2VQFT

Modified uridines with c5-methylene substituents at the first position of the trna anticodon stabilize u-g wobble pairing during decoding
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAVQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S RRNA
publication title Modified Uridines with C5-Methylene Substituents at the First Position of the tRNA Anticodon Stabilize U.G Wobble Pairing During Decoding.
pubmed doi rcsb
total genus 35
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2008-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 2vqfT00
4X62T 4DUYT 1J5ET 1XNRT 1HNZT 1N33T 4JI1T 4LF4T 2F4VT 1I94T 4YY3T 4B3MT 2UUCT 4LF5T 2UUAT 1HNWT 1N32T 1IBMT 4B3ST 4LF8T 4DV0T 1IBLT 1HNXT 4KHPT 4GKJT 2UXDT 5IWAT 4DR6T 4LFCT 4DR4T 1N36T 4DUZT 5BR8T 2VQET 4JI5T 4DR1T 3T1HT 4DV1T 4JI6T 4DV4T 4NXNT 1N34T 4JYAT 4DR2T 5LMUT 1XMOT 4JI7T 4JI0T 2E5LT 2UXCT 4DV6T 4OX9T 4B3RT 2ZM6T 3T1YT 4LF7T 2VQFT 1HR0T 3OTOT 5LMNT 1XNQT 1XMQT 2HHHT 4DV3T 4X65T 4YHHT 2UXBT 4B3TT 4DV7T 4LFBT 4X66T 4DR3T 4LF6T 2UUBT 4JI3T 4LFAT 4NXMT 4GKKT 4JV5T 4K0KT 4JI8T 4JI2T 4DV2T 4DV5T 4DR7T 4X64T 1IBKT 2UU9T 4DR5T 1FJGT 4AQYT 4JI4T 4LF9T
chains in the Genus database with same CATH superfamily
2Y48B 3ZMTB 4JEUB 5EK3A 4HN9A 2VASA 2LHNA 3KINB 4LF5T 2LKHA 5LGTB 4QWNB 3F57A 4LF8T 1E1HB 3RRCA 2ODVA 5AQGB 4U33A 4TZ4C 5HYAA 3TLTA 3ZSSA 2X9WA 4JI5T 3AE9A 2W63A 1Y64B 3AE1A 3EDVA 4OYKA 4U72A 3FHNA 3R84B 1ZEEA 1VRBA 2CM0A 3ZMVB 4QXCB 1JNRA 4TNWA 3ZMZB 2E9XC 4UV8B 5JDFA 1HR0T 5AQIB 5ETWA 1JNZA 4MFRA 2YK0A 4TNVA 2IDOB 5AQOB 3ESLA 3L8RA 4WW0A 1XDPA 4ZEYA 3LDQB 4CXYA 3NKZA 4CI2B 2MPKA 1ZP0A 2QYWA 1D0XA 3AE8A 4ZOLE 2WDQA 2RP4A 1D1CA 3PU3A 3UU4A 3RYHE 3TLUA 2V26A 4IDNA 4UV9B 4U3CA 4XAXB 4CI3B 1YW0A 1BR1A 4WBNE 1MNDA 1XZYA 4ILUA 1OEDB 1J5ET 2LSIA 3ZYLA 5JRCB 1N33T 1HX8A 2HN1A 4P1NA 5AQNB 3PDYA 4NUUA 4CQIA 1SUMB 2XAQB 2ZMAA 2UXDT 1N36T 3AE2A 3HR0A 5L4HA 3ZKRA 2L3LA 2DI4A 4EZHA 1YQ4A 3T1HT 1MMGA 3B5MA 5L2LA 3CQGB 1M62A 2SPCA 3JADA 3CIRA 4J2CA 2V1DB 4G63A 2OLTA 4MBQA 2W66A 3KV5A 3IF8B 1X79A 5KMGP 1W0AA 1BR2A 4I50E 5HEOA 3CX6B 4BJNA 2PBIA 4UF0A 4O4JE 4Z91A 5HEGA 2JRKA 3ZLIA 2BBHA 2RPAA 2VKOA 5A1LA 4OHFA 1OEDC 2X9HA 3ZMSB 2CHNA 3UFGA 4EAHA 2XPKA 2BS3A 5FKYA 4CN6A 4DNDA 4I4TE 2BG9C 4PJJA 1KEYA 5F8PA 2C0SA 3ZCJA 3LFMA 2UUAT 1ZOYA 2BS4A 2JQKA 3CX8B 1U4QA 1NAFA 3PUVF 5H6QB 3UQ4A 4DIDB 1EZ3A 3JC6C 2W0GA 4H9NC 1FMWA 3AXJB 3QOFA 5DQVA 3CMLA 3N2GE 4KHZF 3R6NA 2KT9A 4QXHB 4ZS2A 2QRXA 4I43B 1S94A 2CBIA 2DCFA 4AKRB 1XDOA 3MA9A 4IE7A 3LK42 3FZLB 5CFBA 2VQFT 3ONLC 5FNVE 3CWZB 4AKGA 2FJAA 4CZZB 3PUXF 3UQ7A 4LF6T 3E08A 4XBFB 4AQFC 3PUWF 4JI8T 5AQVB 2KMFA 5J2UE 3BQLA 4IDOA 1HTJF 4IE5A 4X64T 2BBJA 2IHR1 2WCAA 1IBKT 3N9QA 4HFCA 2E2AA 4EB6E 2KNDA 3AA7B 2LHRA 2MAWA 3PURA 4ANJA 3FXEB 2XSAA 1HNWT 2LLYA 2V7MA 3C98B 2XAJB 3AE5A 2Q9QD 3F2EA 3H37A 2ZLYA 4UELA 1KFYA 3FZHB 2XSBA 2LRKA 1UX4A 2V7LA 4LFCT 4UR9A 1IJ6A 4YSXA 3RGLA 4BJMA 2VWAA 4DR1T 5JREA 4JYAT 3EDUA 2WY2A 3LK3B 4PNIA 1YD8G 2WBLA 4ZI2C 2Y8DA 4DBQA 3AEEA 5F3JA 2UXCT 5C3JA 2NTXA 2N1GA 2CEAA 2J62A 4H63H 2CE7A 5JR9B 3N9MA 2BVLA 5FY1A 2YDSA 2XQ3A 3L09A 2FUPA 2H88A 3QK6A 4ILCA 3JAEA 4YSYA 2JJ9A 3NWIA 4HWFA 4DBRA 1M7KA 4GYSA 3BQIA 3ZYMA 5JRCA 3RYFE 3AB3B 4U2ZA 3CQXC 4B6XA 2HN2A 5FXZA 2ACZA 4JV5T 1FEWA 5LBMA 1UCUA 2WP9A 3ZT5A 5ABGA 4DV2T 5IHYA 2V8SV 4HE8A 2UU9T 2K9AA 3P4WA 2CCQA 2LM2A 3P50A 5LBQB 4ZI3C 2X67A 2E9XD 4DO0A 4YY3T 3IA3A 2J47A 4UIGA 3AE7A 5FP3A 3LBXB 4EOZB 5AQUB 2Q9QB 5LOVE 3S4UA 5LHGB 3UUBA 1UURA 4ZS3A 3RQWA 2E8IA 2VB6A 5LG4A 4EV6A 2C5IT 3N9LA 3VR9A 1KNPA 5JR9C 4ZI7E 2NOXA 2LT3A 4NIQA 3RYCE 5JH7E 3I1AA 4HGAA 5ABFA 4OX9T 3UU3A 2BG9E 4LF7T 5LA6E 4HFDA 5HCJA 5C8YE 3AEFA 4IREA 5ABHA 3FBZA 3EHZA 3OBVE 1HCIA 3P4SA 5LGUB 3VRAA 3AEDA 4H9PC 1O3XA 2L9QA 2WQYA 2Q9QC 2XQYA 3H3MA 4ILAA 4P0AA 4JEHB 3AA1B 4X1KE 2E5VA 3E0ZA 4JI1T 4NPPA 5FVKA 2UUCT 3CVRA 3LJCA 1XWMA 1IBMT 3UTKA 3K3OA 5AFUL 3P4PA 4KMCA 1Z8UA 3K3QC 1ZHCA 2YU1A 4H9RC 1IAPA 4H63V 2WDVA 3A7MA 3GN5B 4CI1B 4MHCA 3RIAA 5JDNA 1G8XA 3PUGA 4JI7T 1KNRA 4ILBA 1MMNA 4AKLA 4ADZA 2LM9A 2WU2A 3PJAA 4QH4A 2XUEA 2AXDS 4PK5A 2LSGA 4DV3T 4UXNB 5AQFB 3RRWA 3OJAA 4U2YA 2CXDA 2V6XA 4LFBT 4O4IE 3QC9A 4A56A 3RC8A 5JTGA 4K0KT 3F31A 2X66A 3JC6D 4QXBB 4EEDA 3M65A 5AQJB 3FZKB 3WAKA 1YKEB 4M1PA 2IUBA 4PAGA 3OPCA 3P7IA 5JQGE 3IHRA 5HEUA 3M3ZB 2YDQA 3KV9A 4JBWF 3U78A 3SS1A 5JR9A 5AQTB 5AQQB 4X1IE 3HKDE 4UVAB 5FMNA 3PV0F 5JDMA 5JDLA 2MBGA 3UUMA 3UFEA 4DMVA 3MACA 2XQ5A 3E22E 5J0ZA 3AAAB 3H3AA 4ISTA 4WYVA 2BG9B 2ZM6T 2LOSA 4YHJA 3UUXB 1HG5A 2UXXB 5LYJE 4PJMA 1D0ZA 5FYMA 2X9XA 2JQ9A 2IAKA 1FIOA 5L3CB 3V5UA 3HI2A 2KWHA 3LBXA 4EIWA 2Q9QA 4U7YA 4DR7T 4TV9E 1SE7A 2W4XA 4DR5T 3RHWA 4BAYB 4F6RC 2KZ7B 4YTMA 2VL0A 4ZI2D 2DLRA 3LK2B 5JDGA 2CWOA 4OK0A 4GK0E 2WB5A 4ASKA 5HXHA 1IBLT 2CHOA 1S35A 5KDMC 4DR4T 2PJQA 4O8SA 3D0TA 3BK9A 1E2AA 2AE9A 2VURA 3LSVA 3NVOA 3AVSA 3OYXA 4DR2T 4TWHA 4YJ2E 4C91A 1T72A 3AECA 2RA1A 1G73A 2MOZA 1LRZA 2W67A 4HFEA 3C4XA 3ONJA 4ZI3D 3OTOT 5LMNT 3ANWA 4Q25A 2M6IA 2B1EA 4F8HA 3MKDA 2CXLA 3CX7B 3I9WA 2BDEA 3PU8A 2E9XA 1QSDA 3KV4A 4X66T 4DR3T 4HTEA 2V7KA 2X0HA 3ZEFB 1UX5A 4DV5T 5CA0E 3J9X1 3C4WA 3MZKB 5LNKA 3RX6A 1FJGT 4PJLA 2V6YB 2XTLA 3GN5A 1WYBA 2LKGA 2C5JA 3PUAA 3AE4A 1H7CA 3UU8A 5FXXA 3PUYF 2CBJA 4WBOA 4KUMB 3OYZA 4L0RA 3VR8A 1W0BA 3PTRB 3C51A 4B3ST 1BR0A 3UU5A 1MMAA 5LG3A 1CHUA 2BKNA 5LHIB 4PJNA 3O1HA 2M6BA 2PFVA 2WMNA 4DUZT 3C4ZA 3HL6A 5AQPB 3RIUC 1D1AA 1ZV4X 1MIVA 2YDRA 4EXTA 5LMUT 3MXZA 3C50A 5AQLB 3EVYA 5HEHA 3I0OA 2EHOC 1QLBA 5LGNB 4TN7B 5L47A 3BQKA 1NENA 4ZXLA 2FJBA 4XZCA 4YXDA 3FZFB 3AE3A 1XMQT 3AEAA 4O2AE 2PG8A 2YEVC 3UULA 4B3TT 5KX5E 4DV7T 4I55E 3VRBA 3B57A 4GKKT 4QH1A 1R8IA 5CGMA 4P0BA 2XASB 1QUUA 2ES0A 4QH5A 2PTFA 3RH3A 5EZYE 2JIWA 2HPLA 2NW9A 4CXXA 2DWKA 2A2FX 1WR0A 1OEDA 4LMJA 4X62T 5LJMA 4IE6A 1UK5A 4LF4T 2D2SA 5H6RB 3ZPOA 2YU2A 3RI5A 5AQKB 3PUSA 2V5DA 4KBMB 5E0OA 1N32T 5J1GA 3N9NA 4DV0T 2BG9A 1HX1B 3GMIA 3NRXA 4EYYR 4GKJT 3SOLA 5IWAT 5CB4E 5BR8T 2XAFB 1YXRA 4NXNT 5JDQA 4WNKA 1V9DA 5L3FB 4LMLA 5JVDE 2BS2A 3AVRA 5DABA 2XJ7A 3ZCIA 3JAFA 3AA0B 5FXVA 2IC9A 4TUYE 4UEMA 2DHRA 3IBPA 4PK6A 4C90A 4AQGA 5M4YA 3CQCB 4YLHA 1WYCA 3G06A 3N9OA 4L9IA 4UF0B 4YHHT 2WM9A 2XY8B 3AAEB 4E7SA 5KXJA 4CXWA 2UUBT 5HXCA 1NEKA 3RC3A 3HKEE 2X9YA 3K3NA 4CN4A 1UGOA 4IL4A 2VKHA 4AQFA 3OVUA 2A3DA 2WAUA 1WRDA 3C64A 1XNRT 4DVDA 2ZM0A 1VCSA 4G2AA 4HKAA 4HFHA 4H9QC 5FVLA 5LXTE 2K48A 3HKCE 1D1BA 2KLQA 4H9OC 3ONXA 4A97A 3AXJA 4QHOA 3TLWA 2H3RA 2W00A 3FB2A 5L3GB 3RQUA 4DV4T 5HXEA 1T98A 4P09A 3I0QA 4COFA 1T7SA 2NWBA 1MNEA 1XMOT 5FY7A 2E5LT 1DU2A 1T8BA 2IMLA 3T1YT 2K5BB 1XNQT 2CXFA 2NW8A 3N5LA 3GA8A 3T8OA 5HAXA 1SA0E 2X68A 2K24A 2X0YA 5IYZE 2YINA 3RKGA 1WCRA 3TLVA 2UXNB 3Q2MA 3UU6A 2IC6A 5CJ5A 4H9SE 4V1Av 4HWHA 2CLYC 3N9PA 5IUXA 2KXPB 4UVCB 2KSRA 4OFZA 4JLEA 3P8CD 1FMVA 3Q5WA 2XQ4A 5HXSA 5LB7B 5JDHA 2NW7A 2QGSA 1E7PA 3EAMA 5AQSB 3QUJA 1HNXT 4KHPT 2WZIA 4AKIA 4AXPA 2OA5A 2IW5B 5BMVE 2BZBA 1J1JA 1YKHB 1W09A 4TV8E 3ETVA 3W15B 1SHZC 4MLKA 4IGUA 2QA7A 4AKHA 5DQWA 3P4RA 3KVAA 4B3RT 1L0VA 3NZPA 4YFSA 3AEGA 3ABVA 5FXWA 4NUVA 3ZN0B 3L3PA 4HWIB 3TLSA 5DJQC 5HWYA 4QKNA 3B13A 2D0UA 4PW8A 4Z8XA 1KNZA 4LFAT 5L4EA 2J1DG 3O4XE 4E7ZA 4DMWA 2JPFA 2D9DA 4A5XA 3N2OA 2DL1A 4ZZBA 2ODUA 2WS3A 2D5UA 2W2UA 3LG7A 4U74A 2CA5A 2H89A 4JI4T 3TKLB 2NTYA 4IDZA 3ZT6A 2QVAA 3O9XA 4L5GA 1HNZT 2F4VT 3ZMUB 4B3MT 2CMRA 2EHOD 4GYRA 2XM1A 4HFVA 2CRBA 1HF8A 3V5SA 4IDPA 3ZJ1A 5GONE 2DWGA 2LSYA 2M67A 3UT5E 2ZM8A 3SFEA 2LSJA 3ZYKA 2X51A 5AQMB 3ZN1B 4GK5E 2L8KA 2X0LB 4IE4A 1LVKA 4CN1A 3AAIA 4EEBA 5C2TA 4OYJA 2H7OA 3SFDA 3ZJ2A 3Q5XA 2FJDA 5ABFB 3Q5EA 3CKDA 4HWCA 3VHLA 3WAJA 4EZ4A 5EK4A 4TWFA 3O1JA 2VKDA 2WZHA 1IJ5A 2UXBT 2W62A 2G0UA 3RIFA 1D0YA 1HFAA 2YN6A 4MALA 5AQHB 4ERRA 4ZHQE 5CA1E 1NWMX 2XQ8A 2V7IA 3X1DA 1HS7A 1LVFA 3N2KE 4YJ3E 2NP9A 5F5WA 2LRLA 2JQHA 2NR4A 5AQRB 4Z90A 4N78D 3PE0A 3DJBA 4JUYA 1VCTA 2I59A 1OWAA 4AIUA 3MK7C 5EK2A 2EHOB 1WLXA 2LEHA 1KF6A 2I6HA 2WU5A 2Z6EA 3O1IA 4QX8B 1MIWA 3J7Yq 4YT0A 1W9RA 4KI0F 3QB5A 2VVSA 3I9YA 2VQET 2MYSA 2ACXA 3AEBA 3VKGA 3K8PC 4IDQA 2LJLA 4ISSA 3U3IA 3A8YC 3EI0A 2A72A 4JI0T 4ZZCA 3IEEA 5HXRA 3FZMB 4DV6T 2LOPA 1CUNA 4X1YE 3GWHA 4QX7B 4IHJE 2KINB 2WMOA 3OKQA 4PFPA 4HFIA 4GOUA 2HHHT 5L3DB 1Y01A 4X65T 3ZC0A 4FI5A 1KK7A 5ABEA 3L39A 2XHEB 2VVNA 3ZT7A 2LE8A 4JI2T 2WWVA 3KBTA 2XQ9A 4KX6A 4TWDA 5HEJA 1J5WA 4AQYT 2XAGB 3SWHA 4LF9T 3EUHA 4AI6A 3SRZA 3HKBE 4FJOA 2WSSV 3Q9DA 2XZEA 2HH7A 1YQ3A 1VOMA 2WWUA 3VU7H 2C5KT 2GK9A 4YSZA 2J4GA 3QB5K 4U31A 4DR6T 2CWYA 2VK9A 4EGWA 2XQ6A 4UVBB 2OV9A 4X5TA 1Z0PA 4DV1T 2XQAA 2H7VC 1N34T 2BKOA 3KFWX 3NRYA 4HEAA 1WFDA 1BR4A 1MIYA 2BKPA 3A5XA 3PJAJ 3ZSTA 3DP7A 3HA4A 2XQ7A 1I6ZA 5HCMA 2B76A 3PUZF 3RF1A 1LKXA 2KWIB 2WDRA 2BVMA 3ETUA 4KP3C 2VKJA 4X20E 3KDSE 5HWXA 3KBUA 2I0MA 3PUQA 5J2TE 1HG2A 2JQQA 5L3BB 2N2NA 4HWDA 4JI3T 4NXMT 3RPUA 4EYUA 3K1SA 2R6GF 5ADXL 1MMDA 3CK6A 5LHHB 4K0UA 4HFBA 3AA6B 3KVBA 3KV6A 4BA9A 5TAOA 3QNUA 1ZKEA 3MJXA 1GQEA 4DUYT 4IE0A 1OEDE 2W61A 4I0UA 2Y6XA 2MTQA 1I94T 2HPJA 3P4QA 2XAHB 2CPTA 4U7IA 3EABA 3FBLA 3JCFA 5FL1A 4WZXA 1IZNB 2V7JA 3AE6A 4A98A 3ZC1A 5FY0A 4YTPA 1US7B 5FL0A 3DTOA 2P9BA 3RYIE 4JI6T 3VKHA 4PK4A 4LMKA 2IIUA 4PFOA 1U5PA 3WI3A 2ZM2A 2CLYB 2K3WA 4YTNA 2FJEA 4TX5A 3RIUA 1OXZA 2JMHA 2YKSA 2LSKA 4IIJE 4IL9A 3FXDB 3ANWB 4IT4A 1X9BA 2V5CA 2DNXA 2JMKA 5L3EB 1UUSA 2FBWA 2YOEA 2XM2A 2D0TA 2EHOA 3NBXX 4O2BE 2E9XB 3Q5DA 3CPZA 2VL8A 5LP6E 4GIWA 3RKOA 5LJNA 3RLFF 2N9DA 1B7TA 2A9UA 4O4HE 4O4LE 3NZQA 5LCYA 3UUNA 4AISA 2V6YA 1AJ3A 1WR6A
chains in the Genus database with same CATH topology
4X62T 4DUYT 1J5ET 1XNRT 1HNZT 1N33T 4JI1T 4LF4T 2F4VT 1I94T 4YY3T 4B3MT 2UUCT 4LF5T 2UUAT 1HNWT 1N32T 1IBMT 4B3ST 4LF8T 4DV0T 1IBLT 1HNXT 4KHPT 4GKJT 2UXDT 5IWAT 4DR6T 4LFCT 4DR4T 1N36T 4DUZT 5BR8T 2VQET 4JI5T 4DR1T 3T1HT 4DV1T 4JI6T 4DV4T 4NXNT 1N34T 4JYAT 4DR2T 5LMUT 1XMOT 4JI7T 4JI0T 2E5LT 2UXCT 4DV6T 4OX9T 4B3RT 2ZM6T 3T1YT 4LF7T 2VQFT 1HR0T 3OTOT 5LMNT 1XNQT 1XMQT 2HHHT 4DV3T 4X65T 4YHHT 2UXBT 4B3TT 4DV7T 4LFBT 4X66T 4DR3T 4LF6T 2UUBT 4JI3T 4LFAT 4NXMT 4GKKT 4JV5T 4K0KT 4JI8T 4JI2T 4DV2T 4DV5T 4DR7T 4X64T 1IBKT 2UU9T 4DR5T 1FJGT 4AQYT 4JI4T 4LF9T
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X62 T;  4DUY T;  1J5E T;  1XNR T;  1HNZ T;  1N33 T;  4JI1 T;  4LF4 T;  2F4V T;  1I94 T;  4YY3 T;  4B3M T;  2UUC T;  4LF5 T;  2UUA T;  1HNW T;  1N32 T;  1IBM T;  4B3S T;  4LF8 T;  4DV0 T;  1IBL T;  1HNX T;  4KHP T;  4GKJ T;  2UXD T;  5IWA T;  4DR6 T;  4LFC T;  4DR4 T;  1N36 T;  4DUZ T;  5BR8 T;  2VQE T;  4JI5 T;  4DR1 T;  3T1H T;  4DV1 T;  4JI6 T;  4DV4 T;  4NXN T;  1N34 T;  4JYA T;  4DR2 T;  5LMU T;  1XMO T;  4JI7 T;  4JI0 T;  2E5L T;  2UXC T;  4DV6 T;  4OX9 T;  4B3R T;  2ZM6 T;  3T1Y T;  4LF7 T;  2VQF T;  1HR0 T;  3OTO T;  5LMN T;  1XNQ T;  1XMQ T;  2HHH T;  4DV3 T;  4X65 T;  4YHH T;  2UXB T;  4B3T T;  4DV7 T;  4LFB T;  4X66 T;  4DR3 T;  4LF6 T;  2UUB T;  4JI3 T;  4LFA T;  4NXM T;  4GKK T;  4JV5 T;  4K0K T;  4JI8 T;  4JI2 T;  4DV2 T;  4DV5 T;  4DR7 T;  4X64 T;  1IBK T;  2UU9 T;  4DR5 T;  1FJG T;  4AQY T;  4JI4 T;  4LF9 T; 
#chains in the Genus database with same CATH topology
 2Y48 B;  3ZMT B;  4JEU B;  5EK3 A;  4HN9 A;  2VAS A;  2LHN A;  3KIN B;  4LF5 T;  2LKH A;  5LGT B;  4QWN B;  3F57 A;  4LF8 T;  1E1H B;  3RRC A;  2ODV A;  5AQG B;  4U33 A;  4TZ4 C;  5HYA A;  3TLT A;  3ZSS A;  2X9W A;  4JI5 T;  3AE9 A;  2W63 A;  1Y64 B;  3AE1 A;  3EDV A;  4OYK A;  4U72 A;  3FHN A;  3R84 B;  1ZEE A;  1VRB A;  2CM0 A;  3ZMV B;  4QXC B;  1JNR A;  4TNW A;  3ZMZ B;  2E9X C;  4UV8 B;  5JDF A;  1HR0 T;  5AQI B;  5ETW A;  1JNZ A;  4MFR A;  2YK0 A;  4TNV A;  2IDO B;  5AQO B;  3ESL A;  3L8R A;  4WW0 A;  1XDP A;  4ZEY A;  3LDQ B;  4CXY A;  3NKZ A;  4CI2 B;  2MPK A;  1ZP0 A;  2QYW A;  1D0X A;  3AE8 A;  4ZOL E;  2WDQ A;  2RP4 A;  1D1C A;  3PU3 A;  3UU4 A;  3RYH E;  3TLU A;  2V26 A;  4IDN A;  4UV9 B;  4U3C A;  4XAX B;  4CI3 B;  1YW0 A;  1BR1 A;  4WBN E;  1MND A;  1XZY A;  4ILU A;  1OED B;  1J5E T;  2LSI A;  3ZYL A;  5JRC B;  1N33 T;  1HX8 A;  2HN1 A;  4P1N A;  5AQN B;  3PDY A;  4NUU A;  4CQI A;  1SUM B;  2XAQ B;  2ZMA A;  2UXD T;  1N36 T;  3AE2 A;  3HR0 A;  5L4H A;  3ZKR A;  2L3L A;  2DI4 A;  4EZH A;  1YQ4 A;  3T1H T;  1MMG A;  3B5M A;  5L2L A;  3CQG B;  1M62 A;  2SPC A;  3JAD A;  3CIR A;  4J2C A;  2V1D B;  4G63 A;  2OLT A;  4MBQ A;  2W66 A;  3KV5 A;  3IF8 B;  1X79 A;  5KMG P;  1W0A A;  1BR2 A;  4I50 E;  5HEO A;  3CX6 B;  4BJN A;  2PBI A;  4UF0 A;  4O4J E;  4Z91 A;  5HEG A;  2JRK A;  3ZLI A;  2BBH A;  2RPA A;  2VKO A;  5A1L A;  4OHF A;  1OED C;  2X9H A;  3ZMS B;  2CHN A;  3UFG A;  4EAH A;  2XPK A;  2BS3 A;  5FKY A;  4CN6 A;  4DND A;  4I4T E;  2BG9 C;  4PJJ A;  1KEY A;  5F8P A;  2C0S A;  3ZCJ A;  3LFM A;  2UUA T;  1ZOY A;  2BS4 A;  2JQK A;  3CX8 B;  1U4Q A;  1NAF A;  3PUV F;  5H6Q B;  3UQ4 A;  4DID B;  1EZ3 A;  3JC6 C;  2W0G A;  4H9N C;  1FMW A;  3AXJ B;  3QOF A;  5DQV A;  3CML A;  3N2G E;  4KHZ F;  3R6N A;  2KT9 A;  4QXH B;  4ZS2 A;  2QRX A;  4I43 B;  1S94 A;  2CBI A;  2DCF A;  4AKR B;  1XDO A;  3MA9 A;  4IE7 A;  3LK4 2;  3FZL B;  5CFB A;  2VQF T;  3ONL C;  5FNV E;  3CWZ B;  4AKG A;  2FJA A;  4CZZ B;  3PUX F;  3UQ7 A;  4LF6 T;  3E08 A;  4XBF B;  4AQF C;  3PUW F;  4JI8 T;  5AQV B;  2KMF A;  5J2U E;  3BQL A;  4IDO A;  1HTJ F;  4IE5 A;  4X64 T;  2BBJ A;  2IHR 1;  2WCA A;  1IBK T;  3N9Q A;  4HFC A;  2E2A A;  4EB6 E;  2KND A;  3AA7 B;  2LHR A;  2MAW A;  3PUR A;  4ANJ A;  3FXE B;  2XSA A;  1HNW T;  2LLY A;  2V7M A;  3C98 B;  2XAJ B;  3AE5 A;  2Q9Q D;  3F2E A;  3H37 A;  2ZLY A;  4UEL A;  1KFY A;  3FZH B;  2XSB A;  2LRK A;  1UX4 A;  2V7L A;  4LFC T;  4UR9 A;  1IJ6 A;  4YSX A;  3RGL A;  4BJM A;  2VWA A;  4DR1 T;  5JRE A;  4JYA T;  3EDU A;  2WY2 A;  3LK3 B;  4PNI A;  1YD8 G;  2WBL A;  4ZI2 C;  2Y8D A;  4DBQ A;  3AEE A;  5F3J A;  2UXC T;  5C3J A;  2NTX A;  2N1G A;  2CEA A;  2J62 A;  4H63 H;  2CE7 A;  5JR9 B;  3N9M A;  2BVL A;  5FY1 A;  2YDS A;  2XQ3 A;  3L09 A;  2FUP A;  2H88 A;  3QK6 A;  4ILC A;  3JAE A;  4YSY A;  2JJ9 A;  3NWI A;  4HWF A;  4DBR A;  1M7K A;  4GYS A;  3BQI A;  3ZYM A;  5JRC A;  3RYF E;  3AB3 B;  4U2Z A;  3CQX C;  4B6X A;  2HN2 A;  5FXZ A;  2ACZ A;  4JV5 T;  1FEW A;  5LBM A;  1UCU A;  2WP9 A;  3ZT5 A;  5ABG A;  4DV2 T;  5IHY A;  2V8S V;  4HE8 A;  2UU9 T;  2K9A A;  3P4W A;  2CCQ A;  2LM2 A;  3P50 A;  5LBQ B;  4ZI3 C;  2X67 A;  2E9X D;  4DO0 A;  4YY3 T;  3IA3 A;  2J47 A;  4UIG A;  3AE7 A;  5FP3 A;  3LBX B;  4EOZ B;  5AQU B;  2Q9Q B;  5LOV E;  3S4U A;  5LHG B;  3UUB A;  1UUR A;  4ZS3 A;  3RQW A;  2E8I A;  2VB6 A;  5LG4 A;  4EV6 A;  2C5I T;  3N9L A;  3VR9 A;  1KNP A;  5JR9 C;  4ZI7 E;  2NOX A;  2LT3 A;  4NIQ A;  3RYC E;  5JH7 E;  3I1A A;  4HGA A;  5ABF A;  4OX9 T;  3UU3 A;  2BG9 E;  4LF7 T;  5LA6 E;  4HFD A;  5HCJ A;  5C8Y E;  3AEF A;  4IRE A;  5ABH A;  3FBZ A;  3EHZ A;  3OBV E;  1HCI A;  3P4S A;  5LGU B;  3VRA A;  3AED A;  4H9P C;  1O3X A;  2L9Q A;  2WQY A;  2Q9Q C;  2XQY A;  3H3M A;  4ILA A;  4P0A A;  4JEH B;  3AA1 B;  4X1K E;  2E5V A;  3E0Z A;  4JI1 T;  4NPP A;  5FVK A;  2UUC T;  3CVR A;  3LJC A;  1XWM A;  1IBM T;  3UTK A;  3K3O A;  5AFU L;  3P4P A;  4KMC A;  1Z8U A;  3K3Q C;  1ZHC A;  2YU1 A;  4H9R C;  1IAP A;  4H63 V;  2WDV A;  3A7M A;  3GN5 B;  4CI1 B;  4MHC A;  3RIA A;  5JDN A;  1G8X A;  3PUG A;  4JI7 T;  1KNR A;  4ILB A;  1MMN A;  4AKL A;  4ADZ A;  2LM9 A;  2WU2 A;  3PJA A;  4QH4 A;  2XUE A;  2AXD S;  4PK5 A;  2LSG A;  4DV3 T;  4UXN B;  5AQF B;  3RRW A;  3OJA A;  4U2Y A;  2CXD A;  2V6X A;  4LFB T;  4O4I E;  3QC9 A;  4A56 A;  3RC8 A;  5JTG A;  4K0K T;  3F31 A;  2X66 A;  3JC6 D;  4QXB B;  4EED A;  3M65 A;  5AQJ B;  3FZK B;  3WAK A;  1YKE B;  4M1P A;  2IUB A;  4PAG A;  3OPC A;  3P7I A;  5JQG E;  3IHR A;  5HEU A;  3M3Z B;  2YDQ A;  3KV9 A;  4JBW F;  3U78 A;  3SS1 A;  5JR9 A;  5AQT B;  5AQQ B;  4X1I E;  3HKD E;  4UVA B;  5FMN A;  3PV0 F;  5JDM A;  5JDL A;  2MBG A;  3UUM A;  3UFE A;  4DMV A;  3MAC A;  2XQ5 A;  3E22 E;  5J0Z A;  3AAA B;  3H3A A;  4IST A;  4WYV A;  2BG9 B;  2ZM6 T;  2LOS A;  4YHJ A;  3UUX B;  1HG5 A;  2UXX B;  5LYJ E;  4PJM A;  1D0Z A;  5FYM A;  2X9X A;  2JQ9 A;  2IAK A;  1FIO A;  5L3C B;  3V5U A;  3HI2 A;  2KWH A;  3LBX A;  4EIW A;  2Q9Q A;  4U7Y A;  4DR7 T;  4TV9 E;  1SE7 A;  2W4X A;  4DR5 T;  3RHW A;  4BAY B;  4F6R C;  2KZ7 B;  4YTM A;  2VL0 A;  4ZI2 D;  2DLR A;  3LK2 B;  5JDG A;  2CWO A;  4OK0 A;  4GK0 E;  2WB5 A;  4ASK A;  5HXH A;  1IBL T;  2CHO A;  1S35 A;  5KDM C;  4DR4 T;  2PJQ A;  4O8S A;  3D0T A;  3BK9 A;  1E2A A;  2AE9 A;  2VUR A;  3LSV A;  3NVO A;  3AVS A;  3OYX A;  4DR2 T;  4TWH A;  4YJ2 E;  4C91 A;  1T72 A;  3AEC A;  2RA1 A;  1G73 A;  2MOZ A;  1LRZ A;  2W67 A;  4HFE A;  3C4X A;  3ONJ A;  4ZI3 D;  3OTO T;  5LMN T;  3ANW A;  4Q25 A;  2M6I A;  2B1E A;  4F8H A;  3MKD A;  2CXL A;  3CX7 B;  3I9W A;  2BDE A;  3PU8 A;  2E9X A;  1QSD A;  3KV4 A;  4X66 T;  4DR3 T;  4HTE A;  2V7K A;  2X0H A;  3ZEF B;  1UX5 A;  4DV5 T;  5CA0 E;  3J9X 1;  3C4W A;  3MZK B;  5LNK A;  3RX6 A;  1FJG T;  4PJL A;  2V6Y B;  2XTL A;  3GN5 A;  1WYB A;  2LKG A;  2C5J A;  3PUA A;  3AE4 A;  1H7C A;  3UU8 A;  5FXX A;  3PUY F;  2CBJ A;  4WBO A;  4KUM B;  3OYZ A;  4L0R A;  3VR8 A;  1W0B A;  3PTR B;  3C51 A;  4B3S T;  1BR0 A;  3UU5 A;  1MMA A;  5LG3 A;  1CHU A;  2BKN A;  5LHI B;  4PJN A;  3O1H A;  2M6B A;  2PFV A;  2WMN A;  4DUZ T;  3C4Z A;  3HL6 A;  5AQP B;  3RIU C;  1D1A A;  1ZV4 X;  1MIV A;  2YDR A;  4EXT A;  5LMU T;  3MXZ A;  3C50 A;  5AQL B;  3EVY A;  5HEH A;  3I0O A;  2EHO C;  1QLB A;  5LGN B;  4TN7 B;  5L47 A;  3BQK A;  1NEN A;  4ZXL A;  2FJB A;  4XZC A;  4YXD A;  3FZF B;  3AE3 A;  1XMQ T;  3AEA A;  4O2A E;  2PG8 A;  2YEV C;  3UUL A;  4B3T T;  5KX5 E;  4DV7 T;  4I55 E;  3VRB A;  3B57 A;  4GKK T;  4QH1 A;  1R8I A;  5CGM A;  4P0B A;  2XAS B;  1QUU A;  2ES0 A;  4QH5 A;  2PTF A;  3RH3 A;  5EZY E;  2JIW A;  2HPL A;  2NW9 A;  4CXX A;  2DWK A;  2A2F X;  1WR0 A;  1OED A;  4LMJ A;  4X62 T;  5LJM A;  4IE6 A;  1UK5 A;  4LF4 T;  2D2S A;  5H6R B;  3ZPO A;  2YU2 A;  3RI5 A;  5AQK B;  3PUS A;  2V5D A;  4KBM B;  5E0O A;  1N32 T;  5J1G A;  3N9N A;  4DV0 T;  2BG9 A;  1HX1 B;  3GMI A;  3NRX A;  4EYY R;  4GKJ T;  3SOL A;  5IWA T;  5CB4 E;  5BR8 T;  2XAF B;  1YXR A;  4NXN T;  5JDQ A;  4WNK A;  1V9D A;  5L3F B;  4LML A;  5JVD E;  2BS2 A;  3AVR A;  5DAB A;  2XJ7 A;  3ZCI A;  3JAF A;  3AA0 B;  5FXV A;  2IC9 A;  4TUY E;  4UEM A;  2DHR A;  3IBP A;  4PK6 A;  4C90 A;  4AQG A;  5M4Y A;  3CQC B;  4YLH A;  1WYC A;  3G06 A;  3N9O A;  4L9I A;  4UF0 B;  4YHH T;  2WM9 A;  2XY8 B;  3AAE B;  4E7S A;  5KXJ A;  4CXW A;  2UUB T;  5HXC A;  1NEK A;  3RC3 A;  3HKE E;  2X9Y A;  3K3N A;  4CN4 A;  1UGO A;  4IL4 A;  2VKH A;  4AQF A;  3OVU A;  2A3D A;  2WAU A;  1WRD A;  3C64 A;  1XNR T;  4DVD A;  2ZM0 A;  1VCS A;  4G2A A;  4HKA A;  4HFH A;  4H9Q C;  5FVL A;  5LXT E;  2K48 A;  3HKC E;  1D1B A;  2KLQ A;  4H9O C;  3ONX A;  4A97 A;  3AXJ A;  4QHO A;  3TLW A;  2H3R A;  2W00 A;  3FB2 A;  5L3G B;  3RQU A;  4DV4 T;  5HXE A;  1T98 A;  4P09 A;  3I0Q A;  4COF A;  1T7S A;  2NWB A;  1MNE A;  1XMO T;  5FY7 A;  2E5L T;  1DU2 A;  1T8B A;  2IML A;  3T1Y T;  2K5B B;  1XNQ T;  2CXF A;  2NW8 A;  3N5L A;  3GA8 A;  3T8O A;  5HAX A;  1SA0 E;  2X68 A;  2K24 A;  2X0Y A;  5IYZ E;  2YIN A;  3RKG A;  1WCR A;  3TLV A;  2UXN B;  3Q2M A;  3UU6 A;  2IC6 A;  5CJ5 A;  4H9S E;  4V1A v;  4HWH A;  2CLY C;  3N9P A;  5IUX A;  2KXP B;  4UVC B;  2KSR A;  4OFZ A;  4JLE A;  3P8C D;  1FMV A;  3Q5W A;  2XQ4 A;  5HXS A;  5LB7 B;  5JDH A;  2NW7 A;  2QGS A;  1E7P A;  3EAM A;  5AQS B;  3QUJ A;  1HNX T;  4KHP T;  2WZI A;  4AKI A;  4AXP A;  2OA5 A;  2IW5 B;  5BMV E;  2BZB A;  1J1J A;  1YKH B;  1W09 A;  4TV8 E;  3ETV A;  3W15 B;  1SHZ C;  4MLK A;  4IGU A;  2QA7 A;  4AKH A;  5DQW A;  3P4R A;  3KVA A;  4B3R T;  1L0V A;  3NZP A;  4YFS A;  3AEG A;  3ABV A;  5FXW A;  4NUV A;  3ZN0 B;  3L3P A;  4HWI B;  3TLS A;  5DJQ C;  5HWY A;  4QKN A;  3B13 A;  2D0U A;  4PW8 A;  4Z8X A;  1KNZ A;  4LFA T;  5L4E A;  2J1D G;  3O4X E;  4E7Z A;  4DMW A;  2JPF A;  2D9D A;  4A5X A;  3N2O A;  2DL1 A;  4ZZB A;  2ODU A;  2WS3 A;  2D5U A;  2W2U A;  3LG7 A;  4U74 A;  2CA5 A;  2H89 A;  4JI4 T;  3TKL B;  2NTY A;  4IDZ A;  3ZT6 A;  2QVA A;  3O9X A;  4L5G A;  1HNZ T;  2F4V T;  3ZMU B;  4B3M T;  2CMR A;  2EHO D;  4GYR A;  2XM1 A;  4HFV A;  2CRB A;  1HF8 A;  3V5S A;  4IDP A;  3ZJ1 A;  5GON E;  2DWG A;  2LSY A;  2M67 A;  3UT5 E;  2ZM8 A;  3SFE A;  2LSJ A;  3ZYK A;  2X51 A;  5AQM B;  3ZN1 B;  4GK5 E;  2L8K A;  2X0L B;  4IE4 A;  1LVK A;  4CN1 A;  3AAI A;  4EEB A;  5C2T A;  4OYJ A;  2H7O A;  3SFD A;  3ZJ2 A;  3Q5X A;  2FJD A;  5ABF B;  3Q5E A;  3CKD A;  4HWC A;  3VHL A;  3WAJ A;  4EZ4 A;  5EK4 A;  4TWF A;  3O1J A;  2VKD A;  2WZH A;  1IJ5 A;  2UXB T;  2W62 A;  2G0U A;  3RIF A;  1D0Y A;  1HFA A;  2YN6 A;  4MAL A;  5AQH B;  4ERR A;  4ZHQ E;  5CA1 E;  1NWM X;  2XQ8 A;  2V7I A;  3X1D A;  1HS7 A;  1LVF A;  3N2K E;  4YJ3 E;  2NP9 A;  5F5W A;  2LRL A;  2JQH A;  2NR4 A;  5AQR B;  4Z90 A;  4N78 D;  3PE0 A;  3DJB A;  4JUY A;  1VCT A;  2I59 A;  1OWA A;  4AIU A;  3MK7 C;  5EK2 A;  2EHO B;  1WLX A;  2LEH A;  1KF6 A;  2I6H A;  2WU5 A;  2Z6E A;  3O1I A;  4QX8 B;  1MIW A;  3J7Y q;  4YT0 A;  1W9R A;  4KI0 F;  3QB5 A;  2VVS A;  3I9Y A;  2VQE T;  2MYS A;  2ACX A;  3AEB A;  3VKG A;  3K8P C;  4IDQ A;  2LJL A;  4ISS A;  3U3I A;  3A8Y C;  3EI0 A;  2A72 A;  4JI0 T;  4ZZC A;  3IEE A;  5HXR A;  3FZM B;  4DV6 T;  2LOP A;  1CUN A;  4X1Y E;  3GWH A;  4QX7 B;  4IHJ E;  2KIN B;  2WMO A;  3OKQ A;  4PFP A;  4HFI A;  4GOU A;  2HHH T;  5L3D B;  1Y01 A;  4X65 T;  3ZC0 A;  4FI5 A;  1KK7 A;  5ABE A;  3L39 A;  2XHE B;  2VVN A;  3ZT7 A;  2LE8 A;  4JI2 T;  2WWV A;  3KBT A;  2XQ9 A;  4KX6 A;  4TWD A;  5HEJ A;  1J5W A;  4AQY T;  2XAG B;  3SWH A;  4LF9 T;  3EUH A;  4AI6 A;  3SRZ A;  3HKB E;  4FJO A;  2WSS V;  3Q9D A;  2XZE A;  2HH7 A;  1YQ3 A;  1VOM A;  2WWU A;  3VU7 H;  2C5K T;  2GK9 A;  4YSZ A;  2J4G A;  3QB5 K;  4U31 A;  4DR6 T;  2CWY A;  2VK9 A;  4EGW A;  2XQ6 A;  4UVB B;  2OV9 A;  4X5T A;  1Z0P A;  4DV1 T;  2XQA A;  2H7V C;  1N34 T;  2BKO A;  3KFW X;  3NRY A;  4HEA A;  1WFD A;  1BR4 A;  1MIY A;  2BKP A;  3A5X A;  3PJA J;  3ZST A;  3DP7 A;  3HA4 A;  2XQ7 A;  1I6Z A;  5HCM A;  2B76 A;  3PUZ F;  3RF1 A;  1LKX A;  2KWI B;  2WDR A;  2BVM A;  3ETU A;  4KP3 C;  2VKJ A;  4X20 E;  3KDS E;  5HWX A;  3KBU A;  2I0M A;  3PUQ A;  5J2T E;  1HG2 A;  2JQQ A;  5L3B B;  2N2N A;  4HWD A;  4JI3 T;  4NXM T;  3RPU A;  4EYU A;  3K1S A;  2R6G F;  5ADX L;  1MMD A;  3CK6 A;  5LHH B;  4K0U A;  4HFB A;  3AA6 B;  3KVB A;  3KV6 A;  4BA9 A;  5TAO A;  3QNU A;  1ZKE A;  3MJX A;  1GQE A;  4DUY T;  4IE0 A;  1OED E;  2W61 A;  4I0U A;  2Y6X A;  2MTQ A;  1I94 T;  2HPJ A;  3P4Q A;  2XAH B;  2CPT A;  4U7I A;  3EAB A;  3FBL A;  3JCF A;  5FL1 A;  4WZX A;  1IZN B;  2V7J A;  3AE6 A;  4A98 A;  3ZC1 A;  5FY0 A;  4YTP A;  1US7 B;  5FL0 A;  3DTO A;  2P9B A;  3RYI E;  4JI6 T;  3VKH A;  4PK4 A;  4LMK A;  2IIU A;  4PFO A;  1U5P A;  3WI3 A;  2ZM2 A;  2CLY B;  2K3W A;  4YTN A;  2FJE A;  4TX5 A;  3RIU A;  1OXZ A;  2JMH A;  2YKS A;  2LSK A;  4IIJ E;  4IL9 A;  3FXD B;  3ANW B;  4IT4 A;  1X9B A;  2V5C A;  2DNX A;  2JMK A;  5L3E B;  1UUS A;  2FBW A;  2YOE A;  2XM2 A;  2D0T A;  2EHO A;  3NBX X;  4O2B E;  2E9X B;  3Q5D A;  3CPZ A;  2VL8 A;  5LP6 E;  4GIW A;  3RKO A;  5LJN A;  3RLF F;  2N9D A;  1B7T A;  2A9U A;  4O4H E;  4O4L E;  3NZQ A;  5LCY A;  3UUN A;  4AIS A;  2V6Y A;  1AJ3 A;  1WR6 A; 
#chains in the Genus database with same CATH homology
 4X62 T;  4DUY T;  1J5E T;  1XNR T;  1HNZ T;  1N33 T;  4JI1 T;  4LF4 T;  2F4V T;  1I94 T;  4YY3 T;  4B3M T;  2UUC T;  4LF5 T;  2UUA T;  1HNW T;  1N32 T;  1IBM T;  4B3S T;  4LF8 T;  4DV0 T;  1IBL T;  1HNX T;  4KHP T;  4GKJ T;  2UXD T;  5IWA T;  4DR6 T;  4LFC T;  4DR4 T;  1N36 T;  4DUZ T;  5BR8 T;  2VQE T;  4JI5 T;  4DR1 T;  3T1H T;  4DV1 T;  4JI6 T;  4DV4 T;  4NXN T;  1N34 T;  4JYA T;  4DR2 T;  5LMU T;  1XMO T;  4JI7 T;  4JI0 T;  2E5L T;  2UXC T;  4DV6 T;  4OX9 T;  4B3R T;  2ZM6 T;  3T1Y T;  4LF7 T;  2VQF T;  1HR0 T;  3OTO T;  5LMN T;  1XNQ T;  1XMQ T;  2HHH T;  4DV3 T;  4X65 T;  4YHH T;  2UXB T;  4B3T T;  4DV7 T;  4LFB T;  4X66 T;  4DR3 T;  4LF6 T;  2UUB T;  4JI3 T;  4LFA T;  4NXM T;  4GKK T;  4JV5 T;  4K0K T;  4JI8 T;  4JI2 T;  4DV2 T;  4DV5 T;  4DR7 T;  4X64 T;  1IBK T;  2UU9 T;  4DR5 T;  1FJG T;  4AQY T;  4JI4 T;  4LF9 T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...