2KWHA

Ral binding domain of rlip76 (ralbp1)
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
56
structure length
56
Chain Sequence
GSETQAGIKEEIRRQEFLLNSLHRDLQGGIKDLSKEERLWEVQRILTALKRKLREA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transport protein
molecule keywords RalA-binding protein 1
publication title The RalB-RLIP76 complex reveals a novel mode of ral-effector interaction
pubmed doi rcsb
source organism Homo sapiens
total genus 20
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2010-04-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.90 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2kwhA00
3QK6A 2XTLA 4CQIA 3S4UA 2KWHA 3MXZA 4DNDA 2CA5A 4J2CA 3FXEB 2MBGA 2IC6A 2IC9A 3CKDA 3L3PA 3TKLB 2C5IT 1QSDA 2C5JA 2G0UA 1IJ6A 2C5KT 1Z0PA 3QUJA 1H7CA 2KWIB 4B6XA 1LRZA 3N5LA 1ZKEA 3FXDB 1LVFA 4FI5A 2X9WA 4L0RA 2X9XA 3P7IA 2K48A 4EYYR 2X9YA 3CVRA 1IJ5A
chains in the Genus database with same CATH superfamily
3A7MA 2CMRA 3HL6A 4HWFA 3RC3A 4YTNA 4JI3T 1E7PA 4Z90A 3LK42 2M6BA 1FIOA 3RYIE 2DL1A 1BR0A 3DJBA 5H6RB 3VU7H 3C4ZA 4Q25A 4A5XA 2XUEA 4YLHA 5FL0A 3C51A 4HEAA 4NIQA 3S4UA 3WAJA 1QLBA 4YY3T 2NW9A 4JLEA 5JTGA 5FY7A 3ZYLA 2WBLA 4TNVA 3KBUA 5JDGA 2DNXA 3ONXA 1VRBA 2V8SV 1WCRA 2MOZA 3UU5A 1N33T 4MLKA 3U3IA 3L39A 5AQLB 2WDRA 2YDQA 2N2NA 4HFCA 4BAYB 3EUHA 3PUAA 4YJ2E 3O1JA 3OPCA 3FB2A 2UXBT 2CA5A 3ZMZB 4IDPA 2CRBA 5L3DB 4PW8A 1E1HB 3CPZA 2NWBA 3AEGA 3ZMVB 1D1CA 3AAIA 3P4SA 3AE7A 2NTXA 3AA1B 3IHRA 4IT4A 4GKKT 1SUMB 4O4HE 2IC9A 3SWHA 4TWHA 1NAFA 2LEHA 4ZZCA 2L3LA 3I0OA 1XNRT 2VL0A 3EHZA 3P4QA 3RIUA 4IREA 4JI1T 2VASA 2YDSA 1XZYA 5L4HA 1KNZA 2X67A 3WAKA 5JDFA 2M67A 4X66T 3BK9A 2A9UA 3CKDA 3R84B 2EHOD 4JI2T 4DV6T 3AA6B 4YXDA 1IZNB 5LB7B 1YKHB 3ZN1B 5HXSA 3N9PA 3T8OA 2QA7A 4JUYA 1WR0A 3UT5E 4B3ST 4I4TE 2K3WA 3UU6A 1VCTA 2IHR1 2ZM8A 4PJMA 5FY0A 4YTPA 5HEOA 4YJ3E 1IJ6A 4ZS2A 2UXNB 3K3OA 5CJ5A 1MNDA 2JJ9A 2E2AA 1D0ZA 2FUPA 3VKHA 2K5BB 1HG5A 3PUZF 2KT9A 3ABVA 4HFEA 3TKLB 2C5IT 4X20E 2LSGA 5CFBA 3RF1A 2CPTA 2XQ4A 3PURA 3OTOT 3J9X1 3PUSA 1MMNA 1M7KA 2VK9A 1GQEA 2EHOB 4IDNA 3N2OA 4EOZB 4TN7B 3ZT5A 2VWAA 3CIRA 3AE2A 3SS1A 1HTJF 3NRYA 5DQVA 4EGWA 3ANWA 2WY2A 4JV5T 3FXDB 4HFBA 4ZI3C 2WZHA 4O2AE 1T98A 3OYXA 1ZV4X 5LYJE 4OYJA 5AQPB 4JI6T 3O4XE 2C5KT 4LF4T 2YK0A 2WWVA 2V7LA 4O2BE 2LSIA 3FBLA 2BG9E 2LT3A 3LG7A 4HWCA 3P4WA 4H9NC 5FNVE 4CQIA 3RYHE 2UUAT 4WBOA 3GA8A 2Y8DA 2Q9QD 4UV8B 5LGNB 1J5ET 4KP3C 2BG9B 5FP3A 4UF0A 4ERRA 2LKGA 4DR1T 2WDQA 1I6ZA 4PK5A 1YKEB 3VRAA 1VCSA 5LHGB 3AB3B 3QC9A 2CWYA 2LSJA 3SFDA 4U2YA 4H9OC 4ILAA 4DBQA 4HFHA 4QWNB 5L47A 5EK3A 2NTYA 4GYRA 3W15B 4DV2T 3AA0B 5HXEA 3RX6A 1IAPA 3RLFF 4ZS3A 5E0OA 3I9YA 2JQ9A 5HCMA 1HG2A 1UURA 1KK7A 2LM9A 3J7Yq 2X0LB 2XTLA 1KF6A 2LE8A 2C0SA 4ILCA 1N32T 2XAJB 3ZJ1A 2BKNA 4HWHA 4TV9E 3CQXC 4MHCA 3PE0A 3ZYMA 4PNIA 4UR9A 2EHOA 3ZMTB 4IGUA 2EHOC 2BS2A 3TLTA 4PAGA 4DUYT 1UX4A 3AECA 2UUBT 2CBJA 4GIWA 3KVAA 2IIUA 2JQHA 4K0UA 1Z8UA 4X1YE 3AA7B 2HHHT 3BQLA 2LKHA 2XAFB 3FZKB 4DV4T 3HKCE 2FJDA 3VKGA 2VKHA 5L3BB 4CI1B 3O9XA 4DVDA 1HNXT 2W00A 2FJBA 4EAHA 4JI7T 3Q5WA 2WQYA 2KINB 4AKGA 4U3CA 3K8PC 1D1AA 3O1IA 1YW0A 4LMLA 4ZEYA 4AI6A 4EZ4A 2BG9A 3JC6D 2BG9C 5J1GA 4JI8T 5AQRB 3PUXF 2LRKA 4DV0T 4IL4A 1I94T 5ADXL 4NUVA 3GN5B 3MXZA 4DNDA 4HN9A 2YINA 4PFOA 2VQFT 2I0MA 5J2UE 2FJAA 3EDUA 5LNKA 2P9BA 3AEFA 2D9DA 1US7B 2V7MA 4COFA 5KMGP 4TV8E 2J4GA 5JDMA 5F8PA 4YFSA 1MMAA 2W62A 2XSBA 3MACA 3ZT7A 4OYKA 3RKGA 3P4PA 2H7VC 4O4LE 5LMNT 2XSAA 2ODVA 4AKHA 3E22E 4Z91A 1FJGT 5JH7E 3Q5XA 4DV3T 4ASKA 4JI4T 2Q9QA 2W61A 4I0UA 2CE7A 1HX8A 2Q9QC 2XQYA 1ZHCA 3FXEB 3OKQA 4QH1A 2WSSV 2AXDS 4DBRA 4PK6A 4WW0A 4NXNT 2K9AA 4H63H 4ANJA 3N2KE 3N5LA 3K3NA 4E7ZA 5J0ZA 1KEYA 3PDYA 4BJNA 1V9DA 2WM9A 5ETWA 2W4XA 2IUBA 1W0BA 2ZM2A 2YU1A 3SOLA 5BMVE 2V6YB 3RIFA 5AQIB 4WZXA 3LJCA 5JRCB 3B5MA 1FMVA 2ACZA 5CGMA 4MBQA 5LGUB 3UUXB 5LJNA 4KHPT 3NVOA 3A5XA 3Q5EA 3DP7A 5AQJB 5LCYA 1Z0PA 2R6GF 5C2TA 4TX5A 1BR1A 4EV6A 3TLVA 2CLYB 5L3CB 1M62A 4H9PC 4IE5A 3JCFA 2CXFA 3AEBA 3UU4A 4GOUA 4YHHT 4KI0F 2ZMAA 4CN4A 2D0UA 2KZ7B 1VOMA 3ZC1A 3B57A 4LF8T 2XQ9A 4ZZBA 5HEHA 2IC6A 3C4XA 2UUCT 4IL9A 5BR8T 2H88A 3RKOA 2E5VA 4F6RC 1MIYA 3LK3B 5FMNA 4HFVA 5HAXA 3LBXB 2YKSA 2IAKA 4HTEA 4QXHB 2SPCA 3NWIA 2RPAA 2C5JA 3E08A 4GK5E 2DCFA 2V7JA 2E9XB 2Y6XA 1IBLT 1B7TA 1OXZA 5AQHB 2CWOA 2X66A 4OFZA 3PUYF 5FY1A 2BVLA 4AQFA 3JC6C 4AQFC 1UK5A 3ESLA 3AAEB 3T1YT 5ABFB 3OVUA 4DV7T 4NPPA 4ILBA 4O4JE 3QB5K 4PJNA 2OA5A 2KWHA 1HF8A 2WZIA 4QKNA 4ZI7E 3AXJB 3ZMUB 1AJ3A 3RPUA 3RRCA 2V6YA 3NZQA 3RC8A 2PTFA 3PU8A 2LOSA 2X51A 2XHEB 2X9XA 3C64A 4TWDA 3UUNA 4PK4A 2VKJA 3I0QA 4DR4T 4HE8A 1SA0E 4TUYE 4HWIB 2MYSA 3U78A 2NOXA 3K1SA 5FKYA 3HR0A 3R6NA 2A3DA 3N9QA 2PFVA 2XAQB 4DMWA 4CN6A 2YN6A 5L3FB 4J2CA 1YQ3A 5LHIB 4LFBT 1S35A 5LJMA 4WNKA 3UU3A 3O1HA 4EB6E 5AQNB 5KXJA 2XQ8A 1ZKEA 3C4WA 4X62T 2VVSA 3QK6A 2LLYA 3TLSA 2ES0A 3VR9A 1S94A 1JNZA 2V7KA 4U2ZA 4LFCT 2VKDA 5TAOA 1XMQT 4A56A 5AQVB 2ODUA 4DR2T 1SE7A 4EYUA 4DUZT 3UFEA 2QVAA 4YSYA 5AQOB 4QX7B 4WBNE 3LBXA 1XDOA 3ZMSB 4F8HA 2E5LT 1T7SA 4JBWF 2D0TA 1KFYA 5HXCA 2XY8B 5JQGE 5LBMA 5AQMB 4QHOA 5EK4A 3IF8B 4P09A 3AE9A 5FL1A 3FZMB 4IE6A 2HPJA 4I43B 1BR4A 5JDQA 5DABA 2JMHA 2XM1A 3ONLC 5LG3A 4HFIA 1L0VA 4CZZB 4P1NA 2V5DA 4IE7A 5AQSB 1N34T 1XDPA 4AKRB 3CK6A 4H63V 2NW7A 3F2EA 3AXJA 2G0UA 2JQKA 4CXYA 3LK2B 1FMWA 1QUUA 2NP9A 5LHHB 1LVKA 2WP9A 3N9OA 4MALA 4EIWA 4G63A 2X68A 1HS7A 1WYCA 3RI5A 5AQGB 3HKBE 4X1IE 1NWMX 3P8CD 5JDNA 3PJAA 2YDRA 3LDQB 3CX8B 3P50A 2V7IA 3NKZA 5JVDE 3HKDE 3MK7C 1X9BA 4DR6T 2XAGB 4UELA 4JEUB 4X5TA 5FVKA 3UUBA 5FXVA 2LSKA 2OLTA 5JR9B 2RP4A 3UFGA 5LBQB 3UUMA 3GWHA 5J2TE 5HEJA 3CX7B 4KX6A 4KBMB 4P0BA 4UXNB 5KX5E 5AQUB 2LSYA 2UXCT 1NENA 2ZM6T 2XM2A 5KDMC 5AQFB 5F3JA 4TZ4C 3ZYKA 1HR0T 3ONJA 4EXTA 1D0XA 2WCAA 3ZEFB 3MJXA 2V26A 2CHOA 3N9MA 1WLXA 3CMLA 3T1HT 5AFUL 4I50E 3PTRB 3HKEE 3I9WA 3KV4A 3RYFE 3NBXX 3N2GE 3EABA 5DQWA 1QSDA 3Q5DA 3CX6B 4H9RC 2HN2A 2VURA 4JEHB 3KV6A 1T72A 4EYYR 4LMJA 4O8SA 2UU9T 1HCIA 3FZHB 1D0YA 2YEVC 2A2FX 3OYZA 3ZN0B 4O4IE 5CB4E 2WMOA 2YU2A 3F31A 3RQUA 4L0RA 3A8YC 5LGTB 1W9RA 4EEBA 1CHUA 5EZYE 4DMVA 4IIJE 3AVRA 4U74A 4XBFB 4PJJA 2MPKA 5IYZE 2JQQA 2IDOB 4B6XA 4YT0A 3ZSTA 1ZOYA 3PJAJ 2A72A 4OHFA 5FYMA 4U72A 3RIAA 2PBIA 4KUMB 1X79A 2BVMA 1IBMT 3FZLB 4ZHQE 4AXPA 3SFEA 5JREA 5JR9A 4M1PA 5JR9C 3PV0F 4DR3T 4C90A 1WR6A 4UV9B 3EVYA 3EAMA 5IUXA 5EK2A 4B3MT 2CXDA 4V1Av 3ZCJA 4IE0A 4FI5A 2X9WA 3KINB 2VVNA 4YTMA 4LF5T 2CCQA 5HYAA 3E0ZA 2Z6EA 1O3XA 5FVLA 1BR2A 3AAAB 2BBJA 5HCJA 3N9NA 2WU2A 4MFRA 1LKXA 3BQKA 2XQ5A 2AE9A 3KDSE 2K48A 2X9YA 4TNWA 3LFMA 2E9XD 4XZCA 3UU8A 4L9IA 1J1JA 3ZPOA 2FBWA 4X64T 2H89A 2XZEA 4B3TT 2IW5B 2KWIB 4JYAT 2JIWA 2B1EA 2JMKA 2WMNA 2DLRA 3AEEA 3QOFA 4IHJE 3UQ7A 3ZKRA 5M4YA 1OEDE 3N9LA 3IBPA 4IDQA 3GN5A 3PUGA 2UXDT 2L9QA 3PUQA 3FZFB 3KVBA 3ZCIA 1OEDB 4HWDA 3F57A 3K3QC 4ZI2D 3AE3A 2XQ6A 2J1DG 1EZ3A 5IWAT 5FXZA 1HFAA 3ANWB 3QUJA 1HNZT 2LM2A 2XQAA 4AKLA 3LSVA 4DR7T 3RYCE 2XASB 4Z8XA 3PU3A 5LOVE 5ABGA 3C50A 3M65A 1HNWT 2NW8A 4CXWA 1WFDA 2NR4A 3UULA 2BKOA 3AE4A 4G2AA 5GONE 2H3RA 4BJMA 1ZP0A 4JI5T 3D0TA 2WS3A 1H7CA 1MMGA 3HI2A 2DWKA 2XPKA 5HWXA 2LJLA 2QYWA 2DHRA 5IHYA 2M6IA 4HGAA 3OJAA 1NEKA 4ISTA 4UF0B 3G06A 1WRDA 3RHWA 4B3RT 4CI2B 3RIUC 3NRXA 4KHZF 4OX9T 4LF9T 2N9DA 2W63A 5JRCA 5LA6E 2X0HA 1HX1B 2MBGA 5LG4A 2H7OA 1UX5A 3H3AA 3AE5A 3M3ZB 5AQQB 2HH7A 4YHJA 1UCUA 4QXCB 2KXPB 3QNUA 4A98A 5DJQC 2CLYC 2V6XA 1N36T 4FJOA 3H3MA 3MA9A 3ETVA 5HXRA 1KNPA 4C91A 4PJLA 4EZHA 2ACXA 1MIVA 3PUVF 4DV5T 3JAFA 2RA1A 2V5CA 5FXXA 1E2AA 5LP6E 3GMIA 3KBTA 2OV9A 5AQTB 2DWGA 1ZEEA 3VR8A 3AE8A 4WYVA 4H9QC 3PUWF 4A97A 4U31A 1OEDA 4QH5A 1OEDC 1U5PA 3Q9DA 2W66A 5HWYA 5FXWA 3FBZA 4ILUA 1U4QA 4NXMT 4ZOLE 2VQET 3L3PA 4QH4A 5AQKB 2ZM0A 4JI0T 5JDLA 2W0GA 3UTKA 1MNEA 2YOEA 4UVAB 4E7SA 4N78D 3JAEA 3CWZB 4CXXA 4DR5T 2E9XA 2E9XC 4AKIA 2IMLA 3AEAA 4OK0A 2BDEA 1IJ5A 3L8RA 3ZLIA 2J47A 5HEUA 5ABEA 2BZBA 3KFWX 1J5WA 2BS4A 4UVBB 2CM0A 2KNDA 2WWUA 3SRZA 3MKDA 1WYBA 4K0KT 1MMDA 3X1DA 5ABFA 3DTOA 2KMFA 2D2SA 2LRLA 4PFPA 4X65T 2WAUA 1UGOA 2QGSA 2D5UA 2N1GA 3RH3A 1FEWA 3QB5A 3TLWA 5C8YE 2I6HA 2WDVA 4ZI2C 5L3GB 3CVRA 1YQ4A 4AIUA 3AEDA 2K24A 4U7IA 4IE4A 4XAXB 5LMUT 1XWMA 2LHRA 2PJQA 4QX8B 2WB5A 1XMOT 3H37A 4H9SE 3Q2MA 4L5GA 4U7YA 3EDVA 5HEGA 4DO0A 3WI3A 1JNRA 1LRZA 3B13A 1LVFA 2XQ3A 2HN1A 4YSXA 5L3EB 2Q9QB 1G73A 2W2UA 2L8KA 4GYSA 3KV9A 1G8XA 2KSRA 3V5UA 5LXTE 1CUNA 4IDZA 1YD8G 2XJ7A 2LHNA 3FHNA 4QXBB 4ZXLA 5CA0E 4X1KE 2W67A 3ZJ2A 1T8BA 4GKJT 4YSZA 3RRWA 4AISA 2CHNA 1Y01A 2UXXB 2DI4A 5L4EA 4I55E 2JRKA 1Y64B 3V5SA 3AE6A 4LFAT 5H6QB 2VL8A 2PG8A 2XAHB 5CA1E 3UQ4A 3OBVE 4DIDB 1W0AA 1R8IA 2KLQA 4CI3B 2ZLYA 3IA3A 2F4VT 2V1DB 1IBKT 4TWFA 2VKOA 2X9HA 1SHZC 3ETUA 3HA4A 2MTQA 2Y48B 2BS3A 3CQCB 5L2LA 3RQWA 5HXHA 1MIWA 5F5WA 2MAWA 3ZT6A 4UEMA 3VHLA 2J62A 3MZKB 2XQ7A 2JPFA 5C3JA 2CEAA 4UIGA 4LF6T 1UUSA 4UVCB 2BKPA 1W09A 3RGLA 3C98B 3NZPA 5A1LA 3L09A 3TLUA 1D1BA 4AQGA 3IEEA 2WU5A 4NUUA 2QRXA 3EI0A 2GK9A 3VRBA 4KMCA 5JDHA 2B76A 3P4RA 4AQYT 3P7IA 3CQGB 2CXLA 3AVSA 4LMKA 4P0AA 5ABHA 2BBHA 2X0YA 3ZC0A 2LOPA 2I59A 3AE1A 4CN1A 1OWAA 2VB6A 1YXRA 3I1AA 4ISSA 4DV1T 2FJEA 1DU2A 2CBIA 4EEDA 4IDOA 4LF7T 2E8IA 4BA9A 1KNRA 3BQIA 4ADZA 4HFDA 4HKAA 3JADA 1XNQT 4U33A 3KV5A 2HPLA 4ZI3D 4GK0E 3ZSSA
chains in the Genus database with same CATH topology
2CMRA 2KINB 4AKGA 2MBGA 3HL6A 4AKRB 4H63V 3K8PC 1D1AA 5LG4A 3RC3A 2H7OA 3O1IA 1YW0A 2NW7A 3F2EA 2G0UA 4AI6A 3LK42 1UX5A 4EZ4A 4CXYA 3H3AA 3JC6D 3LK2B 1FMWA 5J1GA 1FIOA 1QUUA 3RYIE 2HH7A 1BR0A 2NP9A 3DJBA 5H6RB 3VU7H 3C4ZA 5LHHB 2XUEA 4YLHA 4YHJA 1UCUA 4QXCB 3C51A 2KXPB 4HEAA 5ADXL 1LVKA 4NUVA 3GN5B 3N9OA 3S4UA 5DJQC 2CLYC 3MXZA 4DNDA 4HN9A 3WAJA 2YINA 4PFOA 4JLEA 2NW9A 4FJOA 4MALA 4EIWA 5J2UE 4G63A 5FY7A 2X68A 3MA9A 3ZYLA 1HS7A 1WYCA 3ETVA 3HKBE 2WBLA 4X1IE 5HXRA 3EDUA 1NWMX 3P8CD 4C91A 3KBUA 5JDGA 2P9BA 4PJLA 5LNKA 5JDNA 2DNXA 4EZHA 1US7B 1VRBA 2ACXA 3ONXA 2V7MA 1MIVA 5KMGP 2MOZA 4TV8E 3CX8B 2RA1A 2V7IA 5FXXA 5JVDE 3HKDE 3MK7C 5JDMA 4MLKA 5F8PA 4YFSA 1MMAA 2W62A 3U3IA 3MACA 2XAGB 4OYKA 4UELA 2N2NA 4JEUB 5LP6E 2H7VC 3GMIA 3KBTA 4O4LE 2DWGA 1ZEEA 4BAYB 4H9QC 3EUHA 3PUAA 4YJ2E 5FXVA 2ODVA 2LSKA 4AKHA 5JR9B 3E22E 5JH7E 1U5PA 2RP4A 3Q9DA 3Q5XA 4ASKA 5LBQB 5HWYA 5FXWA 2Q9QA 3FBZA 2W61A 4ILUA 1U4QA 3O1JA 3UUMA 2CE7A 1HX8A 2Q9QC 2XQYA 3FB2A 2CA5A 3GWHA 1ZHCA 3FXEB 3OKQA 3ZMZB 3CX7B 5L3DB 4ZOLE 2WSSV 3L3PA 1E1HB 3CPZA 2NWBA 4KBMB 4P0BA 2ZM0A 4PW8A 4UXNB 4PK6A 4WW0A 3ZMVB 1D1CA 2K9AA 2W0GA 3UTKA 4DBRA 5JDLA 4H63H 3AAIA 1MNEA 4UVAB 4ANJA 4E7SA 4N78D 2NTXA 2LSYA 3CWZB 3N2KE 4CXXA 3N5LA 3AA1B 2E9XA 3IHRA 3K3NA 5KDMC 4E7ZA 2E9XC 5F3JA 4AKIA 4TZ4C 3ZYKA 4OK0A 2BDEA 3PDYA 4BJNA 1IJ5A 1V9DA 3ZLIA 2WM9A 4EXTA 5ETWA 1D0XA 2BZBA 3KFWX 4O4HE 2IC9A 4UVBB 3ZEFB 3SWHA 2ZM2A 2CM0A 2YU1A 2KNDA 3SOLA 3MJXA 5BMVE 2WWUA 2V26A 1NAFA 2LEHA 2L3LA 3I0OA 3SRZA 3N9MA 1WLXA 3LJCA 3MKDA 3CMLA 5JRCB 2VASA 1WYBA 5AFUL 1MMDA 4I50E 1FMVA 3PTRB 1KNZA 2X67A 4MBQA 5LGUB 3DTOA 3UUXB 3WAKA 3HKEE 3I9WA 2KMFA 3KV4A 3RYFE 5JDFA 5LJNA 2D2SA 4PFPA 2M67A 2WAUA 3BK9A 3NBXX 3CKDA 3N2GE 2QGSA 2D5UA 3R84B 2EHOD 2N1GA 5DQWA 3A5XA 1QSDA 3DP7A 3AA6B 5LCYA 1Z0PA 1IZNB 3RH3A 1YKHB 1FEWA 3CX6B 4H9RC 3ZN1B 5HXSA 5C8YE 3N9PA 4JEHB 3T8OA 3KV6A 4TX5A 1BR1A 4ZI2C 4EYYR 5L3GB 2CLYB 5L3CB 3CVRA 2QA7A 4H9PC 4O8SA 4JUYA 1HCIA 3UT5E 1D0YA 2K24A 2A2FX 2YEVC 4IE5A 4IE4A 4I4TE 3OYZA 2CXFA 3ZN0B 4O4IE 4GOUA 5CB4E 2ZM8A 4PJMA 5FY0A 2ZMAA 4YJ3E 1IJ6A 4XAXB 4ZS2A 2UXNB 3K3OA 2WMOA 2YU2A 3F31A 2D0UA 2LHRA 2KZ7B 2PJQA 4L0RA 1VOMA 3ZC1A 3B57A 1MNDA 2JJ9A 4QX8B 1D0ZA 5LGTB 3VKHA 2K5BB 1HG5A 3H37A 3Q2MA 4H9SE 2IC6A 3C4XA 5EZYE 4DMVA 4IIJE 2KT9A 4L5GA 3TKLB 2C5IT 3AVRA 4U74A 4X20E 3EDVA 4XBFB 4PJJA 3RKOA 2LSGA 5IYZE 2JQQA 4DO0A 4F6RC 4B6XA 3WI3A 1LRZA 3PURA 3B13A 1LVFA 1MIYA 3J9X1 3PUSA 1MMNA 2VK9A 3LK3B 5FMNA 5L3EB 2A72A 2Q9QB 4HFVA 4OHFA 1G73A 3LBXB 5FYMA 5HAXA 2L8KA 4GYSA 4U72A 2IAKA 2EHOB 3N2OA 4HTEA 3KV9A 1G8XA 2SPCA 4QXHB 4EOZB 4TN7B 3V5UA 2PBIA 1CUNA 5LXTE 2VWAA 4KUMB 1X79A 2C5JA 3SS1A 2BVMA 4IDZA 1YD8G 3E08A 5J2TE 4GK5E 2DCFA 1HTJF 3NRYA 5DQVA 2LHNA 2V7JA 4ZHQE 4AXPA 3ANWA 2E9XB 2Y6XA 3FXDB 5JREA 4ZI3C 5JR9A 4M1PA 3FHNA 1B7TA 4QXBB 5JR9C 1OXZA 4O2AE 5CA0E 4X1KE 2CWOA 1T98A 2X66A 4OFZA 3ZJ2A 3OYXA 1ZV4X 4C90A 1WR6A 5LYJE 4OYJA 4UV9B 5FY1A 3EVYA 2BVLA 3O4XE 4AQFA 3RRWA 3JC6C 5EK2A 2C5KT 4AQFC 2CXDA 4V1Av 2UXXB 2DI4A 3ZCJA 2YK0A 3ESLA 2V7LA 3AAEB 4IE0A 4FI5A 4I55E 4O2BE 2X9WA 3KINB 2LSIA 3FBLA 2LT3A 2JRKA 3LG7A 4O4JE 2CCQA 4PJNA 1Y64B 3V5SA 4H9NC 3E0ZA 5FNVE 4CQIA 2OA5A 3RYHE 2KWHA 5HYAA 4WBOA 3GA8A 2Z6EA 2Y8DA 1HF8A 1O3XA 2Q9QD 2VL8A 4UV8B 1BR2A 4QKNA 5H6QB 4ZI7E 5LGNB 3AAAB 3ZMUB 2PG8A 2XAHB 5CA1E 4KP3C 3N9NA 1AJ3A 3RPUA 3OBVE 3RRCA 5FP3A 4UF0A 3NZQA 3RC8A 4ERRA 4MFRA 3PU8A 1LKXA 2LOSA 2X51A 2XHEB 3BQKA 2KLQA 2X9XA 3KDSE 3C64A 2K48A 4PK5A 4CI3B 2ZLYA 2X9YA 1YKEB 5LHGB 3AB3B 2E9XD 3LFMA 3UUNA 2V1DB 3QC9A 2VKOA 2X9HA 1SHZC 4XZCA 2CWYA 3ETUA 3HA4A 2MTQA 4PK4A 2LSJA 2VKJA 3I0QA 4L9IA 2Y48B 4HE8A 3ZPOA 1SA0E 3CQCB 4TUYE 4H9OC 5L2LA 4DBQA 2IW5B 2MYSA 2KWIB 3U78A 2NOXA 5HXHA 2B1EA 2JMKA 2WMNA 2DLRA 4QWNB 1MIWA 5EK3A 3HR0A 2NTYA 4IHJE 3R6NA 4GYRA 2A3DA 3W15B 3AA0B 3N9QA 2XAQB 2PFVA 4UEMA 4DMWA 5HXEA 5M4YA 3RX6A 1IAPA 5L3FB 3N9LA 4J2CA 3IBPA 3GN5A 3VHLA 3PUGA 2L9QA 3PUQA 5LHIB 4ZS3A 3MZKB 5E0OA 3I9YA 1S35A 3KVBA 5LJMA 4WNKA 3O1HA 1HG2A 3ZCIA 4EB6E 2JPFA 1ZKEA 2CEAA 1KK7A 2LM9A 3F57A 3C4WA 4UIGA 3K3QC 3J7Yq 4ZI2D 2X0LB 4UVCB 2J1DG 3QK6A 2XTLA 2LE8A 2ES0A 3C98B 3NZPA 5A1LA 1S94A 1EZ3A 2V7KA 3L09A 2C0SA 5FXZA 1D1BA 2VKDA 4AQGA 3IEEA 4NUUA 5TAOA 1HFAA 4A56A 2XAJB 3ZJ1A 3ANWB 3QUJA 2ODUA 2GK9A 4KMCA 5JDHA 4EYUA 4TV9E 3P7IA 4AKLA 3UFEA 5KX5E 3CQXC 2CXLA 3CQGB 3RYCE 4MHCA 2XASB 4Z8XA 3PE0A 3PU3A 5LOVE 3AVSA 3C50A 3M65A 4QX7B 3LBXA 4PNIA 3ZYMA 4WBNE 4P0AA 2NW8A 4CXWA 2EHOA 3UULA 3ZMTB 4IGUA 2EHOC 4G2AA 2LOPA 3ZC0A 5GONE 3ZMSB 4PAGA 2H3RA 4BJMA 2I59A 3D0TA 1OWAA 2D0TA 5HXCA 1UX4A 5JQGE 2VB6A 1H7CA 5LBMA 1MMGA 4QHOA 3HI2A 3I1AA 4GIWA 2DWKA 4ISSA 5EK4A 3KVAA 3IF8B 4P09A 5HWXA 4IE6A 2HPJA 2LJLA 4I43B 4K0UA 2DHRA 4X1YE 5IHYA 3AA7B 4HGAA 3BQLA 1BR4A 5JDQA 2XAFB 5DABA 2E8IA 4BA9A 2JMHA 3HKCE 3OJAA 4ISTA 4UF0B 3BQIA 3VKGA 1WRDA 2VKHA 4ADZA 5L3BB 4CI2B 4CI1B 3O9XA 4HKAA 3NRXA 3KV5A 4DVDA 4CZZB 2HPLA 2N9DA 2W00A 4GK0E 4ZI3D 4IE7A 4EAHA 2W63A 5JRCA 5LA6E 3Q5WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QK6 A;  2XTL A;  4CQI A;  3S4U A;  2KWH A;  3MXZ A;  4DND A;  2CA5 A;  4J2C A;  3FXE B;  2MBG A;  2IC6 A;  2IC9 A;  3CKD A;  3L3P A;  3TKL B;  2C5I T;  1QSD A;  2C5J A;  2G0U A;  1IJ6 A;  2C5K T;  1Z0P A;  3QUJ A;  1H7C A;  2KWI B;  4B6X A;  1LRZ A;  3N5L A;  1ZKE A;  3FXD B;  1LVF A;  4FI5 A;  2X9W A;  4L0R A;  2X9X A;  3P7I A;  2K48 A;  4EYY R;  2X9Y A;  3CVR A;  1IJ5 A; 
#chains in the Genus database with same CATH topology
 3A7M A;  2CMR A;  3HL6 A;  4HWF A;  3RC3 A;  4YTN A;  4JI3 T;  1E7P A;  4Z90 A;  3LK4 2;  2M6B A;  1FIO A;  3RYI E;  2DL1 A;  1BR0 A;  3DJB A;  5H6R B;  3VU7 H;  3C4Z A;  4Q25 A;  4A5X A;  2XUE A;  4YLH A;  5FL0 A;  3C51 A;  4HEA A;  4NIQ A;  3S4U A;  3WAJ A;  1QLB A;  4YY3 T;  2NW9 A;  4JLE A;  5JTG A;  5FY7 A;  3ZYL A;  2WBL A;  4TNV A;  3KBU A;  5JDG A;  2DNX A;  3ONX A;  1VRB A;  2V8S V;  1WCR A;  2MOZ A;  3UU5 A;  1N33 T;  4MLK A;  3U3I A;  3L39 A;  5AQL B;  2WDR A;  2YDQ A;  2N2N A;  4HFC A;  4BAY B;  3EUH A;  3PUA A;  4YJ2 E;  3O1J A;  3OPC A;  3FB2 A;  2UXB T;  2CA5 A;  3ZMZ B;  4IDP A;  2CRB A;  5L3D B;  4PW8 A;  1E1H B;  3CPZ A;  2NWB A;  3AEG A;  3ZMV B;  1D1C A;  3AAI A;  3P4S A;  3AE7 A;  2NTX A;  3AA1 B;  3IHR A;  4IT4 A;  4GKK T;  1SUM B;  4O4H E;  2IC9 A;  3SWH A;  4TWH A;  1NAF A;  2LEH A;  4ZZC A;  2L3L A;  3I0O A;  1XNR T;  2VL0 A;  3EHZ A;  3P4Q A;  3RIU A;  4IRE A;  4JI1 T;  2VAS A;  2YDS A;  1XZY A;  5L4H A;  1KNZ A;  2X67 A;  3WAK A;  5JDF A;  2M67 A;  4X66 T;  3BK9 A;  2A9U A;  3CKD A;  3R84 B;  2EHO D;  4JI2 T;  4DV6 T;  3AA6 B;  4YXD A;  1IZN B;  5LB7 B;  1YKH B;  3ZN1 B;  5HXS A;  3N9P A;  3T8O A;  2QA7 A;  4JUY A;  1WR0 A;  3UT5 E;  4B3S T;  4I4T E;  2K3W A;  3UU6 A;  1VCT A;  2IHR 1;  2ZM8 A;  4PJM A;  5FY0 A;  4YTP A;  5HEO A;  4YJ3 E;  1IJ6 A;  4ZS2 A;  2UXN B;  3K3O A;  5CJ5 A;  1MND A;  2JJ9 A;  2E2A A;  1D0Z A;  2FUP A;  3VKH A;  2K5B B;  1HG5 A;  3PUZ F;  2KT9 A;  3ABV A;  4HFE A;  3TKL B;  2C5I T;  4X20 E;  2LSG A;  5CFB A;  3RF1 A;  2CPT A;  2XQ4 A;  3PUR A;  3OTO T;  3J9X 1;  3PUS A;  1MMN A;  1M7K A;  2VK9 A;  1GQE A;  2EHO B;  4IDN A;  3N2O A;  4EOZ B;  4TN7 B;  3ZT5 A;  2VWA A;  3CIR A;  3AE2 A;  3SS1 A;  1HTJ F;  3NRY A;  5DQV A;  4EGW A;  3ANW A;  2WY2 A;  4JV5 T;  3FXD B;  4HFB A;  4ZI3 C;  2WZH A;  4O2A E;  1T98 A;  3OYX A;  1ZV4 X;  5LYJ E;  4OYJ A;  5AQP B;  4JI6 T;  3O4X E;  2C5K T;  4LF4 T;  2YK0 A;  2WWV A;  2V7L A;  4O2B E;  2LSI A;  3FBL A;  2BG9 E;  2LT3 A;  3LG7 A;  4HWC A;  3P4W A;  4H9N C;  5FNV E;  4CQI A;  3RYH E;  2UUA T;  4WBO A;  3GA8 A;  2Y8D A;  2Q9Q D;  4UV8 B;  5LGN B;  1J5E T;  4KP3 C;  2BG9 B;  5FP3 A;  4UF0 A;  4ERR A;  2LKG A;  4DR1 T;  2WDQ A;  1I6Z A;  4PK5 A;  1YKE B;  3VRA A;  1VCS A;  5LHG B;  3AB3 B;  3QC9 A;  2CWY A;  2LSJ A;  3SFD A;  4U2Y A;  4H9O C;  4ILA A;  4DBQ A;  4HFH A;  4QWN B;  5L47 A;  5EK3 A;  2NTY A;  4GYR A;  3W15 B;  4DV2 T;  3AA0 B;  5HXE A;  3RX6 A;  1IAP A;  3RLF F;  4ZS3 A;  5E0O A;  3I9Y A;  2JQ9 A;  5HCM A;  1HG2 A;  1UUR A;  1KK7 A;  2LM9 A;  3J7Y q;  2X0L B;  2XTL A;  1KF6 A;  2LE8 A;  2C0S A;  4ILC A;  1N32 T;  2XAJ B;  3ZJ1 A;  2BKN A;  4HWH A;  4TV9 E;  3CQX C;  4MHC A;  3PE0 A;  3ZYM A;  4PNI A;  4UR9 A;  2EHO A;  3ZMT B;  4IGU A;  2EHO C;  2BS2 A;  3TLT A;  4PAG A;  4DUY T;  1UX4 A;  3AEC A;  2UUB T;  2CBJ A;  4GIW A;  3KVA A;  2IIU A;  2JQH A;  4K0U A;  1Z8U A;  4X1Y E;  3AA7 B;  2HHH T;  3BQL A;  2LKH A;  2XAF B;  3FZK B;  4DV4 T;  3HKC E;  2FJD A;  3VKG A;  2VKH A;  5L3B B;  4CI1 B;  3O9X A;  4DVD A;  1HNX T;  2W00 A;  2FJB A;  4EAH A;  4JI7 T;  3Q5W A;  2WQY A;  2KIN B;  4AKG A;  4U3C A;  3K8P C;  1D1A A;  3O1I A;  1YW0 A;  4LML A;  4ZEY A;  4AI6 A;  4EZ4 A;  2BG9 A;  3JC6 D;  2BG9 C;  5J1G A;  4JI8 T;  5AQR B;  3PUX F;  2LRK A;  4DV0 T;  4IL4 A;  1I94 T;  5ADX L;  4NUV A;  3GN5 B;  3MXZ A;  4DND A;  4HN9 A;  2YIN A;  4PFO A;  2VQF T;  2I0M A;  5J2U E;  2FJA A;  3EDU A;  5LNK A;  2P9B A;  3AEF A;  2D9D A;  1US7 B;  2V7M A;  4COF A;  5KMG P;  4TV8 E;  2J4G A;  5JDM A;  5F8P A;  4YFS A;  1MMA A;  2W62 A;  2XSB A;  3MAC A;  3ZT7 A;  4OYK A;  3RKG A;  3P4P A;  2H7V C;  4O4L E;  5LMN T;  2XSA A;  2ODV A;  4AKH A;  3E22 E;  4Z91 A;  1FJG T;  5JH7 E;  3Q5X A;  4DV3 T;  4ASK A;  4JI4 T;  2Q9Q A;  2W61 A;  4I0U A;  2CE7 A;  1HX8 A;  2Q9Q C;  2XQY A;  1ZHC A;  3FXE B;  3OKQ A;  4QH1 A;  2WSS V;  2AXD S;  4DBR A;  4PK6 A;  4WW0 A;  4NXN T;  2K9A A;  4H63 H;  4ANJ A;  3N2K E;  3N5L A;  3K3N A;  4E7Z A;  5J0Z A;  1KEY A;  3PDY A;  4BJN A;  1V9D A;  2WM9 A;  5ETW A;  2W4X A;  2IUB A;  1W0B A;  2ZM2 A;  2YU1 A;  3SOL A;  5BMV E;  2V6Y B;  3RIF A;  5AQI B;  4WZX A;  3LJC A;  5JRC B;  3B5M A;  1FMV A;  2ACZ A;  5CGM A;  4MBQ A;  5LGU B;  3UUX B;  5LJN A;  4KHP T;  3NVO A;  3A5X A;  3Q5E A;  3DP7 A;  5AQJ B;  5LCY A;  1Z0P A;  2R6G F;  5C2T A;  4TX5 A;  1BR1 A;  4EV6 A;  3TLV A;  2CLY B;  5L3C B;  1M62 A;  4H9P C;  4IE5 A;  3JCF A;  2CXF A;  3AEB A;  3UU4 A;  4GOU A;  4YHH T;  4KI0 F;  2ZMA A;  4CN4 A;  2D0U A;  2KZ7 B;  1VOM A;  3ZC1 A;  3B57 A;  4LF8 T;  2XQ9 A;  4ZZB A;  5HEH A;  2IC6 A;  3C4X A;  2UUC T;  4IL9 A;  5BR8 T;  2H88 A;  3RKO A;  2E5V A;  4F6R C;  1MIY A;  3LK3 B;  5FMN A;  4HFV A;  5HAX A;  3LBX B;  2YKS A;  2IAK A;  4HTE A;  4QXH B;  2SPC A;  3NWI A;  2RPA A;  2C5J A;  3E08 A;  4GK5 E;  2DCF A;  2V7J A;  2E9X B;  2Y6X A;  1IBL T;  1B7T A;  1OXZ A;  5AQH B;  2CWO A;  2X66 A;  4OFZ A;  3PUY F;  5FY1 A;  2BVL A;  4AQF A;  3JC6 C;  4AQF C;  1UK5 A;  3ESL A;  3AAE B;  3T1Y T;  5ABF B;  3OVU A;  4DV7 T;  4NPP A;  4ILB A;  4O4J E;  3QB5 K;  4PJN A;  2OA5 A;  2KWH A;  1HF8 A;  2WZI A;  4QKN A;  4ZI7 E;  3AXJ B;  3ZMU B;  1AJ3 A;  3RPU A;  3RRC A;  2V6Y A;  3NZQ A;  3RC8 A;  2PTF A;  3PU8 A;  2LOS A;  2X51 A;  2XHE B;  2X9X A;  3C64 A;  4TWD A;  3UUN A;  4PK4 A;  2VKJ A;  3I0Q A;  4DR4 T;  4HE8 A;  1SA0 E;  4TUY E;  4HWI B;  2MYS A;  3U78 A;  2NOX A;  3K1S A;  5FKY A;  3HR0 A;  3R6N A;  2A3D A;  3N9Q A;  2PFV A;  2XAQ B;  4DMW A;  4CN6 A;  2YN6 A;  5L3F B;  4J2C A;  1YQ3 A;  5LHI B;  4LFB T;  1S35 A;  5LJM A;  4WNK A;  3UU3 A;  3O1H A;  4EB6 E;  5AQN B;  5KXJ A;  2XQ8 A;  1ZKE A;  3C4W A;  4X62 T;  2VVS A;  3QK6 A;  2LLY A;  3TLS A;  2ES0 A;  3VR9 A;  1S94 A;  1JNZ A;  2V7K A;  4U2Z A;  4LFC T;  2VKD A;  5TAO A;  1XMQ T;  4A56 A;  5AQV B;  2ODU A;  4DR2 T;  1SE7 A;  4EYU A;  4DUZ T;  3UFE A;  2QVA A;  4YSY A;  5AQO B;  4QX7 B;  4WBN E;  3LBX A;  1XDO A;  3ZMS B;  4F8H A;  2E5L T;  1T7S A;  4JBW F;  2D0T A;  1KFY A;  5HXC A;  2XY8 B;  5JQG E;  5LBM A;  5AQM B;  4QHO A;  5EK4 A;  3IF8 B;  4P09 A;  3AE9 A;  5FL1 A;  3FZM B;  4IE6 A;  2HPJ A;  4I43 B;  1BR4 A;  5JDQ A;  5DAB A;  2JMH A;  2XM1 A;  3ONL C;  5LG3 A;  4HFI A;  1L0V A;  4CZZ B;  4P1N A;  2V5D A;  4IE7 A;  5AQS B;  1N34 T;  1XDP A;  4AKR B;  3CK6 A;  4H63 V;  2NW7 A;  3F2E A;  3AXJ A;  2G0U A;  2JQK A;  4CXY A;  3LK2 B;  1FMW A;  1QUU A;  2NP9 A;  5LHH B;  1LVK A;  2WP9 A;  3N9O A;  4MAL A;  4EIW A;  4G63 A;  2X68 A;  1HS7 A;  1WYC A;  3RI5 A;  5AQG B;  3HKB E;  4X1I E;  1NWM X;  3P8C D;  5JDN A;  3PJA A;  2YDR A;  3LDQ B;  3CX8 B;  3P50 A;  2V7I A;  3NKZ A;  5JVD E;  3HKD E;  3MK7 C;  1X9B A;  4DR6 T;  2XAG B;  4UEL A;  4JEU B;  4X5T A;  5FVK A;  3UUB A;  5FXV A;  2LSK A;  2OLT A;  5JR9 B;  2RP4 A;  3UFG A;  5LBQ B;  3UUM A;  3GWH A;  5J2T E;  5HEJ A;  3CX7 B;  4KX6 A;  4KBM B;  4P0B A;  4UXN B;  5KX5 E;  5AQU B;  2LSY A;  2UXC T;  1NEN A;  2ZM6 T;  2XM2 A;  5KDM C;  5AQF B;  5F3J A;  4TZ4 C;  3ZYK A;  1HR0 T;  3ONJ A;  4EXT A;  1D0X A;  2WCA A;  3ZEF B;  3MJX A;  2V26 A;  2CHO A;  3N9M A;  1WLX A;  3CML A;  3T1H T;  5AFU L;  4I50 E;  3PTR B;  3HKE E;  3I9W A;  3KV4 A;  3RYF E;  3NBX X;  3N2G E;  3EAB A;  5DQW A;  1QSD A;  3Q5D A;  3CX6 B;  4H9R C;  2HN2 A;  2VUR A;  4JEH B;  3KV6 A;  1T72 A;  4EYY R;  4LMJ A;  4O8S A;  2UU9 T;  1HCI A;  3FZH B;  1D0Y A;  2YEV C;  2A2F X;  3OYZ A;  3ZN0 B;  4O4I E;  5CB4 E;  2WMO A;  2YU2 A;  3F31 A;  3RQU A;  4L0R A;  3A8Y C;  5LGT B;  1W9R A;  4EEB A;  1CHU A;  5EZY E;  4DMV A;  4IIJ E;  3AVR A;  4U74 A;  4XBF B;  4PJJ A;  2MPK A;  5IYZ E;  2JQQ A;  2IDO B;  4B6X A;  4YT0 A;  3ZST A;  1ZOY A;  3PJA J;  2A72 A;  4OHF A;  5FYM A;  4U72 A;  3RIA A;  2PBI A;  4KUM B;  1X79 A;  2BVM A;  1IBM T;  3FZL B;  4ZHQ E;  4AXP A;  3SFE A;  5JRE A;  5JR9 A;  4M1P A;  5JR9 C;  3PV0 F;  4DR3 T;  4C90 A;  1WR6 A;  4UV9 B;  3EVY A;  3EAM A;  5IUX A;  5EK2 A;  4B3M T;  2CXD A;  4V1A v;  3ZCJ A;  4IE0 A;  4FI5 A;  2X9W A;  3KIN B;  2VVN A;  4YTM A;  4LF5 T;  2CCQ A;  5HYA A;  3E0Z A;  2Z6E A;  1O3X A;  5FVL A;  1BR2 A;  3AAA B;  2BBJ A;  5HCJ A;  3N9N A;  2WU2 A;  4MFR A;  1LKX A;  3BQK A;  2XQ5 A;  2AE9 A;  3KDS E;  2K48 A;  2X9Y A;  4TNW A;  3LFM A;  2E9X D;  4XZC A;  3UU8 A;  4L9I A;  1J1J A;  3ZPO A;  2FBW A;  4X64 T;  2H89 A;  2XZE A;  4B3T T;  2IW5 B;  2KWI B;  4JYA T;  2JIW A;  2B1E A;  2JMK A;  2WMN A;  2DLR A;  3AEE A;  3QOF A;  4IHJ E;  3UQ7 A;  3ZKR A;  5M4Y A;  1OED E;  3N9L A;  3IBP A;  4IDQ A;  3GN5 A;  3PUG A;  2UXD T;  2L9Q A;  3PUQ A;  3FZF B;  3KVB A;  3ZCI A;  1OED B;  4HWD A;  3F57 A;  3K3Q C;  4ZI2 D;  3AE3 A;  2XQ6 A;  2J1D G;  1EZ3 A;  5IWA T;  5FXZ A;  1HFA A;  3ANW B;  3QUJ A;  1HNZ T;  2LM2 A;  2XQA A;  4AKL A;  3LSV A;  4DR7 T;  3RYC E;  2XAS B;  4Z8X A;  3PU3 A;  5LOV E;  5ABG A;  3C50 A;  3M65 A;  1HNW T;  2NW8 A;  4CXW A;  1WFD A;  2NR4 A;  3UUL A;  2BKO A;  3AE4 A;  4G2A A;  5GON E;  2H3R A;  4BJM A;  1ZP0 A;  4JI5 T;  3D0T A;  2WS3 A;  1H7C A;  1MMG A;  3HI2 A;  2DWK A;  2XPK A;  5HWX A;  2LJL A;  2QYW A;  2DHR A;  5IHY A;  2M6I A;  4HGA A;  3OJA A;  1NEK A;  4IST A;  4UF0 B;  3G06 A;  1WRD A;  3RHW A;  4B3R T;  4CI2 B;  3RIU C;  3NRX A;  4KHZ F;  4OX9 T;  4LF9 T;  2N9D A;  2W63 A;  5JRC A;  5LA6 E;  2X0H A;  1HX1 B;  2MBG A;  5LG4 A;  2H7O A;  1UX5 A;  3H3A A;  3AE5 A;  3M3Z B;  5AQQ B;  2HH7 A;  4YHJ A;  1UCU A;  4QXC B;  2KXP B;  3QNU A;  4A98 A;  5DJQ C;  2CLY C;  2V6X A;  1N36 T;  4FJO A;  3H3M A;  3MA9 A;  3ETV A;  5HXR A;  1KNP A;  4C91 A;  4PJL A;  4EZH A;  2ACX A;  1MIV A;  3PUV F;  4DV5 T;  3JAF A;  2RA1 A;  2V5C A;  5FXX A;  1E2A A;  5LP6 E;  3GMI A;  3KBT A;  2OV9 A;  5AQT B;  2DWG A;  1ZEE A;  3VR8 A;  3AE8 A;  4WYV A;  4H9Q C;  3PUW F;  4A97 A;  4U31 A;  1OED A;  4QH5 A;  1OED C;  1U5P A;  3Q9D A;  2W66 A;  5HWY A;  5FXW A;  3FBZ A;  4ILU A;  1U4Q A;  4NXM T;  4ZOL E;  2VQE T;  3L3P A;  4QH4 A;  5AQK B;  2ZM0 A;  4JI0 T;  5JDL A;  2W0G A;  3UTK A;  1MNE A;  2YOE A;  4UVA B;  4E7S A;  4N78 D;  3JAE A;  3CWZ B;  4CXX A;  4DR5 T;  2E9X A;  2E9X C;  4AKI A;  2IML A;  3AEA A;  4OK0 A;  2BDE A;  1IJ5 A;  3L8R A;  3ZLI A;  2J47 A;  5HEU A;  5ABE A;  2BZB A;  3KFW X;  1J5W A;  2BS4 A;  4UVB B;  2CM0 A;  2KND A;  2WWU A;  3SRZ A;  3MKD A;  1WYB A;  4K0K T;  1MMD A;  3X1D A;  5ABF A;  3DTO A;  2KMF A;  2D2S A;  2LRL A;  4PFP A;  4X65 T;  2WAU A;  1UGO A;  2QGS A;  2D5U A;  2N1G A;  3RH3 A;  1FEW A;  3QB5 A;  3TLW A;  5C8Y E;  2I6H A;  2WDV A;  4ZI2 C;  5L3G B;  3CVR A;  1YQ4 A;  4AIU A;  3AED A;  2K24 A;  4U7I A;  4IE4 A;  4XAX B;  5LMU T;  1XWM A;  2LHR A;  2PJQ A;  4QX8 B;  2WB5 A;  1XMO T;  3H37 A;  4H9S E;  3Q2M A;  4L5G A;  4U7Y A;  3EDV A;  5HEG A;  4DO0 A;  3WI3 A;  1JNR A;  1LRZ A;  3B13 A;  1LVF A;  2XQ3 A;  2HN1 A;  4YSX A;  5L3E B;  2Q9Q B;  1G73 A;  2W2U A;  2L8K A;  4GYS A;  3KV9 A;  1G8X A;  2KSR A;  3V5U A;  5LXT E;  1CUN A;  4IDZ A;  1YD8 G;  2XJ7 A;  2LHN A;  3FHN A;  4QXB B;  4ZXL A;  5CA0 E;  4X1K E;  2W67 A;  3ZJ2 A;  1T8B A;  4GKJ T;  4YSZ A;  3RRW A;  4AIS A;  2CHN A;  1Y01 A;  2UXX B;  2DI4 A;  5L4E A;  4I55 E;  2JRK A;  1Y64 B;  3V5S A;  3AE6 A;  4LFA T;  5H6Q B;  2VL8 A;  2PG8 A;  2XAH B;  5CA1 E;  3UQ4 A;  3OBV E;  4DID B;  1W0A A;  1R8I A;  2KLQ A;  4CI3 B;  2ZLY A;  3IA3 A;  2F4V T;  2V1D B;  1IBK T;  4TWF A;  2VKO A;  2X9H A;  1SHZ C;  3ETU A;  3HA4 A;  2MTQ A;  2Y48 B;  2BS3 A;  3CQC B;  5L2L A;  3RQW A;  5HXH A;  1MIW A;  5F5W A;  2MAW A;  3ZT6 A;  4UEM A;  3VHL A;  2J62 A;  3MZK B;  2XQ7 A;  2JPF A;  5C3J A;  2CEA A;  4UIG A;  4LF6 T;  1UUS A;  4UVC B;  2BKP A;  1W09 A;  3RGL A;  3C98 B;  3NZP A;  5A1L A;  3L09 A;  3TLU A;  1D1B A;  4AQG A;  3IEE A;  2WU5 A;  4NUU A;  2QRX A;  3EI0 A;  2GK9 A;  3VRB A;  4KMC A;  5JDH A;  2B76 A;  3P4R A;  4AQY T;  3P7I A;  3CQG B;  2CXL A;  3AVS A;  4LMK A;  4P0A A;  5ABH A;  2BBH A;  2X0Y A;  3ZC0 A;  2LOP A;  2I59 A;  3AE1 A;  4CN1 A;  1OWA A;  2VB6 A;  1YXR A;  3I1A A;  4ISS A;  4DV1 T;  2FJE A;  1DU2 A;  2CBI A;  4EED A;  4IDO A;  4LF7 T;  2E8I A;  4BA9 A;  1KNR A;  3BQI A;  4ADZ A;  4HFD A;  4HKA A;  3JAD A;  1XNQ T;  4U33 A;  3KV5 A;  2HPL A;  4ZI3 D;  4GK0 E;  3ZSS A; 
#chains in the Genus database with same CATH homology
 2CMR A;  2KIN B;  4AKG A;  2MBG A;  3HL6 A;  4AKR B;  4H63 V;  3K8P C;  1D1A A;  5LG4 A;  3RC3 A;  2H7O A;  3O1I A;  1YW0 A;  2NW7 A;  3F2E A;  2G0U A;  4AI6 A;  3LK4 2;  1UX5 A;  4EZ4 A;  4CXY A;  3H3A A;  3JC6 D;  3LK2 B;  1FMW A;  5J1G A;  1FIO A;  1QUU A;  3RYI E;  2HH7 A;  1BR0 A;  2NP9 A;  3DJB A;  5H6R B;  3VU7 H;  3C4Z A;  5LHH B;  2XUE A;  4YLH A;  4YHJ A;  1UCU A;  4QXC B;  3C51 A;  2KXP B;  4HEA A;  5ADX L;  1LVK A;  4NUV A;  3GN5 B;  3N9O A;  3S4U A;  5DJQ C;  2CLY C;  3MXZ A;  4DND A;  4HN9 A;  3WAJ A;  2YIN A;  4PFO A;  4JLE A;  2NW9 A;  4FJO A;  4MAL A;  4EIW A;  5J2U E;  4G63 A;  5FY7 A;  2X68 A;  3MA9 A;  3ZYL A;  1HS7 A;  1WYC A;  3ETV A;  3HKB E;  2WBL A;  4X1I E;  5HXR A;  3EDU A;  1NWM X;  3P8C D;  4C91 A;  3KBU A;  5JDG A;  2P9B A;  4PJL A;  5LNK A;  5JDN A;  2DNX A;  4EZH A;  1US7 B;  1VRB A;  2ACX A;  3ONX A;  2V7M A;  1MIV A;  5KMG P;  2MOZ A;  4TV8 E;  3CX8 B;  2RA1 A;  2V7I A;  5FXX A;  5JVD E;  3HKD E;  3MK7 C;  5JDM A;  4MLK A;  5F8P A;  4YFS A;  1MMA A;  2W62 A;  3U3I A;  3MAC A;  2XAG B;  4OYK A;  4UEL A;  2N2N A;  4JEU B;  5LP6 E;  2H7V C;  3GMI A;  3KBT A;  4O4L E;  2DWG A;  1ZEE A;  4BAY B;  4H9Q C;  3EUH A;  3PUA A;  4YJ2 E;  5FXV A;  2ODV A;  2LSK A;  4AKH A;  5JR9 B;  3E22 E;  5JH7 E;  1U5P A;  2RP4 A;  3Q9D A;  3Q5X A;  4ASK A;  5LBQ B;  5HWY A;  5FXW A;  2Q9Q A;  3FBZ A;  2W61 A;  4ILU A;  1U4Q A;  3O1J A;  3UUM A;  2CE7 A;  1HX8 A;  2Q9Q C;  2XQY A;  3FB2 A;  2CA5 A;  3GWH A;  1ZHC A;  3FXE B;  3OKQ A;  3ZMZ B;  3CX7 B;  5L3D B;  4ZOL E;  2WSS V;  3L3P A;  1E1H B;  3CPZ A;  2NWB A;  4KBM B;  4P0B A;  2ZM0 A;  4PW8 A;  4UXN B;  4PK6 A;  4WW0 A;  3ZMV B;  1D1C A;  2K9A A;  2W0G A;  3UTK A;  4DBR A;  5JDL A;  4H63 H;  3AAI A;  1MNE A;  4UVA B;  4ANJ A;  4E7S A;  4N78 D;  2NTX A;  2LSY A;  3CWZ B;  3N2K E;  4CXX A;  3N5L A;  3AA1 B;  2E9X A;  3IHR A;  3K3N A;  5KDM C;  4E7Z A;  2E9X C;  5F3J A;  4AKI A;  4TZ4 C;  3ZYK A;  4OK0 A;  2BDE A;  3PDY A;  4BJN A;  1IJ5 A;  1V9D A;  3ZLI A;  2WM9 A;  4EXT A;  5ETW A;  1D0X A;  2BZB A;  3KFW X;  4O4H E;  2IC9 A;  4UVB B;  3ZEF B;  3SWH A;  2ZM2 A;  2CM0 A;  2YU1 A;  2KND A;  3SOL A;  3MJX A;  5BMV E;  2WWU A;  2V26 A;  1NAF A;  2LEH A;  2L3L A;  3I0O A;  3SRZ A;  3N9M A;  1WLX A;  3LJC A;  3MKD A;  3CML A;  5JRC B;  2VAS A;  1WYB A;  5AFU L;  1MMD A;  4I50 E;  1FMV A;  3PTR B;  1KNZ A;  2X67 A;  4MBQ A;  5LGU B;  3DTO A;  3UUX B;  3WAK A;  3HKE E;  3I9W A;  2KMF A;  3KV4 A;  3RYF E;  5JDF A;  5LJN A;  2D2S A;  4PFP A;  2M67 A;  2WAU A;  3BK9 A;  3NBX X;  3CKD A;  3N2G E;  2QGS A;  2D5U A;  3R84 B;  2EHO D;  2N1G A;  5DQW A;  3A5X A;  1QSD A;  3DP7 A;  3AA6 B;  5LCY A;  1Z0P A;  1IZN B;  3RH3 A;  1YKH B;  1FEW A;  3CX6 B;  4H9R C;  3ZN1 B;  5HXS A;  5C8Y E;  3N9P A;  4JEH B;  3T8O A;  3KV6 A;  4TX5 A;  1BR1 A;  4ZI2 C;  4EYY R;  5L3G B;  2CLY B;  5L3C B;  3CVR A;  2QA7 A;  4H9P C;  4O8S A;  4JUY A;  1HCI A;  3UT5 E;  1D0Y A;  2K24 A;  2A2F X;  2YEV C;  4IE5 A;  4IE4 A;  4I4T E;  3OYZ A;  2CXF A;  3ZN0 B;  4O4I E;  4GOU A;  5CB4 E;  2ZM8 A;  4PJM A;  5FY0 A;  2ZMA A;  4YJ3 E;  1IJ6 A;  4XAX B;  4ZS2 A;  2UXN B;  3K3O A;  2WMO A;  2YU2 A;  3F31 A;  2D0U A;  2LHR A;  2KZ7 B;  2PJQ A;  4L0R A;  1VOM A;  3ZC1 A;  3B57 A;  1MND A;  2JJ9 A;  4QX8 B;  1D0Z A;  5LGT B;  3VKH A;  2K5B B;  1HG5 A;  3H37 A;  3Q2M A;  4H9S E;  2IC6 A;  3C4X A;  5EZY E;  4DMV A;  4IIJ E;  2KT9 A;  4L5G A;  3TKL B;  2C5I T;  3AVR A;  4U74 A;  4X20 E;  3EDV A;  4XBF B;  4PJJ A;  3RKO A;  2LSG A;  5IYZ E;  2JQQ A;  4DO0 A;  4F6R C;  4B6X A;  3WI3 A;  1LRZ A;  3PUR A;  3B13 A;  1LVF A;  1MIY A;  3J9X 1;  3PUS A;  1MMN A;  2VK9 A;  3LK3 B;  5FMN A;  5L3E B;  2A72 A;  2Q9Q B;  4HFV A;  4OHF A;  1G73 A;  3LBX B;  5FYM A;  5HAX A;  2L8K A;  4GYS A;  4U72 A;  2IAK A;  2EHO B;  3N2O A;  4HTE A;  3KV9 A;  1G8X A;  2SPC A;  4QXH B;  4EOZ B;  4TN7 B;  3V5U A;  2PBI A;  1CUN A;  5LXT E;  2VWA A;  4KUM B;  1X79 A;  2C5J A;  3SS1 A;  2BVM A;  4IDZ A;  1YD8 G;  3E08 A;  5J2T E;  4GK5 E;  2DCF A;  1HTJ F;  3NRY A;  5DQV A;  2LHN A;  2V7J A;  4ZHQ E;  4AXP A;  3ANW A;  2E9X B;  2Y6X A;  3FXD B;  5JRE A;  4ZI3 C;  5JR9 A;  4M1P A;  3FHN A;  1B7T A;  4QXB B;  5JR9 C;  1OXZ A;  4O2A E;  5CA0 E;  4X1K E;  2CWO A;  1T98 A;  2X66 A;  4OFZ A;  3ZJ2 A;  3OYX A;  1ZV4 X;  4C90 A;  1WR6 A;  5LYJ E;  4OYJ A;  4UV9 B;  5FY1 A;  3EVY A;  2BVL A;  3O4X E;  4AQF A;  3RRW A;  3JC6 C;  5EK2 A;  2C5K T;  4AQF C;  2CXD A;  4V1A v;  2UXX B;  2DI4 A;  3ZCJ A;  2YK0 A;  3ESL A;  2V7L A;  3AAE B;  4IE0 A;  4FI5 A;  4I55 E;  4O2B E;  2X9W A;  3KIN B;  2LSI A;  3FBL A;  2LT3 A;  2JRK A;  3LG7 A;  4O4J E;  2CCQ A;  4PJN A;  1Y64 B;  3V5S A;  4H9N C;  3E0Z A;  5FNV E;  4CQI A;  2OA5 A;  3RYH E;  2KWH A;  5HYA A;  4WBO A;  3GA8 A;  2Z6E A;  2Y8D A;  1HF8 A;  1O3X A;  2Q9Q D;  2VL8 A;  4UV8 B;  1BR2 A;  4QKN A;  5H6Q B;  4ZI7 E;  5LGN B;  3AAA B;  3ZMU B;  2PG8 A;  2XAH B;  5CA1 E;  4KP3 C;  3N9N A;  1AJ3 A;  3RPU A;  3OBV E;  3RRC A;  5FP3 A;  4UF0 A;  3NZQ A;  3RC8 A;  4ERR A;  4MFR A;  3PU8 A;  1LKX A;  2LOS A;  2X51 A;  2XHE B;  3BQK A;  2KLQ A;  2X9X A;  3KDS E;  3C64 A;  2K48 A;  4PK5 A;  4CI3 B;  2ZLY A;  2X9Y A;  1YKE B;  5LHG B;  3AB3 B;  2E9X D;  3LFM A;  3UUN A;  2V1D B;  3QC9 A;  2VKO A;  2X9H A;  1SHZ C;  4XZC A;  2CWY A;  3ETU A;  3HA4 A;  2MTQ A;  4PK4 A;  2LSJ A;  2VKJ A;  3I0Q A;  4L9I A;  2Y48 B;  4HE8 A;  3ZPO A;  1SA0 E;  3CQC B;  4TUY E;  4H9O C;  5L2L A;  4DBQ A;  2IW5 B;  2MYS A;  2KWI B;  3U78 A;  2NOX A;  5HXH A;  2B1E A;  2JMK A;  2WMN A;  2DLR A;  4QWN B;  1MIW A;  5EK3 A;  3HR0 A;  2NTY A;  4IHJ E;  3R6N A;  4GYR A;  2A3D A;  3W15 B;  3AA0 B;  3N9Q A;  2XAQ B;  2PFV A;  4UEM A;  4DMW A;  5HXE A;  5M4Y A;  3RX6 A;  1IAP A;  5L3F B;  3N9L A;  4J2C A;  3IBP A;  3GN5 A;  3VHL A;  3PUG A;  2L9Q A;  3PUQ A;  5LHI B;  4ZS3 A;  3MZK B;  5E0O A;  3I9Y A;  1S35 A;  3KVB A;  5LJM A;  4WNK A;  3O1H A;  1HG2 A;  3ZCI A;  4EB6 E;  2JPF A;  1ZKE A;  2CEA A;  1KK7 A;  2LM9 A;  3F57 A;  3C4W A;  4UIG A;  3K3Q C;  3J7Y q;  4ZI2 D;  2X0L B;  4UVC B;  2J1D G;  3QK6 A;  2XTL A;  2LE8 A;  2ES0 A;  3C98 B;  3NZP A;  5A1L A;  1S94 A;  1EZ3 A;  2V7K A;  3L09 A;  2C0S A;  5FXZ A;  1D1B A;  2VKD A;  4AQG A;  3IEE A;  4NUU A;  5TAO A;  1HFA A;  4A56 A;  2XAJ B;  3ZJ1 A;  3ANW B;  3QUJ A;  2ODU A;  2GK9 A;  4KMC A;  5JDH A;  4EYU A;  4TV9 E;  3P7I A;  4AKL A;  3UFE A;  5KX5 E;  3CQX C;  2CXL A;  3CQG B;  3RYC E;  4MHC A;  2XAS B;  4Z8X A;  3PE0 A;  3PU3 A;  5LOV E;  3AVS A;  3C50 A;  3M65 A;  4QX7 B;  3LBX A;  4PNI A;  3ZYM A;  4WBN E;  4P0A A;  2NW8 A;  4CXW A;  2EHO A;  3UUL A;  3ZMT B;  4IGU A;  2EHO C;  4G2A A;  2LOP A;  3ZC0 A;  5GON E;  3ZMS B;  4PAG A;  2H3R A;  4BJM A;  2I59 A;  3D0T A;  1OWA A;  2D0T A;  5HXC A;  1UX4 A;  5JQG E;  2VB6 A;  1H7C A;  5LBM A;  1MMG A;  4QHO A;  3HI2 A;  3I1A A;  4GIW A;  2DWK A;  4ISS A;  5EK4 A;  3KVA A;  3IF8 B;  4P09 A;  5HWX A;  4IE6 A;  2HPJ A;  2LJL A;  4I43 B;  4K0U A;  2DHR A;  4X1Y E;  5IHY A;  3AA7 B;  4HGA A;  3BQL A;  1BR4 A;  5JDQ A;  2XAF B;  5DAB A;  2E8I A;  4BA9 A;  2JMH A;  3HKC E;  3OJA A;  4IST A;  4UF0 B;  3BQI A;  3VKG A;  1WRD A;  2VKH A;  4ADZ A;  5L3B B;  4CI2 B;  4CI1 B;  3O9X A;  4HKA A;  3NRX A;  3KV5 A;  4DVD A;  4CZZ B;  2HPL A;  2N9D A;  2W00 A;  4GK0 E;  4ZI3 D;  4IE7 A;  4EAH A;  2W63 A;  5JRC A;  5LA6 E;  3Q5W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...