5LJMA

Structure of spata2 pub domain
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
215
structure length
203
Chain Sequence
GPMDTKFKDDLFRKYVQFHESSDECLRVAASTLLSLHKVDPFYRFRLIQFYEVVESSLRSLSSSSLRALHGAFSMLETVGINLFLYPWKKEFRSIKTYTGPFVYYVKSTLLEEDIRAILSCMGYTPELGTAYKLRELVETLQVKMVSFELFLAKVECEQMLEIHSQVKDKGYSELDIVSERKSSAEDVRGCSDALRRRAEGRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title SPATA2 Links CYLD to LUBAC, Activates CYLD, and Controls LUBAC Signaling.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
molecule keywords Spermatogenesis-associated protein 2
total genus 83
structure length 203
sequence length 215
ec nomenclature
pdb deposition date 2016-07-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.2190 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 5ljmA00
4JUYA 2CCQA 2HPJA 2CM0A 4P0AA 4OYKA 4P0BA 4OYJA 2HPLA 2D5UA 4P09A 5LJMA 5LJNA
chains in the Genus database with same CATH superfamily
2CXLA 2VVNA 2JQKA 3AEBA 2UXDT 3MA9A 1UCUA 4AQGA 4YTMA 2W62A 4NIQA 4HFDA 4OYJA 4UVCB 2K9AA 2V1DB 4IE4A 5LJNA 3UULA 1LRZA 1X9BA 1SA0E 4TNWA 4NXNT 1N32T 3ZMZB 2IUBA 2QVAA 3PUGA 5C8YE 1YKEB 2VK9A 4IGUA 3UU8A 3OJAA 3UQ4A 2K5BB 4YHJA 5CA1E 4IDNA 2BKOA 1X79A 1OEDB 3AEAA 2Q9QC 3VU7H 4U3CA 4DO0A 1NAFA 2W0GA 2RA1A 2KINB 4IE6A 2LRLA 1QUUA 2OA5A 3PUYF 5HEGA 2WU2A 3UU6A 3ZYMA 4YHHT 4QX8B 3RQWA 3RYHE 4PW8A 1SUMB 4X62T 2M6BA 2JMHA 2GK9A 5HAXA 3P4SA 1LVKA 2WZHA 4HWIB 5HEUA 3QK6A 4MALA 2ZM2A 3RYFE 5EK4A 4AKHA 3TLTA 3H3AA 1I6ZA 2CBIA 2X9HA 5L4EA 4GKKT 3N2GE 3O1HA 3PU3A 1XNQT 1J5WA 4ILBA 4H9SE 4FI5A 2V5DA 3QB5K 2VL0A 2UUBT 2KNDA 5DJQC 2J62A 2BG9B 1OEDE 3HR0A 3UU5A 3I9WA 2IDOB 4PJMA 3MKDA 2W67A 3N9LA 2XQ3A 3LG7A 3PJAA 5ETWA 2Y6XA 5FXZA 2QA7A 2V5CA 1T8BA 3AA6B 3TLWA 2XQ8A 4TWFA 1FMWA 2EHOB 4O4LE 3FXEB 4DV3T 4LMJA 3OPCA 4UF0A 4HFVA 4O4HE 5JDGA 3NKZA 1XDOA 2D2SA 2Q9QA 1W9RA 2PFVA 3FXDB 4IE0A 4NUVA 3AXJA 1Y64B 1FMVA 3C51A 3HI2A 2XQ6A 4E7ZA 4TX5A 5CA0E 2VQFT 3K8PC 2XM2A 1WYCA 4PFPA 4PAGA 4JYAT 1UX5A 4HEAA 1KFYA 2XY8B 3EDUA 4LFBT 2CWYA 1BR0A 4QHOA 2FJDA 5IYZE 3RKGA 1HTJF 4EV6A 2V8SV 3GA8A 3VRBA 5LGUB 3C50A 2KWIB 2WM9A 2R6GF 2E9XC 3O9XA 4AQYT 5AQNB 3JAFA 3SOLA 1LVFA 3Q5EA 1VCTA 2QGSA 2X0YA 3AA7B 3JC6D 4IE5A 2XQAA 2H88A 3KFWX 3RLFF 4BA9A 1BR2A 4IL9A 1DU2A 2X66A 5HXRA 4X5TA 1CUNA 2WZIA 3ETVA 3LSVA 1XDPA 4TNVA 3WAKA 2ODVA 2ODUA 3C64A 3F31A 3UT5E 2BG9C 4XAXB 4WW0A 5F3JA 5LNKA 4KP3C 2Y48B 5FL1A 4ZEYA 5AQSB 2NTXA 4ERRA 3ZCIA 4ZI3D 3G06A 4WBOA 1HNZT 3E0ZA 1OXZA 3I9YA 3AA1B 4U74A 2BBHA 1M62A 5LG4A 3KV4A 4QKNA 3P4RA 4A5XA 2C5JA 3EDVA 4KMCA 3AE4A 3AA0B 3X1DA 2LSGA 3KV5A 2J47A 4HFEA 4B6XA 5JR9C 5JR9B 3HKDE 4HTEA 2ES0A 2N9DA 4H9QC 4U72A 5JDLA 4JI7T 1MMGA 2FJAA 4H9RC 4WBNE 2J4GA 3HA4A 5HCJA 3HKCE 3Q5DA 3O1IA 1KNZA 3I0QA 1Z0PA 3ZN0B 4QXBB 1D0XA 1XNRT 4JI0T 3HL6A 3ZN1B 3Q2MA 4A98A 5L3GB 1CHUA 4HFBA 3LK42 4YXDA 3TLVA 3UUBA 4CQIA 3ZC0A 5ABFA 1BR4A 3UTKA 1HG5A 1ZV4X 4LMLA 5FXVA 2KMFA 2LEHA 4A97A 4ISTA 5A1LA 2E9XD 2N2NA 3BK9A 4QXHB 2WU5A 5HWXA 3AAIA 3RI5A 3ZCJA 5LMNT 4Z91A 3RRWA 2WQYA 2LSYA 4U2YA 3AE2A 4I4TE 3AAEB 2W00A 5HYAA 3ZJ1A 3F57A 3N9OA 4IDQA 4AIUA 2YK0A 3ZC1A 3FBZA 3JAEA 3ONXA 3N2OA 2DHRA 4UXNB 5LOVE 4DVDA 2LOPA 1OWAA 4O4IE 3RH3A 4DMVA 2KZ7B 3L09A 4J2CA 3QOFA 4KI0F 2LSJA 1SE7A 2ACXA 1HX8A 4ZZBA 3PUZF 3OVUA 1QSDA 2CXFA 3DJBA 5IHYA 2Y8DA 3KV9A 2LLYA 4YLHA 5HXEA 2H7OA 2IIUA 2HN2A 2JQ9A 2RP4A 2ZM0A 2MAWA 5L4HA 2LSKA 3FZHB 1D1AA 1KF6A 4ZI2C 3KV6A 1U4QA 3ZYKA 5HEOA 3NZQA 2ZM6T 3KVAA 2FBWA 3ZMVB 2W2UA 3T1YT 1N34T 4OFZA 5LHIB 1UX4A 3LFMA 3UU4A 1KNPA 1OEDA 5KDMC 3B57A 3T1HT 4C91A 2ZLYA 5LB7B 3P4PA 2XAGB 3FZLB 4QXCB 3K3QC 3ZT7A 3KBTA 1MMDA 3RC8A 1YXRA 5J2UE 2HPJA 2QRXA 4HWHA 3AVSA 4O2AE 2VQET 4DV5T 1D1CA 2X9WA 4QWNB 2V6YA 3GN5A 1YQ3A 1ZHCA 3P50A 4EOZB 4EEBA 4O8SA 4UIGA 4B3TT 3N9QA 2K48A 4DBRA 1T7SA 2E2AA 3RC3A 3VHLA 5LA6E 3NRXA 1G73A 1IZNB 3MXZA 2A3DA 1WRDA 3P8CD 2CLYC 3I1AA 1NEKA 4HWCA 3SFDA 2XPKA 2A72A 1LKXA 1SHZC 3RKOA 1Y01A 4DMWA 4TN7B 4BJNA 4DV7T 2W4XA 2F4VT 2A9UA 4JI2T 3DTOA 2L8KA 3K3NA 4FJOA 4U33A 5AQHB 4AKIA 2WMNA 4ADZA 4DV0T 2KLQA 4LF9T 3VR8A 2HN1A 2ZM8A 4YT0A 3B13A 4ILAA 5H6QB 4ZI2D 5JTGA 3TLSA 2XUEA 3U3IA 3ZEFB 2YKSA 4UF0B 1XZYA 2KSRA 4L5GA 2HHHT 2BS4A 5EK3A 2XQ9A 4HE8A 4CXYA 4DNDA 1HFAA 1YKHB 3IF8B 3PU8A 3RX6A 4ILCA 2CXDA 1YD8G 1HS7A 3NRYA 2IC6A 3CIRA 3Q5WA 3BQIA 2JJ9A 1B7TA 3MK7C 3KINB 1S35A 5L3BB 4HFCA 5HWYA 3ABVA 4F6RC 5L3FB 4V1Av 3B5MA 4DR4T 3Q5XA 5FY0A 2IHR1 3RRCA 4QX7B 3AE9A 4UVAB 1U5PA 4BJMA 3HKBE 4DBQA 2UU9T 1UUSA 1MNDA 3CX6B 3NBXX 3AE8A 5GONE 2BS3A 4DR6T 5LJMA 5IWAT 3ANWA 4TV8E 4PJLA 4JEUB 3MACA 3VR9A 1UGOA 3M65A 4UV9B 2V7LA 4H63V 5LP6E 4GOUA 5JVDE 4O2BE 3RYCE 1IJ5A 2PJQA 5L2LA 1IBKT 4H9PC 2P9BA 2DNXA 3FB2A 1N33T 2XAJB 5E0OA 4YSZA 5LGTB 2Z6EA 4HN9A 4XBFB 3FZMB 5J1GA 3QUJA 4LF6T 4LMKA 2MTQA 4ZZCA 1JNZA 2CCQA 4NXMT 3SRZA 4H9NC 4GK5E 2XAQB 5J0ZA 4UV8B 2XQ4A 1W0AA 1WR6A 2LT3A 4ILUA 4AKRB 1E1HB 3EHZA 5JDNA 5KX5E 2WSSV 1HR0T 3QB5A 4MHCA 5AQGB 1IJ6A 2DI4A 5JDMA 4GKJT 3LBXB 3MJXA 3SS1A 4DR3T 1QLBA 2I6HA 3P4QA 1E2AA 4HGAA 4CI3B 2YDRA 1J1JA 4B3MT 2VVSA 3CQXC 1ZOYA 5JDQA 4DR5T 4K0UA 4EYUA 3UUXB 2OV9A 4EXTA 5HEHA 2LKGA 2V7MA 3RGLA 2D5UA 2BVLA 3D0TA 4UR9A 5CFBA 2KT9A 4KHZF 4X64T 4CN4A 1VRBA 2VURA 3ESLA 1HNXT 2VASA 2WDQA 4HWFA 5JDHA 5DABA 4LF4T 2LOSA 3RHWA 1WYBA 2KXPB 4I0UA 3EVYA 4UELA 4COFA 2HH7A 1T72A 2V26A 3I0OA 5DQVA 5F5WA 3J9X1 2YU2A 4JI5T 5JH7E 1AJ3A 2X68A 3RIUC 2YINA 2L3LA 5AQUB 4CN1A 3IA3A 2OLTA 5CGMA 3M3ZB 4DR7T 5FVKA 1JNRA 4EZ4A 4F8HA 2CBJA 2CMRA 2ACZA 2WB5A 2UUAT 3N9NA 4NUUA 2CHNA 3V5SA 1J5ET 4YJ2E 2CRBA 5JRCB 4JLEA 1FEWA 5AQVB 4TWHA 3ZT5A 4ZI7E 2EHOC 2DWGA 3ZMTB 1XMOT 2X51A 4CI2B 2XQYA 2XQ5A 2CHOA 3Q9DA 3K3OA 4AKLA 2XHEB 1O3XA 2V6XA 3KBUA 4U2ZA 4TWDA 2E9XB 5J2TE 2DCFA 4K0KT 4IIJE 3ONLC 3KDSE 1W09A 2PG8A 2NP9A 3CMLA 3L39A 2LHRA 2H89A 3AE6A 3J7Yq 2WCAA 1XWMA 3A8YC 2PBIA 2WDRA 2H7VC 5AQIB 2E5VA 5HCMA 5ABGA 2EHOA 3O4XE 5HXSA 3ETUA 2X0HA 4JV5T 2SPCA 3AEDA 2I0MA 4I50E 5IUXA 2YEVC 4EZHA 2VL8A 3AAAB 3IBPA 3RYIE 2HPLA 4AXPA 3ZMUB 2C5KT 1YQ4A 4ASKA 4BAYB 2VKHA 3BQKA 2W66A 3CVRA 5FXWA 5HXCA 4P0AA 4AISA 5FY7A 2LJLA 2LM2A 2MOZA 3F2EA 3UUNA 2C5IT 4X1IE 1MIYA 1HG2A 1W0BA 4X1YE 4QH5A 5DQWA 3L8RA 5AQPB 3AECA 4CXXA 4EYYR 2UXBT 2WMOA 2C0SA 4DUYT 2XM1A 2D0TA 3SWHA 5F8PA 2JMKA 3PJAJ 2X9XA 5AQLB 4EGWA 5ABFB 3VKGA 4CN6A 2LRKA 3PUQA 3CWZB 4AQFC 3PUSA 3P4WA 1D0ZA 3UU3A 4HFHA 5TAOA 1ZKEA 4M1PA 4DR2T 3FZFB 5L3DB 1V9DA 3NVOA 4PJNA 5ABEA 2VKDA 4DUZT 2CM0A 4KX6A 3EAMA 3RIFA 3E22E 3EUHA 4OYKA 1US7B 3ZKRA 4IDPA 3DP7A 3AE7A 2XQ7A 1H7CA 2KWHA 2N1GA 3A5XA 3CPZA 4GIWA 1S94A 4I55E 4KBMB 4P09A 2LM9A 3LK2B 1HX1B 4UVBB 2LHNA 2W61A 4YJ3E 3VKHA 2X67A 3RF1A 3ONJA 3AE5A 3SFEA 3LDQB 2NOXA 2W63A 4JEHB 4Z8XA 3VRAA 4IREA 1Z8UA 4JUYA 2YN6A 2YDSA 2WS3A 4QH4A 4WZXA 4H63H 2VB6A 4U31A 3ZYLA 4DV1T 3AEGA 2BG9A 1WR0A 2QYWA 4HWDA 4MBQA 4TZ4C 4C90A 5LBQB 3RPUA 3GWHA 2NWBA 1WLXA 2RPAA 2NW9A 2JIWA 4PNIA 2MBGA 3PE0A 5HXHA 4LFCT 2JPFA 4ZXLA 1KK7A 4TUYE 3EI0A 2L9QA 1UURA 2FJBA 5KXJA 3C4WA 3OYZA 3TKLB 5AQMB 3AVRA 3K1SA 4NPPA 2EHOD 2WP9A 2XAHB 5AQTB 4O4JE 3N2KE 3FHNA 1IAPA 3PUXF 4UEMA 3UFGA 2MYSA 4A56A 3C98B 3QNUA 4AQFA 3AEEA 3CK6A 2CEAA 3HKEE 1VOMA 2FUPA 2ZMAA 4GYRA 3UFEA 5LG3A 3CQCB 4Z90A 3H3MA 2V6YB 3E08A 3GN5B 3CQGB 4PK6A 3LBXA 5H6RB 3ZMSB 5M4YA 2E5LT 5ADXL 5AQKB 5FNVE 4LFAT 4JBWF 4Q25A 2LKHA 3OKQA 2XSBA 2VKJA 2UXNB 2XASB 2BVMA 4HKAA 5EK2A 2BG9E 5L47A 4JI1T 5LMUT 4OHFA 3C4XA 4TV9E 1HNWT 2XAFB 3N9MA 4P1NA 3PUAA 1FJGT 3ZJ2A 5JREA 4YSXA 1D1BA 3AE1A 3GMIA 4U7YA 5AQOB 1MIWA 1FIOA 3AEFA 2WWVA 4IE7A 5C2TA 4H9OC 2BKPA 2JQHA 1IBLT 4OX9T 2CA5A 2YOEA 3C4ZA 5C3JA 5CB4E 4XZCA 4LF8T 2E9XA 4ISSA 4PFOA 3ZSSA 1MIVA 3NWIA 3TLUA 5L3EB 3R84B 2K3WA 4IHJE 3RIAA 4LF5T 4YY3T 4X65T 3N9PA 1MMNA 3O1JA 2WY2A 5BR8T 2CE7A 2NW8A 2X0LB 3PTRB 4U7IA 4ZI3C 1WCRA 2J1DG 4HFIA 2IAKA 5FKYA 3R6NA 2AXDS 4GK0E 4WNKA 2A2FX 5JQGE 4IL4A 1KEYA 2VWAA 4QH1A 2DLRA 2WDVA 3PDYA 1N36T 3T8OA 4EAHA 3V5UA 3CX8B 5FY1A 1L0VA 4CZZB 5JRCA 1EZ3A 3AXJB 2NR4A 2H3RA 5LXTE 1HCIA 4DR1T 2BZBA 5FMNA 5FYMA 4B3RT 3ZT6A 3JC6C 1YW0A 3RQUA 3JCFA 3MZKB 3QC9A 5LYJE 3IEEA 2MPKA 1ZEEA 3LJCA 4MFRA 5KMGP 2UXXB 1G8XA 2K24A 3PUVF 4X20E 1VCSA 2YU1A 3ZPOA 1GQEA 1HF8A 1NENA 2B1EA 2PTFA 5ABHA 4N78D 1OEDC 5AQFB 3PURA 4CXWA 1BR1A 1M7KA 2V7JA 3S4UA 2E8IA 3ZSTA 4AI6A 4YSYA 5FVLA 2CLYB 2UUCT 3UUMA 4GYSA 4IT4A 3NZPA 5LBMA 4IDOA 5AQJB 2IMLA 4YTNA 2WAUA 5CJ5A 4AKGA 4YFSA 2DWKA 3FBLA 2NTYA 1ZP0A 5HEJA 5LGNB 2AE9A 4G2AA 3RIUA 2XZEA 1T98A 3ZLIA 4JI6T 1E7PA 5JR9A 4KUMB 3PUWF 2JQQA 2YDQA 4EB6E 2WWUA 4ZS3A 2BKNA 3A7MA 4CI1B 2WBLA 4DV2T 4PJJA 4WYVA 1NWMX 2XSAA 3JADA 4P0BA 3OBVE 4DIDB 1R8IA 4E7SA 4KHPT 3IHRA 1MNEA 4YTPA 2D0UA 2X9YA 2XTLA 4EIWA 2LSIA 2NW7A 2VKOA 3BQLA 3KVBA 2LE8A 4ZOLE 4I43B 3AE3A 4MLKA 2B76A 5L3CB 2I59A 3AB3B 1D0YA 2XJ7A 5FXXA 2Q9QB 4JI3T 3W15B 4JI4T 2V7IA 4X1KE 4DV6T 1I94T 3EABA 2Q9QD 2M6IA 1XMQT 2FJEA 5EZYE 5FP3A 3H37A 4PK5A 5AQQB 4X66T 2G0UA 3CKDA 5JDFA 2BDEA 4OK0A 2M67A 2IC9A 5LCYA 3U78A 2V7KA 5LHGB 3UQ7A 4ANJA 4L0RA 4EEDA 1IBMT 4G63A 3OTOT 3LK3B 3N5LA 2IW5B 2D9DA 5BMVE 4ZHQE 1KNRA 1MMAA 3OYXA 4IDZA 3L3PA 2CWOA 3CX7B 4ZS2A 4B3ST 4L9IA 3FZKB 4JI8T 2BBJA 4PK4A 4DV4T 2CPTA 3WI3A 4LF7T 1WFDA 2UXCT 1UK5A 2BS2A 3P7IA 5AQRB 3PV0F 5FL0A 5AFUL 5LHHB 3ANWB 2DL1A 2JRKA 3WAJA
chains in the Genus database with same CATH topology
2CXLA 3MA9A 1UCUA 2W62A 4UVCB 4OYJA 2K9AA 2V1DB 4IE4A 5LJNA 3UULA 1LRZA 1SA0E 3ZMZB 3PUGA 5C8YE 1YKEB 2VK9A 4IGUA 3OJAA 2K5BB 4YHJA 5CA1E 1X79A 4DO0A 3VU7H 2Q9QC 1NAFA 2W0GA 2RA1A 2KINB 4IE6A 1QUUA 2OA5A 3ZYMA 4QX8B 3RYHE 4PW8A 2JMHA 2GK9A 5HAXA 4C90A 1LVKA 3RYFE 4AKHA 3QK6A 4MALA 2ZM2A 5EK4A 3H3AA 2X9HA 3N2GE 3O1HA 3PU3A 4H9SE 4FI5A 2KNDA 5DJQC 3HR0A 3I9WA 4PJMA 3MKDA 3N9LA 5ETWA 3LG7A 5FXZA 2Y6XA 2QA7A 3AA6B 1FMWA 2EHOB 4O4LE 3FXEB 4UF0A 4HFVA 4O4HE 4C91A 2Q9QA 2D2SA 4IE0A 2PFVA 4NUVA 3FXDB 1Y64B 1FMVA 3HI2A 3C51A 4E7ZA 4TX5A 5CA0E 3K8PC 1WYCA 4PFPA 4PAGA 1UX5A 4HEAA 3EDUA 1BR0A 2CWYA 4QHOA 5IYZE 1HTJF 3GA8A 5LGUB 3C50A 2KWIB 2WM9A 2E9XC 3O9XA 3SOLA 1LVFA 2QGSA 3AA7B 3JC6D 4IE5A 4CXXA 3KFWX 4BA9A 1BR2A 2X66A 5HXRA 1CUNA 3ETVA 3WAKA 2ODVA 2ODUA 3C64A 3F31A 3UT5E 4XAXB 5LNKA 4WW0A 5F3JA 4KP3C 2Y48B 2NTXA 4ERRA 3ZCIA 4ZI3D 4WBOA 3E0ZA 1OXZA 3I9YA 3AA1B 4U74A 5LG4A 3KV4A 4QKNA 2C5JA 3EDVA 4KMCA 3AA0B 4B6XA 2LSGA 3KV5A 5JR9C 5JR9B 3HKDE 4HTEA 2ES0A 2N9DA 4H9QC 4U72A 5JDLA 1MMGA 4H9RC 4WBNE 3HA4A 3HKCE 3O1IA 1KNZA 3I0QA 1Z0PA 3ZN0B 4QXBB 1D0XA 3HL6A 3ZN1B 3Q2MA 5L3GB 3LK42 4CQIA 3ZC0A 1BR4A 3UTKA 1HG5A 1ZV4X 5FXVA 2KMFA 2LEHA 4ISTA 5A1LA 2E9XD 2N2NA 3BK9A 4QXHB 5HWXA 3AAIA 3ZCJA 3RRWA 2LSYA 4I4TE 3AAEB 2W00A 5HYAA 3ZJ1A 3F57A 3N9OA 2YK0A 3ZC1A 3FBZA 3ONXA 5LOVE 3N2OA 2DHRA 4UXNB 4DVDA 2LOPA 1OWAA 4O4IE 3RH3A 4DMVA 2KZ7B 3L09A 4J2CA 2LSJA 2ACXA 1HX8A 1QSDA 2CXFA 3DJBA 5IHYA 2Y8DA 3KV9A 4YLHA 5HXEA 2H7OA 2RP4A 2ZM0A 2LSKA 1D1AA 4ZI2C 3KV6A 1U4QA 3ZYKA 3NZQA 3KVAA 3ZMVB 4OFZA 5LHIB 1UX4A 3LFMA 5KDMC 3B57A 2ZLYA 2XAGB 4QXCB 3K3QC 3KBTA 1MMDA 3RC8A 2HPJA 3AVSA 4O2AE 1D1CA 2X9WA 4QWNB 3GN5A 1ZHCA 4EOZB 4O8SA 4UIGA 3N9QA 2K48A 3RC3A 3VHLA 5LA6E 3NRXA 1G73A 1IZNB 3MXZA 2A3DA 1WRDA 3P8CD 2CLYC 3I1AA 2A72A 1LKXA 1SHZC 3RKOA 4DMWA 4TN7B 4BJNA 3DTOA 2L8KA 3K3NA 4FJOA 2WMNA 4ADZA 2KLQA 2ZM8A 3B13A 5H6QB 4ZI2D 2XUEA 3U3IA 3ZEFB 4UF0B 4L5GA 5EK3A 4HE8A 4CXYA 4DNDA 1HFAA 1YKHB 3IF8B 3PU8A 3RX6A 2CXDA 1YD8G 1HS7A 3NRYA 2IC6A 3Q5WA 3BQIA 2JJ9A 1B7TA 3MK7C 3KINB 1S35A 5L3BB 5HWYA 4F6RC 5L3FB 4V1Av 3Q5XA 5FY0A 3RRCA 4QX7B 4UVAB 1U5PA 4BJMA 3HKBE 1MNDA 3CX6B 3NBXX 5GONE 5LJMA 3ANWA 4TV8E 4PJLA 4JEUB 3MACA 3M65A 4UV9B 2V7LA 4H63V 5LP6E 4GOUA 5JVDE 4O2BE 3RYCE 1IJ5A 2PJQA 5L2LA 4H9PC 2P9BA 2DNXA 3FB2A 2XAJB 5E0OA 5LGTB 2Z6EA 4HN9A 4XBFB 5J1GA 3QUJA 2MTQA 2CCQA 3SRZA 4H9NC 4GK5E 2XAQB 4UV8B 4ILUA 1WR6A 2LT3A 5JDNA 4AKRB 1E1HB 5KX5E 2WSSV 4MHCA 1IJ6A 2DI4A 5JDMA 3LBXB 3MJXA 3SS1A 4HGAA 4CI3B 5JDQA 3CQXC 4K0UA 4EYUA 3UUXB 4EXTA 2V7MA 2D5UA 2BVLA 3D0TA 2KT9A 1VRBA 3ESLA 2VASA 5JDHA 5DABA 2LOSA 1WYBA 2KXPB 3EVYA 4UELA 2HH7A 2V26A 3I0OA 5DQVA 3J9X1 2YU2A 5JH7E 1AJ3A 2X68A 2YINA 2L3LA 4EZ4A 2CMRA 3N9NA 4NUUA 3V5SA 4YJ2E 5JRCB 4JLEA 1FEWA 4ZI7E 2EHOC 2DWGA 3ZMTB 2X51A 4CI2B 2XQYA 3Q9DA 3K3OA 4AKLA 2XHEB 1O3XA 5J2TE 3KBUA 2E9XB 2DCFA 4IIJE 3KDSE 2PG8A 2NP9A 3CMLA 4AKIA 2LHRA 3J7Yq 5J2UE 2PBIA 2H7VC 5HXSA 2EHOA 3O4XE 3ETUA 2SPCA 4I50E 2YEVC 4EZHA 2VL8A 3AAAB 3IBPA 3RYIE 2HPLA 4AXPA 3ZMUB 2C5KT 4BAYB 4ASKA 2VKHA 3BQKA 3CVRA 5FXWA 5HXCA 4P0AA 5FY7A 2LJLA 2MOZA 3F2EA 3UUNA 2C5IT 4X1IE 1MIYA 1HG2A 4X1YE 5DQWA 4EYYR 2WMOA 2C0SA 2D0TA 3SWHA 5F8PA 2JMKA 2X9XA 3VKGA 3PUQA 3CWZB 4AQFC 3PUSA 1D0ZA 5TAOA 1ZKEA 4M1PA 5L3DB 1V9DA 4PJNA 2VKDA 2CM0A 3E22E 3EUHA 4OYKA 1US7B 3DP7A 4DBRA 1H7CA 2KWHA 2N1GA 3A5XA 3CPZA 4GIWA 1S94A 4I55E 4KBMB 4P09A 2LM9A 3LK2B 4UVBB 2LHNA 2W61A 4YJ3E 3VKHA 2X67A 2NOXA 2W63A 4JEHB 4Z8XA 4JUYA 4H63H 2VB6A 3ZYLA 4MBQA 4TZ4C 5LBQB 3RPUA 3GWHA 2NWBA 1WLXA 2NW9A 4PNIA 2MBGA 3PE0A 5HXHA 2JPFA 1KK7A 4TUYE 2L9QA 3C4WA 3OYZA 3TKLB 3AVRA 2EHOD 2XAHB 4O4JE 3N2KE 3FHNA 1IAPA 4UEMA 4A56A 4AQFA 2MYSA 3C98B 2CEAA 3HKEE 1VOMA 4GYRA 2ZMAA 3UFEA 3CQCB 3GN5B 3E08A 4PK6A 3CQGB 5H6RB 3LBXA 3ZMSB 5M4YA 5ADXL 5FNVE 3OKQA 2VKJA 2UXNB 2XASB 2BVMA 4HKAA 5EK2A 4OHFA 3C4XA 4TV9E 2XAFB 3N9MA 3PUAA 3ZJ2A 5JREA 1D1BA 3GMIA 1MIWA 1FIOA 4IE7A 4H9OC 2CA5A 3C4ZA 5CB4E 4XZCA 2E9XA 4ISSA 4PFOA 1MIVA 5L3EB 3R84B 4IHJE 3N9PA 1MMNA 3O1JA 2CE7A 2NW8A 2X0LB 3PTRB 4ZI3C 4AQGA 2J1DG 4DBQA 2IAKA 3R6NA 4GK0E 4WNKA 2A2FX 5JQGE 2VWAA 2DLRA 3PDYA 3T8OA 4EAHA 3V5UA 3CX8B 5FY1A 4CZZB 5JRCA 1EZ3A 5LXTE 2H3RA 1HCIA 2BZBA 5FMNA 5FYMA 3JC6C 1YW0A 3MZKB 3QC9A 5LYJE 3IEEA 3LJCA 1ZEEA 4MFRA 5KMGP 2UXXB 1G8XA 2K24A 4X20E 3ZPOA 2YU1A 1HF8A 2B1EA 4N78D 3PURA 4CXWA 1BR1A 2V7JA 3S4UA 2E8IA 4AI6A 2CLYB 3UUMA 4GYSA 3NZPA 5LBMA 4AKGA 2WAUA 4YFSA 2DWKA 3FBLA 2NTYA 5LGNB 4G2AA 3ZLIA 1T98A 5JR9A 4KUMB 2JQQA 4EB6E 2WWUA 4ZS3A 4CI1B 2WBLA 4PJJA 1NWMX 4P0BA 3OBVE 4E7SA 3IHRA 1MNEA 2D0UA 2X9YA 2XTLA 4EIWA 2LSIA 2NW7A 2VKOA 3BQLA 3KVBA 2LE8A 4ZOLE 4I43B 4MLKA 5L3CB 2I59A 3AB3B 1D0YA 5FXXA 2Q9QB 3W15B 2V7IA 4X1KE 2Q9QD 5EZYE 5FP3A 3H37A 4PK5A 2G0UA 3CKDA 5JDFA 2BDEA 4OK0A 2M67A 2IC9A 5LCYA 3U78A 2V7KA 5LHGB 4ANJA 4L0RA 4G63A 3LK3B 3N5LA 2IW5B 5BMVE 4ZHQE 1MMAA 3OYXA 4IDZA 3L3PA 2CWOA 3CX7B 4ZS2A 4L9IA 4PK4A 3WI3A 5AFUL 3P7IA 5LHHB 3ANWB 5JDGA 2JRKA 3WAJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JUY A;  2CCQ A;  2HPJ A;  2CM0 A;  4P0A A;  4OYK A;  4P0B A;  4OYJ A;  2HPL A;  2D5U A;  4P09 A;  5LJM A;  5LJN A; 
#chains in the Genus database with same CATH topology
 2CXL A;  2VVN A;  2JQK A;  3AEB A;  2UXD T;  3MA9 A;  1UCU A;  4AQG A;  4YTM A;  2W62 A;  4NIQ A;  4HFD A;  4OYJ A;  4UVC B;  2K9A A;  2V1D B;  4IE4 A;  5LJN A;  3UUL A;  1LRZ A;  1X9B A;  1SA0 E;  4TNW A;  4NXN T;  1N32 T;  3ZMZ B;  2IUB A;  2QVA A;  3PUG A;  5C8Y E;  1YKE B;  2VK9 A;  4IGU A;  3UU8 A;  3OJA A;  3UQ4 A;  2K5B B;  4YHJ A;  5CA1 E;  4IDN A;  2BKO A;  1X79 A;  1OED B;  3AEA A;  2Q9Q C;  3VU7 H;  4U3C A;  4DO0 A;  1NAF A;  2W0G A;  2RA1 A;  2KIN B;  4IE6 A;  2LRL A;  1QUU A;  2OA5 A;  3PUY F;  5HEG A;  2WU2 A;  3UU6 A;  3ZYM A;  4YHH T;  4QX8 B;  3RQW A;  3RYH E;  4PW8 A;  1SUM B;  4X62 T;  2M6B A;  2JMH A;  2GK9 A;  5HAX A;  3P4S A;  1LVK A;  2WZH A;  4HWI B;  5HEU A;  3QK6 A;  4MAL A;  2ZM2 A;  3RYF E;  5EK4 A;  4AKH A;  3TLT A;  3H3A A;  1I6Z A;  2CBI A;  2X9H A;  5L4E A;  4GKK T;  3N2G E;  3O1H A;  3PU3 A;  1XNQ T;  1J5W A;  4ILB A;  4H9S E;  4FI5 A;  2V5D A;  3QB5 K;  2VL0 A;  2UUB T;  2KND A;  5DJQ C;  2J62 A;  2BG9 B;  1OED E;  3HR0 A;  3UU5 A;  3I9W A;  2IDO B;  4PJM A;  3MKD A;  2W67 A;  3N9L A;  2XQ3 A;  3LG7 A;  3PJA A;  5ETW A;  2Y6X A;  5FXZ A;  2QA7 A;  2V5C A;  1T8B A;  3AA6 B;  3TLW A;  2XQ8 A;  4TWF A;  1FMW A;  2EHO B;  4O4L E;  3FXE B;  4DV3 T;  4LMJ A;  3OPC A;  4UF0 A;  4HFV A;  4O4H E;  5JDG A;  3NKZ A;  1XDO A;  2D2S A;  2Q9Q A;  1W9R A;  2PFV A;  3FXD B;  4IE0 A;  4NUV A;  3AXJ A;  1Y64 B;  1FMV A;  3C51 A;  3HI2 A;  2XQ6 A;  4E7Z A;  4TX5 A;  5CA0 E;  2VQF T;  3K8P C;  2XM2 A;  1WYC A;  4PFP A;  4PAG A;  4JYA T;  1UX5 A;  4HEA A;  1KFY A;  2XY8 B;  3EDU A;  4LFB T;  2CWY A;  1BR0 A;  4QHO A;  2FJD A;  5IYZ E;  3RKG A;  1HTJ F;  4EV6 A;  2V8S V;  3GA8 A;  3VRB A;  5LGU B;  3C50 A;  2KWI B;  2WM9 A;  2R6G F;  2E9X C;  3O9X A;  4AQY T;  5AQN B;  3JAF A;  3SOL A;  1LVF A;  3Q5E A;  1VCT A;  2QGS A;  2X0Y A;  3AA7 B;  3JC6 D;  4IE5 A;  2XQA A;  2H88 A;  3KFW X;  3RLF F;  4BA9 A;  1BR2 A;  4IL9 A;  1DU2 A;  2X66 A;  5HXR A;  4X5T A;  1CUN A;  2WZI A;  3ETV A;  3LSV A;  1XDP A;  4TNV A;  3WAK A;  2ODV A;  2ODU A;  3C64 A;  3F31 A;  3UT5 E;  2BG9 C;  4XAX B;  4WW0 A;  5F3J A;  5LNK A;  4KP3 C;  2Y48 B;  5FL1 A;  4ZEY A;  5AQS B;  2NTX A;  4ERR A;  3ZCI A;  4ZI3 D;  3G06 A;  4WBO A;  1HNZ T;  3E0Z A;  1OXZ A;  3I9Y A;  3AA1 B;  4U74 A;  2BBH A;  1M62 A;  5LG4 A;  3KV4 A;  4QKN A;  3P4R A;  4A5X A;  2C5J A;  3EDV A;  4KMC A;  3AE4 A;  3AA0 B;  3X1D A;  2LSG A;  3KV5 A;  2J47 A;  4HFE A;  4B6X A;  5JR9 C;  5JR9 B;  3HKD E;  4HTE A;  2ES0 A;  2N9D A;  4H9Q C;  4U72 A;  5JDL A;  4JI7 T;  1MMG A;  2FJA A;  4H9R C;  4WBN E;  2J4G A;  3HA4 A;  5HCJ A;  3HKC E;  3Q5D A;  3O1I A;  1KNZ A;  3I0Q A;  1Z0P A;  3ZN0 B;  4QXB B;  1D0X A;  1XNR T;  4JI0 T;  3HL6 A;  3ZN1 B;  3Q2M A;  4A98 A;  5L3G B;  1CHU A;  4HFB A;  3LK4 2;  4YXD A;  3TLV A;  3UUB A;  4CQI A;  3ZC0 A;  5ABF A;  1BR4 A;  3UTK A;  1HG5 A;  1ZV4 X;  4LML A;  5FXV A;  2KMF A;  2LEH A;  4A97 A;  4IST A;  5A1L A;  2E9X D;  2N2N A;  3BK9 A;  4QXH B;  2WU5 A;  5HWX A;  3AAI A;  3RI5 A;  3ZCJ A;  5LMN T;  4Z91 A;  3RRW A;  2WQY A;  2LSY A;  4U2Y A;  3AE2 A;  4I4T E;  3AAE B;  2W00 A;  5HYA A;  3ZJ1 A;  3F57 A;  3N9O A;  4IDQ A;  4AIU A;  2YK0 A;  3ZC1 A;  3FBZ A;  3JAE A;  3ONX A;  3N2O A;  2DHR A;  4UXN B;  5LOV E;  4DVD A;  2LOP A;  1OWA A;  4O4I E;  3RH3 A;  4DMV A;  2KZ7 B;  3L09 A;  4J2C A;  3QOF A;  4KI0 F;  2LSJ A;  1SE7 A;  2ACX A;  1HX8 A;  4ZZB A;  3PUZ F;  3OVU A;  1QSD A;  2CXF A;  3DJB A;  5IHY A;  2Y8D A;  3KV9 A;  2LLY A;  4YLH A;  5HXE A;  2H7O A;  2IIU A;  2HN2 A;  2JQ9 A;  2RP4 A;  2ZM0 A;  2MAW A;  5L4H A;  2LSK A;  3FZH B;  1D1A A;  1KF6 A;  4ZI2 C;  3KV6 A;  1U4Q A;  3ZYK A;  5HEO A;  3NZQ A;  2ZM6 T;  3KVA A;  2FBW A;  3ZMV B;  2W2U A;  3T1Y T;  1N34 T;  4OFZ A;  5LHI B;  1UX4 A;  3LFM A;  3UU4 A;  1KNP A;  1OED A;  5KDM C;  3B57 A;  3T1H T;  4C91 A;  2ZLY A;  5LB7 B;  3P4P A;  2XAG B;  3FZL B;  4QXC B;  3K3Q C;  3ZT7 A;  3KBT A;  1MMD A;  3RC8 A;  1YXR A;  5J2U E;  2HPJ A;  2QRX A;  4HWH A;  3AVS A;  4O2A E;  2VQE T;  4DV5 T;  1D1C A;  2X9W A;  4QWN B;  2V6Y A;  3GN5 A;  1YQ3 A;  1ZHC A;  3P50 A;  4EOZ B;  4EEB A;  4O8S A;  4UIG A;  4B3T T;  3N9Q A;  2K48 A;  4DBR A;  1T7S A;  2E2A A;  3RC3 A;  3VHL A;  5LA6 E;  3NRX A;  1G73 A;  1IZN B;  3MXZ A;  2A3D A;  1WRD A;  3P8C D;  2CLY C;  3I1A A;  1NEK A;  4HWC A;  3SFD A;  2XPK A;  2A72 A;  1LKX A;  1SHZ C;  3RKO A;  1Y01 A;  4DMW A;  4TN7 B;  4BJN A;  4DV7 T;  2W4X A;  2F4V T;  2A9U A;  4JI2 T;  3DTO A;  2L8K A;  3K3N A;  4FJO A;  4U33 A;  5AQH B;  4AKI A;  2WMN A;  4ADZ A;  4DV0 T;  2KLQ A;  4LF9 T;  3VR8 A;  2HN1 A;  2ZM8 A;  4YT0 A;  3B13 A;  4ILA A;  5H6Q B;  4ZI2 D;  5JTG A;  3TLS A;  2XUE A;  3U3I A;  3ZEF B;  2YKS A;  4UF0 B;  1XZY A;  2KSR A;  4L5G A;  2HHH T;  2BS4 A;  5EK3 A;  2XQ9 A;  4HE8 A;  4CXY A;  4DND A;  1HFA A;  1YKH B;  3IF8 B;  3PU8 A;  3RX6 A;  4ILC A;  2CXD A;  1YD8 G;  1HS7 A;  3NRY A;  2IC6 A;  3CIR A;  3Q5W A;  3BQI A;  2JJ9 A;  1B7T A;  3MK7 C;  3KIN B;  1S35 A;  5L3B B;  4HFC A;  5HWY A;  3ABV A;  4F6R C;  5L3F B;  4V1A v;  3B5M A;  4DR4 T;  3Q5X A;  5FY0 A;  2IHR 1;  3RRC A;  4QX7 B;  3AE9 A;  4UVA B;  1U5P A;  4BJM A;  3HKB E;  4DBQ A;  2UU9 T;  1UUS A;  1MND A;  3CX6 B;  3NBX X;  3AE8 A;  5GON E;  2BS3 A;  4DR6 T;  5LJM A;  5IWA T;  3ANW A;  4TV8 E;  4PJL A;  4JEU B;  3MAC A;  3VR9 A;  1UGO A;  3M65 A;  4UV9 B;  2V7L A;  4H63 V;  5LP6 E;  4GOU A;  5JVD E;  4O2B E;  3RYC E;  1IJ5 A;  2PJQ A;  5L2L A;  1IBK T;  4H9P C;  2P9B A;  2DNX A;  3FB2 A;  1N33 T;  2XAJ B;  5E0O A;  4YSZ A;  5LGT B;  2Z6E A;  4HN9 A;  4XBF B;  3FZM B;  5J1G A;  3QUJ A;  4LF6 T;  4LMK A;  2MTQ A;  4ZZC A;  1JNZ A;  2CCQ A;  4NXM T;  3SRZ A;  4H9N C;  4GK5 E;  2XAQ B;  5J0Z A;  4UV8 B;  2XQ4 A;  1W0A A;  1WR6 A;  2LT3 A;  4ILU A;  4AKR B;  1E1H B;  3EHZ A;  5JDN A;  5KX5 E;  2WSS V;  1HR0 T;  3QB5 A;  4MHC A;  5AQG B;  1IJ6 A;  2DI4 A;  5JDM A;  4GKJ T;  3LBX B;  3MJX A;  3SS1 A;  4DR3 T;  1QLB A;  2I6H A;  3P4Q A;  1E2A A;  4HGA A;  4CI3 B;  2YDR A;  1J1J A;  4B3M T;  2VVS A;  3CQX C;  1ZOY A;  5JDQ A;  4DR5 T;  4K0U A;  4EYU A;  3UUX B;  2OV9 A;  4EXT A;  5HEH A;  2LKG A;  2V7M A;  3RGL A;  2D5U A;  2BVL A;  3D0T A;  4UR9 A;  5CFB A;  2KT9 A;  4KHZ F;  4X64 T;  4CN4 A;  1VRB A;  2VUR A;  3ESL A;  1HNX T;  2VAS A;  2WDQ A;  4HWF A;  5JDH A;  5DAB A;  4LF4 T;  2LOS A;  3RHW A;  1WYB A;  2KXP B;  4I0U A;  3EVY A;  4UEL A;  4COF A;  2HH7 A;  1T72 A;  2V26 A;  3I0O A;  5DQV A;  5F5W A;  3J9X 1;  2YU2 A;  4JI5 T;  5JH7 E;  1AJ3 A;  2X68 A;  3RIU C;  2YIN A;  2L3L A;  5AQU B;  4CN1 A;  3IA3 A;  2OLT A;  5CGM A;  3M3Z B;  4DR7 T;  5FVK A;  1JNR A;  4EZ4 A;  4F8H A;  2CBJ A;  2CMR A;  2ACZ A;  2WB5 A;  2UUA T;  3N9N A;  4NUU A;  2CHN A;  3V5S A;  1J5E T;  4YJ2 E;  2CRB A;  5JRC B;  4JLE A;  1FEW A;  5AQV B;  4TWH A;  3ZT5 A;  4ZI7 E;  2EHO C;  2DWG A;  3ZMT B;  1XMO T;  2X51 A;  4CI2 B;  2XQY A;  2XQ5 A;  2CHO A;  3Q9D A;  3K3O A;  4AKL A;  2XHE B;  1O3X A;  2V6X A;  3KBU A;  4U2Z A;  4TWD A;  2E9X B;  5J2T E;  2DCF A;  4K0K T;  4IIJ E;  3ONL C;  3KDS E;  1W09 A;  2PG8 A;  2NP9 A;  3CML A;  3L39 A;  2LHR A;  2H89 A;  3AE6 A;  3J7Y q;  2WCA A;  1XWM A;  3A8Y C;  2PBI A;  2WDR A;  2H7V C;  5AQI B;  2E5V A;  5HCM A;  5ABG A;  2EHO A;  3O4X E;  5HXS A;  3ETU A;  2X0H A;  4JV5 T;  2SPC A;  3AED A;  2I0M A;  4I50 E;  5IUX A;  2YEV C;  4EZH A;  2VL8 A;  3AAA B;  3IBP A;  3RYI E;  2HPL A;  4AXP A;  3ZMU B;  2C5K T;  1YQ4 A;  4ASK A;  4BAY B;  2VKH A;  3BQK A;  2W66 A;  3CVR A;  5FXW A;  5HXC A;  4P0A A;  4AIS A;  5FY7 A;  2LJL A;  2LM2 A;  2MOZ A;  3F2E A;  3UUN A;  2C5I T;  4X1I E;  1MIY A;  1HG2 A;  1W0B A;  4X1Y E;  4QH5 A;  5DQW A;  3L8R A;  5AQP B;  3AEC A;  4CXX A;  4EYY R;  2UXB T;  2WMO A;  2C0S A;  4DUY T;  2XM1 A;  2D0T A;  3SWH A;  5F8P A;  2JMK A;  3PJA J;  2X9X A;  5AQL B;  4EGW A;  5ABF B;  3VKG A;  4CN6 A;  2LRK A;  3PUQ A;  3CWZ B;  4AQF C;  3PUS A;  3P4W A;  1D0Z A;  3UU3 A;  4HFH A;  5TAO A;  1ZKE A;  4M1P A;  4DR2 T;  3FZF B;  5L3D B;  1V9D A;  3NVO A;  4PJN A;  5ABE A;  2VKD A;  4DUZ T;  2CM0 A;  4KX6 A;  3EAM A;  3RIF A;  3E22 E;  3EUH A;  4OYK A;  1US7 B;  3ZKR A;  4IDP A;  3DP7 A;  3AE7 A;  2XQ7 A;  1H7C A;  2KWH A;  2N1G A;  3A5X A;  3CPZ A;  4GIW A;  1S94 A;  4I55 E;  4KBM B;  4P09 A;  2LM9 A;  3LK2 B;  1HX1 B;  4UVB B;  2LHN A;  2W61 A;  4YJ3 E;  3VKH A;  2X67 A;  3RF1 A;  3ONJ A;  3AE5 A;  3SFE A;  3LDQ B;  2NOX A;  2W63 A;  4JEH B;  4Z8X A;  3VRA A;  4IRE A;  1Z8U A;  4JUY A;  2YN6 A;  2YDS A;  2WS3 A;  4QH4 A;  4WZX A;  4H63 H;  2VB6 A;  4U31 A;  3ZYL A;  4DV1 T;  3AEG A;  2BG9 A;  1WR0 A;  2QYW A;  4HWD A;  4MBQ A;  4TZ4 C;  4C90 A;  5LBQ B;  3RPU A;  3GWH A;  2NWB A;  1WLX A;  2RPA A;  2NW9 A;  2JIW A;  4PNI A;  2MBG A;  3PE0 A;  5HXH A;  4LFC T;  2JPF A;  4ZXL A;  1KK7 A;  4TUY E;  3EI0 A;  2L9Q A;  1UUR A;  2FJB A;  5KXJ A;  3C4W A;  3OYZ A;  3TKL B;  5AQM B;  3AVR A;  3K1S A;  4NPP A;  2EHO D;  2WP9 A;  2XAH B;  5AQT B;  4O4J E;  3N2K E;  3FHN A;  1IAP A;  3PUX F;  4UEM A;  3UFG A;  2MYS A;  4A56 A;  3C98 B;  3QNU A;  4AQF A;  3AEE A;  3CK6 A;  2CEA A;  3HKE E;  1VOM A;  2FUP A;  2ZMA A;  4GYR A;  3UFE A;  5LG3 A;  3CQC B;  4Z90 A;  3H3M A;  2V6Y B;  3E08 A;  3GN5 B;  3CQG B;  4PK6 A;  3LBX A;  5H6R B;  3ZMS B;  5M4Y A;  2E5L T;  5ADX L;  5AQK B;  5FNV E;  4LFA T;  4JBW F;  4Q25 A;  2LKH A;  3OKQ A;  2XSB A;  2VKJ A;  2UXN B;  2XAS B;  2BVM A;  4HKA A;  5EK2 A;  2BG9 E;  5L47 A;  4JI1 T;  5LMU T;  4OHF A;  3C4X A;  4TV9 E;  1HNW T;  2XAF B;  3N9M A;  4P1N A;  3PUA A;  1FJG T;  3ZJ2 A;  5JRE A;  4YSX A;  1D1B A;  3AE1 A;  3GMI A;  4U7Y A;  5AQO B;  1MIW A;  1FIO A;  3AEF A;  2WWV A;  4IE7 A;  5C2T A;  4H9O C;  2BKP A;  2JQH A;  1IBL T;  4OX9 T;  2CA5 A;  2YOE A;  3C4Z A;  5C3J A;  5CB4 E;  4XZC A;  4LF8 T;  2E9X A;  4ISS A;  4PFO A;  3ZSS A;  1MIV A;  3NWI A;  3TLU A;  5L3E B;  3R84 B;  2K3W A;  4IHJ E;  3RIA A;  4LF5 T;  4YY3 T;  4X65 T;  3N9P A;  1MMN A;  3O1J A;  2WY2 A;  5BR8 T;  2CE7 A;  2NW8 A;  2X0L B;  3PTR B;  4U7I A;  4ZI3 C;  1WCR A;  2J1D G;  4HFI A;  2IAK A;  5FKY A;  3R6N A;  2AXD S;  4GK0 E;  4WNK A;  2A2F X;  5JQG E;  4IL4 A;  1KEY A;  2VWA A;  4QH1 A;  2DLR A;  2WDV A;  3PDY A;  1N36 T;  3T8O A;  4EAH A;  3V5U A;  3CX8 B;  5FY1 A;  1L0V A;  4CZZ B;  5JRC A;  1EZ3 A;  3AXJ B;  2NR4 A;  2H3R A;  5LXT E;  1HCI A;  4DR1 T;  2BZB A;  5FMN A;  5FYM A;  4B3R T;  3ZT6 A;  3JC6 C;  1YW0 A;  3RQU A;  3JCF A;  3MZK B;  3QC9 A;  5LYJ E;  3IEE A;  2MPK A;  1ZEE A;  3LJC A;  4MFR A;  5KMG P;  2UXX B;  1G8X A;  2K24 A;  3PUV F;  4X20 E;  1VCS A;  2YU1 A;  3ZPO A;  1GQE A;  1HF8 A;  1NEN A;  2B1E A;  2PTF A;  5ABH A;  4N78 D;  1OED C;  5AQF B;  3PUR A;  4CXW A;  1BR1 A;  1M7K A;  2V7J A;  3S4U A;  2E8I A;  3ZST A;  4AI6 A;  4YSY A;  5FVL A;  2CLY B;  2UUC T;  3UUM A;  4GYS A;  4IT4 A;  3NZP A;  5LBM A;  4IDO A;  5AQJ B;  2IML A;  4YTN A;  2WAU A;  5CJ5 A;  4AKG A;  4YFS A;  2DWK A;  3FBL A;  2NTY A;  1ZP0 A;  5HEJ A;  5LGN B;  2AE9 A;  4G2A A;  3RIU A;  2XZE A;  1T98 A;  3ZLI A;  4JI6 T;  1E7P A;  5JR9 A;  4KUM B;  3PUW F;  2JQQ A;  2YDQ A;  4EB6 E;  2WWU A;  4ZS3 A;  2BKN A;  3A7M A;  4CI1 B;  2WBL A;  4DV2 T;  4PJJ A;  4WYV A;  1NWM X;  2XSA A;  3JAD A;  4P0B A;  3OBV E;  4DID B;  1R8I A;  4E7S A;  4KHP T;  3IHR A;  1MNE A;  4YTP A;  2D0U A;  2X9Y A;  2XTL A;  4EIW A;  2LSI A;  2NW7 A;  2VKO A;  3BQL A;  3KVB A;  2LE8 A;  4ZOL E;  4I43 B;  3AE3 A;  4MLK A;  2B76 A;  5L3C B;  2I59 A;  3AB3 B;  1D0Y A;  2XJ7 A;  5FXX A;  2Q9Q B;  4JI3 T;  3W15 B;  4JI4 T;  2V7I A;  4X1K E;  4DV6 T;  1I94 T;  3EAB A;  2Q9Q D;  2M6I A;  1XMQ T;  2FJE A;  5EZY E;  5FP3 A;  3H37 A;  4PK5 A;  5AQQ B;  4X66 T;  2G0U A;  3CKD A;  5JDF A;  2BDE A;  4OK0 A;  2M67 A;  2IC9 A;  5LCY A;  3U78 A;  2V7K A;  5LHG B;  3UQ7 A;  4ANJ A;  4L0R A;  4EED A;  1IBM T;  4G63 A;  3OTO T;  3LK3 B;  3N5L A;  2IW5 B;  2D9D A;  5BMV E;  4ZHQ E;  1KNR A;  1MMA A;  3OYX A;  4IDZ A;  3L3P A;  2CWO A;  3CX7 B;  4ZS2 A;  4B3S T;  4L9I A;  3FZK B;  4JI8 T;  2BBJ A;  4PK4 A;  4DV4 T;  2CPT A;  3WI3 A;  4LF7 T;  1WFD A;  2UXC T;  1UK5 A;  2BS2 A;  3P7I A;  5AQR B;  3PV0 F;  5FL0 A;  5AFU L;  5LHH B;  3ANW B;  2DL1 A;  2JRK A;  3WAJ A; 
#chains in the Genus database with same CATH homology
 2CXL A;  3MA9 A;  1UCU A;  2W62 A;  4UVC B;  4OYJ A;  2K9A A;  2V1D B;  4IE4 A;  5LJN A;  3UUL A;  1LRZ A;  1SA0 E;  3ZMZ B;  3PUG A;  5C8Y E;  1YKE B;  2VK9 A;  4IGU A;  3OJA A;  2K5B B;  4YHJ A;  5CA1 E;  1X79 A;  4DO0 A;  3VU7 H;  2Q9Q C;  1NAF A;  2W0G A;  2RA1 A;  2KIN B;  4IE6 A;  1QUU A;  2OA5 A;  3ZYM A;  4QX8 B;  3RYH E;  4PW8 A;  2JMH A;  2GK9 A;  5HAX A;  4C90 A;  1LVK A;  3RYF E;  4AKH A;  3QK6 A;  4MAL A;  2ZM2 A;  5EK4 A;  3H3A A;  2X9H A;  3N2G E;  3O1H A;  3PU3 A;  4H9S E;  4FI5 A;  2KND A;  5DJQ C;  3HR0 A;  3I9W A;  4PJM A;  3MKD A;  3N9L A;  5ETW A;  3LG7 A;  5FXZ A;  2Y6X A;  2QA7 A;  3AA6 B;  1FMW A;  2EHO B;  4O4L E;  3FXE B;  4UF0 A;  4HFV A;  4O4H E;  4C91 A;  2Q9Q A;  2D2S A;  4IE0 A;  2PFV A;  4NUV A;  3FXD B;  1Y64 B;  1FMV A;  3HI2 A;  3C51 A;  4E7Z A;  4TX5 A;  5CA0 E;  3K8P C;  1WYC A;  4PFP A;  4PAG A;  1UX5 A;  4HEA A;  3EDU A;  1BR0 A;  2CWY A;  4QHO A;  5IYZ E;  1HTJ F;  3GA8 A;  5LGU B;  3C50 A;  2KWI B;  2WM9 A;  2E9X C;  3O9X A;  3SOL A;  1LVF A;  2QGS A;  3AA7 B;  3JC6 D;  4IE5 A;  4CXX A;  3KFW X;  4BA9 A;  1BR2 A;  2X66 A;  5HXR A;  1CUN A;  3ETV A;  3WAK A;  2ODV A;  2ODU A;  3C64 A;  3F31 A;  3UT5 E;  4XAX B;  5LNK A;  4WW0 A;  5F3J A;  4KP3 C;  2Y48 B;  2NTX A;  4ERR A;  3ZCI A;  4ZI3 D;  4WBO A;  3E0Z A;  1OXZ A;  3I9Y A;  3AA1 B;  4U74 A;  5LG4 A;  3KV4 A;  4QKN A;  2C5J A;  3EDV A;  4KMC A;  3AA0 B;  4B6X A;  2LSG A;  3KV5 A;  5JR9 C;  5JR9 B;  3HKD E;  4HTE A;  2ES0 A;  2N9D A;  4H9Q C;  4U72 A;  5JDL A;  1MMG A;  4H9R C;  4WBN E;  3HA4 A;  3HKC E;  3O1I A;  1KNZ A;  3I0Q A;  1Z0P A;  3ZN0 B;  4QXB B;  1D0X A;  3HL6 A;  3ZN1 B;  3Q2M A;  5L3G B;  3LK4 2;  4CQI A;  3ZC0 A;  1BR4 A;  3UTK A;  1HG5 A;  1ZV4 X;  5FXV A;  2KMF A;  2LEH A;  4IST A;  5A1L A;  2E9X D;  2N2N A;  3BK9 A;  4QXH B;  5HWX A;  3AAI A;  3ZCJ A;  3RRW A;  2LSY A;  4I4T E;  3AAE B;  2W00 A;  5HYA A;  3ZJ1 A;  3F57 A;  3N9O A;  2YK0 A;  3ZC1 A;  3FBZ A;  3ONX A;  5LOV E;  3N2O A;  2DHR A;  4UXN B;  4DVD A;  2LOP A;  1OWA A;  4O4I E;  3RH3 A;  4DMV A;  2KZ7 B;  3L09 A;  4J2C A;  2LSJ A;  2ACX A;  1HX8 A;  1QSD A;  2CXF A;  3DJB A;  5IHY A;  2Y8D A;  3KV9 A;  4YLH A;  5HXE A;  2H7O A;  2RP4 A;  2ZM0 A;  2LSK A;  1D1A A;  4ZI2 C;  3KV6 A;  1U4Q A;  3ZYK A;  3NZQ A;  3KVA A;  3ZMV B;  4OFZ A;  5LHI B;  1UX4 A;  3LFM A;  5KDM C;  3B57 A;  2ZLY A;  2XAG B;  4QXC B;  3K3Q C;  3KBT A;  1MMD A;  3RC8 A;  2HPJ A;  3AVS A;  4O2A E;  1D1C A;  2X9W A;  4QWN B;  3GN5 A;  1ZHC A;  4EOZ B;  4O8S A;  4UIG A;  3N9Q A;  2K48 A;  3RC3 A;  3VHL A;  5LA6 E;  3NRX A;  1G73 A;  1IZN B;  3MXZ A;  2A3D A;  1WRD A;  3P8C D;  2CLY C;  3I1A A;  2A72 A;  1LKX A;  1SHZ C;  3RKO A;  4DMW A;  4TN7 B;  4BJN A;  3DTO A;  2L8K A;  3K3N A;  4FJO A;  2WMN A;  4ADZ A;  2KLQ A;  2ZM8 A;  3B13 A;  5H6Q B;  4ZI2 D;  2XUE A;  3U3I A;  3ZEF B;  4UF0 B;  4L5G A;  5EK3 A;  4HE8 A;  4CXY A;  4DND A;  1HFA A;  1YKH B;  3IF8 B;  3PU8 A;  3RX6 A;  2CXD A;  1YD8 G;  1HS7 A;  3NRY A;  2IC6 A;  3Q5W A;  3BQI A;  2JJ9 A;  1B7T A;  3MK7 C;  3KIN B;  1S35 A;  5L3B B;  5HWY A;  4F6R C;  5L3F B;  4V1A v;  3Q5X A;  5FY0 A;  3RRC A;  4QX7 B;  4UVA B;  1U5P A;  4BJM A;  3HKB E;  1MND A;  3CX6 B;  3NBX X;  5GON E;  5LJM A;  3ANW A;  4TV8 E;  4PJL A;  4JEU B;  3MAC A;  3M65 A;  4UV9 B;  2V7L A;  4H63 V;  5LP6 E;  4GOU A;  5JVD E;  4O2B E;  3RYC E;  1IJ5 A;  2PJQ A;  5L2L A;  4H9P C;  2P9B A;  2DNX A;  3FB2 A;  2XAJ B;  5E0O A;  5LGT B;  2Z6E A;  4HN9 A;  4XBF B;  5J1G A;  3QUJ A;  2MTQ A;  2CCQ A;  3SRZ A;  4H9N C;  4GK5 E;  2XAQ B;  4UV8 B;  4ILU A;  1WR6 A;  2LT3 A;  5JDN A;  4AKR B;  1E1H B;  5KX5 E;  2WSS V;  4MHC A;  1IJ6 A;  2DI4 A;  5JDM A;  3LBX B;  3MJX A;  3SS1 A;  4HGA A;  4CI3 B;  5JDQ A;  3CQX C;  4K0U A;  4EYU A;  3UUX B;  4EXT A;  2V7M A;  2D5U A;  2BVL A;  3D0T A;  2KT9 A;  1VRB A;  3ESL A;  2VAS A;  5JDH A;  5DAB A;  2LOS A;  1WYB A;  2KXP B;  3EVY A;  4UEL A;  2HH7 A;  2V26 A;  3I0O A;  5DQV A;  3J9X 1;  2YU2 A;  5JH7 E;  1AJ3 A;  2X68 A;  2YIN A;  2L3L A;  4EZ4 A;  2CMR A;  3N9N A;  4NUU A;  3V5S A;  4YJ2 E;  5JRC B;  4JLE A;  1FEW A;  4ZI7 E;  2EHO C;  2DWG A;  3ZMT B;  2X51 A;  4CI2 B;  2XQY A;  3Q9D A;  3K3O A;  4AKL A;  2XHE B;  1O3X A;  5J2T E;  3KBU A;  2E9X B;  2DCF A;  4IIJ E;  3KDS E;  2PG8 A;  2NP9 A;  3CML A;  4AKI A;  2LHR A;  3J7Y q;  5J2U E;  2PBI A;  2H7V C;  5HXS A;  2EHO A;  3O4X E;  3ETU A;  2SPC A;  4I50 E;  2YEV C;  4EZH A;  2VL8 A;  3AAA B;  3IBP A;  3RYI E;  2HPL A;  4AXP A;  3ZMU B;  2C5K T;  4BAY B;  4ASK A;  2VKH A;  3BQK A;  3CVR A;  5FXW A;  5HXC A;  4P0A A;  5FY7 A;  2LJL A;  2MOZ A;  3F2E A;  3UUN A;  2C5I T;  4X1I E;  1MIY A;  1HG2 A;  4X1Y E;  5DQW A;  4EYY R;  2WMO A;  2C0S A;  2D0T A;  3SWH A;  5F8P A;  2JMK A;  2X9X A;  3VKG A;  3PUQ A;  3CWZ B;  4AQF C;  3PUS A;  1D0Z A;  5TAO A;  1ZKE A;  4M1P A;  5L3D B;  1V9D A;  4PJN A;  2VKD A;  2CM0 A;  3E22 E;  3EUH A;  4OYK A;  1US7 B;  3DP7 A;  4DBR A;  1H7C A;  2KWH A;  2N1G A;  3A5X A;  3CPZ A;  4GIW A;  1S94 A;  4I55 E;  4KBM B;  4P09 A;  2LM9 A;  3LK2 B;  4UVB B;  2LHN A;  2W61 A;  4YJ3 E;  3VKH A;  2X67 A;  2NOX A;  2W63 A;  4JEH B;  4Z8X A;  4JUY A;  4H63 H;  2VB6 A;  3ZYL A;  4MBQ A;  4TZ4 C;  5LBQ B;  3RPU A;  3GWH A;  2NWB A;  1WLX A;  2NW9 A;  4PNI A;  2MBG A;  3PE0 A;  5HXH A;  2JPF A;  1KK7 A;  4TUY E;  2L9Q A;  3C4W A;  3OYZ A;  3TKL B;  3AVR A;  2EHO D;  2XAH B;  4O4J E;  3N2K E;  3FHN A;  1IAP A;  4UEM A;  4A56 A;  4AQF A;  2MYS A;  3C98 B;  2CEA A;  3HKE E;  1VOM A;  4GYR A;  2ZMA A;  3UFE A;  3CQC B;  3GN5 B;  3E08 A;  4PK6 A;  3CQG B;  5H6R B;  3LBX A;  3ZMS B;  5M4Y A;  5ADX L;  5FNV E;  3OKQ A;  2VKJ A;  2UXN B;  2XAS B;  2BVM A;  4HKA A;  5EK2 A;  4OHF A;  3C4X A;  4TV9 E;  2XAF B;  3N9M A;  3PUA A;  3ZJ2 A;  5JRE A;  1D1B A;  3GMI A;  1MIW A;  1FIO A;  4IE7 A;  4H9O C;  2CA5 A;  3C4Z A;  5CB4 E;  4XZC A;  2E9X A;  4ISS A;  4PFO A;  1MIV A;  5L3E B;  3R84 B;  4IHJ E;  3N9P A;  1MMN A;  3O1J A;  2CE7 A;  2NW8 A;  2X0L B;  3PTR B;  4ZI3 C;  4AQG A;  2J1D G;  4DBQ A;  2IAK A;  3R6N A;  4GK0 E;  4WNK A;  2A2F X;  5JQG E;  2VWA A;  2DLR A;  3PDY A;  3T8O A;  4EAH A;  3V5U A;  3CX8 B;  5FY1 A;  4CZZ B;  5JRC A;  1EZ3 A;  5LXT E;  2H3R A;  1HCI A;  2BZB A;  5FMN A;  5FYM A;  3JC6 C;  1YW0 A;  3MZK B;  3QC9 A;  5LYJ E;  3IEE A;  3LJC A;  1ZEE A;  4MFR A;  5KMG P;  2UXX B;  1G8X A;  2K24 A;  4X20 E;  3ZPO A;  2YU1 A;  1HF8 A;  2B1E A;  4N78 D;  3PUR A;  4CXW A;  1BR1 A;  2V7J A;  3S4U A;  2E8I A;  4AI6 A;  2CLY B;  3UUM A;  4GYS A;  3NZP A;  5LBM A;  4AKG A;  2WAU A;  4YFS A;  2DWK A;  3FBL A;  2NTY A;  5LGN B;  4G2A A;  3ZLI A;  1T98 A;  5JR9 A;  4KUM B;  2JQQ A;  4EB6 E;  2WWU A;  4ZS3 A;  4CI1 B;  2WBL A;  4PJJ A;  1NWM X;  4P0B A;  3OBV E;  4E7S A;  3IHR A;  1MNE A;  2D0U A;  2X9Y A;  2XTL A;  4EIW A;  2LSI A;  2NW7 A;  2VKO A;  3BQL A;  3KVB A;  2LE8 A;  4ZOL E;  4I43 B;  4MLK A;  5L3C B;  2I59 A;  3AB3 B;  1D0Y A;  5FXX A;  2Q9Q B;  3W15 B;  2V7I A;  4X1K E;  2Q9Q D;  5EZY E;  5FP3 A;  3H37 A;  4PK5 A;  2G0U A;  3CKD A;  5JDF A;  2BDE A;  4OK0 A;  2M67 A;  2IC9 A;  5LCY A;  3U78 A;  2V7K A;  5LHG B;  4ANJ A;  4L0R A;  4G63 A;  3LK3 B;  3N5L A;  2IW5 B;  5BMV E;  4ZHQ E;  1MMA A;  3OYX A;  4IDZ A;  3L3P A;  2CWO A;  3CX7 B;  4ZS2 A;  4L9I A;  4PK4 A;  3WI3 A;  5AFU L;  3P7I A;  5LHH B;  3ANW B;  5JDG A;  2JRK A;  3WAJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...