2KWHA

Ral binding domain of rlip76 (ralbp1)
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
56
structure length
56
Chain Sequence
GSETQAGIKEEIRRQEFLLNSLHRDLQGGIKDLSKEERLWEVQRILTALKRKLREA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The RalB-RLIP76 complex reveals a novel mode of ral-effector interaction
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
molecule keywords RalA-binding protein 1
total genus 20
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2010-04-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.90 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2kwhA00
1IJ5A 1IJ6A 2C5IT 1ZKEA 3L3PA 2C5KT 4EYYR 3CKDA 4B6XA 2CA5A 1Z0PA 4DNDA 2X9XA 2KWIB 1QSDA 1LRZA 3FXEB 2XTLA 3S4UA 3FXDB 4J2CA 2KWHA 2MBGA 4CQIA 2K48A 3CVRA 3MXZA 3TKLB 3P7IA 2X9WA 3N5LA 2X9YA 2G0UA 1H7CA 2C5JA 4FI5A 3QUJA 1LVFA 4L0RA 2IC9A 2IC6A 3QK6A
chains in the Genus database with same CATH superfamily
2JMKA 3UU5A 3ABVA 3NRYA 3N2OA 1OEDC 2D0TA 3GMIA 3MA9A 2QGSA 4HFCA 4BAYB 1BR2A 3QC9A 2YINA 3KV5A 3P4QA 3EDVA 3GN5A 5F5WA 3ZSSA 2ODUA 4YSXA 3LK2B 3C4XA 5C3JA 3UQ7A 4KI0F 2BBHA 1E1HB 3FBLA 4X1IE 2H89A 5ETWA 1I6ZA 3IHRA 3P4PA 4NUUA 4IL4A 4ZOLE 3UUXB 5HEJA 4DR1T 4B3ST 1XNRT 4XBFB 3AE3A 4YHJA 3RC8A 3IF8B 3TLSA 4MALA 2WSSV 4EGWA 3R84B 3J7Yq 5LG3A 4AI6A 5LCYA 4PK4A 5AQQB 4L9IA 1XZYA 2JQKA 3N2KE 4QXHB 5FY0A 2MOZA 4JUYA 3KDSE 4XAXB 3UFEA 3V5SA 4DR3T 4LF6T 4EZHA 2ZMAA 1T8BA 3CQXC 4JEHB 4PNIA 2RA1A 4ZS2A 1CUNA 4FJOA 4O4JE 4O2BE 2VKHA 5AQJB 5HWXA 4OX9T 4KMCA 2LSKA 3PUYF 3LK42 4KHPT 5F8PA 2PFVA 4AQYT 4EYYR 4I0UA 3W15B 3VR8A 4TN7B 2FUPA 1O3XA 5HWYA 5JDMA 4KP3C 5FMNA 4DV4T 5L4HA 2W67A 1MNEA 3A7MA 3AE2A 5EZYE 1Z8UA 2E9XA 4N78D 2YN6A 3FZLB 1KF6A 3LBXA 5LG4A 4B3TT 4LMLA 1JNRA 3MACA 4ILBA 2VKJA 3ZYKA 2VURA 4LMJA 2DLRA 4AISA 4ADZA 2X51A 4TWDA 1T98A 2UUBT 4PJLA 3ZLIA 3F31A 2N9DA 3AA0B 3I0QA 4U31A 4O4IE 2CBIA 4WYVA 4YTMA 4H63H 4TNWA 4ILCA 2WMOA 1WCRA 3GN5B 1Y01A 2ZM6T 1MMDA 5L4EA 2J4GA 4P0BA 3RRCA 5HXSA 5LHGB 3M65A 2AXDS 4DBRA 4ZI2C 1IAPA 3AXJB 2V6XA 4IIJE 5JDQA 3CX7B 3O1HA 4B6XA 3CQGB 4CN1A 2LOSA 4GYSA 3WAJA 2W61A 4ISSA 5AQKB 2WCAA 2XAJB 3OVUA 5HXCA 2XQ7A 2MBGA 3UU3A 4HWHA 2UXNB 2NW8A 1X79A 5FP3A 1OWAA 2XQ4A 1KNPA 3JC6D 3RYIE 4JI3T 1T72A 3HKEE 4ISTA 4HKAA 4EEBA 3PUWF 4LF9T 4B3RT 3P4SA 2J62A 2V6YA 1SHZC 3FZKB 5LBQB 3ZT6A 3HL6A 2WQYA 4UV8B 3QUJA 4AKHA 1MMGA 3UTKA 5LJNA 2JIWA 3QB5A 4CN6A 2ODVA 2IDOB 4A97A 2X9HA 4H9SE 2NTYA 4JBWF 4O4HE 3R6NA 5IWAT 3RI5A 2J47A 4PFPA 3E08A 2XUEA 2CA5A 2ACXA 2WB5A 1J5WA 2BKNA 4NIQA 4TNVA 4DNDA 4BJMA 2CE7A 4E7SA 3ZMZB 2CHNA 5L3GB 2LSGA 5ABGA 3G06A 1SA0E 3OYXA 3ZMTB 3N9OA 3ZT5A 4NXMT 2NP9A 1QSDA 4COFA 2VVSA 3BQIA 4X1KE 2BVMA 2YU2A 3PJAA 4P09A 1FIOA 1OEDA 2V26A 4YFSA 5HCMA 3PUVF 4HFDA 1FJGT 2LSIA 1BR1A 5FVKA 2WBLA 2F4VT 4IHJE 4UR9A 3WI3A 2X0LB 1H7CA 2JRKA 4U7IA 3NKZA 4WNKA 1Y64B 2XZEA 4QHOA 4AKIA 4FI5A 1L0VA 2MYSA 2W62A 4IE7A 5AQNB 4ASKA 3DTOA 3K8PC 3AE8A 3ZT7A 1IBKT 2W63A 5AQVB 2XQYA 2XQ5A 4JV5T 1KK7A 5L3FB 1NAFA 4U3CA 3RKGA 1G73A 1MMNA 5IYZE 2K3WA 3IA3A 2HHHT 3MJXA 2XPKA 4LF8T 3ZJ2A 1Z0PA 1HCIA 4IT4A 3TLWA 2WDVA 3AEGA 2VVNA 4DR2T 4DR4T 4NPPA 4X5TA 3BQKA 2YDQA 1YQ4A 1MIWA 3NRXA 4AQGA 3O9XA 3AA7B 3EAMA 5DJQC 1D1BA 3FZHB 4PW8A 5C2TA 3BK9A 3KV9A 3RYCE 3ZCIA 5EK2A 2Z6EA 3CVRA 2NW9A 1BR4A 2XQ3A 3H37A 4HFHA 4JEUB 2CLYC 3OKQA 3UU4A 3AAAB 4PJJA 3QNUA 5JDHA 1BR0A 2JQQA 2JMHA 2LSYA 2KLQA 3AE6A 2LM2A 2M6BA 3WAKA 2HPLA 3VHLA 2FJDA 4DIDB 2RP4A 4HFVA 4PFOA 5IHYA 4EYUA 4YLHA 3LFMA 4HWIB 2CPTA 1IBMT 2XAQB 1IJ6A 3EABA 3UU6A 4GOUA 3N9NA 5TAOA 3H3AA 5ADXL 4X20E 1XDOA 3OBVE 3ETVA 3UUNA 3VRAA 1R8IA 3AEBA 1W0BA 2LHNA 3F57A 1EZ3A 2WWUA 2B1EA 1FMVA 4IDOA 2FJEA 5AQOB 5JDFA 3PTRB 5C8YE 1MNDA 2D2SA 3HA4A 4LMKA 4PJMA 3JC6C 4TV9E 1LRZA 4A56A 4AQFC 1JNZA 1WLXA 2KT9A 2V6YB 4NUVA 1GQEA 5LBMA 5LJMA 4YTNA 2KWHA 2HN2A 5HAXA 3TKLB 3A8YC 2WWVA 4DVDA 4UV9B 1VRBA 4QH5A 5AFUL 2KNDA 4CN4A 4YT0A 5FL0A 2WZIA 5AQLB 4LFCT 1KNRA 3CX6B 1OXZA 2V7LA 5KXJA 2K9AA 3NZPA 3TLUA 5DQVA 5CGMA 1U5PA 2D5UA 3CMLA 1KFYA 5A1LA 4DV3T 4L5GA 3RIUA 2VKDA 4X66T 2LLYA 3N2GE 1WFDA 2YOEA 3ANWA 3AXJA 3U3IA 4HFEA 4AIUA 4YHHT 4YSZA 2RPAA 2CLYB 2I0MA 2E8IA 4F6RC 2XAFB 4DR6T 3PU8A 3UUMA 2H88A 3MZKB 4EOZB 5J2TE 2MPKA 2ZM0A 3UULA 4GYRA 1XNQT 1OEDE 3AE9A 2CM0A 4DO0A 3ZN0B 4ZI3C 5JDLA 4IE5A 4YXDA 1N33T 2K48A 4ZI7E 3MXZA 2ZM2A 4JI7T 3SFEA 2X9WA 3AEDA 2I6HA 3EUHA 2X9YA 3I9WA 3RIFA 4BA9A 5LP6E 4JI4T 4QXCB 2OV9A 4DBQA 4IREA 3LBXB 2BZBA 5FYMA 3J9X1 2LSJA 3RLFF 2BG9E 4U2YA 5LMUT 3GWHA 2FJAA 3HR0A 5FY7A 3P4RA 3ANWB 4O4LE 1UGOA 4PJNA 5GONE 5JVDE 4LF5T 2YU1A 3H3MA 3AAEB 3C64A 5LGTB 2JQHA 3N9LA 3C50A 3KV4A 3I0OA 3A5XA 2X9XA 3AECA 2ZM8A 5L47A 5L3BB 2E5LT 1MIVA 3L09A 4H9RC 4MBQA 2XSAA 2QVAA 2ZLYA 3FXEB 5KX5E 3S4UA 3PUSA 1WRDA 4I50E 2GK9A 4Z90A 5CA0E 2NWBA 2V7JA 2LJLA 5AQFB 4JI0T 4IDZA 2XM2A 3P7IA 4PAGA 2QYWA 1SUMB 4ZZBA 4AQFA 4ERRA 2Q9QB 1VCSA 2G0UA 3LSVA 3KFWX 4IE0A 2QRXA 2L8KA 4WBNE 2DHRA 2I59A 4YTPA 5ABFB 1HFAA 2X68A 1U4QA 3AVSA 2K24A 2V5CA 4KHZF 3CWZB 4QH4A 2D0UA 4DR5T 4OYJA 3K3NA 5FXWA 1QLBA 2A3DA 4AKLA 4CI1B 4AXPA 4CXWA 3N9MA 2VQET 3AEFA 4DV5T 3AE7A 1N36T 5CB4E 3SWHA 3ZKRA 2UXCT 3AB3B 1XDPA 3K3OA 3HI2A 4ANJA 2NR4A 1HNXT 1YXRA 5HEOA 2E9XD 2KXPB 3CIRA 3EHZA 3IEEA 2WS3A 4ILAA 1UUSA 2A2FX 2BDEA 1FEWA 1V9DA 2EHOA 2LKHA 4X62T 1J5ET 2UU9T 4EAHA 4LF4T 3AEAA 2JPFA 3PUGA 4DUZT 4JI2T 3FXDB 1MMAA 2CXLA 2BG9C 4OHFA 1IZNB 2BG9B 2LE8A 4IE6A 5KDMC 5LYJE 3KINB 4O8SA 3KBTA 1D0XA 4P1NA 3RHWA 3ZMVB 3RYFE 2QA7A 5JR9A 5H6RB 3T1YT 2PJQA 4OYKA 1D1AA 5JREA 2R6GF 2A72A 3ZEFB 2SPCA 2W66A 2IC9A 5IUXA 2WDQA 4UELA 3GA8A 3L3PA 1HF8A 5DABA 4H9PC 2BS3A 4HTEA 2VQFT 2V1DB 4UVBB 4UVAB 3KVAA 4TX5A 4WBOA 4TUYE 4ZXLA 3RIAA 2XQAA 3ZSTA 2CMRA 4ZZCA 4PK6A 5LHHB 5CFBA 3FZFB 2Y6XA 5FL1A 3B57A 4UXNB 3PUAA 4ZI3D 5AQIB 3K3QC 5LOVE 2PTFA 5JR9B 3KV6A 2CXFA 3KVBA 4GK0E 3ZPOA 4X1YE 1LVKA 4UIGA 4X64T 3RH3A 5JTGA 1CHUA 2A9UA 2IUBA 4QKNA 4WW0A 2M67A 1M7KA 4CQIA 4MLKA 3RIUC 3NWIA 2CHOA 3ZJ1A 3EI0A 3PUXF 2CCQA 2EHOB 2MTQA 4HE8A 5H6QB 3SRZA 3T1HT 3AA6B 4UVCB 1S94A 2PBIA 3U78A 2H7VC 5J1GA 3Q9DA 1E2AA 1E7PA 1IBLT 2BS2A 2W00A 4BJNA 2XQ9A 2YKSA 2VL8A 3LG7A 2ACZA 4JI1T 1HS7A 3ZMUB 2ES0A 3OYZA 3FHNA 2YK0A 1UK5A 5J0ZA 4DV6T 3FZMB 3C51A 4IGUA 3AE5A 4CI3B 5ABFA 4G63A 4ILUA 3HKCE 1T7SA 3EVYA 5FXZA 5L2LA 2W0GA 3UQ4A 5EK4A 4YSYA 1HTJF 2Q9QA 4IL9A 5HYAA 4DMVA 1HNZT 1VOMA 3L39A 2EHOD 3M3ZB 3E22E 1WYBA 2HN1A 3Q5EA 1D1CA 3MKDA 3AE1A 1UX5A 4GK5E 4U33A 1NENA 2Y8DA 4UF0B 4EXTA 3O1IA 3LK3B 3P4WA 2XHEB 2V5DA 3P50A 4TWHA 2WY2A 3I1AA 3N9PA 4H9NC 3OTOT 4B3MT 2BG9A 3ESLA 1W09A 4TZ4C 1LVFA 2C0SA 1KNZA 4E7ZA 2YEVC 3PE0A 5JR9C 4GIWA 2KZ7B 1B7TA 2N1GA 1ZV4X 4JLEA 3CX8B 1D0YA 2C5IT 2VWAA 4KBMB 4EB6E 5BMVE 4JI6T 5JRCB 5FY1A 5AQSB 1KEYA 3VR9A 5LXTE 2IMLA 4HGAA 4DV7T 4ZS3A 2JJ9A 2XM1A 3RKOA 2EHOC 4EEDA 3RRWA 2LRKA 4HWCA 3K1SA 1S35A 2LRLA 3B5MA 4LFBT 5AQHB 2M6IA 2KINB 2X0YA 5L3DB 2XJ7A 3C4WA 1NEKA 4JI5T 4K0KT 2WP9A 1I94T 3RPUA 4QH1A 5AQGB 3IBPA 3P8CD 3CQCB 3JAFA 3TLVA 1QUUA 5HXHA 3RYHE 4LF7T 2E9XB 1ZEEA 3NBXX 3Q5XA 1M62A 4L0RA 4YJ2E 4X65T 2WU2A 3JADA 2IC6A 1YQ3A 3OPCA 1J1JA 2UUAT 4JI8T 2XSBA 2DCFA 3PDYA 4QX7B 5JDGA 3T8OA 5DQWA 3AA1B 2LM9A 4IE4A 3AE4A 1ZKEA 3Q5WA 5FVLA 5ABEA 2X67A 4IDQA 5HCJA 5HEHA 4Q25A 2J1DG 5EK3A 4A98A 3CKDA 2CWOA 1YKHB 3NZQA 4G2AA 4H63V 1HG2A 2B76A 2XAHB 1XMOT 3C98B 4P0AA 1N32T 2XASB 4CXXA 2OLTA 4MHCA 2K5BB 2KWIB 2HPJA 3HKBE 3LJCA 3UT5E 4C91A 2IW5B 2BKOA 2Q9QD 4AKRB 4GKKT 5FXVA 4TV8E 4HWDA 4GKJT 2XTLA 5LGUB 4J2CA 2UXBT 4EIWA 2IIUA 3L8RA 2CRBA 3LDQB 4H9QC 4Z91A 3ZMSB 4A5XA 4DV2T 3N5LA 3PV0F 4UEMA 4U72A 5LB7B 2UXXB 2E9XC 2DI4A 3UUBA 2L9QA 5CA1E 3MK7C 4CZZB 5JDNA 5LA6E 2V7KA 3JAEA 2FBWA 3RQUA 3ZN1B 5LMNT 2VK9A 3X1DA 1N34T 3RF1A 2HH7A 3ONJA 5LHIB 3QK6A 4PK5A 3BQLA 4K0UA 1IJ5A 2Y48B 2E2AA 2C5KT 2LT3A 4OK0A 3CK6A 4QWNB 3PJAJ 2IAKA 4KX6A 4U74A 5FXXA 5L3EB 3AAIA 4CXYA 5JRCA 2Q9QC 2KSRA 4DV1T 2XQ8A 2MAWA 5HEGA 1X9BA 2LHRA 1UX4A 3CPZA 2NOXA 2D9DA 4LFAT 1ZP0A 2DWGA 2N2NA 1HG5A 3E0ZA 3PUQA 5J2UE 3V5UA 2PG8A 3N9QA 4YJ3E 4IDNA 1ZOYA 5BR8T 1XMQT 2WU5A 3D0TA 4WZXA 3UFGA 2P9BA 2OA5A 3DJBA 2WAUA 4TWFA 2CEAA 4UF0A 2VKOA 4CI2B 3KBUA 1XWMA 4ZI2D 4M1PA 4HFIA 5KMGP 2UUCT 4YY3T 2WZHA 4V1Av 2DL1A 3ZC1A 4IDPA 5CJ5A 1WR0A 3QOFA 1SE7A 3I9YA 1DU2A 3AEEA 3ZYMA 2X66A 2YDSA 3OJAA 2NW7A 4HN9A 5E0OA 2KMFA 2V8SV 5LNKA 4H9OC 5M4YA 3NVOA 4ZHQE 3ZC0A 5LGNB 3F2EA 4EZ4A 1W9RA 2XAGB 2XY8B 4I4TE 3ETUA 1LKXA 2VB6A 3SS1A 5F3JA 1VCTA 5FNVE 1FMWA 2BS4A 2LEHA 3FBZA 3FB2A 3HKDE 3EDUA 3TLTA 3DP7A 2VASA 3QB5K 3PURA 1WYCA 1WR6A 3RQWA 3VU7H 4OFZA 5AQTB 1W0AA 3RC3A 5ABHA 3PU3A 2H3RA 5HXRA 3B13A 4EV6A 1HR0T 4C90A 1OEDB 4KUMB 4DMWA 5HXEA 2NTXA 2CXDA 2JQ9A 3C4ZA 4HFBA 2L3LA 4HEAA 1HX1B 3JCFA 4QX8B 2IHR1 4HWFA 4AKGA 3Q5DA 4QXBB 4I43B 3PUZF 2XQ6A 4DR7T 3RGLA 2C5JA 1UCUA 3O1JA 3SOLA 5AQMB 3UU8A 5HEUA 1UURA 2FJBA 4JYAT 3SFDA 4DUYT 2LKGA 2CBJA 2DWKA 1ZHCA 2WM9A 2X0HA 4ZEYA 1HX8A 1NWMX 2E5VA 1D0ZA 3O4XE 3Q2MA 1YW0A 5AQRB 5AQUB 3ZYLA 1AJ3A 3VKGA 5AQPB 2DNXA 3ONXA 4F8HA 2V7IA 1YD8G 2W2UA 1MIYA 2BKPA 5FKYA 3AVRA 2YDRA 2H7OA 3RX6A 3VKHA 2LOPA 4I55E 2UXDT 4XZCA 1G8XA 1HNWT 5JH7E 5L3CB 2W4XA 1YKEB 2WMNA 4O2AE 4MFRA 2AE9A 2WDRA 4U7YA 4DV0T 2VL0A 3VRBA 5JQGE 3ZCJA 4Z8XA 1US7B 2BBJA 2BVLA 4U2ZA 4NXNT 3ONLC 2CWYA 2V7MA
chains in the Genus database with same CATH topology
2JMKA 3NRYA 3N2OA 2D0TA 3MA9A 3GMIA 2QGSA 4BAYB 1BR2A 3QC9A 2YINA 3KV5A 3EDVA 3GN5A 2ODUA 3LK2B 3C4XA 1E1HB 3FBLA 4X1IE 5ETWA 3IHRA 4NUUA 4ZOLE 3UUXB 4YHJA 3RC8A 3IF8B 4MALA 2WSSV 3R84B 3J7Yq 5LCYA 4PK4A 5FY0A 4L9IA 3N2KE 4QXHB 2MOZA 4JUYA 3KDSE 4XAXB 3UFEA 4EZHA 2ZMAA 3CQXC 4JEHB 4PNIA 2RA1A 4ZS2A 1CUNA 4FJOA 4O4JE 4O2BE 2VKHA 5HWXA 4KMCA 2LSKA 3LK42 5F8PA 2PFVA 4EYYR 3W15B 4TN7B 5JDMA 1O3XA 5HWYA 4KP3C 5FMNA 1MNEA 5EZYE 2E9XA 4N78D 3LBXA 5LG4A 3MACA 2VKJA 3ZYKA 2DLRA 4ADZA 2X51A 1T98A 4PJLA 3ZLIA 3F31A 2N9DA 3AA0B 3I0QA 4O4IE 4H63H 2WMOA 3GN5B 1MMDA 4P0BA 3RRCA 5HXSA 5LHGB 3M65A 4DBRA 4ZI2C 1IAPA 4IIJE 5JDQA 3CX7B 3O1HA 4B6XA 3CQGB 2LOSA 4GYSA 3WAJA 2W61A 4ISSA 2XAJB 5HXCA 2MBGA 2UXNB 2NW8A 1X79A 5FP3A 1OWAA 3JC6D 3RYIE 3HKEE 4ISTA 4HKAA 5LBQB 1SHZC 3HL6A 4UV8B 3QUJA 4AKHA 1MMGA 3UTKA 5LJNA 2ODVA 2X9HA 4H9SE 2NTYA 4O4HE 3R6NA 4PFPA 3E08A 2XUEA 2CA5A 2ACXA 4DNDA 5L3GB 4BJMA 2CE7A 4E7SA 3ZMZB 2LSGA 3OYXA 1SA0E 3ZMTB 3N9OA 2NP9A 1QSDA 3BQIA 4X1KE 2BVMA 2YU2A 4P09A 4YFSA 1FIOA 2V26A 4YJ2E 2LSIA 1BR1A 2WBLA 4IHJE 3WI3A 2X0LB 1H7CA 2JRKA 4WNKA 1Y64B 4QHOA 4AKIA 4FI5A 2MYSA 2W62A 4IE7A 4ASKA 3DTOA 3K8PC 2W63A 2XQYA 1KK7A 5L3FB 1NAFA 1G73A 1MMNA 5IYZE 3MJXA 3ZJ2A 1Z0PA 1HCIA 3BQKA 1MIWA 3NRXA 4AQGA 3O9XA 3AA7B 5DJQC 1D1BA 4PW8A 3BK9A 3KV9A 3RYCE 3ZCIA 5EK2A 2Z6EA 3CVRA 2NW9A 1BR4A 3H37A 4JEUB 2CLYC 3OKQA 3AAAB 4PJJA 5JDHA 1BR0A 2JQQA 2JMHA 2LSYA 2KLQA 3WAKA 2HPLA 3VHLA 2RP4A 4HFVA 4PFOA 5IHYA 4EYUA 4YLHA 3LFMA 2XAQB 1IJ6A 4GOUA 3N9NA 5TAOA 3H3AA 5ADXL 4X20E 3OBVE 3ETVA 3UUNA 2LHNA 3F57A 1EZ3A 2WWUA 2B1EA 1FMVA 5JDFA 3PTRB 5C8YE 1MNDA 2D2SA 3HA4A 4TV9E 4PJMA 3JC6C 1LRZA 4A56A 4AQFC 1WLXA 2KT9A 4NUVA 5LBMA 5LJMA 2KWHA 5HAXA 3TKLB 4DVDA 4UV9B 1VRBA 5AFUL 2KNDA 3CX6B 1OXZA 2V7LA 2K9AA 3NZPA 5DQVA 1U5PA 2D5UA 3CMLA 5A1LA 4L5GA 4XBFB 2VKDA 3N2GE 3ANWA 3U3IA 2CLYB 2E8IA 4F6RC 2XAFB 3PU8A 3UUMA 3MZKB 4EOZB 5J2TE 2ZM0A 3UULA 4GYRA 2CM0A 4DO0A 3ZN0B 4ZI3C 5JDLA 4IE5A 2K48A 4ZI7E 3MXZA 2ZM2A 2X9WA 3EUHA 5LP6E 2X9YA 3I9WA 4BA9A 4QXCB 4DBQA 3LBXB 2BZBA 5FYMA 3J9X1 2LSJA 3GWHA 3HR0A 5FY7A 3ANWB 4O4LE 4PJNA 5GONE 5JVDE 2YU1A 3AAEB 3C64A 5LGTB 3N9LA 3C50A 3KV4A 3I0OA 3A5XA 2X9XA 5L3BB 2ZM8A 1MIVA 3L09A 4H9RC 4MBQA 5KX5E 2ZLYA 3FXEB 3S4UA 3PUSA 1WRDA 4I50E 2GK9A 5CA0E 2NWBA 2V7JA 2LJLA 4IDZA 3P7IA 4PAGA 4AQFA 4ERRA 2Q9QB 2G0UA 3KFWX 4IE0A 2L8KA 4WBNE 2DHRA 2I59A 1HFAA 2X68A 1U4QA 3AVSA 2K24A 3CWZB 2D0UA 4OYJA 3K3NA 5FXWA 4AKLA 2A3DA 4CI1B 4AXPA 4CXWA 3N9MA 5CB4E 3SWHA 3AB3B 3K3OA 4ANJA 3HI2A 2E9XD 2KXPB 3IEEA 2A2FX 2BDEA 1FEWA 1V9DA 2EHOA 4EAHA 2JPFA 3PUGA 3FXDB 1MMAA 2CXLA 4OHFA 1IZNB 2LE8A 4IE6A 5KDMC 5LYJE 4AI6A 3KINB 4O8SA 3KBTA 1D0XA 3ZMVB 3RYFE 2QA7A 5JR9A 5H6RB 2PJQA 4OYKA 1D1AA 5JREA 2A72A 3ZEFB 2SPCA 2IC9A 4UELA 3GA8A 3L3PA 1HF8A 5DABA 4H9PC 4HTEA 2V1DB 4UVBB 4UVAB 3KVAA 4TX5A 4WBOA 4TUYE 5LHHB 2CMRA 4PK6A 2Y6XA 3B57A 4UXNB 3PUAA 4ZI3D 3K3QC 5LOVE 5JR9B 3KV6A 2CXFA 3KVBA 4GK0E 3ZPOA 4X1YE 1LVKA 4UIGA 3RH3A 4WW0A 4QKNA 2M67A 4CQIA 4MLKA 3ZJ1A 2CCQA 2EHOB 2MTQA 4HE8A 5H6QB 3SRZA 3AA6B 4UVCB 1S94A 2PBIA 3U78A 2H7VC 5J1GA 3Q9DA 2W00A 4BJNA 2VL8A 3LG7A 1HS7A 3ZMUB 2ES0A 3OYZA 3FHNA 2YK0A 3C51A 4IGUA 4CI3B 4G63A 4ILUA 3HKCE 5FXZA 3EVYA 5L2LA 2W0GA 5EK4A 1HTJF 2Q9QA 5HYAA 4DMVA 1VOMA 2EHOD 3E22E 1WYBA 1D1CA 3MKDA 4GK5E 1UX5A 4UF0B 2Y8DA 4EXTA 3O1IA 3LK3B 2XHEB 3N9PA 3I1AA 4H9NC 3ESLA 4TZ4C 1LVFA 2C0SA 1KNZA 4E7ZA 2YEVC 3PE0A 5JR9C 4GIWA 2KZ7B 1B7TA 2N1GA 1ZV4X 4JLEA 3CX8B 1D0YA 2C5IT 2VWAA 4KBMB 4EB6E 5BMVE 5JRCB 5FY1A 5LXTE 4HGAA 4ZS3A 2JJ9A 3RKOA 2EHOC 3RRWA 1S35A 2KINB 5L3DB 3C4WA 3RPUA 3IBPA 3P8CD 3CQCB 1QUUA 3RYHE 2E9XB 1ZEEA 3NBXX 3Q5XA 4L0RA 2IC6A 2DCFA 3PDYA 4QX7B 5JDGA 3T8OA 5DQWA 3AA1B 2LM9A 4IE4A 3Q5WA 1ZKEA 2X67A 5EK3A 2J1DG 3CKDA 2CWOA 1YKHB 3NZQA 4G2AA 4H63V 1HG2A 4P0AA 2XAHB 3C98B 2XASB 4CXXA 4MHCA 2K5BB 2KWIB 2HPJA 3HKBE 3LJCA 3UT5E 4C91A 2IW5B 2Q9QD 4AKRB 5FXVA 4TV8E 2XTLA 5LGUB 4J2CA 4EIWA 4H9QC 3ZMSB 3N5LA 4UEMA 4U72A 2UXXB 2E9XC 2DI4A 5JDNA 2L9QA 5CA1E 3MK7C 4CZZB 5LA6E 2V7KA 3ZN1B 2VK9A 2HH7A 5LHIB 3QK6A 4PK5A 3BQLA 4K0UA 1IJ5A 2Y48B 2C5KT 2LT3A 4OK0A 4QWNB 4U74A 5FXXA 2IAKA 5L3EB 4CXYA 5JRCA 3AAIA 2Q9QC 2LHRA 1UX4A 3CPZA 2NOXA 5J2UE 2DWGA 2N2NA 1HG5A 3E0ZA 3PUQA 3V5UA 2PG8A 3N9QA 4YJ3E 3D0TA 2P9BA 2OA5A 3DJBA 2WAUA 4UF0A 2CEAA 4ZI2D 2VKOA 4CI2B 3KBUA 5HXHA 4M1PA 5KMGP 3ZC1A 4V1Av 3I9YA 3ZYMA 2X66A 4HN9A 3OJAA 2NW7A 5E0OA 5M4YA 2KMFA 3ZC0A 5LNKA 4H9OC 4ZHQE 5LGNB 3F2EA 4EZ4A 2XAGB 4I4TE 3ETUA 1LKXA 2VB6A 3SS1A 5F3JA 5FNVE 1FMWA 2LEHA 3FBZA 3FB2A 3HKDE 3EDUA 3DP7A 2VASA 3PURA 1WYCA 1WR6A 3VU7H 4OFZA 3PU3A 2H3RA 5HXRA 3B13A 4C90A 4KUMB 4DMWA 5HXEA 2NTXA 2CXDA 3C4ZA 4HEAA 2L3LA 4QX8B 4AKGA 4QXBB 4I43B 2C5JA 1UCUA 3O1JA 3SOLA 2DWKA 1ZHCA 2WM9A 1HX8A 1NWMX 1D0ZA 3O4XE 3Q2MA 1YW0A 3ZYLA 1AJ3A 3VKGA 2DNXA 3ONXA 2V7IA 1YD8G 1MIYA 3AVRA 2H7OA 3RX6A 3VKHA 2LOPA 4I55E 4XZCA 1G8XA 5JH7E 5L3CB 1YKEB 2WMNA 4O2AE 4MFRA 5JQGE 3ZCJA 4Z8XA 1US7B 2BVLA 3V5SA 3RC3A 2CWYA 2V7MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IJ5 A;  1IJ6 A;  2C5I T;  1ZKE A;  3L3P A;  2C5K T;  4EYY R;  3CKD A;  4B6X A;  2CA5 A;  1Z0P A;  4DND A;  2X9X A;  2KWI B;  1QSD A;  1LRZ A;  3FXE B;  2XTL A;  3S4U A;  3FXD B;  4J2C A;  2KWH A;  2MBG A;  4CQI A;  2K48 A;  3CVR A;  3MXZ A;  3TKL B;  3P7I A;  2X9W A;  3N5L A;  2X9Y A;  2G0U A;  1H7C A;  2C5J A;  4FI5 A;  3QUJ A;  1LVF A;  4L0R A;  2IC9 A;  2IC6 A;  3QK6 A; 
#chains in the Genus database with same CATH topology
 2JMK A;  3UU5 A;  3ABV A;  3NRY A;  3N2O A;  1OED C;  2D0T A;  3GMI A;  3MA9 A;  2QGS A;  4HFC A;  4BAY B;  1BR2 A;  3QC9 A;  2YIN A;  3KV5 A;  3P4Q A;  3EDV A;  3GN5 A;  5F5W A;  3ZSS A;  2ODU A;  4YSX A;  3LK2 B;  3C4X A;  5C3J A;  3UQ7 A;  4KI0 F;  2BBH A;  1E1H B;  3FBL A;  4X1I E;  2H89 A;  5ETW A;  1I6Z A;  3IHR A;  3P4P A;  4NUU A;  4IL4 A;  4ZOL E;  3UUX B;  5HEJ A;  4DR1 T;  4B3S T;  1XNR T;  4XBF B;  3AE3 A;  4YHJ A;  3RC8 A;  3IF8 B;  3TLS A;  4MAL A;  2WSS V;  4EGW A;  3R84 B;  3J7Y q;  5LG3 A;  4AI6 A;  5LCY A;  4PK4 A;  5AQQ B;  4L9I A;  1XZY A;  2JQK A;  3N2K E;  4QXH B;  5FY0 A;  2MOZ A;  4JUY A;  3KDS E;  4XAX B;  3UFE A;  3V5S A;  4DR3 T;  4LF6 T;  4EZH A;  2ZMA A;  1T8B A;  3CQX C;  4JEH B;  4PNI A;  2RA1 A;  4ZS2 A;  1CUN A;  4FJO A;  4O4J E;  4O2B E;  2VKH A;  5AQJ B;  5HWX A;  4OX9 T;  4KMC A;  2LSK A;  3PUY F;  3LK4 2;  4KHP T;  5F8P A;  2PFV A;  4AQY T;  4EYY R;  4I0U A;  3W15 B;  3VR8 A;  4TN7 B;  2FUP A;  1O3X A;  5HWY A;  5JDM A;  4KP3 C;  5FMN A;  4DV4 T;  5L4H A;  2W67 A;  1MNE A;  3A7M A;  3AE2 A;  5EZY E;  1Z8U A;  2E9X A;  4N78 D;  2YN6 A;  3FZL B;  1KF6 A;  3LBX A;  5LG4 A;  4B3T T;  4LML A;  1JNR A;  3MAC A;  4ILB A;  2VKJ A;  3ZYK A;  2VUR A;  4LMJ A;  2DLR A;  4AIS A;  4ADZ A;  2X51 A;  4TWD A;  1T98 A;  2UUB T;  4PJL A;  3ZLI A;  3F31 A;  2N9D A;  3AA0 B;  3I0Q A;  4U31 A;  4O4I E;  2CBI A;  4WYV A;  4YTM A;  4H63 H;  4TNW A;  4ILC A;  2WMO A;  1WCR A;  3GN5 B;  1Y01 A;  2ZM6 T;  1MMD A;  5L4E A;  2J4G A;  4P0B A;  3RRC A;  5HXS A;  5LHG B;  3M65 A;  2AXD S;  4DBR A;  4ZI2 C;  1IAP A;  3AXJ B;  2V6X A;  4IIJ E;  5JDQ A;  3CX7 B;  3O1H A;  4B6X A;  3CQG B;  4CN1 A;  2LOS A;  4GYS A;  3WAJ A;  2W61 A;  4ISS A;  5AQK B;  2WCA A;  2XAJ B;  3OVU A;  5HXC A;  2XQ7 A;  2MBG A;  3UU3 A;  4HWH A;  2UXN B;  2NW8 A;  1X79 A;  5FP3 A;  1OWA A;  2XQ4 A;  1KNP A;  3JC6 D;  3RYI E;  4JI3 T;  1T72 A;  3HKE E;  4IST A;  4HKA A;  4EEB A;  3PUW F;  4LF9 T;  4B3R T;  3P4S A;  2J62 A;  2V6Y A;  1SHZ C;  3FZK B;  5LBQ B;  3ZT6 A;  3HL6 A;  2WQY A;  4UV8 B;  3QUJ A;  4AKH A;  1MMG A;  3UTK A;  5LJN A;  2JIW A;  3QB5 A;  4CN6 A;  2ODV A;  2IDO B;  4A97 A;  2X9H A;  4H9S E;  2NTY A;  4JBW F;  4O4H E;  3R6N A;  5IWA T;  3RI5 A;  2J47 A;  4PFP A;  3E08 A;  2XUE A;  2CA5 A;  2ACX A;  2WB5 A;  1J5W A;  2BKN A;  4NIQ A;  4TNV A;  4DND A;  4BJM A;  2CE7 A;  4E7S A;  3ZMZ B;  2CHN A;  5L3G B;  2LSG A;  5ABG A;  3G06 A;  1SA0 E;  3OYX A;  3ZMT B;  3N9O A;  3ZT5 A;  4NXM T;  2NP9 A;  1QSD A;  4COF A;  2VVS A;  3BQI A;  4X1K E;  2BVM A;  2YU2 A;  3PJA A;  4P09 A;  1FIO A;  1OED A;  2V26 A;  4YFS A;  5HCM A;  3PUV F;  4HFD A;  1FJG T;  2LSI A;  1BR1 A;  5FVK A;  2WBL A;  2F4V T;  4IHJ E;  4UR9 A;  3WI3 A;  2X0L B;  1H7C A;  2JRK A;  4U7I A;  3NKZ A;  4WNK A;  1Y64 B;  2XZE A;  4QHO A;  4AKI A;  4FI5 A;  1L0V A;  2MYS A;  2W62 A;  4IE7 A;  5AQN B;  4ASK A;  3DTO A;  3K8P C;  3AE8 A;  3ZT7 A;  1IBK T;  2W63 A;  5AQV B;  2XQY A;  2XQ5 A;  4JV5 T;  1KK7 A;  5L3F B;  1NAF A;  4U3C A;  3RKG A;  1G73 A;  1MMN A;  5IYZ E;  2K3W A;  3IA3 A;  2HHH T;  3MJX A;  2XPK A;  4LF8 T;  3ZJ2 A;  1Z0P A;  1HCI A;  4IT4 A;  3TLW A;  2WDV A;  3AEG A;  2VVN A;  4DR2 T;  4DR4 T;  4NPP A;  4X5T A;  3BQK A;  2YDQ A;  1YQ4 A;  1MIW A;  3NRX A;  4AQG A;  3O9X A;  3AA7 B;  3EAM A;  5DJQ C;  1D1B A;  3FZH B;  4PW8 A;  5C2T A;  3BK9 A;  3KV9 A;  3RYC E;  3ZCI A;  5EK2 A;  2Z6E A;  3CVR A;  2NW9 A;  1BR4 A;  2XQ3 A;  3H37 A;  4HFH A;  4JEU B;  2CLY C;  3OKQ A;  3UU4 A;  3AAA B;  4PJJ A;  3QNU A;  5JDH A;  1BR0 A;  2JQQ A;  2JMH A;  2LSY A;  2KLQ A;  3AE6 A;  2LM2 A;  2M6B A;  3WAK A;  2HPL A;  3VHL A;  2FJD A;  4DID B;  2RP4 A;  4HFV A;  4PFO A;  5IHY A;  4EYU A;  4YLH A;  3LFM A;  4HWI B;  2CPT A;  1IBM T;  2XAQ B;  1IJ6 A;  3EAB A;  3UU6 A;  4GOU A;  3N9N A;  5TAO A;  3H3A A;  5ADX L;  4X20 E;  1XDO A;  3OBV E;  3ETV A;  3UUN A;  3VRA A;  1R8I A;  3AEB A;  1W0B A;  2LHN A;  3F57 A;  1EZ3 A;  2WWU A;  2B1E A;  1FMV A;  4IDO A;  2FJE A;  5AQO B;  5JDF A;  3PTR B;  5C8Y E;  1MND A;  2D2S A;  3HA4 A;  4LMK A;  4PJM A;  3JC6 C;  4TV9 E;  1LRZ A;  4A56 A;  4AQF C;  1JNZ A;  1WLX A;  2KT9 A;  2V6Y B;  4NUV A;  1GQE A;  5LBM A;  5LJM A;  4YTN A;  2KWH A;  2HN2 A;  5HAX A;  3TKL B;  3A8Y C;  2WWV A;  4DVD A;  4UV9 B;  1VRB A;  4QH5 A;  5AFU L;  2KND A;  4CN4 A;  4YT0 A;  5FL0 A;  2WZI A;  5AQL B;  4LFC T;  1KNR A;  3CX6 B;  1OXZ A;  2V7L A;  5KXJ A;  2K9A A;  3NZP A;  3TLU A;  5DQV A;  5CGM A;  1U5P A;  2D5U A;  3CML A;  1KFY A;  5A1L A;  4DV3 T;  4L5G A;  3RIU A;  2VKD A;  4X66 T;  2LLY A;  3N2G E;  1WFD A;  2YOE A;  3ANW A;  3AXJ A;  3U3I A;  4HFE A;  4AIU A;  4YHH T;  4YSZ A;  2RPA A;  2CLY B;  2I0M A;  2E8I A;  4F6R C;  2XAF B;  4DR6 T;  3PU8 A;  3UUM A;  2H88 A;  3MZK B;  4EOZ B;  5J2T E;  2MPK A;  2ZM0 A;  3UUL A;  4GYR A;  1XNQ T;  1OED E;  3AE9 A;  2CM0 A;  4DO0 A;  3ZN0 B;  4ZI3 C;  5JDL A;  4IE5 A;  4YXD A;  1N33 T;  2K48 A;  4ZI7 E;  3MXZ A;  2ZM2 A;  4JI7 T;  3SFE A;  2X9W A;  3AED A;  2I6H A;  3EUH A;  2X9Y A;  3I9W A;  3RIF A;  4BA9 A;  5LP6 E;  4JI4 T;  4QXC B;  2OV9 A;  4DBQ A;  4IRE A;  3LBX B;  2BZB A;  5FYM A;  3J9X 1;  2LSJ A;  3RLF F;  2BG9 E;  4U2Y A;  5LMU T;  3GWH A;  2FJA A;  3HR0 A;  5FY7 A;  3P4R A;  3ANW B;  4O4L E;  1UGO A;  4PJN A;  5GON E;  5JVD E;  4LF5 T;  2YU1 A;  3H3M A;  3AAE B;  3C64 A;  5LGT B;  2JQH A;  3N9L A;  3C50 A;  3KV4 A;  3I0O A;  3A5X A;  2X9X A;  3AEC A;  2ZM8 A;  5L47 A;  5L3B B;  2E5L T;  1MIV A;  3L09 A;  4H9R C;  4MBQ A;  2XSA A;  2QVA A;  2ZLY A;  3FXE B;  5KX5 E;  3S4U A;  3PUS A;  1WRD A;  4I50 E;  2GK9 A;  4Z90 A;  5CA0 E;  2NWB A;  2V7J A;  2LJL A;  5AQF B;  4JI0 T;  4IDZ A;  2XM2 A;  3P7I A;  4PAG A;  2QYW A;  1SUM B;  4ZZB A;  4AQF A;  4ERR A;  2Q9Q B;  1VCS A;  2G0U A;  3LSV A;  3KFW X;  4IE0 A;  2QRX A;  2L8K A;  4WBN E;  2DHR A;  2I59 A;  4YTP A;  5ABF B;  1HFA A;  2X68 A;  1U4Q A;  3AVS A;  2K24 A;  2V5C A;  4KHZ F;  3CWZ B;  4QH4 A;  2D0U A;  4DR5 T;  4OYJ A;  3K3N A;  5FXW A;  1QLB A;  2A3D A;  4AKL A;  4CI1 B;  4AXP A;  4CXW A;  3N9M A;  2VQE T;  3AEF A;  4DV5 T;  3AE7 A;  1N36 T;  5CB4 E;  3SWH A;  3ZKR A;  2UXC T;  3AB3 B;  1XDP A;  3K3O A;  3HI2 A;  4ANJ A;  2NR4 A;  1HNX T;  1YXR A;  5HEO A;  2E9X D;  2KXP B;  3CIR A;  3EHZ A;  3IEE A;  2WS3 A;  4ILA A;  1UUS A;  2A2F X;  2BDE A;  1FEW A;  1V9D A;  2EHO A;  2LKH A;  4X62 T;  1J5E T;  2UU9 T;  4EAH A;  4LF4 T;  3AEA A;  2JPF A;  3PUG A;  4DUZ T;  4JI2 T;  3FXD B;  1MMA A;  2CXL A;  2BG9 C;  4OHF A;  1IZN B;  2BG9 B;  2LE8 A;  4IE6 A;  5KDM C;  5LYJ E;  3KIN B;  4O8S A;  3KBT A;  1D0X A;  4P1N A;  3RHW A;  3ZMV B;  3RYF E;  2QA7 A;  5JR9 A;  5H6R B;  3T1Y T;  2PJQ A;  4OYK A;  1D1A A;  5JRE A;  2R6G F;  2A72 A;  3ZEF B;  2SPC A;  2W66 A;  2IC9 A;  5IUX A;  2WDQ A;  4UEL A;  3GA8 A;  3L3P A;  1HF8 A;  5DAB A;  4H9P C;  2BS3 A;  4HTE A;  2VQF T;  2V1D B;  4UVB B;  4UVA B;  3KVA A;  4TX5 A;  4WBO A;  4TUY E;  4ZXL A;  3RIA A;  2XQA A;  3ZST A;  2CMR A;  4ZZC A;  4PK6 A;  5LHH B;  5CFB A;  3FZF B;  2Y6X A;  5FL1 A;  3B57 A;  4UXN B;  3PUA A;  4ZI3 D;  5AQI B;  3K3Q C;  5LOV E;  2PTF A;  5JR9 B;  3KV6 A;  2CXF A;  3KVB A;  4GK0 E;  3ZPO A;  4X1Y E;  1LVK A;  4UIG A;  4X64 T;  3RH3 A;  5JTG A;  1CHU A;  2A9U A;  2IUB A;  4QKN A;  4WW0 A;  2M67 A;  1M7K A;  4CQI A;  4MLK A;  3RIU C;  3NWI A;  2CHO A;  3ZJ1 A;  3EI0 A;  3PUX F;  2CCQ A;  2EHO B;  2MTQ A;  4HE8 A;  5H6Q B;  3SRZ A;  3T1H T;  3AA6 B;  4UVC B;  1S94 A;  2PBI A;  3U78 A;  2H7V C;  5J1G A;  3Q9D A;  1E2A A;  1E7P A;  1IBL T;  2BS2 A;  2W00 A;  4BJN A;  2XQ9 A;  2YKS A;  2VL8 A;  3LG7 A;  2ACZ A;  4JI1 T;  1HS7 A;  3ZMU B;  2ES0 A;  3OYZ A;  3FHN A;  2YK0 A;  1UK5 A;  5J0Z A;  4DV6 T;  3FZM B;  3C51 A;  4IGU A;  3AE5 A;  4CI3 B;  5ABF A;  4G63 A;  4ILU A;  3HKC E;  1T7S A;  3EVY A;  5FXZ A;  5L2L A;  2W0G A;  3UQ4 A;  5EK4 A;  4YSY A;  1HTJ F;  2Q9Q A;  4IL9 A;  5HYA A;  4DMV A;  1HNZ T;  1VOM A;  3L39 A;  2EHO D;  3M3Z B;  3E22 E;  1WYB A;  2HN1 A;  3Q5E A;  1D1C A;  3MKD A;  3AE1 A;  1UX5 A;  4GK5 E;  4U33 A;  1NEN A;  2Y8D A;  4UF0 B;  4EXT A;  3O1I A;  3LK3 B;  3P4W A;  2XHE B;  2V5D A;  3P50 A;  4TWH A;  2WY2 A;  3I1A A;  3N9P A;  4H9N C;  3OTO T;  4B3M T;  2BG9 A;  3ESL A;  1W09 A;  4TZ4 C;  1LVF A;  2C0S A;  1KNZ A;  4E7Z A;  2YEV C;  3PE0 A;  5JR9 C;  4GIW A;  2KZ7 B;  1B7T A;  2N1G A;  1ZV4 X;  4JLE A;  3CX8 B;  1D0Y A;  2C5I T;  2VWA A;  4KBM B;  4EB6 E;  5BMV E;  4JI6 T;  5JRC B;  5FY1 A;  5AQS B;  1KEY A;  3VR9 A;  5LXT E;  2IML A;  4HGA A;  4DV7 T;  4ZS3 A;  2JJ9 A;  2XM1 A;  3RKO A;  2EHO C;  4EED A;  3RRW A;  2LRK A;  4HWC A;  3K1S A;  1S35 A;  2LRL A;  3B5M A;  4LFB T;  5AQH B;  2M6I A;  2KIN B;  2X0Y A;  5L3D B;  2XJ7 A;  3C4W A;  1NEK A;  4JI5 T;  4K0K T;  2WP9 A;  1I94 T;  3RPU A;  4QH1 A;  5AQG B;  3IBP A;  3P8C D;  3CQC B;  3JAF A;  3TLV A;  1QUU A;  5HXH A;  3RYH E;  4LF7 T;  2E9X B;  1ZEE A;  3NBX X;  3Q5X A;  1M62 A;  4L0R A;  4YJ2 E;  4X65 T;  2WU2 A;  3JAD A;  2IC6 A;  1YQ3 A;  3OPC A;  1J1J A;  2UUA T;  4JI8 T;  2XSB A;  2DCF A;  3PDY A;  4QX7 B;  5JDG A;  3T8O A;  5DQW A;  3AA1 B;  2LM9 A;  4IE4 A;  3AE4 A;  1ZKE A;  3Q5W A;  5FVL A;  5ABE A;  2X67 A;  4IDQ A;  5HCJ A;  5HEH A;  4Q25 A;  2J1D G;  5EK3 A;  4A98 A;  3CKD A;  2CWO A;  1YKH B;  3NZQ A;  4G2A A;  4H63 V;  1HG2 A;  2B76 A;  2XAH B;  1XMO T;  3C98 B;  4P0A A;  1N32 T;  2XAS B;  4CXX A;  2OLT A;  4MHC A;  2K5B B;  2KWI B;  2HPJ A;  3HKB E;  3LJC A;  3UT5 E;  4C91 A;  2IW5 B;  2BKO A;  2Q9Q D;  4AKR B;  4GKK T;  5FXV A;  4TV8 E;  4HWD A;  4GKJ T;  2XTL A;  5LGU B;  4J2C A;  2UXB T;  4EIW A;  2IIU A;  3L8R A;  2CRB A;  3LDQ B;  4H9Q C;  4Z91 A;  3ZMS B;  4A5X A;  4DV2 T;  3N5L A;  3PV0 F;  4UEM A;  4U72 A;  5LB7 B;  2UXX B;  2E9X C;  2DI4 A;  3UUB A;  2L9Q A;  5CA1 E;  3MK7 C;  4CZZ B;  5JDN A;  5LA6 E;  2V7K A;  3JAE A;  2FBW A;  3RQU A;  3ZN1 B;  5LMN T;  2VK9 A;  3X1D A;  1N34 T;  3RF1 A;  2HH7 A;  3ONJ A;  5LHI B;  3QK6 A;  4PK5 A;  3BQL A;  4K0U A;  1IJ5 A;  2Y48 B;  2E2A A;  2C5K T;  2LT3 A;  4OK0 A;  3CK6 A;  4QWN B;  3PJA J;  2IAK A;  4KX6 A;  4U74 A;  5FXX A;  5L3E B;  3AAI A;  4CXY A;  5JRC A;  2Q9Q C;  2KSR A;  4DV1 T;  2XQ8 A;  2MAW A;  5HEG A;  1X9B A;  2LHR A;  1UX4 A;  3CPZ A;  2NOX A;  2D9D A;  4LFA T;  1ZP0 A;  2DWG A;  2N2N A;  1HG5 A;  3E0Z A;  3PUQ A;  5J2U E;  3V5U A;  2PG8 A;  3N9Q A;  4YJ3 E;  4IDN A;  1ZOY A;  5BR8 T;  1XMQ T;  2WU5 A;  3D0T A;  4WZX A;  3UFG A;  2P9B A;  2OA5 A;  3DJB A;  2WAU A;  4TWF A;  2CEA A;  4UF0 A;  2VKO A;  4CI2 B;  3KBU A;  1XWM A;  4ZI2 D;  4M1P A;  4HFI A;  5KMG P;  2UUC T;  4YY3 T;  2WZH A;  4V1A v;  2DL1 A;  3ZC1 A;  4IDP A;  5CJ5 A;  1WR0 A;  3QOF A;  1SE7 A;  3I9Y A;  1DU2 A;  3AEE A;  3ZYM A;  2X66 A;  2YDS A;  3OJA A;  2NW7 A;  4HN9 A;  5E0O A;  2KMF A;  2V8S V;  5LNK A;  4H9O C;  5M4Y A;  3NVO A;  4ZHQ E;  3ZC0 A;  5LGN B;  3F2E A;  4EZ4 A;  1W9R A;  2XAG B;  2XY8 B;  4I4T E;  3ETU A;  1LKX A;  2VB6 A;  3SS1 A;  5F3J A;  1VCT A;  5FNV E;  1FMW A;  2BS4 A;  2LEH A;  3FBZ A;  3FB2 A;  3HKD E;  3EDU A;  3TLT A;  3DP7 A;  2VAS A;  3QB5 K;  3PUR A;  1WYC A;  1WR6 A;  3RQW A;  3VU7 H;  4OFZ A;  5AQT B;  1W0A A;  3RC3 A;  5ABH A;  3PU3 A;  2H3R A;  5HXR A;  3B13 A;  4EV6 A;  1HR0 T;  4C90 A;  1OED B;  4KUM B;  4DMW A;  5HXE A;  2NTX A;  2CXD A;  2JQ9 A;  3C4Z A;  4HFB A;  2L3L A;  4HEA A;  1HX1 B;  3JCF A;  4QX8 B;  2IHR 1;  4HWF A;  4AKG A;  3Q5D A;  4QXB B;  4I43 B;  3PUZ F;  2XQ6 A;  4DR7 T;  3RGL A;  2C5J A;  1UCU A;  3O1J A;  3SOL A;  5AQM B;  3UU8 A;  5HEU A;  1UUR A;  2FJB A;  4JYA T;  3SFD A;  4DUY T;  2LKG A;  2CBJ A;  2DWK A;  1ZHC A;  2WM9 A;  2X0H A;  4ZEY A;  1HX8 A;  1NWM X;  2E5V A;  1D0Z A;  3O4X E;  3Q2M A;  1YW0 A;  5AQR B;  5AQU B;  3ZYL A;  1AJ3 A;  3VKG A;  5AQP B;  2DNX A;  3ONX A;  4F8H A;  2V7I A;  1YD8 G;  2W2U A;  1MIY A;  2BKP A;  5FKY A;  3AVR A;  2YDR A;  2H7O A;  3RX6 A;  3VKH A;  2LOP A;  4I55 E;  2UXD T;  4XZC A;  1G8X A;  1HNW T;  5JH7 E;  5L3C B;  2W4X A;  1YKE B;  2WMN A;  4O2A E;  4MFR A;  2AE9 A;  2WDR A;  4U7Y A;  4DV0 T;  2VL0 A;  3VRB A;  5JQG E;  3ZCJ A;  4Z8X A;  1US7 B;  2BBJ A;  2BVL A;  4U2Z A;  4NXN T;  3ONL C;  2CWY A;  2V7M A; 
#chains in the Genus database with same CATH homology
 2JMK A;  3NRY A;  3N2O A;  2D0T A;  3MA9 A;  3GMI A;  2QGS A;  4BAY B;  1BR2 A;  3QC9 A;  2YIN A;  3KV5 A;  3EDV A;  3GN5 A;  2ODU A;  3LK2 B;  3C4X A;  1E1H B;  3FBL A;  4X1I E;  5ETW A;  3IHR A;  4NUU A;  4ZOL E;  3UUX B;  4YHJ A;  3RC8 A;  3IF8 B;  4MAL A;  2WSS V;  3R84 B;  3J7Y q;  5LCY A;  4PK4 A;  5FY0 A;  4L9I A;  3N2K E;  4QXH B;  2MOZ A;  4JUY A;  3KDS E;  4XAX B;  3UFE A;  4EZH A;  2ZMA A;  3CQX C;  4JEH B;  4PNI A;  2RA1 A;  4ZS2 A;  1CUN A;  4FJO A;  4O4J E;  4O2B E;  2VKH A;  5HWX A;  4KMC A;  2LSK A;  3LK4 2;  5F8P A;  2PFV A;  4EYY R;  3W15 B;  4TN7 B;  5JDM A;  1O3X A;  5HWY A;  4KP3 C;  5FMN A;  1MNE A;  5EZY E;  2E9X A;  4N78 D;  3LBX A;  5LG4 A;  3MAC A;  2VKJ A;  3ZYK A;  2DLR A;  4ADZ A;  2X51 A;  1T98 A;  4PJL A;  3ZLI A;  3F31 A;  2N9D A;  3AA0 B;  3I0Q A;  4O4I E;  4H63 H;  2WMO A;  3GN5 B;  1MMD A;  4P0B A;  3RRC A;  5HXS A;  5LHG B;  3M65 A;  4DBR A;  4ZI2 C;  1IAP A;  4IIJ E;  5JDQ A;  3CX7 B;  3O1H A;  4B6X A;  3CQG B;  2LOS A;  4GYS A;  3WAJ A;  2W61 A;  4ISS A;  2XAJ B;  5HXC A;  2MBG A;  2UXN B;  2NW8 A;  1X79 A;  5FP3 A;  1OWA A;  3JC6 D;  3RYI E;  3HKE E;  4IST A;  4HKA A;  5LBQ B;  1SHZ C;  3HL6 A;  4UV8 B;  3QUJ A;  4AKH A;  1MMG A;  3UTK A;  5LJN A;  2ODV A;  2X9H A;  4H9S E;  2NTY A;  4O4H E;  3R6N A;  4PFP A;  3E08 A;  2XUE A;  2CA5 A;  2ACX A;  4DND A;  5L3G B;  4BJM A;  2CE7 A;  4E7S A;  3ZMZ B;  2LSG A;  3OYX A;  1SA0 E;  3ZMT B;  3N9O A;  2NP9 A;  1QSD A;  3BQI A;  4X1K E;  2BVM A;  2YU2 A;  4P09 A;  4YFS A;  1FIO A;  2V26 A;  4YJ2 E;  2LSI A;  1BR1 A;  2WBL A;  4IHJ E;  3WI3 A;  2X0L B;  1H7C A;  2JRK A;  4WNK A;  1Y64 B;  4QHO A;  4AKI A;  4FI5 A;  2MYS A;  2W62 A;  4IE7 A;  4ASK A;  3DTO A;  3K8P C;  2W63 A;  2XQY A;  1KK7 A;  5L3F B;  1NAF A;  1G73 A;  1MMN A;  5IYZ E;  3MJX A;  3ZJ2 A;  1Z0P A;  1HCI A;  3BQK A;  1MIW A;  3NRX A;  4AQG A;  3O9X A;  3AA7 B;  5DJQ C;  1D1B A;  4PW8 A;  3BK9 A;  3KV9 A;  3RYC E;  3ZCI A;  5EK2 A;  2Z6E A;  3CVR A;  2NW9 A;  1BR4 A;  3H37 A;  4JEU B;  2CLY C;  3OKQ A;  3AAA B;  4PJJ A;  5JDH A;  1BR0 A;  2JQQ A;  2JMH A;  2LSY A;  2KLQ A;  3WAK A;  2HPL A;  3VHL A;  2RP4 A;  4HFV A;  4PFO A;  5IHY A;  4EYU A;  4YLH A;  3LFM A;  2XAQ B;  1IJ6 A;  4GOU A;  3N9N A;  5TAO A;  3H3A A;  5ADX L;  4X20 E;  3OBV E;  3ETV A;  3UUN A;  2LHN A;  3F57 A;  1EZ3 A;  2WWU A;  2B1E A;  1FMV A;  5JDF A;  3PTR B;  5C8Y E;  1MND A;  2D2S A;  3HA4 A;  4TV9 E;  4PJM A;  3JC6 C;  1LRZ A;  4A56 A;  4AQF C;  1WLX A;  2KT9 A;  4NUV A;  5LBM A;  5LJM A;  2KWH A;  5HAX A;  3TKL B;  4DVD A;  4UV9 B;  1VRB A;  5AFU L;  2KND A;  3CX6 B;  1OXZ A;  2V7L A;  2K9A A;  3NZP A;  5DQV A;  1U5P A;  2D5U A;  3CML A;  5A1L A;  4L5G A;  4XBF B;  2VKD A;  3N2G E;  3ANW A;  3U3I A;  2CLY B;  2E8I A;  4F6R C;  2XAF B;  3PU8 A;  3UUM A;  3MZK B;  4EOZ B;  5J2T E;  2ZM0 A;  3UUL A;  4GYR A;  2CM0 A;  4DO0 A;  3ZN0 B;  4ZI3 C;  5JDL A;  4IE5 A;  2K48 A;  4ZI7 E;  3MXZ A;  2ZM2 A;  2X9W A;  3EUH A;  5LP6 E;  2X9Y A;  3I9W A;  4BA9 A;  4QXC B;  4DBQ A;  3LBX B;  2BZB A;  5FYM A;  3J9X 1;  2LSJ A;  3GWH A;  3HR0 A;  5FY7 A;  3ANW B;  4O4L E;  4PJN A;  5GON E;  5JVD E;  2YU1 A;  3AAE B;  3C64 A;  5LGT B;  3N9L A;  3C50 A;  3KV4 A;  3I0O A;  3A5X A;  2X9X A;  5L3B B;  2ZM8 A;  1MIV A;  3L09 A;  4H9R C;  4MBQ A;  5KX5 E;  2ZLY A;  3FXE B;  3S4U A;  3PUS A;  1WRD A;  4I50 E;  2GK9 A;  5CA0 E;  2NWB A;  2V7J A;  2LJL A;  4IDZ A;  3P7I A;  4PAG A;  4AQF A;  4ERR A;  2Q9Q B;  2G0U A;  3KFW X;  4IE0 A;  2L8K A;  4WBN E;  2DHR A;  2I59 A;  1HFA A;  2X68 A;  1U4Q A;  3AVS A;  2K24 A;  3CWZ B;  2D0U A;  4OYJ A;  3K3N A;  5FXW A;  4AKL A;  2A3D A;  4CI1 B;  4AXP A;  4CXW A;  3N9M A;  5CB4 E;  3SWH A;  3AB3 B;  3K3O A;  4ANJ A;  3HI2 A;  2E9X D;  2KXP B;  3IEE A;  2A2F X;  2BDE A;  1FEW A;  1V9D A;  2EHO A;  4EAH A;  2JPF A;  3PUG A;  3FXD B;  1MMA A;  2CXL A;  4OHF A;  1IZN B;  2LE8 A;  4IE6 A;  5KDM C;  5LYJ E;  4AI6 A;  3KIN B;  4O8S A;  3KBT A;  1D0X A;  3ZMV B;  3RYF E;  2QA7 A;  5JR9 A;  5H6R B;  2PJQ A;  4OYK A;  1D1A A;  5JRE A;  2A72 A;  3ZEF B;  2SPC A;  2IC9 A;  4UEL A;  3GA8 A;  3L3P A;  1HF8 A;  5DAB A;  4H9P C;  4HTE A;  2V1D B;  4UVB B;  4UVA B;  3KVA A;  4TX5 A;  4WBO A;  4TUY E;  5LHH B;  2CMR A;  4PK6 A;  2Y6X A;  3B57 A;  4UXN B;  3PUA A;  4ZI3 D;  3K3Q C;  5LOV E;  5JR9 B;  3KV6 A;  2CXF A;  3KVB A;  4GK0 E;  3ZPO A;  4X1Y E;  1LVK A;  4UIG A;  3RH3 A;  4WW0 A;  4QKN A;  2M67 A;  4CQI A;  4MLK A;  3ZJ1 A;  2CCQ A;  2EHO B;  2MTQ A;  4HE8 A;  5H6Q B;  3SRZ A;  3AA6 B;  4UVC B;  1S94 A;  2PBI A;  3U78 A;  2H7V C;  5J1G A;  3Q9D A;  2W00 A;  4BJN A;  2VL8 A;  3LG7 A;  1HS7 A;  3ZMU B;  2ES0 A;  3OYZ A;  3FHN A;  2YK0 A;  3C51 A;  4IGU A;  4CI3 B;  4G63 A;  4ILU A;  3HKC E;  5FXZ A;  3EVY A;  5L2L A;  2W0G A;  5EK4 A;  1HTJ F;  2Q9Q A;  5HYA A;  4DMV A;  1VOM A;  2EHO D;  3E22 E;  1WYB A;  1D1C A;  3MKD A;  4GK5 E;  1UX5 A;  4UF0 B;  2Y8D A;  4EXT A;  3O1I A;  3LK3 B;  2XHE B;  3N9P A;  3I1A A;  4H9N C;  3ESL A;  4TZ4 C;  1LVF A;  2C0S A;  1KNZ A;  4E7Z A;  2YEV C;  3PE0 A;  5JR9 C;  4GIW A;  2KZ7 B;  1B7T A;  2N1G A;  1ZV4 X;  4JLE A;  3CX8 B;  1D0Y A;  2C5I T;  2VWA A;  4KBM B;  4EB6 E;  5BMV E;  5JRC B;  5FY1 A;  5LXT E;  4HGA A;  4ZS3 A;  2JJ9 A;  3RKO A;  2EHO C;  3RRW A;  1S35 A;  2KIN B;  5L3D B;  3C4W A;  3RPU A;  3IBP A;  3P8C D;  3CQC B;  1QUU A;  3RYH E;  2E9X B;  1ZEE A;  3NBX X;  3Q5X A;  4L0R A;  2IC6 A;  2DCF A;  3PDY A;  4QX7 B;  5JDG A;  3T8O A;  5DQW A;  3AA1 B;  2LM9 A;  4IE4 A;  3Q5W A;  1ZKE A;  2X67 A;  5EK3 A;  2J1D G;  3CKD A;  2CWO A;  1YKH B;  3NZQ A;  4G2A A;  4H63 V;  1HG2 A;  4P0A A;  2XAH B;  3C98 B;  2XAS B;  4CXX A;  4MHC A;  2K5B B;  2KWI B;  2HPJ A;  3HKB E;  3LJC A;  3UT5 E;  4C91 A;  2IW5 B;  2Q9Q D;  4AKR B;  5FXV A;  4TV8 E;  2XTL A;  5LGU B;  4J2C A;  4EIW A;  4H9Q C;  3ZMS B;  3N5L A;  4UEM A;  4U72 A;  2UXX B;  2E9X C;  2DI4 A;  5JDN A;  2L9Q A;  5CA1 E;  3MK7 C;  4CZZ B;  5LA6 E;  2V7K A;  3ZN1 B;  2VK9 A;  2HH7 A;  5LHI B;  3QK6 A;  4PK5 A;  3BQL A;  4K0U A;  1IJ5 A;  2Y48 B;  2C5K T;  2LT3 A;  4OK0 A;  4QWN B;  4U74 A;  5FXX A;  2IAK A;  5L3E B;  4CXY A;  5JRC A;  3AAI A;  2Q9Q C;  2LHR A;  1UX4 A;  3CPZ A;  2NOX A;  5J2U E;  2DWG A;  2N2N A;  1HG5 A;  3E0Z A;  3PUQ A;  3V5U A;  2PG8 A;  3N9Q A;  4YJ3 E;  3D0T A;  2P9B A;  2OA5 A;  3DJB A;  2WAU A;  4UF0 A;  2CEA A;  4ZI2 D;  2VKO A;  4CI2 B;  3KBU A;  5HXH A;  4M1P A;  5KMG P;  3ZC1 A;  4V1A v;  3I9Y A;  3ZYM A;  2X66 A;  4HN9 A;  3OJA A;  2NW7 A;  5E0O A;  5M4Y A;  2KMF A;  3ZC0 A;  5LNK A;  4H9O C;  4ZHQ E;  5LGN B;  3F2E A;  4EZ4 A;  2XAG B;  4I4T E;  3ETU A;  1LKX A;  2VB6 A;  3SS1 A;  5F3J A;  5FNV E;  1FMW A;  2LEH A;  3FBZ A;  3FB2 A;  3HKD E;  3EDU A;  3DP7 A;  2VAS A;  3PUR A;  1WYC A;  1WR6 A;  3VU7 H;  4OFZ A;  3PU3 A;  2H3R A;  5HXR A;  3B13 A;  4C90 A;  4KUM B;  4DMW A;  5HXE A;  2NTX A;  2CXD A;  3C4Z A;  4HEA A;  2L3L A;  4QX8 B;  4AKG A;  4QXB B;  4I43 B;  2C5J A;  1UCU A;  3O1J A;  3SOL A;  2DWK A;  1ZHC A;  2WM9 A;  1HX8 A;  1NWM X;  1D0Z A;  3O4X E;  3Q2M A;  1YW0 A;  3ZYL A;  1AJ3 A;  3VKG A;  2DNX A;  3ONX A;  2V7I A;  1YD8 G;  1MIY A;  3AVR A;  2H7O A;  3RX6 A;  3VKH A;  2LOP A;  4I55 E;  4XZC A;  1G8X A;  5JH7 E;  5L3C B;  1YKE B;  2WMN A;  4O2A E;  4MFR A;  5JQG E;  3ZCJ A;  4Z8X A;  1US7 B;  2BVL A;  3V5S A;  3RC3 A;  2CWY A;  2V7M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...