4GYS A;  4HEA A;  3B13 A;  5L3F B;  4KMC A;  3NBX X;  3ETV A;  2XAF B;  1X79 A;  3BK9 A;  1FIO A;  1U4Q A;  3N9N A;  2K5B B;  3IBP A;  3O4X E;  1OWA A;  5IHY A;  3ZN0 B;  2EHO C;  5HWX A;  4GK5 E;  2E9X D;  2JMK A;  4M1P A;  4P09 A;  3KV5 A;  2V26 A;  4U72 A;  5EK2 A;  2X9X A;  3AA7 B;  5FNV E;  5LHH B;  3LFM A;  3ZYL A;  3MJX A;  2G0U A;  4ADZ A;  3ZMU B;  4HKA A;  4WNK A;  3R84 B;  2N1G A;  4IST A;  3Q9D A;  5HXC A;  2MBG A;  3N2K E;  3KBT A;  3QC9 A;  5CA0 E;  2V7M A;  4IHJ E;  3HL6 A;  3O9X A;  2ES0 A;  2OA5 A;  2VWA A;  4IE6 A;  3H37 A;  3N9L A;  1U5P A;  2X9H A;  5JDF A;  4Z8X A;  3L3P A;  4WBN E;  5LA6 E;  5FY1 A;  2Q9Q A;  3LK2 B;  4DMW A;  2QA7 A;  4F6R C;  3ZMT B;  2L8K A;  3FBZ A;  3LK4 2;  4H63 V;  4CQI A;  3ZJ2 A;  4DBQ A;  3I1A A;  2D2S A;  1D1C A;  2DCF A;  3ZCJ A;  3KV6 A;  3PU3 A;  4AKL A;  3HI2 A;  4TZ4 C;  2M67 A;  3LK3 B;  3Q2M A;  4N78 D;  2W0G A;  2V7J A;  4OHF A;  2EHO B;  4H9O C;  1D1A A;  5DQV A;  2XAG B;  2L9Q A;  1V9D A;  1E1H B;  1HF8 A;  4QXC B;  3DP7 A;  1T98 A;  4IE4 A;  4X20 E;  1LVF A;  2K48 A;  3CQC B;  4UF0 A;  2L3L A;  3UUM A;  5M4Y A;  1IZN B;  4DND A;  5JDG A;  1BR2 A;  1MIV A;  2YU1 A;  3ZLI A;  3I0Q A;  1MMN A;  2VK9 A;  3U78 A;  4C90 A;  3AVR A;  4AXP A;  3LJC A;  3HKB E;  4XAX B;  4O2A E;  5J1G A;  2DLR A;  2CLY C;  3CKD A;  3H3A A;  1QSD A;  5L3E B;  2JPF A;  5HXH A;  3PE0 A;  2Y48 B;  4PJM A;  5JH7 E;  5L2L A;  2K24 A;  3PU8 A;  4QXB B;  2LOP A;  5LBM A;  2GK9 A;  3IHR A;  3I9W A;  4K0U A;  4HFV A;  1MMA A;  3CX6 B;  3W15 B;  2V7K A;  2XAJ B;  4P0B A;  4UXN B;  2LSI A;  5F8P A;  4ILU A;  4KP3 C;  5LXT E;  1WRD A;  5L3B B;  3AAA B;  1MIW A;  2A2F X;  4O4J E;  4QXH B;  3KDS E;  4XBF B;  3MXZ A;  3BQL A;  1FMV A;  2SPC A;  2LT3 A;  3C64 A;  3C4Z A;  5HXR A;  2JRK A;  4I43 B;  5DAB A;  4EAH A;  1S94 A;  2NTY A;  2DWG A;  2LSG A;  1WYC A;  2PG8 A;  3AVS A;  3EDV A;  2NW7 A;  4YJ3 E;  2HH7 A;  3PUS A;  2CLY B;  2KND A;  4AQF C;  4TX5 A;  2LSY A;  2LSJ A;  3ZC1 A;  1BR4 A;  3K8P C;  4PFP A;  4H63 H;  2WWU A;  3C51 A;  3L09 A;  3CQG B;  2LSK A;  4KBM B;  3FHN A;  4A56 A;  1H7C A;  4PK4 A;  3QK6 A;  4CXW A;  5J2T E;  3AA0 B;  4NUU A;  1D1B A;  5LG4 A;  1LRZ A;  5LCY A;  5LHG B;  3RH3 A;  4AKG A;  3OBV E;  4PFO A;  3ZYM A;  5GON E;  4HE8 A;  4X1I E;  5HWY A;  2BVM A;  4MAL A;  4YJ2 E;  4MLK A;  1HCI A;  2CM0 A;  2MYS A;  4HGA A;  3ZMS B;  1MMD A;  5HAX A;  5LOV E;  5F3J A;  1SA0 E;  3ZMV B;  3OYZ A;  2V1D B;  3PDY A;  3UUN A;  2ODU A;  4DMV A;  5EK4 A;  1G8X A;  4AQG A;  4IIJ E;  2D0T A;  3KVB A;  3LG7 A;  3UTK A;  4ZI2 D;  3AA6 B;  5JRE A;  2KIN B;  5TAO A;  3GWH A;  2H7O A;  2C5I T;  3N2O A;  3OYX A;  4QHO A;  3CX7 B;  4EZH A;  4PK6 A;  3EDU A;  3RC3 A;  5J2U E;  2XTL A;  2E9X A;  3CWZ B;  3S4U A;  1BR0 A;  4AI6 A;  2Z6E A;  2E8I A;  3N9Q A;  2CCQ A;  3AB3 B;  5LBQ B;  3KFW X;  3J9X 1;  3RYI E;  3E0Z A;  1ZKE A;  5JR9 C;  2BZB A;  1ZEE A;  3N5L A;  3VHL A;  4ISS A;  1MIY A;  1BR1 A;  3ZMZ B;  3U3I A;  5ETW A;  2LJL A;  4MBQ A;  4O4L E;  1HX8 A;  3IF8 B;  2J1D G;  4IE5 A;  3KIN B;  5KMG P;  3PTR B;  2CWO A;  4HN9 A;  2XAQ B;  2QGS A;  1YW0 A;  3HKD E;  1UX5 A;  2A72 A;  1NAF A;  1WR6 A;  3JC6 D;  5LNK A;  3ANW A;  2KZ7 B;  2XUE A;  1YD8 G;  2XHE B;  4E7Z A;  2CWY A;  2KT9 A;  4X1Y E;  3RYC E;  5LJM A;  5E0O A;  3FB2 A;  2NP9 A;  4ZI2 C;  1CUN A;  4U74 A;  3FBL A;  3LBX B;  3WAK A;  2UXX B;  5DJQ C;  3O1H A;  5LP6 E;  1HG5 A;  4GK0 E;  3AAE B;  4WBO A;  5JDN A;  5JVD E;  4GOU A;  4DVD A;  5JDL A;  2NOX A;  2K9A A;  2X51 A;  3E08 A;  2X68 A;  5CA1 E;  2B1E A;  1UX4 A;  2IW5 B;  3K3N A;  3CML A;  2YEV C;  5JR9 B;  1YKH B;  1G73 A;  4X1K E;  3CQX C;  4I50 E;  3P7I A;  4ERR A;  3ZC0 A;  2KXP B;  3N9P A;  1LVK A;  4KUM B;  1KNZ A;  4L0R A;  3E22 E;  3MK7 C;  2I59 A;  4MFR A;  3BQI A;  4UF0 B;  3RPU A;  4EXT A;  2D5U A;  3RC8 A;  4O8S A;  3EVY A;  2A3D A;  2PFV A;  1OXZ A;  3D0T A;  2WBL A;  1FMW A;  4H9S E;  3MKD A;  4AKR B;  3RRW A;  5FMN A;  3O1I A;  4FJO A;  4OK0 A;  3GA8 A;  4UVC B;  2Y6X A;  4UIG A;  2ACX A;  2RA1 A;  4AQF A;  4AKI A;  2D0U A;  2CE7 A;  4IGU A;  2MOZ A;  4NUV A;  2VKD A;  5FXX A;  5JR9 A;  4QWN B;  3RYF E;  2ZM0 A;  5HXS A;  2ZLY A;  3T8O A;  4TUY E;  3CX8 B;  4YLH A;  2Y8D A;  2W62 A;  5ADX L;  3ESL A;  5L3D B;  4PJJ A;  5JRC A;  1IJ6 A;  1WYB A;  4H9R C;  4I4T E;  4BJN A;  4OFZ A;  5AFU L;  3A5X A;  2E9X B;  3RKO A;  4IDZ A;  1SHZ C;  3UFE A;  1O3X A;  3AA1 B;  3OKQ A;  4ZOL E;  2JQQ A;  2Q9Q C;  2JMH A;  4AKH A;  1VOM A;  1LKX A;  3SRZ A;  3RX6 A;  4BAY B;  3NZQ A;  3MA9 A;  3KVA A;  3C50 A;  3PUG A;  4PJN A;  4TV8 E;  4EOZ B;  5LGU B;  2HPJ A;  2RP4 A;  3ZJ1 A;  5EK3 A;  4PJL A;  2ZMA A;  4UVB B;  5LYJ E;  3P8C D;  5FXZ A;  5LGN B;  4EB6 E;  2PBI A;  4CXY A;  4EYU A;  3NRY A;  4IE0 A;  4YHJ A;  1MMG A;  4EZ4 A;  3HKC E;  3N2G E;  5KX5 E;  5H6Q B;  2YIN A;  2WAU A;  3FXE B;  3C4X A;  5FYM A;  2KLQ A;  1YKE B;  2DI4 A;  3LBX A;  3PUQ A;  5JDM A;  2C0S A;  4ZI3 D;  4XZC A;  2WMO A;  2NTX A;  2X0L B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...