5LJMA

Structure of spata2 pub domain
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
215
structure length
203
Chain Sequence
GPMDTKFKDDLFRKYVQFHESSDECLRVAASTLLSLHKVDPFYRFRLIQFYEVVESSLRSLSSSSLRALHGAFSMLETVGINLFLYPWKKEFRSIKTYTGPFVYYVKSTLLEEDIRAILSCMGYTPELGTAYKLRELVETLQVKMVSFELFLAKVECEQMLEIHSQVKDKGYSELDIVSERKSSAEDVRGCSDALRRRAEGRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell cycle
molecule keywords Spermatogenesis-associated protein 2
publication title SPATA2 Links CYLD to LUBAC, Activates CYLD, and Controls LUBAC Signaling.
pubmed doi rcsb
source organism Homo sapiens
total genus 83
structure length 203
sequence length 215
ec nomenclature
pdb deposition date 2016-07-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.2190 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 5ljmA00
2D5UA 2HPLA 2HPJA 5LJMA 5LJNA 4OYKA 4P0AA 4JUYA 2CCQA 4P09A 4P0BA 2CM0A 4OYJA
chains in the Genus database with same CATH superfamily
1KNRA 2BKNA 2DWKA 1AJ3A 5BR8T 3O1JA 1OEDC 3B57A 1OXZA 2PTFA 3K3QC 2BS2A 1D0ZA 4HWCA 1BR4A 2WZHA 4AKIA 5LB7B 3SS1A 4HFIA 3JADA 2L9QA 2XQ9A 4PAGA 3KVBA 1MNDA 3KV5A 3RKOA 4DO0A 3CMLA 2KLQA 5LJNA 1UK5A 3LFMA 5FVLA 2NP9A 5AQUB 4DNDA 2XQ5A 2V7MA 2OLTA 2ZM2A 4P0BA 3ZT7A 3P4WA 3C4WA 3FBZA 3NWIA 4JI1T 4TNVA 4GKKT 2L3LA 2WMNA 1QSDA 4EOZB 5C3JA 4C91A 4JI0T 2C0SA 4O8SA 4QX8B 3LBXA 2KWIB 2WMOA 1D1CA 3IBPA 2CXLA 3PUSA 2FJEA 3AEBA 1Z8UA 5JRCB 5M4YA 5FKYA 2WBLA 2HN2A 3FB2A 4WW0A 1QUUA 3O1IA 4I55E 1MMDA 3ZLIA 4B3RT 3LSVA 1E7PA 1BR0A 1YD8G 4AQYT 2XJ7A 3RQUA 2W63A 1UX4A 2D2SA 2XAGB 3ONJA 2BVMA 4P1NA 4IT4A 5HEUA 3KV6A 4YLHA 4ILBA 2HHHT 2LHRA 2HH7A 3FXEB 2X9XA 2V7LA 4UV8B 3WI3A 1KEYA 3ZMTB 2JQKA 4L9IA 3PUAA 4CXXA 4HFBA 2MOZA 2UXCT 3LG7A 4YHHT 2H88A 2V7KA 1E2AA 5ABHA 2C5IT 2CEAA 4E7SA 3PTRB 3PV0F 4X5TA 1W9RA 4FJOA 1H7CA 5HWYA 3AE8A 3RYCE 4GK0E 3RIAA 4HFCA 2ZLYA 3RHWA 5LCYA 2FUPA 2QRXA 3AAAB 5AQIB 4EEBA 4ZOLE 4AXPA 3PUWF 1JNRA 5LHGB 3VR9A 5L47A 1SE7A 1I94T 4EEDA 2XQ6A 5FL1A 2RPAA 4OYKA 4J2CA 1G8XA 3CX7B 3QNUA 2IMLA 4IE5A 1XNRT 3CQCB 3RRCA 4TV8E 1IAPA 2XAHB 1XMOT 1LVFA 4HWHA 1UURA 4UV9B 2V8SV 4ZS2A 3DP7A 3ZC0A 3Q5WA 5LHIB 2N9DA 3C51A 2ZM0A 3VRAA 4ZS3A 4KI0F 4MFRA 5H6QB 4NIQA 3QC9A 3ZJ2A 4O4HE 5ABEA 3PUYF 2CBIA 3AECA 3AXJA 1CHUA 2ODUA 2P9BA 1XDOA 4QHOA 4X66T 2WDRA 2ACZA 4YSYA 5L4EA 3OBVE 1NWMX 4CN6A 2SPCA 3KV9A 2IDOB 4XZCA 1CUNA 4DIDB 2CWOA 3UU8A 4CQIA 2IAKA 1ZP0A 2LEHA 2NTYA 4OYJA 5LMUT 1WRDA 2XM1A 4A5XA 1W09A 2M6BA 5AQNB 1WR6A 4EZ4A 4U7YA 3PDYA 4YJ2E 5FXZA 1YQ4A 4CN4A 5AQTB 4CI2B 1I6ZA 2BG9A 3GN5A 2X51A 4ZI3C 5JDHA 3LK3B 4IDOA 2XQ4A 5FMNA 2AE9A 2IW5B 2D0TA 3RF1A 1Y01A 2EHOA 1T98A 4JEUB 3KBTA 4QH1A 4I4TE 4DR6T 4ZZBA 4CN1A 2YDSA 3DJBA 2MYSA 2V6YA 2J47A 3SRZA 1HTJF 4KBMB 4I0UA 2FBWA 5A1LA 4O2AE 2E9XB 5CA0E 3VHLA 2Q9QB 1MMAA 2VK9A 4DV0T 2LRLA 2K48A 3ZT6A 2E9XA 4QKNA 2YDRA 3RPUA 4CI3B 1S94A 4ILUA 5LBMA 1MNEA 2EHOD 2Q9QA 5JDFA 4GKJT 1IBKT 3CPZA 2HN1A 5HCJA 3ESLA 2MTQA 1XNQT 2VQFT 2X66A 2NW7A 2YK0A 5CJ5A 3WAJA 1B7TA 3L8RA 1WLXA 2R6GF 2YINA 2XQ8A 3AE9A 2D0UA 1D1AA 3LJCA 5L2LA 2E9XD 3ANWB 4DMWA 2E8IA 3ZC1A 4ILCA 5HXRA 2JPFA 4KHPT 4YTMA 4CI1B 2E5VA 2QVAA 1NEKA 4CXYA 3HL6A 4ISSA 4PK6A 2NR4A 2XY8B 1US7B 3P4SA 3MK7C 4GK5E 4I50E 3P7IA 3UUMA 4BA9A 4DV2T 1IZNB 4UVCB 2WDQA 2CHOA 2UUCT 4UXNB 2BBHA 5EK2A 3T1YT 2IC6A 1IJ5A 2ZM8A 4JLEA 2UU9T 2LSYA 5FNVE 2WB5A 5AQKB 1SHZC 5GONE 2I0MA 2MPKA 3V5SA 4IIJE 4L0RA 1L0VA 1J5ET 3AVSA 4PK5A 3DTOA 4EXTA 3PU8A 5LP6E 2OA5A 3AE6A 2MBGA 5JTGA 2VL8A 4TWHA 3P4QA 3C4XA 3MACA 5JR9C 2QGSA 3LK2B 3ZEFB 4NXNT 3HKCE 3C4ZA 4B6XA 3ZSTA 3VR8A 1NENA 1UGOA 4HWIB 3U3IA 4O4JE 4XBFB 2MAWA 1YW0A 3UFEA 3HI2A 4B3ST 1T72A 3EVYA 4ZI2C 3I1AA 3AA6B 3ABVA 1HG2A 1V9DA 4YXDA 1XMQT 2X0HA 3Q2MA 3UTKA 3EDUA 3RLFF 4YHJA 1VOMA 5EZYE 2BBJA 3KBUA 5FY1A 5HEGA 5LGUB 1HX8A 3I9WA 2XM2A 5AQRB 5HAXA 4B3MT 4TX5A 3QOFA 5ETWA 4IDNA 2VB6A 3ZYLA 3ZMVB 5LGNB 4UELA 2XHEB 5FL0A 2LE8A 3AVRA 3AB3B 5CA1E 2CWYA 4E7ZA 1FMWA 2LT3A 5AQSB 3N9LA 4JYAT 1HS7A 3OTOT 3O4XE 1YQ3A 3RQWA 3RX6A 4CZZB 2JRKA 3E22E 4H9PC 5LHHB 3RI5A 4JI4T 2DNXA 3S4UA 5IWAT 3K8PC 4K0UA 4DR3T 3RIFA 2PBIA 4H9RC 2X9WA 2NOXA 1HG5A 4IE7A 4U2YA 5HCMA 5H6RB 4YSZA 2W62A 4H9OC 4EYYR 5HXHA 1LKXA 2K24A 4MHCA 5AQLB 5JRCA 3IEEA 4I43B 3PJAJ 2WP9A 2LM2A 1U5PA 1N33T 1KK7A 3UQ7A 4QXHB 3C64A 4UIGA 4EAHA 3UUNA 1YKEB 3P8CD 2XQYA 4AQGA 2UXDT 4HFEA 4F8HA 5BMVE 4WBNE 5LYJE 3ZMSB 5E0OA 5AQQB 4AISA 2WDVA 3NZPA 2W00A 3GMIA 4YT0A 2CM0A 3PUXF 3PUZF 5HEJA 5FXVA 1VCTA 2JMKA 4CXWA 4XAXB 3F57A 2ACXA 3RGLA 3FZLB 4ASKA 2KNDA 2B1EA 1HFAA 3I9YA 2WAUA 5C8YE 4DUYT 3C98B 4DMVA 3MA9A 3AA1B 4P0AA 2XQ3A 5DQVA 5AQOB 3BQLA 2PG8A 2J62A 3UU5A 4UVBB 5AQFB 2XTLA 2M67A 1HCIA 2LJLA 2A3DA 3V5UA 3RYFE 2Y6XA 5L4HA 3K1SA 2Y48B 1XWMA 1Z0PA 4DV6T 4LMLA 4AQFA 2VKDA 2W61A 2BG9E 3VKHA 3PUQA 3ZMUB 2J1DG 2XAFB 5J2UE 4H9QC 1IBMT 3H3AA 2JJ9A 1FEWA 2CLYC 3AAIA 2LSGA 3N2OA 4P09A 4DV1T 4BAYB 2C5JA 2CXDA 3AE2A 2DWGA 4IDPA 4TV9E 4AIUA 3EHZA 2V7JA 5IHYA 3CK6A 3MJXA 3NKZA 1HNWT 3AE5A 1T8BA 3A8YC 2PJQA 2BKOA 2XAJB 3AAEB 4HN9A 2WU2A 2VKOA 5JH7E 3QB5A 2XUEA 3JC6D 2H7VC 2DHRA 4A97A 4GIWA 1WR0A 5CFBA 2FJBA 2JMHA 3T1HT 1G73A 3CQXC 4PW8A 1BR1A 2K3WA 4WBOA 1KFYA 2BKPA 2DL1A 4JV5T 1S35A 2QA7A 1HNZT 4DR4T 2CXFA 2V1DB 5JQGE 3RH3A 3N9OA 2X9HA 4IE4A 1Y64B 3ZN1B 2V26A 4MALA 3ZT5A 1T7SA 2WQYA 2UXBT 5FY7A 4X64T 2KT9A 3Q5EA 2BZBA 3JC6C 4Z91A 4DR7T 1HNXT 1QLBA 3O1HA 4AI6A 3AEFA 5FY0A 4ZEYA 3KFWX 4TN7B 2UXNB 4YSXA 5JDLA 5KX5E 2KSRA 2DLRA 5CGMA 2E2AA 4QXBB 4V1Av 4JI3T 3CIRA 2KWHA 4EGWA 5F3JA 3N5LA 4LFCT 4OHFA 3FXDB 3N2KE 5DJQC 4DV7T 3AE7A 3ZMZB 3TKLB 4LF7T 5LGTB 1FJGT 4DBRA 3HKBE 5DQWA 3Q9DA 3K3OA 3CX6B 4LF6T 1KF6A 3VKGA 4LFBT 4IREA 2KZ7B 3TLVA 4HWFA 3NBXX 4JI2T 4UF0B 3MKDA 1E1HB 2BG9C 2WS3A 4C90A 4EB6E 3J9X1 4HE8A 5LG4A 5KMGP 3E08A 3I0OA 2LRKA 2FJDA 4QWNB 2D5UA 5JR9B 3RRWA 4U3CA 2YEVC 2Q9QD 2EHOC 3TLTA 3ANWA 2LKGA 3AE3A 3HKEE 3UUBA 2ZM6T 3RIUA 3AEEA 4AKRB 2M6IA 1D0YA 2ES0A 2IIUA 4YFSA 4PNIA 4DR2T 5L3FB 1MMGA 5FXXA 1N32T 5LXTE 4U2ZA 5JDNA 2X68A 4H9NC 5JVDE 3VRBA 2D9DA 2LOPA 3ZCJA 2VL0A 2CMRA 2E9XC 5AQGB 4A56A 3C50A 1OEDB 2Q9QC 2XSBA 1J1JA 4H63H 5ADXL 5L3BB 3B13A 4YTPA 4Z90A 1OEDA 2I6HA 3L09A 4U33A 4TWFA 5FVKA 3EABA 3CQGB 2CRBA 2X9YA 3BK9A 5AQHB 4UVAB 4BJNA 2WCAA 4GOUA 4BJMA 4IL4A 4NPPA 2DCFA 4DR1T 1HR0T 4WNKA 3PU3A 1SUMB 3AEAA 5AQMB 4U31A 4LF5T 4A98A 4X20E 5KXJA 2CBJA 3RIUC 4FI5A 3EI0A 4PFPA 1IBLT 1WYCA 3N9QA 3HKDE 3CWZB 4GYRA 4WYVA 4IL9A 3H37A 4WZXA 3UQ4A 4PJJA 3P4PA 2V5DA 2V7IA 4ADZA 5HEHA 4JBWF 5JDGA 5JDMA 2LM9A 4ANJA 4EZHA 2X67A 1J5WA 2LSKA 5FXWA 3LK42 2W2UA 3D0TA 4IDZA 5AQJB 2YOEA 1UX5A 2BVLA 3FZHB 1LVKA 1R8IA 1HF8A 1BR2A 1UCUA 3AEDA 1UUSA 2YN6A 1WCRA 5LOVE 2W67A 1W0AA 2W0GA 3TLUA 5EK4A 4DUZT 4ZHQE 5AQPB 4YY3T 1XZYA 2VVSA 4LFAT 3LDQB 2VURA 1IJ6A 3PE0A 3ZCIA 1YKHB 1XDPA 3ZN0B 3B5MA 3UU3A 3SWHA 3UT5E 4B3TT 4HTEA 3LBXB 4EIWA 2UUBT 2UUAT 2G0UA 5TAOA 2N2NA 5J1GA 3M3ZB 1VCSA 3N9NA 4MLKA 4HGAA 4JUYA 1KNZA 1N36T 3BQIA 3E0ZA 2LHNA 3ZKRA 2ODVA 3P50A 2V6XA 2VASA 2RA1A 3U78A 4IHJE 3GA8A 3MZKB 2JQQA 3ETUA 4GYSA 1W0BA 2XPKA 3AA0B 2CLYB 2XASB 3NZQA 2CA5A 4NUUA 5AFUL 3X1DA 4DBQA 3SFDA 4LF8T 2HPLA 2WSSV 5HXEA 4ZI7E 5KDMC 2BS3A 5CB4E 5LMNT 2KMFA 1LRZA 3J7Yq 4H63V 3WAKA 4EV6A 3F2EA 2AXDS 2WU5A 2XQ7A 5LBQB 4TNWA 5L3CB 3UUXB 3ZPOA 1X79A 1X9BA 3A7MA 4F6RC 4JI5T 3O9XA 1D1BA 4X62T 2VQET 1WFDA 2LSIA 3F31A 4U72A 2C5KT 5F5WA 3GWHA 4O4LE 3FZMB 2H7OA 2H89A 2LKHA 4KP3C 2A2FX 1M62A 2W4XA 2K5BB 4HKAA 2BDEA 2KINB 4QH4A 4H9SE 3H3MA 5J0ZA 3KVAA 4IE0A 5AQVB 3OYZA 2UXXB 2XSAA 5L3EB 3TLWA 3CVRA 4U7IA 3ZJ1A 4LF4T 5ABFB 3QB5K 1KNPA 3MXZA 2V5CA 3ZSSA 3N9MA 4Z8XA 3AXJB 5LNKA 3OJAA 1U4QA 2PFVA 4HFHA 5ABFA 5L3GB 3KINB 1ZV4X 4IDQA 3JCFA 4LF9T 1ZHCA 4L5GA 4PK4A 3N9PA 4MBQA 4JI6T 3AE4A 2YDQA 3N2GE 4KUMB 3PJAA 5L3DB 3RC8A 4M1PA 4OX9T 1O3XA 4PJNA 1WYBA 4X1IE 2JQHA 5JREA 4DR5T 4ZI3D 4PFOA 3G06A 1JNZA 4AQFC 4IE6A 3W15B 2CPTA 5IYZE 2WWUA 3M65A 5IUXA 3UU6A 3RYHE 4AKLA 4COFA 2IUBA 2NWBA 3AEGA 4DVDA 2OV9A 2BG9B 2LLYA 2B76A 2LOSA 3GN5B 3SOLA 4DV5T 3UULA 3PUVF 3HA4A 1GQEA 1YXRA 4OFZA 4N78D 4OK0A 2EHOB 2JIWA 2RP4A 4UR9A 3IF8B 2VKJA 2X0LB 2L8KA 3EDVA 1MIVA 5J2TE 2NTXA 3EUHA 2CE7A 4TUYE 2HPJA 3ETVA 2V6YB 3IHRA 5LA6E 3RC3A 1VRBA 1NAFA 2KXPB 5LG3A 1HX1B 1SA0E 2CHNA 4JI8T 1FIOA 4KHZF 1OEDE 4QX7B 3L39A 2A72A 3FHNA 3A5XA 1MIYA 3UU4A 3R84B 2DI4A 2E5LT 3NVOA 4X1YE 2NW9A 3IA3A 3OYXA 2X0YA 3Q5DA 4ZXLA 2GK9A 1N34T 3KV4A 2CCQA 4HEAA 4QXCB 2NW8A 1MMNA 3SFEA 4HFDA 4UF0A 2WM9A 5ABGA 1OWAA 2BS4A 4G2AA 4UEMA 4NUVA 1EZ3A 3EAMA 5C2TA 2WWVA 3OPCA 4NXMT 2F4VT 3NRYA 2J4GA 2VKHA 2YKSA 3T8OA 2H3RA 5JR9A 3KDSE 3FZFB 3JAFA 2VVNA 4EYUA 4DV3T 3I0QA 2A9UA 3JAEA 3UFGA 4TZ4C 2XZEA 1D0XA 2QYWA 5FP3A 3P4RA 3RYIE 4ZZCA 3K3NA 5DABA 5F8PA 3PURA 4O4IE 4TWDA 3OVUA 2VWAA 4X65T 2I59A 1FMVA 5JDQA 5HYAA 2YU2A 3ZYKA 3QUJA 4Q25A 4IGUA 4PJMA 2Y8DA 3BQKA 5LJMA 3QK6A 4DV4T 4HFVA 3HR0A 3ONXA 4ISTA 2JQ9A 4ILAA 3CX8B 2WY2A 4KMCA 4AKGA 4ZI2D 4X1KE 2WZIA 2W66A 1ZOYA 3TLSA 5HXSA 5HEOA 4LMKA 5EK3A 3PUGA 2LSJA 4U74A 3VU7H 5HWXA 4YJ3E 4K0KT 4JEHB 1MIWA 2IHR1 3AA7B 1M7KA 2K9AA 4QH5A 3L3PA 3NRXA 3AE1A 2XQAA 3CKDA 4AKHA 3Q5XA 4HWDA 1ZKEA 3R6NA 3ZYMA 3OKQA 4JI7T 2Z6EA 2IC9A 1ZEEA 2XAQB 4PJLA 4ERRA 2N1GA 5FYMA 5HXCA 3ONLC 4YTNA 3RKGA 4KX6A 2FJAA 4LMJA 2ZMAA 4G63A 2YU1A 1DU2A 3FBLA 3FZKB 4O2BE
chains in the Genus database with same CATH topology
1BR1A 3LJCA 5L2LA 2DWKA 1AJ3A 4WBOA 2E9XD 3ANWB 4DMWA 2E8IA 3O1JA 3ZC1A 3B57A 1OXZA 1S35A 2QA7A 5HXRA 2JPFA 4DBQA 2CXFA 2V1DB 2HPLA 2WSSV 5HXEA 4CI1B 5JQGE 3RH3A 4ZI7E 5KDMC 3N9OA 3K3QC 4CXYA 2X9HA 4IE4A 1D0ZA 1Y64B 1BR4A 3HL6A 5CB4E 3ZN1B 2V26A 4AKIA 4MALA 3SS1A 4ISSA 2KMFA 4PK6A 2L9QA 1LRZA 3J7Yq 5FY7A 4PAGA 4H63V 2KT9A 1MNDA 1US7B 3KVBA 3MK7C 2BZBA 3JC6C 3KV5A 3WAKA 3F2EA 4GK5E 3RKOA 4I50E 3P7IA 3UUMA 4BA9A 4DO0A 1IZNB 3CMLA 4UVCB 2KLQA 3O1HA 4AI6A 5FY0A 5LJNA 3LFMA 5LBQB 2NP9A 4DNDA 4UXNB 5L3CB 3KFWX 3UUXB 5EK2A 4TN7B 2UXNB 2IC6A 2V7MA 3ZPOA 2ZM2A 1X79A 4P0BA 5JDLA 5KX5E 1IJ5A 2ZM8A 4F6RC 4JLEA 3O9XA 2LSYA 5FNVE 3C4WA 1SHZC 3FBZA 1D1BA 2DLRA 5GONE 4QXBB 4V1Av 2LSIA 3F31A 3V5SA 4U72A 2L3LA 2WMNA 2C5KT 1QSDA 4EOZB 4IIJE 3GWHA 4L0RA 2KWHA 4O4LE 3AVSA 4PK5A 2H7OA 3DTOA 4C91A 4EXTA 3PU8A 5F3JA 4KP3C 3N5LA 5LP6E 2A2FX 2OA5A 2K5BB 4OHFA 3FXDB 2C0SA 4O8SA 4HKAA 2MBGA 3N2KE 4QX8B 5DJQC 2VL8A 3LBXA 2BDEA 2KINB 2KWIB 2WMOA 4H9SE 3ZMZB 3C4XA 3MACA 5JR9C 3TKLB 2QGSA 1D1CA 3KVAA 5LGTB 4IE0A 3LK2B 3ZEFB 3IBPA 4DBRA 3OYZA 2UXXB 2CXLA 5L3EB 3HKBE 3CVRA 3PUSA 5DQWA 3HKCE 3Q9DA 3K3OA 3ZJ1A 3C4ZA 3CX6B 5JRCB 5M4YA 4B6XA 2WBLA 3MXZA 3N9MA 3FB2A 4WW0A 1QUUA 3O1IA 4Z8XA 3U3IA 4O4JE 5LNKA 4I55E 3VKGA 1MMDA 4XBFB 2KZ7B 1YW0A 3UFEA 3HI2A 3OJAA 3ZLIA 1U4QA 3EVYA 4ZI2C 1BR0A 2PFVA 1YD8G 5L3GB 3I1AA 3KINB 3NBXX 1ZV4X 2W63A 3AA6B 1UX4A 2D2SA 2XAGB 4UF0B 3MKDA 2BVMA 1E1HB 1HG2A 3KV6A 1V9DA 1ZHCA 4C90A 4L5GA 4YLHA 3Q2MA 4PK4A 3N9PA 3EDUA 4MBQA 3J9X1 3UTKA 4EB6E 4HE8A 3N2GE 2LHRA 5LG4A 4KUMB 2HH7A 5KMGP 3E08A 3FXEB 5L3DB 2X9XA 2V7LA 4UV8B 3RC8A 4YHJA 1VOMA 5EZYE 3WI3A 4M1PA 3ZMTB 3I0OA 3KBUA 4L9IA 5FY1A 4QWNB 1O3XA 2D5UA 4PJNA 5LGUB 1WYBA 3PUAA 4X1IE 4CXXA 5JR9B 1HX8A 3RRWA 2MOZA 3I9WA 5JREA 2YEVC 5HAXA 3LG7A 2Q9QD 4TX5A 4ZI3D 2EHOC 4PFOA 2V7KA 5ETWA 4AQFC 2C5IT 2CEAA 2VB6A 3ZYLA 4E7SA 3ANWA 3ZMVB 3HKEE 3PTRB 4IE6A 4O2BE 5LGNB 3W15B 5IYZE 2WWUA 4AKRB 4UELA 3M65A 4FJOA 2XHEB 1H7CA 1D0YA 2ES0A 3RYHE 5HWYA 4YFSA 4AKLA 4PNIA 3RYCE 5L3FB 2NWBA 4GK0E 1MMGA 4DVDA 5FXXA 5LXTE 5JDNA 2LE8A 3AVRA 2X68A 3AB3B 2ZLYA 2LOSA 3GN5B 3SOLA 5CA1E 4H9NC 2CWYA 5JVDE 5LCYA 4E7ZA 1FMWA 2LOPA 3ZCJA 2LT3A 3AAAB 3UULA 4ZOLE 3N9LA 2CMRA 2E9XC 4AXPA 4A56A 1HS7A 3HA4A 5LHGB 3C50A 2Q9QC 4OFZA 4N78D 4H63H 4OK0A 2EHOB 3O4XE 2RP4A 5ADXL 3IF8B 5L3BB 3B13A 2VKJA 2X0LB 2L8KA 3EDVA 1MIVA 4OYKA 3L09A 5J2TE 2NTXA 4J2CA 3EUHA 2CE7A 3RX6A 4TUYE 4CZZB 2JRKA 3E22E 2HPJA 3ETVA 1G8XA 4H9PC 3CX7B 3IHRA 5LHHB 2DNXA 3CQGB 3S4UA 3K8PC 4IE5A 2X9YA 5LA6E 3RC3A 1VRBA 1NAFA 2KXPB 3BK9A 4UVAB 4BJNA 3CQCB 4GOUA 3RRCA 4BJMA 4K0UA 1SA0E 1FIOA 4TV8E 2PBIA 4H9RC 1IAPA 2DCFA 2XAHB 1LVFA 2X9WA 2NOXA 4UV9B 4QX7B 1HG5A 4IE7A 4WNKA 4ZS2A 3DP7A 3ZC0A 2A72A 3PU3A 3Q5WA 5H6RB 5LHIB 2W62A 2N9DA 3FHNA 3A5XA 1MIYA 3C51A 4H9OC 4EYYR 5HXHA 4X20E 3R84B 1LKXA 2K24A 2DI4A 2ZM0A 4X1YE 4MHCA 2NW9A 4ZS3A 4MFRA 5JRCA 3IEEA 4I43B 5AFUL 5H6QB 4FI5A 3OYXA 3QC9A 3ZJ2A 4O4HE 2GK9A 3KV4A 2CCQA 4HEAA 4QXCB 4PFPA 2NW8A 1U5PA 2ODUA 2P9BA 1MMNA 1WYCA 3N9QA 1KK7A 3HKDE 3CWZB 4GYRA 4QHOA 4QXHB 4UF0A 2WM9A 3C64A 3H37A 1OWAA 4G2AA 3OBVE 1NWMX 4UEMA 4UIGA 4NUVA 4EAHA 3UUNA 1YKEB 1EZ3A 4PJJA 3P8CD 2SPCA 2XQYA 4AQGA 2V7IA 4ADZA 5BMVE 3KV9A 4WBNE 3NRYA 5LYJE 2VKHA 3ZMSB 5E0OA 4XZCA 1CUNA 3NZPA 3T8OA 2W00A 5JDGA 2H3RA 2CWOA 5JR9A 3GMIA 3KDSE 5JDMA 2CM0A 4CQIA 4EYUA 2IAKA 2LM9A 4ANJA 2LEHA 2NTYA 5FXVA 4EZHA 4OYJA 2X67A 3I0QA 2JMKA 4CXWA 2LSKA 5FXWA 3LK42 1WRDA 4XAXB 3D0TA 3F57A 1WR6A 2ACXA 4IDZA 4TZ4C 4EZ4A 4ASKA 1D0XA 5FP3A 3PDYA 1UX5A 2BVLA 2KNDA 4YJ2E 2B1EA 1LVKA 5FXZA 1HF8A 3RYIE 1HFAA 3I9YA 4CI2B 1BR2A 3K3NA 2WAUA 1UCUA 5DABA 5F8PA 5C8YE 5LOVE 3C98B 4DMVA 2W0GA 3MA9A 3PURA 3AA1B 5EK4A 4P0AA 4ZHQE 4O4IE 5DQVA 3GN5A 3BQLA 2X51A 4ZI3C 5JDHA 2PG8A 2VWAA 3LK3B 5FMNA 2I59A 1FMVA 5JDQA 2IW5B 5HYAA 2YU2A 4UVBB 3ZYKA 3QUJA 2D0TA 2XTLA 1HCIA 2LJLA 2M67A 2A3DA 4IGUA 3V5UA 3RYFE 4PJMA 2Y8DA 3BQKA 2Y6XA 5LJMA 3QK6A 1IJ6A 2Y48B 2EHOA 3PE0A 3ZCIA 1YKHB 1T98A 1Z0PA 3HR0A 4HFVA 4JEUB 3ZN0B 4AQFA 3ONXA 2VKDA 2W61A 4ISTA 3VKHA 3CX8B 3KBTA 3PUQA 3ZMUB 4KMCA 4I4TE 2J1DG 2XAFB 4AKGA 5J2UE 3SWHA 4ZI2D 3DJBA 4H9QC 4X1KE 3H3AA 3UT5E 2MYSA 4HTEA 3SRZA 3LBXB 4EIWA 2JJ9A 1HTJF 1FEWA 2G0UA 5TAOA 2CLYC 2N2NA 3AAIA 4KBMB 2LSGA 3N2OA 5HXSA 5J1GA 5A1LA 4P09A 5EK3A 4O2AE 4BAYB 2E9XB 3PUGA 2LSJA 2C5JA 2CXDA 4U74A 3VU7H 2DWGA 5HWXA 4YJ3E 4JEHB 4TV9E 3N9NA 3VHLA 5CA0E 2Q9QB 1MMAA 2VK9A 4MLKA 1MIWA 3AA7B 2V7JA 2K48A 5IHYA 2K9AA 4HGAA 4JUYA 1KNZA 2E9XA 4QKNA 3RPUA 3L3PA 3NRXA 1S94A 3MJXA 4ILUA 5LBMA 4CI3B 1MNEA 2EHOD 3BQIA 3E0ZA 2Q9QA 5JDFA 2LHNA 2PJQA 3CPZA 3CKDA 4AKHA 3ESLA 3Q5XA 2MTQA 1ZKEA 3R6NA 2ODVA 3ZYMA 3OKQA 2Z6EA 2XAJB 2IC9A 1ZEEA 2XAQB 3AAEB 4HN9A 2VASA 2X66A 4PJLA 2NW7A 2VKOA 2YK0A 5JH7E 4ERRA 2RA1A 2N1GA 5FYMA 5HXCA 3U78A 4IHJE 3WAJA 2XUEA 1B7TA 3GA8A 2H7VC 3JC6D 3MZKB 2DHRA 1WLXA 2JQQA 3ETUA 4GYSA 4GIWA 2YINA 3AA0B 2ZMAA 2CLYB 4G63A 2D0UA 2YU1A 2JMHA 3FBLA 2XASB 3NZQA 1G73A 1D1AA 2CA5A 3CQXC 4NUUA 4PW8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2D5U A;  2HPL A;  2HPJ A;  5LJM A;  5LJN A;  4OYK A;  4P0A A;  4JUY A;  2CCQ A;  4P09 A;  4P0B A;  2CM0 A;  4OYJ A; 
#chains in the Genus database with same CATH topology
 1KNR A;  2BKN A;  2DWK A;  1AJ3 A;  5BR8 T;  3O1J A;  1OED C;  3B57 A;  1OXZ A;  2PTF A;  3K3Q C;  2BS2 A;  1D0Z A;  4HWC A;  1BR4 A;  2WZH A;  4AKI A;  5LB7 B;  3SS1 A;  4HFI A;  3JAD A;  2L9Q A;  2XQ9 A;  4PAG A;  3KVB A;  1MND A;  3KV5 A;  3RKO A;  4DO0 A;  3CML A;  2KLQ A;  5LJN A;  1UK5 A;  3LFM A;  5FVL A;  2NP9 A;  5AQU B;  4DND A;  2XQ5 A;  2V7M A;  2OLT A;  2ZM2 A;  4P0B A;  3ZT7 A;  3P4W A;  3C4W A;  3FBZ A;  3NWI A;  4JI1 T;  4TNV A;  4GKK T;  2L3L A;  2WMN A;  1QSD A;  4EOZ B;  5C3J A;  4C91 A;  4JI0 T;  2C0S A;  4O8S A;  4QX8 B;  3LBX A;  2KWI B;  2WMO A;  1D1C A;  3IBP A;  2CXL A;  3PUS A;  2FJE A;  3AEB A;  1Z8U A;  5JRC B;  5M4Y A;  5FKY A;  2WBL A;  2HN2 A;  3FB2 A;  4WW0 A;  1QUU A;  3O1I A;  4I55 E;  1MMD A;  3ZLI A;  4B3R T;  3LSV A;  1E7P A;  1BR0 A;  1YD8 G;  4AQY T;  2XJ7 A;  3RQU A;  2W63 A;  1UX4 A;  2D2S A;  2XAG B;  3ONJ A;  2BVM A;  4P1N A;  4IT4 A;  5HEU A;  3KV6 A;  4YLH A;  4ILB A;  2HHH T;  2LHR A;  2HH7 A;  3FXE B;  2X9X A;  2V7L A;  4UV8 B;  3WI3 A;  1KEY A;  3ZMT B;  2JQK A;  4L9I A;  3PUA A;  4CXX A;  4HFB A;  2MOZ A;  2UXC T;  3LG7 A;  4YHH T;  2H88 A;  2V7K A;  1E2A A;  5ABH A;  2C5I T;  2CEA A;  4E7S A;  3PTR B;  3PV0 F;  4X5T A;  1W9R A;  4FJO A;  1H7C A;  5HWY A;  3AE8 A;  3RYC E;  4GK0 E;  3RIA A;  4HFC A;  2ZLY A;  3RHW A;  5LCY A;  2FUP A;  2QRX A;  3AAA B;  5AQI B;  4EEB A;  4ZOL E;  4AXP A;  3PUW F;  1JNR A;  5LHG B;  3VR9 A;  5L47 A;  1SE7 A;  1I94 T;  4EED A;  2XQ6 A;  5FL1 A;  2RPA A;  4OYK A;  4J2C A;  1G8X A;  3CX7 B;  3QNU A;  2IML A;  4IE5 A;  1XNR T;  3CQC B;  3RRC A;  4TV8 E;  1IAP A;  2XAH B;  1XMO T;  1LVF A;  4HWH A;  1UUR A;  4UV9 B;  2V8S V;  4ZS2 A;  3DP7 A;  3ZC0 A;  3Q5W A;  5LHI B;  2N9D A;  3C51 A;  2ZM0 A;  3VRA A;  4ZS3 A;  4KI0 F;  4MFR A;  5H6Q B;  4NIQ A;  3QC9 A;  3ZJ2 A;  4O4H E;  5ABE A;  3PUY F;  2CBI A;  3AEC A;  3AXJ A;  1CHU A;  2ODU A;  2P9B A;  1XDO A;  4QHO A;  4X66 T;  2WDR A;  2ACZ A;  4YSY A;  5L4E A;  3OBV E;  1NWM X;  4CN6 A;  2SPC A;  3KV9 A;  2IDO B;  4XZC A;  1CUN A;  4DID B;  2CWO A;  3UU8 A;  4CQI A;  2IAK A;  1ZP0 A;  2LEH A;  2NTY A;  4OYJ A;  5LMU T;  1WRD A;  2XM1 A;  4A5X A;  1W09 A;  2M6B A;  5AQN B;  1WR6 A;  4EZ4 A;  4U7Y A;  3PDY A;  4YJ2 E;  5FXZ A;  1YQ4 A;  4CN4 A;  5AQT B;  4CI2 B;  1I6Z A;  2BG9 A;  3GN5 A;  2X51 A;  4ZI3 C;  5JDH A;  3LK3 B;  4IDO A;  2XQ4 A;  5FMN A;  2AE9 A;  2IW5 B;  2D0T A;  3RF1 A;  1Y01 A;  2EHO A;  1T98 A;  4JEU B;  3KBT A;  4QH1 A;  4I4T E;  4DR6 T;  4ZZB A;  4CN1 A;  2YDS A;  3DJB A;  2MYS A;  2V6Y A;  2J47 A;  3SRZ A;  1HTJ F;  4KBM B;  4I0U A;  2FBW A;  5A1L A;  4O2A E;  2E9X B;  5CA0 E;  3VHL A;  2Q9Q B;  1MMA A;  2VK9 A;  4DV0 T;  2LRL A;  2K48 A;  3ZT6 A;  2E9X A;  4QKN A;  2YDR A;  3RPU A;  4CI3 B;  1S94 A;  4ILU A;  5LBM A;  1MNE A;  2EHO D;  2Q9Q A;  5JDF A;  4GKJ T;  1IBK T;  3CPZ A;  2HN1 A;  5HCJ A;  3ESL A;  2MTQ A;  1XNQ T;  2VQF T;  2X66 A;  2NW7 A;  2YK0 A;  5CJ5 A;  3WAJ A;  1B7T A;  3L8R A;  1WLX A;  2R6G F;  2YIN A;  2XQ8 A;  3AE9 A;  2D0U A;  1D1A A;  3LJC A;  5L2L A;  2E9X D;  3ANW B;  4DMW A;  2E8I A;  3ZC1 A;  4ILC A;  5HXR A;  2JPF A;  4KHP T;  4YTM A;  4CI1 B;  2E5V A;  2QVA A;  1NEK A;  4CXY A;  3HL6 A;  4ISS A;  4PK6 A;  2NR4 A;  2XY8 B;  1US7 B;  3P4S A;  3MK7 C;  4GK5 E;  4I50 E;  3P7I A;  3UUM A;  4BA9 A;  4DV2 T;  1IZN B;  4UVC B;  2WDQ A;  2CHO A;  2UUC T;  4UXN B;  2BBH A;  5EK2 A;  3T1Y T;  2IC6 A;  1IJ5 A;  2ZM8 A;  4JLE A;  2UU9 T;  2LSY A;  5FNV E;  2WB5 A;  5AQK B;  1SHZ C;  5GON E;  2I0M A;  2MPK A;  3V5S A;  4IIJ E;  4L0R A;  1L0V A;  1J5E T;  3AVS A;  4PK5 A;  3DTO A;  4EXT A;  3PU8 A;  5LP6 E;  2OA5 A;  3AE6 A;  2MBG A;  5JTG A;  2VL8 A;  4TWH A;  3P4Q A;  3C4X A;  3MAC A;  5JR9 C;  2QGS A;  3LK2 B;  3ZEF B;  4NXN T;  3HKC E;  3C4Z A;  4B6X A;  3ZST A;  3VR8 A;  1NEN A;  1UGO A;  4HWI B;  3U3I A;  4O4J E;  4XBF B;  2MAW A;  1YW0 A;  3UFE A;  3HI2 A;  4B3S T;  1T72 A;  3EVY A;  4ZI2 C;  3I1A A;  3AA6 B;  3ABV A;  1HG2 A;  1V9D A;  4YXD A;  1XMQ T;  2X0H A;  3Q2M A;  3UTK A;  3EDU A;  3RLF F;  4YHJ A;  1VOM A;  5EZY E;  2BBJ A;  3KBU A;  5FY1 A;  5HEG A;  5LGU B;  1HX8 A;  3I9W A;  2XM2 A;  5AQR B;  5HAX A;  4B3M T;  4TX5 A;  3QOF A;  5ETW A;  4IDN A;  2VB6 A;  3ZYL A;  3ZMV B;  5LGN B;  4UEL A;  2XHE B;  5FL0 A;  2LE8 A;  3AVR A;  3AB3 B;  5CA1 E;  2CWY A;  4E7Z A;  1FMW A;  2LT3 A;  5AQS B;  3N9L A;  4JYA T;  1HS7 A;  3OTO T;  3O4X E;  1YQ3 A;  3RQW A;  3RX6 A;  4CZZ B;  2JRK A;  3E22 E;  4H9P C;  5LHH B;  3RI5 A;  4JI4 T;  2DNX A;  3S4U A;  5IWA T;  3K8P C;  4K0U A;  4DR3 T;  3RIF A;  2PBI A;  4H9R C;  2X9W A;  2NOX A;  1HG5 A;  4IE7 A;  4U2Y A;  5HCM A;  5H6R B;  4YSZ A;  2W62 A;  4H9O C;  4EYY R;  5HXH A;  1LKX A;  2K24 A;  4MHC A;  5AQL B;  5JRC A;  3IEE A;  4I43 B;  3PJA J;  2WP9 A;  2LM2 A;  1U5P A;  1N33 T;  1KK7 A;  3UQ7 A;  4QXH B;  3C64 A;  4UIG A;  4EAH A;  3UUN A;  1YKE B;  3P8C D;  2XQY A;  4AQG A;  2UXD T;  4HFE A;  4F8H A;  5BMV E;  4WBN E;  5LYJ E;  3ZMS B;  5E0O A;  5AQQ B;  4AIS A;  2WDV A;  3NZP A;  2W00 A;  3GMI A;  4YT0 A;  2CM0 A;  3PUX F;  3PUZ F;  5HEJ A;  5FXV A;  1VCT A;  2JMK A;  4CXW A;  4XAX B;  3F57 A;  2ACX A;  3RGL A;  3FZL B;  4ASK A;  2KND A;  2B1E A;  1HFA A;  3I9Y A;  2WAU A;  5C8Y E;  4DUY T;  3C98 B;  4DMV A;  3MA9 A;  3AA1 B;  4P0A A;  2XQ3 A;  5DQV A;  5AQO B;  3BQL A;  2PG8 A;  2J62 A;  3UU5 A;  4UVB B;  5AQF B;  2XTL A;  2M67 A;  1HCI A;  2LJL A;  2A3D A;  3V5U A;  3RYF E;  2Y6X A;  5L4H A;  3K1S A;  2Y48 B;  1XWM A;  1Z0P A;  4DV6 T;  4LML A;  4AQF A;  2VKD A;  2W61 A;  2BG9 E;  3VKH A;  3PUQ A;  3ZMU B;  2J1D G;  2XAF B;  5J2U E;  4H9Q C;  1IBM T;  3H3A A;  2JJ9 A;  1FEW A;  2CLY C;  3AAI A;  2LSG A;  3N2O A;  4P09 A;  4DV1 T;  4BAY B;  2C5J A;  2CXD A;  3AE2 A;  2DWG A;  4IDP A;  4TV9 E;  4AIU A;  3EHZ A;  2V7J A;  5IHY A;  3CK6 A;  3MJX A;  3NKZ A;  1HNW T;  3AE5 A;  1T8B A;  3A8Y C;  2PJQ A;  2BKO A;  2XAJ B;  3AAE B;  4HN9 A;  2WU2 A;  2VKO A;  5JH7 E;  3QB5 A;  2XUE A;  3JC6 D;  2H7V C;  2DHR A;  4A97 A;  4GIW A;  1WR0 A;  5CFB A;  2FJB A;  2JMH A;  3T1H T;  1G73 A;  3CQX C;  4PW8 A;  1BR1 A;  2K3W A;  4WBO A;  1KFY A;  2BKP A;  2DL1 A;  4JV5 T;  1S35 A;  2QA7 A;  1HNZ T;  4DR4 T;  2CXF A;  2V1D B;  5JQG E;  3RH3 A;  3N9O A;  2X9H A;  4IE4 A;  1Y64 B;  3ZN1 B;  2V26 A;  4MAL A;  3ZT5 A;  1T7S A;  2WQY A;  2UXB T;  5FY7 A;  4X64 T;  2KT9 A;  3Q5E A;  2BZB A;  3JC6 C;  4Z91 A;  4DR7 T;  1HNX T;  1QLB A;  3O1H A;  4AI6 A;  3AEF A;  5FY0 A;  4ZEY A;  3KFW X;  4TN7 B;  2UXN B;  4YSX A;  5JDL A;  5KX5 E;  2KSR A;  2DLR A;  5CGM A;  2E2A A;  4QXB B;  4V1A v;  4JI3 T;  3CIR A;  2KWH A;  4EGW A;  5F3J A;  3N5L A;  4LFC T;  4OHF A;  3FXD B;  3N2K E;  5DJQ C;  4DV7 T;  3AE7 A;  3ZMZ B;  3TKL B;  4LF7 T;  5LGT B;  1FJG T;  4DBR A;  3HKB E;  5DQW A;  3Q9D A;  3K3O A;  3CX6 B;  4LF6 T;  1KF6 A;  3VKG A;  4LFB T;  4IRE A;  2KZ7 B;  3TLV A;  4HWF A;  3NBX X;  4JI2 T;  4UF0 B;  3MKD A;  1E1H B;  2BG9 C;  2WS3 A;  4C90 A;  4EB6 E;  3J9X 1;  4HE8 A;  5LG4 A;  5KMG P;  3E08 A;  3I0O A;  2LRK A;  2FJD A;  4QWN B;  2D5U A;  5JR9 B;  3RRW A;  4U3C A;  2YEV C;  2Q9Q D;  2EHO C;  3TLT A;  3ANW A;  2LKG A;  3AE3 A;  3HKE E;  3UUB A;  2ZM6 T;  3RIU A;  3AEE A;  4AKR B;  2M6I A;  1D0Y A;  2ES0 A;  2IIU A;  4YFS A;  4PNI A;  4DR2 T;  5L3F B;  1MMG A;  5FXX A;  1N32 T;  5LXT E;  4U2Z A;  5JDN A;  2X68 A;  4H9N C;  5JVD E;  3VRB A;  2D9D A;  2LOP A;  3ZCJ A;  2VL0 A;  2CMR A;  2E9X C;  5AQG B;  4A56 A;  3C50 A;  1OED B;  2Q9Q C;  2XSB A;  1J1J A;  4H63 H;  5ADX L;  5L3B B;  3B13 A;  4YTP A;  4Z90 A;  1OED A;  2I6H A;  3L09 A;  4U33 A;  4TWF A;  5FVK A;  3EAB A;  3CQG B;  2CRB A;  2X9Y A;  3BK9 A;  5AQH B;  4UVA B;  4BJN A;  2WCA A;  4GOU A;  4BJM A;  4IL4 A;  4NPP A;  2DCF A;  4DR1 T;  1HR0 T;  4WNK A;  3PU3 A;  1SUM B;  3AEA A;  5AQM B;  4U31 A;  4LF5 T;  4A98 A;  4X20 E;  5KXJ A;  2CBJ A;  3RIU C;  4FI5 A;  3EI0 A;  4PFP A;  1IBL T;  1WYC A;  3N9Q A;  3HKD E;  3CWZ B;  4GYR A;  4WYV A;  4IL9 A;  3H37 A;  4WZX A;  3UQ4 A;  4PJJ A;  3P4P A;  2V5D A;  2V7I A;  4ADZ A;  5HEH A;  4JBW F;  5JDG A;  5JDM A;  2LM9 A;  4ANJ A;  4EZH A;  2X67 A;  1J5W A;  2LSK A;  5FXW A;  3LK4 2;  2W2U A;  3D0T A;  4IDZ A;  5AQJ B;  2YOE A;  1UX5 A;  2BVL A;  3FZH B;  1LVK A;  1R8I A;  1HF8 A;  1BR2 A;  1UCU A;  3AED A;  1UUS A;  2YN6 A;  1WCR A;  5LOV E;  2W67 A;  1W0A A;  2W0G A;  3TLU A;  5EK4 A;  4DUZ T;  4ZHQ E;  5AQP B;  4YY3 T;  1XZY A;  2VVS A;  4LFA T;  3LDQ B;  2VUR A;  1IJ6 A;  3PE0 A;  3ZCI A;  1YKH B;  1XDP A;  3ZN0 B;  3B5M A;  3UU3 A;  3SWH A;  3UT5 E;  4B3T T;  4HTE A;  3LBX B;  4EIW A;  2UUB T;  2UUA T;  2G0U A;  5TAO A;  2N2N A;  5J1G A;  3M3Z B;  1VCS A;  3N9N A;  4MLK A;  4HGA A;  4JUY A;  1KNZ A;  1N36 T;  3BQI A;  3E0Z A;  2LHN A;  3ZKR A;  2ODV A;  3P50 A;  2V6X A;  2VAS A;  2RA1 A;  3U78 A;  4IHJ E;  3GA8 A;  3MZK B;  2JQQ A;  3ETU A;  4GYS A;  1W0B A;  2XPK A;  3AA0 B;  2CLY B;  2XAS B;  3NZQ A;  2CA5 A;  4NUU A;  5AFU L;  3X1D A;  4DBQ A;  3SFD A;  4LF8 T;  2HPL A;  2WSS V;  5HXE A;  4ZI7 E;  5KDM C;  2BS3 A;  5CB4 E;  5LMN T;  2KMF A;  1LRZ A;  3J7Y q;  4H63 V;  3WAK A;  4EV6 A;  3F2E A;  2AXD S;  2WU5 A;  2XQ7 A;  5LBQ B;  4TNW A;  5L3C B;  3UUX B;  3ZPO A;  1X79 A;  1X9B A;  3A7M A;  4F6R C;  4JI5 T;  3O9X A;  1D1B A;  4X62 T;  2VQE T;  1WFD A;  2LSI A;  3F31 A;  4U72 A;  2C5K T;  5F5W A;  3GWH A;  4O4L E;  3FZM B;  2H7O A;  2H89 A;  2LKH A;  4KP3 C;  2A2F X;  1M62 A;  2W4X A;  2K5B B;  4HKA A;  2BDE A;  2KIN B;  4QH4 A;  4H9S E;  3H3M A;  5J0Z A;  3KVA A;  4IE0 A;  5AQV B;  3OYZ A;  2UXX B;  2XSA A;  5L3E B;  3TLW A;  3CVR A;  4U7I A;  3ZJ1 A;  4LF4 T;  5ABF B;  3QB5 K;  1KNP A;  3MXZ A;  2V5C A;  3ZSS A;  3N9M A;  4Z8X A;  3AXJ B;  5LNK A;  3OJA A;  1U4Q A;  2PFV A;  4HFH A;  5ABF A;  5L3G B;  3KIN B;  1ZV4 X;  4IDQ A;  3JCF A;  4LF9 T;  1ZHC A;  4L5G A;  4PK4 A;  3N9P A;  4MBQ A;  4JI6 T;  3AE4 A;  2YDQ A;  3N2G E;  4KUM B;  3PJA A;  5L3D B;  3RC8 A;  4M1P A;  4OX9 T;  1O3X A;  4PJN A;  1WYB A;  4X1I E;  2JQH A;  5JRE A;  4DR5 T;  4ZI3 D;  4PFO A;  3G06 A;  1JNZ A;  4AQF C;  4IE6 A;  3W15 B;  2CPT A;  5IYZ E;  2WWU A;  3M65 A;  5IUX A;  3UU6 A;  3RYH E;  4AKL A;  4COF A;  2IUB A;  2NWB A;  3AEG A;  4DVD A;  2OV9 A;  2BG9 B;  2LLY A;  2B76 A;  2LOS A;  3GN5 B;  3SOL A;  4DV5 T;  3UUL A;  3PUV F;  3HA4 A;  1GQE A;  1YXR A;  4OFZ A;  4N78 D;  4OK0 A;  2EHO B;  2JIW A;  2RP4 A;  4UR9 A;  3IF8 B;  2VKJ A;  2X0L B;  2L8K A;  3EDV A;  1MIV A;  5J2T E;  2NTX A;  3EUH A;  2CE7 A;  4TUY E;  2HPJ A;  3ETV A;  2V6Y B;  3IHR A;  5LA6 E;  3RC3 A;  1VRB A;  1NAF A;  2KXP B;  5LG3 A;  1HX1 B;  1SA0 E;  2CHN A;  4JI8 T;  1FIO A;  4KHZ F;  1OED E;  4QX7 B;  3L39 A;  2A72 A;  3FHN A;  3A5X A;  1MIY A;  3UU4 A;  3R84 B;  2DI4 A;  2E5L T;  3NVO A;  4X1Y E;  2NW9 A;  3IA3 A;  3OYX A;  2X0Y A;  3Q5D A;  4ZXL A;  2GK9 A;  1N34 T;  3KV4 A;  2CCQ A;  4HEA A;  4QXC B;  2NW8 A;  1MMN A;  3SFE A;  4HFD A;  4UF0 A;  2WM9 A;  5ABG A;  1OWA A;  2BS4 A;  4G2A A;  4UEM A;  4NUV A;  1EZ3 A;  3EAM A;  5C2T A;  2WWV A;  3OPC A;  4NXM T;  2F4V T;  3NRY A;  2J4G A;  2VKH A;  2YKS A;  3T8O A;  2H3R A;  5JR9 A;  3KDS E;  3FZF B;  3JAF A;  2VVN A;  4EYU A;  4DV3 T;  3I0Q A;  2A9U A;  3JAE A;  3UFG A;  4TZ4 C;  2XZE A;  1D0X A;  2QYW A;  5FP3 A;  3P4R A;  3RYI E;  4ZZC A;  3K3N A;  5DAB A;  5F8P A;  3PUR A;  4O4I E;  4TWD A;  3OVU A;  2VWA A;  4X65 T;  2I59 A;  1FMV A;  5JDQ A;  5HYA A;  2YU2 A;  3ZYK A;  3QUJ A;  4Q25 A;  4IGU A;  4PJM A;  2Y8D A;  3BQK A;  5LJM A;  3QK6 A;  4DV4 T;  4HFV A;  3HR0 A;  3ONX A;  4IST A;  2JQ9 A;  4ILA A;  3CX8 B;  2WY2 A;  4KMC A;  4AKG A;  4ZI2 D;  4X1K E;  2WZI A;  2W66 A;  1ZOY A;  3TLS A;  5HXS A;  5HEO A;  4LMK A;  5EK3 A;  3PUG A;  2LSJ A;  4U74 A;  3VU7 H;  5HWX A;  4YJ3 E;  4K0K T;  4JEH B;  1MIW A;  2IHR 1;  3AA7 B;  1M7K A;  2K9A A;  4QH5 A;  3L3P A;  3NRX A;  3AE1 A;  2XQA A;  3CKD A;  4AKH A;  3Q5X A;  4HWD A;  1ZKE A;  3R6N A;  3ZYM A;  3OKQ A;  4JI7 T;  2Z6E A;  2IC9 A;  1ZEE A;  2XAQ B;  4PJL A;  4ERR A;  2N1G A;  5FYM A;  5HXC A;  3ONL C;  4YTN A;  3RKG A;  4KX6 A;  2FJA A;  4LMJ A;  2ZMA A;  4G63 A;  2YU1 A;  1DU2 A;  3FBL A;  3FZK B;  4O2B E; 
#chains in the Genus database with same CATH homology
 1BR1 A;  3LJC A;  5L2L A;  2DWK A;  1AJ3 A;  4WBO A;  2E9X D;  3ANW B;  4DMW A;  2E8I A;  3O1J A;  3ZC1 A;  3B57 A;  1OXZ A;  1S35 A;  2QA7 A;  5HXR A;  2JPF A;  4DBQ A;  2CXF A;  2V1D B;  2HPL A;  2WSS V;  5HXE A;  4CI1 B;  5JQG E;  3RH3 A;  4ZI7 E;  5KDM C;  3N9O A;  3K3Q C;  4CXY A;  2X9H A;  4IE4 A;  1D0Z A;  1Y64 B;  1BR4 A;  3HL6 A;  5CB4 E;  3ZN1 B;  2V26 A;  4AKI A;  4MAL A;  3SS1 A;  4ISS A;  2KMF A;  4PK6 A;  2L9Q A;  1LRZ A;  3J7Y q;  5FY7 A;  4PAG A;  4H63 V;  2KT9 A;  1MND A;  1US7 B;  3KVB A;  3MK7 C;  2BZB A;  3JC6 C;  3KV5 A;  3WAK A;  3F2E A;  4GK5 E;  3RKO A;  4I50 E;  3P7I A;  3UUM A;  4BA9 A;  4DO0 A;  1IZN B;  3CML A;  4UVC B;  2KLQ A;  3O1H A;  4AI6 A;  5FY0 A;  5LJN A;  3LFM A;  5LBQ B;  2NP9 A;  4DND A;  4UXN B;  5L3C B;  3KFW X;  3UUX B;  5EK2 A;  4TN7 B;  2UXN B;  2IC6 A;  2V7M A;  3ZPO A;  2ZM2 A;  1X79 A;  4P0B A;  5JDL A;  5KX5 E;  1IJ5 A;  2ZM8 A;  4F6R C;  4JLE A;  3O9X A;  2LSY A;  5FNV E;  3C4W A;  1SHZ C;  3FBZ A;  1D1B A;  2DLR A;  5GON E;  4QXB B;  4V1A v;  2LSI A;  3F31 A;  3V5S A;  4U72 A;  2L3L A;  2WMN A;  2C5K T;  1QSD A;  4EOZ B;  4IIJ E;  3GWH A;  4L0R A;  2KWH A;  4O4L E;  3AVS A;  4PK5 A;  2H7O A;  3DTO A;  4C91 A;  4EXT A;  3PU8 A;  5F3J A;  4KP3 C;  3N5L A;  5LP6 E;  2A2F X;  2OA5 A;  2K5B B;  4OHF A;  3FXD B;  2C0S A;  4O8S A;  4HKA A;  2MBG A;  3N2K E;  4QX8 B;  5DJQ C;  2VL8 A;  3LBX A;  2BDE A;  2KIN B;  2KWI B;  2WMO A;  4H9S E;  3ZMZ B;  3C4X A;  3MAC A;  5JR9 C;  3TKL B;  2QGS A;  1D1C A;  3KVA A;  5LGT B;  4IE0 A;  3LK2 B;  3ZEF B;  3IBP A;  4DBR A;  3OYZ A;  2UXX B;  2CXL A;  5L3E B;  3HKB E;  3CVR A;  3PUS A;  5DQW A;  3HKC E;  3Q9D A;  3K3O A;  3ZJ1 A;  3C4Z A;  3CX6 B;  5JRC B;  5M4Y A;  4B6X A;  2WBL A;  3MXZ A;  3N9M A;  3FB2 A;  4WW0 A;  1QUU A;  3O1I A;  4Z8X A;  3U3I A;  4O4J E;  5LNK A;  4I55 E;  3VKG A;  1MMD A;  4XBF B;  2KZ7 B;  1YW0 A;  3UFE A;  3HI2 A;  3OJA A;  3ZLI A;  1U4Q A;  3EVY A;  4ZI2 C;  1BR0 A;  2PFV A;  1YD8 G;  5L3G B;  3I1A A;  3KIN B;  3NBX X;  1ZV4 X;  2W63 A;  3AA6 B;  1UX4 A;  2D2S A;  2XAG B;  4UF0 B;  3MKD A;  2BVM A;  1E1H B;  1HG2 A;  3KV6 A;  1V9D A;  1ZHC A;  4C90 A;  4L5G A;  4YLH A;  3Q2M A;  4PK4 A;  3N9P A;  3EDU A;  4MBQ A;  3J9X 1;  3UTK A;  4EB6 E;  4HE8 A;  3N2G E;  2LHR A;  5LG4 A;  4KUM B;  2HH7 A;  5KMG P;  3E08 A;  3FXE B;  5L3D B;  2X9X A;  2V7L A;  4UV8 B;  3RC8 A;  4YHJ A;  1VOM A;  5EZY E;  3WI3 A;  4M1P A;  3ZMT B;  3I0O A;  3KBU A;  4L9I A;  5FY1 A;  4QWN B;  1O3X A;  2D5U A;  4PJN A;  5LGU B;  1WYB A;  3PUA A;  4X1I E;  4CXX A;  5JR9 B;  1HX8 A;  3RRW A;  2MOZ A;  3I9W A;  5JRE A;  2YEV C;  5HAX A;  3LG7 A;  2Q9Q D;  4TX5 A;  4ZI3 D;  2EHO C;  4PFO A;  2V7K A;  5ETW A;  4AQF C;  2C5I T;  2CEA A;  2VB6 A;  3ZYL A;  4E7S A;  3ANW A;  3ZMV B;  3HKE E;  3PTR B;  4IE6 A;  4O2B E;  5LGN B;  3W15 B;  5IYZ E;  2WWU A;  4AKR B;  4UEL A;  3M65 A;  4FJO A;  2XHE B;  1H7C A;  1D0Y A;  2ES0 A;  3RYH E;  5HWY A;  4YFS A;  4AKL A;  4PNI A;  3RYC E;  5L3F B;  2NWB A;  4GK0 E;  1MMG A;  4DVD A;  5FXX A;  5LXT E;  5JDN A;  2LE8 A;  3AVR A;  2X68 A;  3AB3 B;  2ZLY A;  2LOS A;  3GN5 B;  3SOL A;  5CA1 E;  4H9N C;  2CWY A;  5JVD E;  5LCY A;  4E7Z A;  1FMW A;  2LOP A;  3ZCJ A;  2LT3 A;  3AAA B;  3UUL A;  4ZOL E;  3N9L A;  2CMR A;  2E9X C;  4AXP A;  4A56 A;  1HS7 A;  3HA4 A;  5LHG B;  3C50 A;  2Q9Q C;  4OFZ A;  4N78 D;  4H63 H;  4OK0 A;  2EHO B;  3O4X E;  2RP4 A;  5ADX L;  3IF8 B;  5L3B B;  3B13 A;  2VKJ A;  2X0L B;  2L8K A;  3EDV A;  1MIV A;  4OYK A;  3L09 A;  5J2T E;  2NTX A;  4J2C A;  3EUH A;  2CE7 A;  3RX6 A;  4TUY E;  4CZZ B;  2JRK A;  3E22 E;  2HPJ A;  3ETV A;  1G8X A;  4H9P C;  3CX7 B;  3IHR A;  5LHH B;  2DNX A;  3CQG B;  3S4U A;  3K8P C;  4IE5 A;  2X9Y A;  5LA6 E;  3RC3 A;  1VRB A;  1NAF A;  2KXP B;  3BK9 A;  4UVA B;  4BJN A;  3CQC B;  4GOU A;  3RRC A;  4BJM A;  4K0U A;  1SA0 E;  1FIO A;  4TV8 E;  2PBI A;  4H9R C;  1IAP A;  2DCF A;  2XAH B;  1LVF A;  2X9W A;  2NOX A;  4UV9 B;  4QX7 B;  1HG5 A;  4IE7 A;  4WNK A;  4ZS2 A;  3DP7 A;  3ZC0 A;  2A72 A;  3PU3 A;  3Q5W A;  5H6R B;  5LHI B;  2W62 A;  2N9D A;  3FHN A;  3A5X A;  1MIY A;  3C51 A;  4H9O C;  4EYY R;  5HXH A;  4X20 E;  3R84 B;  1LKX A;  2K24 A;  2DI4 A;  2ZM0 A;  4X1Y E;  4MHC A;  2NW9 A;  4ZS3 A;  4MFR A;  5JRC A;  3IEE A;  4I43 B;  5AFU L;  5H6Q B;  4FI5 A;  3OYX A;  3QC9 A;  3ZJ2 A;  4O4H E;  2GK9 A;  3KV4 A;  2CCQ A;  4HEA A;  4QXC B;  4PFP A;  2NW8 A;  1U5P A;  2ODU A;  2P9B A;  1MMN A;  1WYC A;  3N9Q A;  1KK7 A;  3HKD E;  3CWZ B;  4GYR A;  4QHO A;  4QXH B;  4UF0 A;  2WM9 A;  3C64 A;  3H37 A;  1OWA A;  4G2A A;  3OBV E;  1NWM X;  4UEM A;  4UIG A;  4NUV A;  4EAH A;  3UUN A;  1YKE B;  1EZ3 A;  4PJJ A;  3P8C D;  2SPC A;  2XQY A;  4AQG A;  2V7I A;  4ADZ A;  5BMV E;  3KV9 A;  4WBN E;  3NRY A;  5LYJ E;  2VKH A;  3ZMS B;  5E0O A;  4XZC A;  1CUN A;  3NZP A;  3T8O A;  2W00 A;  5JDG A;  2H3R A;  2CWO A;  5JR9 A;  3GMI A;  3KDS E;  5JDM A;  2CM0 A;  4CQI A;  4EYU A;  2IAK A;  2LM9 A;  4ANJ A;  2LEH A;  2NTY A;  5FXV A;  4EZH A;  4OYJ A;  2X67 A;  3I0Q A;  2JMK A;  4CXW A;  2LSK A;  5FXW A;  3LK4 2;  1WRD A;  4XAX B;  3D0T A;  3F57 A;  1WR6 A;  2ACX A;  4IDZ A;  4TZ4 C;  4EZ4 A;  4ASK A;  1D0X A;  5FP3 A;  3PDY A;  1UX5 A;  2BVL A;  2KND A;  4YJ2 E;  2B1E A;  1LVK A;  5FXZ A;  1HF8 A;  3RYI E;  1HFA A;  3I9Y A;  4CI2 B;  1BR2 A;  3K3N A;  2WAU A;  1UCU A;  5DAB A;  5F8P A;  5C8Y E;  5LOV E;  3C98 B;  4DMV A;  2W0G A;  3MA9 A;  3PUR A;  3AA1 B;  5EK4 A;  4P0A A;  4ZHQ E;  4O4I E;  5DQV A;  3GN5 A;  3BQL A;  2X51 A;  4ZI3 C;  5JDH A;  2PG8 A;  2VWA A;  3LK3 B;  5FMN A;  2I59 A;  1FMV A;  5JDQ A;  2IW5 B;  5HYA A;  2YU2 A;  4UVB B;  3ZYK A;  3QUJ A;  2D0T A;  2XTL A;  1HCI A;  2LJL A;  2M67 A;  2A3D A;  4IGU A;  3V5U A;  3RYF E;  4PJM A;  2Y8D A;  3BQK A;  2Y6X A;  5LJM A;  3QK6 A;  1IJ6 A;  2Y48 B;  2EHO A;  3PE0 A;  3ZCI A;  1YKH B;  1T98 A;  1Z0P A;  3HR0 A;  4HFV A;  4JEU B;  3ZN0 B;  4AQF A;  3ONX A;  2VKD A;  2W61 A;  4IST A;  3VKH A;  3CX8 B;  3KBT A;  3PUQ A;  3ZMU B;  4KMC A;  4I4T E;  2J1D G;  2XAF B;  4AKG A;  5J2U E;  3SWH A;  4ZI2 D;  3DJB A;  4H9Q C;  4X1K E;  3H3A A;  3UT5 E;  2MYS A;  4HTE A;  3SRZ A;  3LBX B;  4EIW A;  2JJ9 A;  1HTJ F;  1FEW A;  2G0U A;  5TAO A;  2CLY C;  2N2N A;  3AAI A;  4KBM B;  2LSG A;  3N2O A;  5HXS A;  5J1G A;  5A1L A;  4P09 A;  5EK3 A;  4O2A E;  4BAY B;  2E9X B;  3PUG A;  2LSJ A;  2C5J A;  2CXD A;  4U74 A;  3VU7 H;  2DWG A;  5HWX A;  4YJ3 E;  4JEH B;  4TV9 E;  3N9N A;  3VHL A;  5CA0 E;  2Q9Q B;  1MMA A;  2VK9 A;  4MLK A;  1MIW A;  3AA7 B;  2V7J A;  2K48 A;  5IHY A;  2K9A A;  4HGA A;  4JUY A;  1KNZ A;  2E9X A;  4QKN A;  3RPU A;  3L3P A;  3NRX A;  1S94 A;  3MJX A;  4ILU A;  5LBM A;  4CI3 B;  1MNE A;  2EHO D;  3BQI A;  3E0Z A;  2Q9Q A;  5JDF A;  2LHN A;  2PJQ A;  3CPZ A;  3CKD A;  4AKH A;  3ESL A;  3Q5X A;  2MTQ A;  1ZKE A;  3R6N A;  2ODV A;  3ZYM A;  3OKQ A;  2Z6E A;  2XAJ B;  2IC9 A;  1ZEE A;  2XAQ B;  3AAE B;  4HN9 A;  2VAS A;  2X66 A;  4PJL A;  2NW7 A;  2VKO A;  2YK0 A;  5JH7 E;  4ERR A;  2RA1 A;  2N1G A;  5FYM A;  5HXC A;  3U78 A;  4IHJ E;  3WAJ A;  2XUE A;  1B7T A;  3GA8 A;  2H7V C;  3JC6 D;  3MZK B;  2DHR A;  1WLX A;  2JQQ A;  3ETU A;  4GYS A;  4GIW A;  2YIN A;  3AA0 B;  2ZMA A;  2CLY B;  4G63 A;  2D0U A;  2YU1 A;  2JMH A;  3FBL A;  2XAS B;  3NZQ A;  1G73 A;  1D1A A;  2CA5 A;  3CQX C;  4NUU A;  4PW8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...