2KWHA

Ral binding domain of rlip76 (ralbp1)
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
56
structure length
56
Chain Sequence
b'GSETQAGIKEEIRRQEFLLNSLHRDLQGGIKDLSKEERLWEVQRILTALKRKLREA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords RalA-binding protein 1
publication title The RalB-RLIP76 complex reveals a novel mode of ral-effector interaction
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 20
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2010-04-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.90 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2kwhA00
2C5KT 3MXZA 1IJ6A 4CQIA 1LRZA 3S4UA 2K48A 1H7CA 1ZKEA 3TKLB 4J2CA 4L0RA 2MBGA 4B6XA 1IJ5A 4EYYR 3QUJA 2G0UA 3P7IA 3CKDA 1LVFA 2X9WA 3CVRA 3FXEB 2IC9A 3N5LA 2IC6A 1Z0PA 2C5JA 2KWIB 2XTLA 4FI5A 4DNDA 2X9XA 3FXDB 2C5IT 2CA5A 2KWHA 3QK6A 3L3PA 2X9YA 1QSDA
chains in the Genus database with same CATH superfamily
3PUXF 3AEGA 3C4XA 5IWAT 2UXXB 5JDQA 1U5PA 4B3ST 3SS1A 2X68A 5ABFB 3KBTA 2D0UA 5LNKA 2XM1A 4KHZF 4MFRA 4O4LE 2PJQA 4U3CA 3HI2A 2ODVA 5JDGA 5CA1E 1BR4A 3PJAA 3R6NA 3UUMA 3AAIA 2D5UA 3UQ7A 2UXDT 2WP9A 3RKGA 2YKSA 4P0AA 5JH7E 3JADA 5AQTB 3MK7C 3OBVE 3MZKB 5LGNB 1JNRA 3OYXA 2RA1A 1WCRA 2J4GA 2FJDA 2ZM6T 4TWDA 3NBXX 3P4RA 3AE8A 3JC6D 1E1HB 4TZ4C 3EVYA 3PURA 3TLWA 3RGLA 4ZZBA 1NAFA 5C3JA 4UVAB 2CHOA 4DR4T 2CM0A 5AQQB 5AQIB 2D2SA 4JI8T 3AE4A 1O3XA 3PU8A 2V7MA 4A97A 4JLEA 4OX9T 4IREA 3AB3B 4HEAA 1UK5A 5HCMA 3I9WA 3F31A 3HKCE 2NP9A 3F2EA 3GMIA 1Y64B 2DI4A 3L8RA 4PFPA 3KDSE 3Q2MA 2FJEA 3L39A 2WBLA 5FVKA 4EOZB 1KK7A 1QSDA 3RF1A 2BG9E 3P4SA 3OPCA 3I1AA 4WYVA 3T1HT 1IJ5A 3G06A 3H3AA 3Q5EA 3N2KE 4H9SE 1D1CA 4NUUA 2V8SV 2X9HA 2IMLA 1FMWA 4ZI3C 3P4WA 4LF8T 3FHNA 3Q5DA 3SFEA 2ES0A 4IE6A 2E5LT 4H9RC 4EV6A 5LYJE 3PUZF 2Y6XA 2XY8B 5L3DB 4JI1T 4HWDA 3ZMVB 4ISTA 2V5DA 3KBUA 3CMLA 4ADZA 2XQ5A 3H37A 2BDEA 4LF5T 4ZS2A 5DJQC 2UUBT 4TUYE 2W2UA 2W67A 3P8CD 4QXCB 3RIAA 3CX6B 3VHLA 1MIYA 3TLSA 4KHPT 3IA3A 3PJAJ 1KNRA 1SE7A 4HFBA 3PV0F 2XM2A 3QB5K 4QXHB 1IBLT 3AE3A 3RH3A 3ZPOA 4BA9A 3P50A 3C98B 1HX1B 4X20E 3IEEA 1MNDA 5J2UE 3A7MA 2XQYA 2X9YA 3R84B 1Z8UA 2A9UA 5E0OA 5L4EA 3CK6A 4EGWA 4NPPA 3LK42 2XZEA 2CEAA 3AXJA 4ZOLE 2XAQB 1WYBA 2XQ8A 2K9AA 3ZMSB 4P09A 3FZMB 2J62A 3AXJB 1OEDE 2V6XA 4JI5T 3PU3A 1IZNB 4HWFA 4CI2B 2X66A 2LOPA 4KMCA 5FYMA 2LKGA 5L3BB 3UU3A 3PUWF 3LBXA 4UVCB 2KSRA 2LSJA 5FY0A 3B5MA 3BK9A 4HWCA 4ILCA 4A5XA 4AISA 3KV5A 1L0VA 1HNZT 2DHRA 4IDZA 1WR6A 2HPLA 1LVKA 2WZIA 2VQET 4IE5A 3LBXB 2CBIA 2YU2A 1DU2A 3SOLA 2X9WA 3O4XE 2ACXA 2DWKA 2ODUA 3NZQA 3HKDE 1LRZA 3KINB 4ZHQE 5C8YE 4V1Av 3RRWA 4YTPA 2WY2A 2PG8A 4JBWF 4CZZB 4GK0E 4IE4A 4G63A 3U78A 1XZYA 3ZSSA 5L3CB 2E5VA 2MOZA 3RRCA 2B76A 5DQWA 5CFBA 3T8OA 1SHZC 2LSGA 3CX7B 3I9YA 5FKYA 2MBGA 4ISSA 5HEJA 1N36T 4NIQA 5AQRB 4QXBB 2DNXA 3PUQA 2PTFA 2KWHA 3PTRB 3KV9A 4JEHB 3RI5A 4F8HA 1HX8A 3N2GE 2XJ7A 4X62T 2YDQA 1NWMX 3AVSA 2JMKA 3ZCJA 4PJJA 3Q5XA 3DJBA 2KMFA 2BS4A 5AQHB 4MBQA 3HL6A 3BQLA 4DMWA 3ETVA 2W61A 2YDRA 2J1DG 5JQGE 2UU9T 2BKNA 4EB6E 1T98A 3EI0A 1XNRT 1WYCA 4J2CA 3O1JA 4EYYR 3ONJA 4ANJA 2E9XD 4YT0A 1Z0PA 5TAOA 1SUMB 2CA5A 3N9PA 4DV4T 4LF6T 2DWGA 3PUVF 4I4TE 2XAGB 3IHRA 3E22E 4HFDA 4X1KE 3P4QA 3QC9A 2V1DB 1UURA 1UGOA 3AVRA 1SA0E 2NOXA 4JI7T 5L2LA 4YLHA 4DV0T 4IE7A 4JI2T 2JJ9A 3CIRA 2B1EA 1M7KA 2M6BA 4NXMT 4YJ3E 3QUJA 5CGMA 5DQVA 1KEYA 4ZI2C 5ADXL 4YJ2E 1VOMA 4PNIA 5LHHB 2K5BB 1MMGA 4MLKA 4WZXA 5FXZA 3RYCE 4ILUA 4FJOA 3ZT6A 4DVDA 3I0OA 4CN6A 2EHOA 2KNDA 5JDMA 3ZKRA 1GQEA 4ILBA 2XQ7A 2XAFB 3RC3A 3AEEA 2EHOB 2W66A 1S35A 2LJLA 4DR5T 2Y48B 3EAMA 2M67A 1Y01A 4Z90A 2V7LA 5HXSA 5DABA 2W62A 5J2TE 4KX6A 2CXLA 3MJXA 3FB2A 4YFSA 1ZV4X 3UQ4A 3FZHB 3CQCB 3UU5A 3SFDA 2WMOA 2DLRA 3NZPA 2XSAA 2EHOC 3VR9A 4DBRA 5AQJB 4U31A 4YHJA 2LEHA 2WWVA 4QWNB 4WBOA 3I0QA 4HFHA 3RHWA 3FZKB 3CVRA 3VKHA 2QVAA 4JEUB 2UUAT 4COFA 1FJGT 4ERRA 5JDHA 2KINB 2QA7A 4PK4A 5HXEA 5HWXA 2C0SA 2UXNB 4C90A 4UEMA 3SWHA 4LFCT 4IDQA 3ZYKA 2CMRA 4DR1T 4BJMA 3ANWA 4XAXB 2A72A 4NXNT 4MALA 2JQ9A 4DR2T 2Q9QD 1VCTA 2VKDA 3CQGB 1W09A 3TLTA 1W0AA 4C91A 4DR3T 1NEKA 3ANWB 4KI0F 1IBMT 2K24A 4X1YE 1WRDA 3GN5A 3ZT5A 4H9NC 3NWIA 2XQ4A 1J1JA 2NW9A 4L5GA 4GKJT 4YXDA 1KF6A 4QX8B 4OHFA 1J5WA 2IHR1 3GN5B 2CE7A 1W9RA 3N9LA 2SPCA 4JI4T 2RP4A 4QH5A 3NVOA 3ZN0B 3OTOT 4DIDB 4U7IA 4U7YA 4EXTA 3N9NA 4O4JE 5AQFB 2ZLYA 1HG2A 3OKQA 4YHHT 2GK9A 2WS3A 3AE5A 4P0BA 3CQXC 1ZOYA 5ABHA 4HTEA 4JI0T 1S94A 3LK2B 4DV5T 5ABEA 3D0TA 1ZP0A 4ZXLA 3HKBE 1ZKEA 1HCIA 3C64A 5F5WA 2AE9A 5AQLB 3RKOA 3HA4A 5FL0A 1YW0A 2AXDS 4E7ZA 2XAJB 3LDQB 2W4XA 2VKJA 4JUYA 2IIUA 2A2FX 5LJNA 2H7OA 5HEUA 3UUXB 2LSYA 5L3EB 3RYIE 2D9DA 4DR6T 1VCSA 5LGTB 1J5ET 4ZZCA 2P9BA 3FBZA 4HFEA 1BR2A 2N9DA 2V6YA 2X51A 4A56A 2I59A 2RPAA 4CXYA 4Z8XA 2VKHA 3ZEFB 3CKDA 5BR8T 3N5LA 3ZYLA 4TX5A 2PFVA 3PUSA 1G8XA 4CN4A 2CLYB 2QRXA 2HN2A 3GWHA 3UU6A 4U33A 3ZJ2A 3M3ZB 5HEGA 2NW8A 4PAGA 3RC8A 2NW7A 2G0UA 1IAPA 2W0GA 1HFAA 2CBJA 4ILAA 2MTQA 2X0YA 3FXDB 2CWOA 5JRCA 4JV5T 4TNWA 1ZHCA 2KLQA 5LP6E 5HAXA 4H9QC 4AKRB 5JDNA 2WWUA 2LT3A 3C50A 2CLYC 5HEHA 1D0ZA 5FXWA 5LA6E 3JAEA 2D0TA 2X0HA 2XHEB 1FEWA 4OFZA 2IUBA 4PK6A 3ETUA 4O4IE 4QH1A 1YKEB 4I0UA 2Q9QA 5FY1A 1OWAA 3CPZA 5CB4E 4IL4A 4IL9A 4HGAA 5HCJA 4UV9B 4WW0A 1MMAA 2H7VC 4Q25A 2K3WA 2Q9QB 2QGSA 5AQNB 2Y8DA 1KNPA 2XQ3A 1D1BA 4X5TA 1MNEA 4KUMB 4CI3B 2BBHA 3RIUA 3HKEE 3NRYA 2LLYA 5IYZE 2A3DA 2FJBA 4TWFA 1CHUA 1EZ3A 5GONE 1UCUA 3JC6C 4DMVA 4GYSA 2Q9QC 1MMDA 3AE9A 3AE2A 4LF9T 4HFCA 2IC9A 4HWHA 4WNKA 4FI5A 2UXCT 2C5IT 3NRXA 3JCFA 2LKHA 5EK3A 1YKHB 3E0ZA 3SRZA 4I43B 2KZ7B 4YSXA 3QNUA 2LE8A 2PBIA 2R6GF 4XZCA 3ONLC 3RIUC 3PDYA 2BKOA 3AE7A 4HKAA 3C51A 3ZMUB 3F57A 4KP3C 3AECA 5LJMA 1G73A 1N34T 1T7SA 4N78D 4TV8E 2CWYA 3OYZA 2IC6A 4K0UA 3K1SA 5AQOB 2XSBA 2NWBA 4HFVA 2UXBT 3OVUA 4YY3T 1X79A 3O1HA 2CHNA 3KV4A 3UUNA 3EHZA 3RQUA 4UXNB 5J0ZA 1KFYA 2OLTA 2WZHA 3FBLA 2XTLA 3VRAA 4GIWA 4X1IE 5ABGA 4X65T 4TV9E 5AQPB 3ZCIA 5JR9A 4PW8A 3FZLB 2NTXA 3PE0A 4LF4T 5AQMB 1VRBA 4CI1B 2Z6EA 3W15B 5LHIB 1N33T 2X9XA 5FY7A 1R8IA 2L9QA 3AAEB 4OK0A 5JDLA 2LOSA 5JR9B 1HR0T 3TLUA 4UVBB 2DCFA 2V7IA 2BG9A 3L09A 2QYWA 4DUYT 1MIVA 1X9BA 5F8PA 5AQKB 2KT9A 3L3PA 5AQGB 4DV3T 1U4QA 3MA9A 4IIJE 3MXZA 3EDUA 5M4YA 2HH7A 3A8YC 3ZMTB 4DV6T 2XUEA 4DR7T 4CXXA 4O4HE 2BS2A 2BG9B 4EEBA 5JR9C 2XASB 3K3OA 4GYRA 4YSYA 1UX5A 5L47A 4I50E 1WR0A 1BR0A 3AA7B 4B3RT 2H3RA 2IDOB 1HNXT 3TLVA 4EZHA 5LHGB 1US7B 5FXXA 2BG9C 1XMQT 4IGUA 3KFWX 2WSSV 5FP3A 1V9DA 5LCYA 1MMNA 4PJLA 1IJ6A 3MKDA 3N9OA 3K3QC 2VKOA 3B13A 1N32T 4GOUA 5LGUB 3JAFA 4X64T 5LXTE 1KNZA 2L8KA 1D0XA 3PUYF 2WB5A 2VURA 1XDOA 4CQIA 1XMOT 3AEDA 3ZLIA 5HEOA 4AQFA 4NUVA 5LMUT 5FL1A 2KWIB 3ZC0A 4H63H 2XAHB 4B3TT 3PUAA 2FUPA 4GK5E 4XBFB 4AIUA 4ZI7E 4AXPA 4CN1A 2VQFT 2XQ9A 5EK2A 1OEDA 2J47A 3AE1A 2CXDA 5H6RB 4DV7T 3AEBA 4HFIA 3UTKA 1JNZA 3VU7H 5EZYE 3J7Yq 1HF8A 2ZM8A 2JPFA 3Q9DA 2YN6A 2HPJA 2LM2A 5L4HA 4EAHA 4AQFC 1OEDB 2NR4A 3Q5WA 2E9XA 4YTNA 3WAJA 4H9PC 2JMHA 2CPTA 2JQKA 2IW5B 3KVAA 5L3GB 3O1IA 4WBNE 2CRBA 2E9XB 2VWAA 1FMVA 5LBQB 2V5CA 1LKXA 5JVDE 4O2AE 4UV8B 2F4VT 1OEDC 4OYJA 1UUSA 5EK4A 2E8IA 1QUUA 2VL8A 4DO0A 3DP7A 3V5SA 4AKLA 4F6RC 1UX4A 5LBMA 5HXCA 1BR1A 2CCQA 1FIOA 3ABVA 3RYFE 4P1NA 2H88A 4EYUA 1YXRA 5FVLA 2E9XC 5LG4A 4U72A 3UT5E 3AEFA 4BAYB 2H89A 4JI3T 2LM9A 3AA6B 2MAWA 4EEDA 2LSKA 2VVNA 2JQQA 2JQHA 1CUNA 3VKGA 1E2AA 4UR9A 4DV2T 2LRKA 5FMNA 3P4PA 3H3MA 1OXZA 3HR0A 3RLFF 4ZI2D 2W63A 3AA1B 2MYSA 2WMNA 3K8PC 4Z91A 2ZM2A 2XQAA 3ZN1B 2BVLA 1XDPA 1WFDA 4PJNA 4UF0A 3CWZB 2BKPA 1W0BA 4A98A 2WCAA 3CX8B 3RQWA 3C4ZA 5CJ5A 1YD8G 5ETWA 2V26A 4AKGA 2JIWA 2YOEA 4DNDA 4QX7B 2MPKA 4I55E 4O8SA 2VB6A 4UF0B 4TNVA 2X0LB 2V6YB 3LG7A 3LK3B 4IDOA 3IF8B 2BS3A 3S4UA 2UUCT 2N2NA 4L0RA 3V5UA 3AA0B 4M1PA 5JTGA 5KXJA 3KVBA 3RIFA 4DUZT 4U2YA 5H6QB 1B7TA 2WAUA 2JRKA 2WU5A 3UUBA 2EHOD 4TWHA 4BJNA 3BQKA 5KDMC 3ZSTA 2V7KA 1T72A 1D0YA 4LMLA 3WAKA 4PJMA 5JRCB 1I94T 4E7SA 1HNWT 5HXRA 2WDRA 1NENA 3K3NA 3LJCA 4HE8A 1WLXA 4AQYT 4H63V 2ZMAA 3VR8A 1AJ3A 3FZFB 2XPKA 3ESLA 1IBKT 3LFMA 4H9OC 4IHJE 4LFBT 5LG3A 4LF7T 2M6IA 4KBMB 4ZEYA 5LMNT 3ZT7A 1XWMA 2YEVC 2LRLA 5AFUL 1I6ZA 2I6HA 4U2ZA 3AAAB 4AKHA 3PUGA 2WDQA 5J1GA 5AQSB 3E08A 4QHOA 4HN9A 3QOFA 5L3FB 1YQ4A 3J9X1 3X1DA 4YSZA 5C2TA 4X66T 2BVMA 4ASKA 5AQUB 4JI6T 3ZMZB 2X67A 3N2OA 3ONXA 5HXHA 4UELA 2VASA 4IT4A 2HN1A 4UIGA 5FNVE 4ZS3A 3UFEA 4IE0A 5FXVA 4LMJA 5CA0E 4TN7B 3P7IA 3LSVA 4PFOA 3EDVA 2VL0A 4EIWA 5KX5E 2BBJA 1HTJF 2DL1A 2FJAA 2C5KT 2E2AA 4YTMA 1ZEEA 3T1YT 2LSIA 2CXFA 2VK9A 3N9QA 2IAKA 4ZI3D 3BQIA 1HG5A 2WQYA 3A5XA 2HHHT 1D1AA 4G2AA 4JYAT 3ZC1A 3RPUA 5JREA 1QLBA 3RX6A 2YINA 3DTOA 3FXEB 2KXPB 4LFAT 3B57A 2C5JA 5A1LA 1T8BA 4AI6A 4GKKT 2XQ6A 3O9XA 2N1GA 2W00A 3AE6A 3VRBA 4AQGA 2ACZA 1E7PA 3WI3A 5HYAA 3UULA 3UU8A 2YU1A 2NTYA 2YK0A 4PK5A 2OV9A 2ZM0A 4O2BE 5LOVE 3OJAA 3AEAA 3QK6A 2V7JA 3NKZA 4IDNA 3EABA 3M65A 3ZJ1A 4EZ4A 5JDFA 2K48A 4DV1T 5HWYA 3QB5A 4AKIA 4B3MT 2WU2A 3UU4A 2WM9A 5IUXA 1M62A 3EUHA 3U3IA 2I0MA 5BMVE 3ZYMA 1H7CA 3TKLB 4L9IA 3GA8A 2OA5A 2LHNA 2YDSA 1LVFA 4K0KT 4IDPA 1XNQT 5LB7B 3RYHE 2LHRA 3UFGA 2VVSA 1MIWA 3MACA 3KV6A 4LMKA 4QH4A 4U74A 5IHYA 1YQ3A 2BZBA 4DBQA 2FBWA 4B6XA 3C4WA 1HS7A 4QKNA 5AQVB 4MHCA 3IBPA 5ABFA 4OYKA 4HWIB 2L3LA 2WDVA 5KMGP 3N9MA 4CXWA 5F3JA
chains in the Genus database with same CATH topology
5JQGE 4DO0A 4EB6E 4H9QC 1T98A 4AKRB 3C4XA 5JDNA 2UXXB 3DP7A 3V5SA 4AKLA 1WYCA 4F6RC 1U5PA 4J2CA 1UX4A 2LT3A 2WWUA 5JDQA 3C50A 2CLYC 1D0ZA 3O1JA 5FXWA 4EYYR 5LA6E 5LBMA 5HXCA 2D0TA 4ANJA 1BR1A 2E9XD 2CCQA 2XHEB 3SS1A 2X68A 1FEWA 1FIOA 3RYFE 3KBTA 2D0UA 1Z0PA 5LNKA 4EYUA 5TAOA 2CA5A 3N9PA 4MFRA 2E9XC 5LG4A 4OFZA 4U72A 4O4LE 4PK6A 2PJQA 3UT5E 2DWGA 3ETUA 4I4TE 4O4IE 4BAYB 2XAGB 3HI2A 3IHRA 2ODVA 5JDGA 3E22E 5CA1E 1BR4A 1YKEB 2Q9QA 3R6NA 3UUMA 2LM9A 4X1KE 3AAIA 5FY1A 3AA6B 1OWAA 2D5UA 3CPZA 3QC9A 5CB4E 2V1DB 2LSKA 2JQQA 4HGAA 3AVRA 1SA0E 2NOXA 1CUNA 3VKGA 4P0AA 4UV9B 4WW0A 5JH7E 3MK7C 5L2LA 1MMAA 2H7VC 3OBVE 3MZKB 5FMNA 4YLHA 5LGNB 2Q9QB 2QGSA 3OYXA 3HR0A 2RA1A 2Y8DA 4IE7A 2JJ9A 4ZI2D 1D1BA 1MNEA 4KUMB 2W63A 3AA1B 2B1EA 2MYSA 2WMNA 3K8PC 4CI3B 4YJ3E 2ZM2A 3QUJA 3HKEE 5DQVA 4ZI2C 3NRYA 5ADXL 3ZN1B 3NBXX 4YJ2E 1VOMA 2BVLA 5IYZE 3JC6D 2A3DA 4PNIA 5LHHB 2K5BB 1E1HB 4TZ4C 1EZ3A 3EVYA 1MMGA 3PURA 4MLKA 5GONE 1UCUA 5FXZA 3JC6C 4ILUA 4PJNA 3RYCE 4UF0A 4DMVA 4GYSA 1NAFA 3CWZB 4UVAB 2Q9QC 4FJOA 1MMDA 2CM0A 3CX8B 4DVDA 3I0OA 2D2SA 2EHOA 3C4ZA 1YD8G 5ETWA 2IC9A 4WNKA 2V26A 4AKGA 1O3XA 3PU8A 2V7MA 4FI5A 4DNDA 2C5IT 4QX7B 4CXWA 2KNDA 4JLEA 5JDMA 4I55E 4O8SA 2VB6A 4UF0B 3AB3B 4HEAA 5EK3A 1YKHB 2X0LB 3E0ZA 3I9WA 3LG7A 3LK3B 3F31A 3IF8B 3HKCE 3SRZA 2NP9A 2XAFB 3RC3A 3F2EA 4I43B 3GMIA 3S4UA 2KZ7B 2N2NA 4L0RA 1Y64B 2DI4A 4PFPA 2LE8A 2EHOB 2PBIA 3AA0B 3KDSE 4M1PA 3V5UA 3Q2MA 4XZCA 3KVBA 1S35A 2LJLA 3PDYA 2WBLA 2Y48B 2M67A 4EOZB 4HKAA 1KK7A 1QSDA 3C51A 2V7LA 5HXSA 5DABA 3ZMUB 2W62A 5H6QB 3F57A 5J2TE 4KP3C 1B7TA 2CXLA 2WAUA 3FB2A 3MJXA 1ZV4X 2JRKA 4YFSA 5LJMA 1G73A 3CQCB 3I1AA 2EHOD 2WMOA 4N78D 4TV8E 1IJ5A 2DLRA 4BJNA 3BQKA 3H3AA 2CWYA 3OYZA 3N2KE 4H9SE 5KDMC 3NZPA 2V7KA 2IC6A 1D0YA 2EHOC 3WAKA 4PJMA 4K0UA 4DBRA 5JRCB 4E7SA 1D1CA 5HXRA 3K3NA 4NUUA 3LJCA 4HE8A 1WLXA 2X9HA 2NWBA 4HFVA 4YHJA 1FMWA 4H63V 4ZI3C 1X79A 2ZMAA 3O1HA 3FHNA 2LEHA 3KV4A 3UUNA 4QWNB 2ES0A 4WBOA 4IE6A 1AJ3A 4UXNB 3I0QA 4H9RC 3CVRA 3FBLA 3VKHA 2XTLA 4JEUB 5LYJE 3ESLA 2Y6XA 4ERRA 5L3DB 5JDHA 5HAXA 3LFMA 4H9OC 4IHJE 4GIWA 4X1IE 2KINB 2QA7A 4PK4A 3ZMVB 5HXEA 4TV9E 4ISTA 4KBMB 5HWXA 2C0SA 3ZCIA 3KBUA 5JR9A 4PW8A 3CMLA 2UXNB 4ADZA 4C90A 2NTXA 4UEMA 2YEVC 3H37A 3SWHA 5AFUL 2BDEA 3PE0A 3ZYKA 4ZS2A 2CMRA 5DJQC 4TUYE 1VRBA 4BJMA 3ANWA 4XAXB 3P8CD 4CI1B 2A72A 2Z6EA 3AAAB 3W15B 4AKHA 4MALA 4QXCB 5LHIB 2X9XA 3PUGA 5FY7A 5J1GA 2L9QA 3CX6B 2Q9QD 3AAEB 3VHLA 4OK0A 1MIYA 5JDLA 2VKDA 3CQGB 2LOSA 3E08A 5JR9B 4QHOA 4HN9A 5L3FB 3J9X1 4UVBB 4C91A 2DCFA 2BVMA 3ANWB 2V7IA 4QXHB 4ASKA 3ZMZB 3RH3A 3ZPOA 4BA9A 2X67A 3L09A 3C98B 3N2OA 3ONXA 1MIVA 2K24A 4X20E 5HXHA 3IEEA 4X1YE 1MNDA 5F8PA 5J2UE 4UELA 1WRDA 3GN5A 2VASA 2XQYA 2KT9A 3L3PA 4H9NC 2X9YA 3R84B 1U4QA 4UIGA 5FNVE 2NW9A 4ZS3A 3MA9A 4IIJE 3MXZA 3UFEA 5E0OA 3EDUA 5M4YA 2HH7A 3ZMTB 4IE0A 2XUEA 3LK42 4L5GA 2CEAA 4CXXA 5FXVA 4O4HE 5JR9C 4QX8B 5CA0E 2XASB 4TN7B 3K3OA 4GYRA 4OHFA 3P7IA 1UX5A 4PFOA 3EDVA 4EIWA 4ZOLE 3GN5B 2XAQB 1WYBA 2CE7A 4I50E 5KX5E 1BR0A 3N9LA 2K9AA 3AA7B 1HTJF 2SPCA 5F3JA 3ZMSB 2RP4A 2H3RA 4P09A 2C5KT 3ZN0B 1ZEEA 2LSIA 2CXFA 4EXTA 3N9NA 4EZHA 5LHGB 1US7B 5FXXA 2VK9A 4O4JE 3N9QA 2ZLYA 2IAKA 1HG2A 4IGUA 3OKQA 3KFWX 3PU3A 2WSSV 1IZNB 2GK9A 5FP3A 4ZI3D 1V9DA 3BQIA 4CI2B 5LCYA 1HG5A 2X66A 3A5XA 1MMNA 4PJLA 1IJ6A 2LOPA 4KMCA 1D1AA 4G2AA 5FYMA 3MKDA 3N9OA 4P0BA 3ZC1A 5L3BB 3RPUA 3CQXC 3K3QC 5JREA 2VKOA 3B13A 4GOUA 5LGUB 3RX6A 3LBXA 4UVCB 2LSJA 4HTEA 5FY0A 3BK9A 2YINA 5LXTE 3DTOA 2L8KA 3FXEB 1KNZA 2KXPB 3KV5A 3B57A 2C5JA 5A1LA 1S94A 2DHRA 4AI6A 3LK2B 4IDZA 3O9XA 1D0XA 2N1GA 1WR6A 2W00A 2HPLA 1LVKA 3D0TA 4AQGA 4CQIA 3HKBE 3WI3A 1ZKEA 1HCIA 4IE5A 3C64A 3LBXB 5HYAA 3ZLIA 3RKOA 3HA4A 2YU2A 3UULA 4AQFA 1YW0A 4E7ZA 3SOLA 2X9WA 2YU1A 4NUVA 2NTYA 2XAJB 2YK0A 2ACXA 3O4XE 2VKJA 4PK5A 2KWIB 3ZC0A 4JUYA 4H63H 4O2BE 2ZM0A 2XAHB 5LOVE 3OJAA 2DWKA 3QK6A 2ODUA 2V7JA 3NZQA 3M65A 2A2FX 5LJNA 3PUAA 3ZJ1A 4EZ4A 3HKDE 1LRZA 4GK5E 4XBFB 3KINB 5JDFA 2H7OA 4ZHQE 5C8YE 2K48A 4V1Av 3RRWA 4ZI7E 5HWYA 4AXPA 4AKIA 2PG8A 3UUXB 2LSYA 4CZZB 5L3EB 3RYIE 4GK0E 5EK2A 4IE4A 2WM9A 4G63A 5LGTB 3U78A 3EUHA 2CXDA 3U3IA 5L3CB 2MOZA 2P9BA 5H6RB 3RRCA 5DQWA 5BMVE 3T8OA 3FBZA 1BR2A 1SHZC 2N9DA 2LSGA 3UTKA 3ZYMA 3VU7H 2X51A 5EZYE 1H7CA 3CX7B 2I59A 4L9IA 3TKLB 3I9YA 4A56A 4CXYA 3J7Yq 1HF8A 2ZM8A 2MBGA 4ISSA 3GA8A 2JPFA 4Z8XA 2OA5A 3Q9DA 2LHNA 2HPJA 2VKHA 4QXBB 3CKDA 1LVFA 2DNXA 3ZEFB 4EAHA 4AQFC 3Q5WA 3N5LA 3PUQA 3ZYLA 4TX5A 3RYHE 2E9XA 2PFVA 3PUSA 2LHRA 3WAJA 4H9PC 2KWHA 1G8XA 3PTRB 2JMHA 1MIWA 2IW5B 3KV9A 3KV6A 3MACA 2CLYB 3GWHA 4JEHB 4U74A 5IHYA 2BZBA 3ZJ2A 1HX8A 3KVAA 3N2GE 4DBQA 2NW8A 4B6XA 3C4WA 4PAGA 5L3GB 1HS7A 3O1IA 1NWMX 4WBNE 3RC8A 2NW7A 2G0UA 1IAPA 2W0GA 1HFAA 3AVSA 2E9XB 2JMKA 2VWAA 1FMVA 4QKNA 5LBQB 3ZCJA 4PJJA 1LKXA 3Q5XA 3DJBA 3IBPA 4MHCA 2KMFA 2MTQA 4OYKA 3FXDB 4MBQA 3HL6A 5JVDE 2CWOA 4O2AE 3BQLA 4UV8B 2L3LA 4DMWA 3ETVA 2W61A 4OYJA 5JRCA 5KMGP 5EK4A 1ZHCA 2E8IA 1QUUA 2KLQA 3N9MA 2J1DG 3NRXA 5LP6E 2VL8A 1OXZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2C5K T;  3MXZ A;  1IJ6 A;  4CQI A;  1LRZ A;  3S4U A;  2K48 A;  1H7C A;  1ZKE A;  3TKL B;  4J2C A;  4L0R A;  2MBG A;  4B6X A;  1IJ5 A;  4EYY R;  3QUJ A;  2G0U A;  3P7I A;  3CKD A;  1LVF A;  2X9W A;  3CVR A;  3FXE B;  2IC9 A;  3N5L A;  2IC6 A;  1Z0P A;  2C5J A;  2KWI B;  2XTL A;  4FI5 A;  4DND A;  2X9X A;  3FXD B;  2C5I T;  2CA5 A;  2KWH A;  3QK6 A;  3L3P A;  2X9Y A;  1QSD A; 
#chains in the Genus database with same CATH topology
 3PUX F;  3AEG A;  3C4X A;  5IWA T;  2UXX B;  5JDQ A;  1U5P A;  4B3S T;  3SS1 A;  2X68 A;  5ABF B;  3KBT A;  2D0U A;  5LNK A;  2XM1 A;  4KHZ F;  4MFR A;  4O4L E;  2PJQ A;  4U3C A;  3HI2 A;  2ODV A;  5JDG A;  5CA1 E;  1BR4 A;  3PJA A;  3R6N A;  3UUM A;  3AAI A;  2D5U A;  3UQ7 A;  2UXD T;  2WP9 A;  3RKG A;  2YKS A;  4P0A A;  5JH7 E;  3JAD A;  5AQT B;  3MK7 C;  3OBV E;  3MZK B;  5LGN B;  1JNR A;  3OYX A;  2RA1 A;  1WCR A;  2J4G A;  2FJD A;  2ZM6 T;  4TWD A;  3NBX X;  3P4R A;  3AE8 A;  3JC6 D;  1E1H B;  4TZ4 C;  3EVY A;  3PUR A;  3TLW A;  3RGL A;  4ZZB A;  1NAF A;  5C3J A;  4UVA B;  2CHO A;  4DR4 T;  2CM0 A;  5AQQ B;  5AQI B;  2D2S A;  4JI8 T;  3AE4 A;  1O3X A;  3PU8 A;  2V7M A;  4A97 A;  4JLE A;  4OX9 T;  4IRE A;  3AB3 B;  4HEA A;  1UK5 A;  5HCM A;  3I9W A;  3F31 A;  3HKC E;  2NP9 A;  3F2E A;  3GMI A;  1Y64 B;  2DI4 A;  3L8R A;  4PFP A;  3KDS E;  3Q2M A;  2FJE A;  3L39 A;  2WBL A;  5FVK A;  4EOZ B;  1KK7 A;  1QSD A;  3RF1 A;  2BG9 E;  3P4S A;  3OPC A;  3I1A A;  4WYV A;  3T1H T;  1IJ5 A;  3G06 A;  3H3A A;  3Q5E A;  3N2K E;  4H9S E;  1D1C A;  4NUU A;  2V8S V;  2X9H A;  2IML A;  1FMW A;  4ZI3 C;  3P4W A;  4LF8 T;  3FHN A;  3Q5D A;  3SFE A;  2ES0 A;  4IE6 A;  2E5L T;  4H9R C;  4EV6 A;  5LYJ E;  3PUZ F;  2Y6X A;  2XY8 B;  5L3D B;  4JI1 T;  4HWD A;  3ZMV B;  4IST A;  2V5D A;  3KBU A;  3CML A;  4ADZ A;  2XQ5 A;  3H37 A;  2BDE A;  4LF5 T;  4ZS2 A;  5DJQ C;  2UUB T;  4TUY E;  2W2U A;  2W67 A;  3P8C D;  4QXC B;  3RIA A;  3CX6 B;  3VHL A;  1MIY A;  3TLS A;  4KHP T;  3IA3 A;  3PJA J;  1KNR A;  1SE7 A;  4HFB A;  3PV0 F;  2XM2 A;  3QB5 K;  4QXH B;  1IBL T;  3AE3 A;  3RH3 A;  3ZPO A;  4BA9 A;  3P50 A;  3C98 B;  1HX1 B;  4X20 E;  3IEE A;  1MND A;  5J2U E;  3A7M A;  2XQY A;  2X9Y A;  3R84 B;  1Z8U A;  2A9U A;  5E0O A;  5L4E A;  3CK6 A;  4EGW A;  4NPP A;  3LK4 2;  2XZE A;  2CEA A;  3AXJ A;  4ZOL E;  2XAQ B;  1WYB A;  2XQ8 A;  2K9A A;  3ZMS B;  4P09 A;  3FZM B;  2J62 A;  3AXJ B;  1OED E;  2V6X A;  4JI5 T;  3PU3 A;  1IZN B;  4HWF A;  4CI2 B;  2X66 A;  2LOP A;  4KMC A;  5FYM A;  2LKG A;  5L3B B;  3UU3 A;  3PUW F;  3LBX A;  4UVC B;  2KSR A;  2LSJ A;  5FY0 A;  3B5M A;  3BK9 A;  4HWC A;  4ILC A;  4A5X A;  4AIS A;  3KV5 A;  1L0V A;  1HNZ T;  2DHR A;  4IDZ A;  1WR6 A;  2HPL A;  1LVK A;  2WZI A;  2VQE T;  4IE5 A;  3LBX B;  2CBI A;  2YU2 A;  1DU2 A;  3SOL A;  2X9W A;  3O4X E;  2ACX A;  2DWK A;  2ODU A;  3NZQ A;  3HKD E;  1LRZ A;  3KIN B;  4ZHQ E;  5C8Y E;  4V1A v;  3RRW A;  4YTP A;  2WY2 A;  2PG8 A;  4JBW F;  4CZZ B;  4GK0 E;  4IE4 A;  4G63 A;  3U78 A;  1XZY A;  3ZSS A;  5L3C B;  2E5V A;  2MOZ A;  3RRC A;  2B76 A;  5DQW A;  5CFB A;  3T8O A;  1SHZ C;  2LSG A;  3CX7 B;  3I9Y A;  5FKY A;  2MBG A;  4ISS A;  5HEJ A;  1N36 T;  4NIQ A;  5AQR B;  4QXB B;  2DNX A;  3PUQ A;  2PTF A;  2KWH A;  3PTR B;  3KV9 A;  4JEH B;  3RI5 A;  4F8H A;  1HX8 A;  3N2G E;  2XJ7 A;  4X62 T;  2YDQ A;  1NWM X;  3AVS A;  2JMK A;  3ZCJ A;  4PJJ A;  3Q5X A;  3DJB A;  2KMF A;  2BS4 A;  5AQH B;  4MBQ A;  3HL6 A;  3BQL A;  4DMW A;  3ETV A;  2W61 A;  2YDR A;  2J1D G;  5JQG E;  2UU9 T;  2BKN A;  4EB6 E;  1T98 A;  3EI0 A;  1XNR T;  1WYC A;  4J2C A;  3O1J A;  4EYY R;  3ONJ A;  4ANJ A;  2E9X D;  4YT0 A;  1Z0P A;  5TAO A;  1SUM B;  2CA5 A;  3N9P A;  4DV4 T;  4LF6 T;  2DWG A;  3PUV F;  4I4T E;  2XAG B;  3IHR A;  3E22 E;  4HFD A;  4X1K E;  3P4Q A;  3QC9 A;  2V1D B;  1UUR A;  1UGO A;  3AVR A;  1SA0 E;  2NOX A;  4JI7 T;  5L2L A;  4YLH A;  4DV0 T;  4IE7 A;  4JI2 T;  2JJ9 A;  3CIR A;  2B1E A;  1M7K A;  2M6B A;  4NXM T;  4YJ3 E;  3QUJ A;  5CGM A;  5DQV A;  1KEY A;  4ZI2 C;  5ADX L;  4YJ2 E;  1VOM A;  4PNI A;  5LHH B;  2K5B B;  1MMG A;  4MLK A;  4WZX A;  5FXZ A;  3RYC E;  4ILU A;  4FJO A;  3ZT6 A;  4DVD A;  3I0O A;  4CN6 A;  2EHO A;  2KND A;  5JDM A;  3ZKR A;  1GQE A;  4ILB A;  2XQ7 A;  2XAF B;  3RC3 A;  3AEE A;  2EHO B;  2W66 A;  1S35 A;  2LJL A;  4DR5 T;  2Y48 B;  3EAM A;  2M67 A;  1Y01 A;  4Z90 A;  2V7L A;  5HXS A;  5DAB A;  2W62 A;  5J2T E;  4KX6 A;  2CXL A;  3MJX A;  3FB2 A;  4YFS A;  1ZV4 X;  3UQ4 A;  3FZH B;  3CQC B;  3UU5 A;  3SFD A;  2WMO A;  2DLR A;  3NZP A;  2XSA A;  2EHO C;  3VR9 A;  4DBR A;  5AQJ B;  4U31 A;  4YHJ A;  2LEH A;  2WWV A;  4QWN B;  4WBO A;  3I0Q A;  4HFH A;  3RHW A;  3FZK B;  3CVR A;  3VKH A;  2QVA A;  4JEU B;  2UUA T;  4COF A;  1FJG T;  4ERR A;  5JDH A;  2KIN B;  2QA7 A;  4PK4 A;  5HXE A;  5HWX A;  2C0S A;  2UXN B;  4C90 A;  4UEM A;  3SWH A;  4LFC T;  4IDQ A;  3ZYK A;  2CMR A;  4DR1 T;  4BJM A;  3ANW A;  4XAX B;  2A72 A;  4NXN T;  4MAL A;  2JQ9 A;  4DR2 T;  2Q9Q D;  1VCT A;  2VKD A;  3CQG B;  1W09 A;  3TLT A;  1W0A A;  4C91 A;  4DR3 T;  1NEK A;  3ANW B;  4KI0 F;  1IBM T;  2K24 A;  4X1Y E;  1WRD A;  3GN5 A;  3ZT5 A;  4H9N C;  3NWI A;  2XQ4 A;  1J1J A;  2NW9 A;  4L5G A;  4GKJ T;  4YXD A;  1KF6 A;  4QX8 B;  4OHF A;  1J5W A;  2IHR 1;  3GN5 B;  2CE7 A;  1W9R A;  3N9L A;  2SPC A;  4JI4 T;  2RP4 A;  4QH5 A;  3NVO A;  3ZN0 B;  3OTO T;  4DID B;  4U7I A;  4U7Y A;  4EXT A;  3N9N A;  4O4J E;  5AQF B;  2ZLY A;  1HG2 A;  3OKQ A;  4YHH T;  2GK9 A;  2WS3 A;  3AE5 A;  4P0B A;  3CQX C;  1ZOY A;  5ABH A;  4HTE A;  4JI0 T;  1S94 A;  3LK2 B;  4DV5 T;  5ABE A;  3D0T A;  1ZP0 A;  4ZXL A;  3HKB E;  1ZKE A;  1HCI A;  3C64 A;  5F5W A;  2AE9 A;  5AQL B;  3RKO A;  3HA4 A;  5FL0 A;  1YW0 A;  2AXD S;  4E7Z A;  2XAJ B;  3LDQ B;  2W4X A;  2VKJ A;  4JUY A;  2IIU A;  2A2F X;  5LJN A;  2H7O A;  5HEU A;  3UUX B;  2LSY A;  5L3E B;  3RYI E;  2D9D A;  4DR6 T;  1VCS A;  5LGT B;  1J5E T;  4ZZC A;  2P9B A;  3FBZ A;  4HFE A;  1BR2 A;  2N9D A;  2V6Y A;  2X51 A;  4A56 A;  2I59 A;  2RPA A;  4CXY A;  4Z8X A;  2VKH A;  3ZEF B;  3CKD A;  5BR8 T;  3N5L A;  3ZYL A;  4TX5 A;  2PFV A;  3PUS A;  1G8X A;  4CN4 A;  2CLY B;  2QRX A;  2HN2 A;  3GWH A;  3UU6 A;  4U33 A;  3ZJ2 A;  3M3Z B;  5HEG A;  2NW8 A;  4PAG A;  3RC8 A;  2NW7 A;  2G0U A;  1IAP A;  2W0G A;  1HFA A;  2CBJ A;  4ILA A;  2MTQ A;  2X0Y A;  3FXD B;  2CWO A;  5JRC A;  4JV5 T;  4TNW A;  1ZHC A;  2KLQ A;  5LP6 E;  5HAX A;  4H9Q C;  4AKR B;  5JDN A;  2WWU A;  2LT3 A;  3C50 A;  2CLY C;  5HEH A;  1D0Z A;  5FXW A;  5LA6 E;  3JAE A;  2D0T A;  2X0H A;  2XHE B;  1FEW A;  4OFZ A;  2IUB A;  4PK6 A;  3ETU A;  4O4I E;  4QH1 A;  1YKE B;  4I0U A;  2Q9Q A;  5FY1 A;  1OWA A;  3CPZ A;  5CB4 E;  4IL4 A;  4IL9 A;  4HGA A;  5HCJ A;  4UV9 B;  4WW0 A;  1MMA A;  2H7V C;  4Q25 A;  2K3W A;  2Q9Q B;  2QGS A;  5AQN B;  2Y8D A;  1KNP A;  2XQ3 A;  1D1B A;  4X5T A;  1MNE A;  4KUM B;  4CI3 B;  2BBH A;  3RIU A;  3HKE E;  3NRY A;  2LLY A;  5IYZ E;  2A3D A;  2FJB A;  4TWF A;  1CHU A;  1EZ3 A;  5GON E;  1UCU A;  3JC6 C;  4DMV A;  4GYS A;  2Q9Q C;  1MMD A;  3AE9 A;  3AE2 A;  4LF9 T;  4HFC A;  2IC9 A;  4HWH A;  4WNK A;  4FI5 A;  2UXC T;  2C5I T;  3NRX A;  3JCF A;  2LKH A;  5EK3 A;  1YKH B;  3E0Z A;  3SRZ A;  4I43 B;  2KZ7 B;  4YSX A;  3QNU A;  2LE8 A;  2PBI A;  2R6G F;  4XZC A;  3ONL C;  3RIU C;  3PDY A;  2BKO A;  3AE7 A;  4HKA A;  3C51 A;  3ZMU B;  3F57 A;  4KP3 C;  3AEC A;  5LJM A;  1G73 A;  1N34 T;  1T7S A;  4N78 D;  4TV8 E;  2CWY A;  3OYZ A;  2IC6 A;  4K0U A;  3K1S A;  5AQO B;  2XSB A;  2NWB A;  4HFV A;  2UXB T;  3OVU A;  4YY3 T;  1X79 A;  3O1H A;  2CHN A;  3KV4 A;  3UUN A;  3EHZ A;  3RQU A;  4UXN B;  5J0Z A;  1KFY A;  2OLT A;  2WZH A;  3FBL A;  2XTL A;  3VRA A;  4GIW A;  4X1I E;  5ABG A;  4X65 T;  4TV9 E;  5AQP B;  3ZCI A;  5JR9 A;  4PW8 A;  3FZL B;  2NTX A;  3PE0 A;  4LF4 T;  5AQM B;  1VRB A;  4CI1 B;  2Z6E A;  3W15 B;  5LHI B;  1N33 T;  2X9X A;  5FY7 A;  1R8I A;  2L9Q A;  3AAE B;  4OK0 A;  5JDL A;  2LOS A;  5JR9 B;  1HR0 T;  3TLU A;  4UVB B;  2DCF A;  2V7I A;  2BG9 A;  3L09 A;  2QYW A;  4DUY T;  1MIV A;  1X9B A;  5F8P A;  5AQK B;  2KT9 A;  3L3P A;  5AQG B;  4DV3 T;  1U4Q A;  3MA9 A;  4IIJ E;  3MXZ A;  3EDU A;  5M4Y A;  2HH7 A;  3A8Y C;  3ZMT B;  4DV6 T;  2XUE A;  4DR7 T;  4CXX A;  4O4H E;  2BS2 A;  2BG9 B;  4EEB A;  5JR9 C;  2XAS B;  3K3O A;  4GYR A;  4YSY A;  1UX5 A;  5L47 A;  4I50 E;  1WR0 A;  1BR0 A;  3AA7 B;  4B3R T;  2H3R A;  2IDO B;  1HNX T;  3TLV A;  4EZH A;  5LHG B;  1US7 B;  5FXX A;  2BG9 C;  1XMQ T;  4IGU A;  3KFW X;  2WSS V;  5FP3 A;  1V9D A;  5LCY A;  1MMN A;  4PJL A;  1IJ6 A;  3MKD A;  3N9O A;  3K3Q C;  2VKO A;  3B13 A;  1N32 T;  4GOU A;  5LGU B;  3JAF A;  4X64 T;  5LXT E;  1KNZ A;  2L8K A;  1D0X A;  3PUY F;  2WB5 A;  2VUR A;  1XDO A;  4CQI A;  1XMO T;  3AED A;  3ZLI A;  5HEO A;  4AQF A;  4NUV A;  5LMU T;  5FL1 A;  2KWI B;  3ZC0 A;  4H63 H;  2XAH B;  4B3T T;  3PUA A;  2FUP A;  4GK5 E;  4XBF B;  4AIU A;  4ZI7 E;  4AXP A;  4CN1 A;  2VQF T;  2XQ9 A;  5EK2 A;  1OED A;  2J47 A;  3AE1 A;  2CXD A;  5H6R B;  4DV7 T;  3AEB A;  4HFI A;  3UTK A;  1JNZ A;  3VU7 H;  5EZY E;  3J7Y q;  1HF8 A;  2ZM8 A;  2JPF A;  3Q9D A;  2YN6 A;  2HPJ A;  2LM2 A;  5L4H A;  4EAH A;  4AQF C;  1OED B;  2NR4 A;  3Q5W A;  2E9X A;  4YTN A;  3WAJ A;  4H9P C;  2JMH A;  2CPT A;  2JQK A;  2IW5 B;  3KVA A;  5L3G B;  3O1I A;  4WBN E;  2CRB A;  2E9X B;  2VWA A;  1FMV A;  5LBQ B;  2V5C A;  1LKX A;  5JVD E;  4O2A E;  4UV8 B;  2F4V T;  1OED C;  4OYJ A;  1UUS A;  5EK4 A;  2E8I A;  1QUU A;  2VL8 A;  4DO0 A;  3DP7 A;  3V5S A;  4AKL A;  4F6R C;  1UX4 A;  5LBM A;  5HXC A;  1BR1 A;  2CCQ A;  1FIO A;  3ABV A;  3RYF E;  4P1N A;  2H88 A;  4EYU A;  1YXR A;  5FVL A;  2E9X C;  5LG4 A;  4U72 A;  3UT5 E;  3AEF A;  4BAY B;  2H89 A;  4JI3 T;  2LM9 A;  3AA6 B;  2MAW A;  4EED A;  2LSK A;  2VVN A;  2JQQ A;  2JQH A;  1CUN A;  3VKG A;  1E2A A;  4UR9 A;  4DV2 T;  2LRK A;  5FMN A;  3P4P A;  3H3M A;  1OXZ A;  3HR0 A;  3RLF F;  4ZI2 D;  2W63 A;  3AA1 B;  2MYS A;  2WMN A;  3K8P C;  4Z91 A;  2ZM2 A;  2XQA A;  3ZN1 B;  2BVL A;  1XDP A;  1WFD A;  4PJN A;  4UF0 A;  3CWZ B;  2BKP A;  1W0B A;  4A98 A;  2WCA A;  3CX8 B;  3RQW A;  3C4Z A;  5CJ5 A;  1YD8 G;  5ETW A;  2V26 A;  4AKG A;  2JIW A;  2YOE A;  4DND A;  4QX7 B;  2MPK A;  4I55 E;  4O8S A;  2VB6 A;  4UF0 B;  4TNV A;  2X0L B;  2V6Y B;  3LG7 A;  3LK3 B;  4IDO A;  3IF8 B;  2BS3 A;  3S4U A;  2UUC T;  2N2N A;  4L0R A;  3V5U A;  3AA0 B;  4M1P A;  5JTG A;  5KXJ A;  3KVB A;  3RIF A;  4DUZ T;  4U2Y A;  5H6Q B;  1B7T A;  2WAU A;  2JRK A;  2WU5 A;  3UUB A;  2EHO D;  4TWH A;  4BJN A;  3BQK A;  5KDM C;  3ZST A;  2V7K A;  1T72 A;  1D0Y A;  4LML A;  3WAK A;  4PJM A;  5JRC B;  1I94 T;  4E7S A;  1HNW T;  5HXR A;  2WDR A;  1NEN A;  3K3N A;  3LJC A;  4HE8 A;  1WLX A;  4AQY T;  4H63 V;  2ZMA A;  3VR8 A;  1AJ3 A;  3FZF B;  2XPK A;  3ESL A;  1IBK T;  3LFM A;  4H9O C;  4IHJ E;  4LFB T;  5LG3 A;  4LF7 T;  2M6I A;  4KBM B;  4ZEY A;  5LMN T;  3ZT7 A;  1XWM A;  2YEV C;  2LRL A;  5AFU L;  1I6Z A;  2I6H A;  4U2Z A;  3AAA B;  4AKH A;  3PUG A;  2WDQ A;  5J1G A;  5AQS B;  3E08 A;  4QHO A;  4HN9 A;  3QOF A;  5L3F B;  1YQ4 A;  3J9X 1;  3X1D A;  4YSZ A;  5C2T A;  4X66 T;  2BVM A;  4ASK A;  5AQU B;  4JI6 T;  3ZMZ B;  2X67 A;  3N2O A;  3ONX A;  5HXH A;  4UEL A;  2VAS A;  4IT4 A;  2HN1 A;  4UIG A;  5FNV E;  4ZS3 A;  3UFE A;  4IE0 A;  5FXV A;  4LMJ A;  5CA0 E;  4TN7 B;  3P7I A;  3LSV A;  4PFO A;  3EDV A;  2VL0 A;  4EIW A;  5KX5 E;  2BBJ A;  1HTJ F;  2DL1 A;  2FJA A;  2C5K T;  2E2A A;  4YTM A;  1ZEE A;  3T1Y T;  2LSI A;  2CXF A;  2VK9 A;  3N9Q A;  2IAK A;  4ZI3 D;  3BQI A;  1HG5 A;  2WQY A;  3A5X A;  2HHH T;  1D1A A;  4G2A A;  4JYA T;  3ZC1 A;  3RPU A;  5JRE A;  1QLB A;  3RX6 A;  2YIN A;  3DTO A;  3FXE B;  2KXP B;  4LFA T;  3B57 A;  2C5J A;  5A1L A;  1T8B A;  4AI6 A;  4GKK T;  2XQ6 A;  3O9X A;  2N1G A;  2W00 A;  3AE6 A;  3VRB A;  4AQG A;  2ACZ A;  1E7P A;  3WI3 A;  5HYA A;  3UUL A;  3UU8 A;  2YU1 A;  2NTY A;  2YK0 A;  4PK5 A;  2OV9 A;  2ZM0 A;  4O2B E;  5LOV E;  3OJA A;  3AEA A;  3QK6 A;  2V7J A;  3NKZ A;  4IDN A;  3EAB A;  3M65 A;  3ZJ1 A;  4EZ4 A;  5JDF A;  2K48 A;  4DV1 T;  5HWY A;  3QB5 A;  4AKI A;  4B3M T;  2WU2 A;  3UU4 A;  2WM9 A;  5IUX A;  1M62 A;  3EUH A;  3U3I A;  2I0M A;  5BMV E;  3ZYM A;  1H7C A;  3TKL B;  4L9I A;  3GA8 A;  2OA5 A;  2LHN A;  2YDS A;  1LVF A;  4K0K T;  4IDP A;  1XNQ T;  5LB7 B;  3RYH E;  2LHR A;  3UFG A;  2VVS A;  1MIW A;  3MAC A;  3KV6 A;  4LMK A;  4QH4 A;  4U74 A;  5IHY A;  1YQ3 A;  2BZB A;  4DBQ A;  2FBW A;  4B6X A;  3C4W A;  1HS7 A;  4QKN A;  5AQV B;  4MHC A;  3IBP A;  5ABF A;  4OYK A;  4HWI B;  2L3L A;  2WDV A;  5KMG P;  3N9M A;  4CXW A;  5F3J A; 
#chains in the Genus database with same CATH homology
 5JQG E;  4DO0 A;  4EB6 E;  4H9Q C;  1T98 A;  4AKR B;  3C4X A;  5JDN A;  2UXX B;  3DP7 A;  3V5S A;  4AKL A;  1WYC A;  4F6R C;  1U5P A;  4J2C A;  1UX4 A;  2LT3 A;  2WWU A;  5JDQ A;  3C50 A;  2CLY C;  1D0Z A;  3O1J A;  5FXW A;  4EYY R;  5LA6 E;  5LBM A;  5HXC A;  2D0T A;  4ANJ A;  1BR1 A;  2E9X D;  2CCQ A;  2XHE B;  3SS1 A;  2X68 A;  1FEW A;  1FIO A;  3RYF E;  3KBT A;  2D0U A;  1Z0P A;  5LNK A;  4EYU A;  5TAO A;  2CA5 A;  3N9P A;  4MFR A;  2E9X C;  5LG4 A;  4OFZ A;  4U72 A;  4O4L E;  4PK6 A;  2PJQ A;  3UT5 E;  2DWG A;  3ETU A;  4I4T E;  4O4I E;  4BAY B;  2XAG B;  3HI2 A;  3IHR A;  2ODV A;  5JDG A;  3E22 E;  5CA1 E;  1BR4 A;  1YKE B;  2Q9Q A;  3R6N A;  3UUM A;  2LM9 A;  4X1K E;  3AAI A;  5FY1 A;  3AA6 B;  1OWA A;  2D5U A;  3CPZ A;  3QC9 A;  5CB4 E;  2V1D B;  2LSK A;  2JQQ A;  4HGA A;  3AVR A;  1SA0 E;  2NOX A;  1CUN A;  3VKG A;  4P0A A;  4UV9 B;  4WW0 A;  5JH7 E;  3MK7 C;  5L2L A;  1MMA A;  2H7V C;  3OBV E;  3MZK B;  5FMN A;  4YLH A;  5LGN B;  2Q9Q B;  2QGS A;  3OYX A;  3HR0 A;  2RA1 A;  2Y8D A;  4IE7 A;  2JJ9 A;  4ZI2 D;  1D1B A;  1MNE A;  4KUM B;  2W63 A;  3AA1 B;  2B1E A;  2MYS A;  2WMN A;  3K8P C;  4CI3 B;  4YJ3 E;  2ZM2 A;  3QUJ A;  3HKE E;  5DQV A;  4ZI2 C;  3NRY A;  5ADX L;  3ZN1 B;  3NBX X;  4YJ2 E;  1VOM A;  2BVL A;  5IYZ E;  3JC6 D;  2A3D A;  4PNI A;  5LHH B;  2K5B B;  1E1H B;  4TZ4 C;  1EZ3 A;  3EVY A;  1MMG A;  3PUR A;  4MLK A;  5GON E;  1UCU A;  5FXZ A;  3JC6 C;  4ILU A;  4PJN A;  3RYC E;  4UF0 A;  4DMV A;  4GYS A;  1NAF A;  3CWZ B;  4UVA B;  2Q9Q C;  4FJO A;  1MMD A;  2CM0 A;  3CX8 B;  4DVD A;  3I0O A;  2D2S A;  2EHO A;  3C4Z A;  1YD8 G;  5ETW A;  2IC9 A;  4WNK A;  2V26 A;  4AKG A;  1O3X A;  3PU8 A;  2V7M A;  4FI5 A;  4DND A;  2C5I T;  4QX7 B;  4CXW A;  2KND A;  4JLE A;  5JDM A;  4I55 E;  4O8S A;  2VB6 A;  4UF0 B;  3AB3 B;  4HEA A;  5EK3 A;  1YKH B;  2X0L B;  3E0Z A;  3I9W A;  3LG7 A;  3LK3 B;  3F31 A;  3IF8 B;  3HKC E;  3SRZ A;  2NP9 A;  2XAF B;  3RC3 A;  3F2E A;  4I43 B;  3GMI A;  3S4U A;  2KZ7 B;  2N2N A;  4L0R A;  1Y64 B;  2DI4 A;  4PFP A;  2LE8 A;  2EHO B;  2PBI A;  3AA0 B;  3KDS E;  4M1P A;  3V5U A;  3Q2M A;  4XZC A;  3KVB A;  1S35 A;  2LJL A;  3PDY A;  2WBL A;  2Y48 B;  2M67 A;  4EOZ B;  4HKA A;  1KK7 A;  1QSD A;  3C51 A;  2V7L A;  5HXS A;  5DAB A;  3ZMU B;  2W62 A;  5H6Q B;  3F57 A;  5J2T E;  4KP3 C;  1B7T A;  2CXL A;  2WAU A;  3FB2 A;  3MJX A;  1ZV4 X;  2JRK A;  4YFS A;  5LJM A;  1G73 A;  3CQC B;  3I1A A;  2EHO D;  2WMO A;  4N78 D;  4TV8 E;  1IJ5 A;  2DLR A;  4BJN A;  3BQK A;  3H3A A;  2CWY A;  3OYZ A;  3N2K E;  4H9S E;  5KDM C;  3NZP A;  2V7K A;  2IC6 A;  1D0Y A;  2EHO C;  3WAK A;  4PJM A;  4K0U A;  4DBR A;  5JRC B;  4E7S A;  1D1C A;  5HXR A;  3K3N A;  4NUU A;  3LJC A;  4HE8 A;  1WLX A;  2X9H A;  2NWB A;  4HFV A;  4YHJ A;  1FMW A;  4H63 V;  4ZI3 C;  1X79 A;  2ZMA A;  3O1H A;  3FHN A;  2LEH A;  3KV4 A;  3UUN A;  4QWN B;  2ES0 A;  4WBO A;  4IE6 A;  1AJ3 A;  4UXN B;  3I0Q A;  4H9R C;  3CVR A;  3FBL A;  3VKH A;  2XTL A;  4JEU B;  5LYJ E;  3ESL A;  2Y6X A;  4ERR A;  5L3D B;  5JDH A;  5HAX A;  3LFM A;  4H9O C;  4IHJ E;  4GIW A;  4X1I E;  2KIN B;  2QA7 A;  4PK4 A;  3ZMV B;  5HXE A;  4TV9 E;  4IST A;  4KBM B;  5HWX A;  2C0S A;  3ZCI A;  3KBU A;  5JR9 A;  4PW8 A;  3CML A;  2UXN B;  4ADZ A;  4C90 A;  2NTX A;  4UEM A;  2YEV C;  3H37 A;  3SWH A;  5AFU L;  2BDE A;  3PE0 A;  3ZYK A;  4ZS2 A;  2CMR A;  5DJQ C;  4TUY E;  1VRB A;  4BJM A;  3ANW A;  4XAX B;  3P8C D;  4CI1 B;  2A72 A;  2Z6E A;  3AAA B;  3W15 B;  4AKH A;  4MAL A;  4QXC B;  5LHI B;  2X9X A;  3PUG A;  5FY7 A;  5J1G A;  2L9Q A;  3CX6 B;  2Q9Q D;  3AAE B;  3VHL A;  4OK0 A;  1MIY A;  5JDL A;  2VKD A;  3CQG B;  2LOS A;  3E08 A;  5JR9 B;  4QHO A;  4HN9 A;  5L3F B;  3J9X 1;  4UVB B;  4C91 A;  2DCF A;  2BVM A;  3ANW B;  2V7I A;  4QXH B;  4ASK A;  3ZMZ B;  3RH3 A;  3ZPO A;  4BA9 A;  2X67 A;  3L09 A;  3C98 B;  3N2O A;  3ONX A;  1MIV A;  2K24 A;  4X20 E;  5HXH A;  3IEE A;  4X1Y E;  1MND A;  5F8P A;  5J2U E;  4UEL A;  1WRD A;  3GN5 A;  2VAS A;  2XQY A;  2KT9 A;  3L3P A;  4H9N C;  2X9Y A;  3R84 B;  1U4Q A;  4UIG A;  5FNV E;  2NW9 A;  4ZS3 A;  3MA9 A;  4IIJ E;  3MXZ A;  3UFE A;  5E0O A;  3EDU A;  5M4Y A;  2HH7 A;  3ZMT B;  4IE0 A;  2XUE A;  3LK4 2;  4L5G A;  2CEA A;  4CXX A;  5FXV A;  4O4H E;  5JR9 C;  4QX8 B;  5CA0 E;  2XAS B;  4TN7 B;  3K3O A;  4GYR A;  4OHF A;  3P7I A;  1UX5 A;  4PFO A;  3EDV A;  4EIW A;  4ZOL E;  3GN5 B;  2XAQ B;  1WYB A;  2CE7 A;  4I50 E;  5KX5 E;  1BR0 A;  3N9L A;  2K9A A;  3AA7 B;  1HTJ F;  2SPC A;  5F3J A;  3ZMS B;  2RP4 A;  2H3R A;  4P09 A;  2C5K T;  3ZN0 B;  1ZEE A;  2LSI A;  2CXF A;  4EXT A;  3N9N A;  4EZH A;  5LHG B;  1US7 B;  5FXX A;  2VK9 A;  4O4J E;  3N9Q A;  2ZLY A;  2IAK A;  1HG2 A;  4IGU A;  3OKQ A;  3KFW X;  3PU3 A;  2WSS V;  1IZN B;  2GK9 A;  5FP3 A;  4ZI3 D;  1V9D A;  3BQI A;  4CI2 B;  5LCY A;  1HG5 A;  2X66 A;  3A5X A;  1MMN A;  4PJL A;  1IJ6 A;  2LOP A;  4KMC A;  1D1A A;  4G2A A;  5FYM A;  3MKD A;  3N9O A;  4P0B A;  3ZC1 A;  5L3B B;  3RPU A;  3CQX C;  3K3Q C;  5JRE A;  2VKO A;  3B13 A;  4GOU A;  5LGU B;  3RX6 A;  3LBX A;  4UVC B;  2LSJ A;  4HTE A;  5FY0 A;  3BK9 A;  2YIN A;  5LXT E;  3DTO A;  2L8K A;  3FXE B;  1KNZ A;  2KXP B;  3KV5 A;  3B57 A;  2C5J A;  5A1L A;  1S94 A;  2DHR A;  4AI6 A;  3LK2 B;  4IDZ A;  3O9X A;  1D0X A;  2N1G A;  1WR6 A;  2W00 A;  2HPL A;  1LVK A;  3D0T A;  4AQG A;  4CQI A;  3HKB E;  3WI3 A;  1ZKE A;  1HCI A;  4IE5 A;  3C64 A;  3LBX B;  5HYA A;  3ZLI A;  3RKO A;  3HA4 A;  2YU2 A;  3UUL A;  4AQF A;  1YW0 A;  4E7Z A;  3SOL A;  2X9W A;  2YU1 A;  4NUV A;  2NTY A;  2XAJ B;  2YK0 A;  2ACX A;  3O4X E;  2VKJ A;  4PK5 A;  2KWI B;  3ZC0 A;  4JUY A;  4H63 H;  4O2B E;  2ZM0 A;  2XAH B;  5LOV E;  3OJA A;  2DWK A;  3QK6 A;  2ODU A;  2V7J A;  3NZQ A;  3M65 A;  2A2F X;  5LJN A;  3PUA A;  3ZJ1 A;  4EZ4 A;  3HKD E;  1LRZ A;  4GK5 E;  4XBF B;  3KIN B;  5JDF A;  2H7O A;  4ZHQ E;  5C8Y E;  2K48 A;  4V1A v;  3RRW A;  4ZI7 E;  5HWY A;  4AXP A;  4AKI A;  2PG8 A;  3UUX B;  2LSY A;  4CZZ B;  5L3E B;  3RYI E;  4GK0 E;  5EK2 A;  4IE4 A;  2WM9 A;  4G63 A;  5LGT B;  3U78 A;  3EUH A;  2CXD A;  3U3I A;  5L3C B;  2MOZ A;  2P9B A;  5H6R B;  3RRC A;  5DQW A;  5BMV E;  3T8O A;  3FBZ A;  1BR2 A;  1SHZ C;  2N9D A;  2LSG A;  3UTK A;  3ZYM A;  3VU7 H;  2X51 A;  5EZY E;  1H7C A;  3CX7 B;  2I59 A;  4L9I A;  3TKL B;  3I9Y A;  4A56 A;  4CXY A;  3J7Y q;  1HF8 A;  2ZM8 A;  2MBG A;  4ISS A;  3GA8 A;  2JPF A;  4Z8X A;  2OA5 A;  3Q9D A;  2LHN A;  2HPJ A;  2VKH A;  4QXB B;  3CKD A;  1LVF A;  2DNX A;  3ZEF B;  4EAH A;  4AQF C;  3Q5W A;  3N5L A;  3PUQ A;  3ZYL A;  4TX5 A;  3RYH E;  2E9X A;  2PFV A;  3PUS A;  2LHR A;  3WAJ A;  4H9P C;  2KWH A;  1G8X A;  3PTR B;  2JMH A;  1MIW A;  2IW5 B;  3KV9 A;  3KV6 A;  3MAC A;  2CLY B;  3GWH A;  4JEH B;  4U74 A;  5IHY A;  2BZB A;  3ZJ2 A;  1HX8 A;  3KVA A;  3N2G E;  4DBQ A;  2NW8 A;  4B6X A;  3C4W A;  4PAG A;  5L3G B;  1HS7 A;  3O1I A;  1NWM X;  4WBN E;  3RC8 A;  2NW7 A;  2G0U A;  1IAP A;  2W0G A;  1HFA A;  3AVS A;  2E9X B;  2JMK A;  2VWA A;  1FMV A;  4QKN A;  5LBQ B;  3ZCJ A;  4PJJ A;  1LKX A;  3Q5X A;  3DJB A;  3IBP A;  4MHC A;  2KMF A;  2MTQ A;  4OYK A;  3FXD B;  4MBQ A;  3HL6 A;  5JVD E;  2CWO A;  4O2A E;  3BQL A;  4UV8 B;  2L3L A;  4DMW A;  3ETV A;  2W61 A;  4OYJ A;  5JRC A;  5KMG P;  5EK4 A;  1ZHC A;  2E8I A;  1QUU A;  2KLQ A;  3N9M A;  2J1D G;  3NRX A;  5LP6 E;  2VL8 A;  1OXZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...