2KWHA

Ral binding domain of rlip76 (ralbp1)
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
56
structure length
56
Chain Sequence
GSETQAGIKEEIRRQEFLLNSLHRDLQGGIKDLSKEERLWEVQRILTALKRKLREA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords RalA-binding protein 1
publication title The RalB-RLIP76 complex reveals a novel mode of ral-effector interaction
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 20
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2010-04-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.90 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2kwhA00
2C5KT 1LVFA 4L0RA 1IJ5A 4B6XA 1LRZA 3QK6A 3S4UA 1H7CA 2G0UA 3CKDA 3FXDB 4CQIA 4EYYR 2IC9A 2K48A 3QUJA 2X9YA 1QSDA 3CVRA 2X9XA 2IC6A 2KWHA 3P7IA 4J2CA 3MXZA 3TKLB 4FI5A 3L3PA 2XTLA 2CA5A 2C5IT 1Z0PA 3N5LA 1ZKEA 2KWIB 2C5JA 4DNDA 1IJ6A 2X9WA 3FXEB 2MBGA
chains in the Genus database with same CATH superfamily
1D1CA 1IBLT 2G0UA 3AE6A 1WFDA 3H3AA 1MNEA 3RPUA 2WB5A 1WYBA 2LSIA 3VU7H 2BS2A 5AQOB 5F5WA 3IHRA 5LJMA 3NRXA 4FJOA 1YXRA 2XHEB 4IDPA 4X64T 3ZT7A 2Y48B 2LRKA 4DR4T 3C4ZA 4OX9T 3AA6B 4GKKT 4BA9A 5JDLA 5AQRB 3K3NA 1N33T 2XQ3A 5LGNB 4NPPA 2FUPA 3OBVE 3PUQA 1N32T 1KNZA 4KI0F 1OEDA 3BQKA 4IDZA 3V5SA 5AFUL 3HA4A 2WWUA 1Z0PA 3ZMUB 3I0QA 3OKQA 4CI3B 4X1KE 2WMOA 3AVRA 2NW7A 3KINB 2WZHA 3KFWX 5JDMA 4ZI2C 4IDQA 5HEOA 4P1NA 3RKGA 3ZMZB 4O4LE 4AQFC 3AE5A 1OEDC 2KMFA 4LFAT 5LGUB 4U74A 1HTJF 3SRZA 3EDVA 4F8HA 3QK6A 1H7CA 4HFVA 2NTXA 3FB2A 3KV6A 4LF6T 2WWVA 2V6YA 1OEDB 1WLXA 3VRAA 1VCSA 3IBPA 5HWYA 3ZMTB 2J62A 3RC8A 2MAWA 4UV9B 3RRWA 3FZMB 1KEYA 4EXTA 2EHOD 5LBQB 2XQ4A 5FP3A 3ZC1A 1US7B 2UXNB 2FJBA 5LHGB 2M6BA 3P7IA 2L8KA 2LHNA 2JQKA 2YK0A 4ZXLA 3VR8A 1QUUA 2VKHA 5CA0E 3RHWA 3JCFA 4L0RA 5H6RB 2PBIA 2V6YB 3ZCJA 4V1Av 3RGLA 3IEEA 3RX6A 5FL1A 2ZM0A 3ZPOA 3I0OA 2N1GA 5HXEA 3AE8A 3ZYMA 3FZFB 4HWHA 2UUBT 2WS3A 2YU2A 2DCFA 3HKCE 4DR5T 4TZ4C 5JR9A 4UXNB 4LMLA 4IHJE 3EHZA 3NKZA 2LEHA 1LKXA 3ZYKA 2LOPA 3GWHA 4JI3T 3ZT5A 2FBWA 2CHOA 1IJ5A 1ZEEA 4UF0A 2XAFB 3SOLA 2Q9QA 4L5GA 4C90A 2LE8A 1HX1B 1T72A 5JR9C 3HL6A 4MBQA 4PJMA 3UFGA 4JI1T 4B3RT 2K24A 4UVBB 4ZEYA 4PAGA 4AKRB 5ABEA 1XWMA 2WP9A 4Z90A 2JMHA 3N2KE 2X66A 2Q9QC 4IE4A 4B3MT 3ETUA 5JR9B 4G2AA 3N9QA 2W4XA 3MK7C 3BQIA 3TLSA 4NUVA 4P0BA 4CN4A 3Q9DA 5AQPB 4DR7T 2X9YA 4WW0A 3UQ4A 5FNVE 4PNIA 4UF0B 2HN1A 2MTQA 2CMRA 2RP4A 4UR9A 3I9YA 4U72A 2DNXA 2WZIA 3U3IA 5JTGA 2A3DA 2IHR1 3RKOA 2V8SV 2C5IT 4DO0A 3F31A 3PUWF 1XDPA 4QWNB 4ZI7E 4U31A 1YQ4A 5IWAT 2ACXA 2XJ7A 5LHIB 3CKDA 4HGAA 1MIYA 4XZCA 2IC9A 4DR6T 4YHHT 3N9PA 4A97A 5IUXA 4IDNA 2ZM6T 4G63A 1J5WA 2UXCT 4E7SA 5LB7B 4NIQA 1XMOT 1Z8UA 3CVRA 3PTRB 4FI5A 5FXZA 5CJ5A 5ABHA 1OXZA 3Q5DA 1D0XA 3O9XA 3O1IA 2ES0A 2PFVA 4TV9E 4U7IA 3FBZA 1EZ3A 2VL0A 5CGMA 1DU2A 2NP9A 3ANWB 3CQCB 2VWAA 2AE9A 1HNZT 4UELA 2VK9A 5JVDE 3DJBA 4I43B 4ZS3A 2JMKA 3KV4A 3PUXF 3KVBA 2XSBA 1KK7A 4OK0A 3SFDA 3ZT6A 3E08A 2NTYA 3CMLA 2V7JA 5ABFB 2I6HA 4GYSA 1IJ6A 3N2GE 3AAIA 5JDHA 4K0UA 1UGOA 4TN7B 4HEAA 4A5XA 4B3TT 1X79A 3PUGA 3ABVA 4JI2T 1UURA 3P50A 3OPCA 4EIWA 1MIWA 2JPFA 4LF5T 2EHOC 3PJAA 3ZN0B 3CX7B 3JADA 3VKHA 3Q5XA 1IAPA 4YSYA 2N2NA 2QVAA 3FZKB 5C3JA 2ZM2A 2QYWA 2OV9A 5L3DB 3MXZA 4ZZCA 2LSJA 4DV5T 4Z91A 5AQTB 4IL4A 1ZKEA 4UIGA 5AQIB 5LGTB 1D0ZA 2W0GA 3O1HA 2EHOB 5KDMC 3RIUC 4X20E 4YTMA 2KSRA 1BR0A 1WR0A 4CI1B 3PUZF 3G06A 4TWFA 3HKEE 5JDQA 4QX8B 4WBNE 1J1JA 3AECA 5FXXA 1NWMX 5FL0A 1SE7A 2D0UA 2WY2A 2MOZA 2WAUA 4EZHA 3U78A 4N78D 3A5XA 4ZOLE 2W62A 3EUHA 4UVAB 4O4HE 3UU3A 2ZLYA 1VCTA 5L3BB 1V9DA 5HYAA 5HXCA 2K48A 1WYCA 4ADZA 5EK3A 4DR3T 5LG3A 2NW9A 4H9NC 4DNDA 1KNPA 4YLHA 1FJGT 1I94T 5HXSA 2BVLA 4HWCA 4CI2B 3PUSA 2VL8A 1ZV4X 4I4TE 1NAFA 3O1JA 4CXWA 3RQUA 5AQVB 1W9RA 2VB6A 3N5LA 3L39A 1S94A 1MMAA 2CEAA 4QHOA 5FMNA 2X0LB 2NWBA 3ZMVB 1UX4A 5FKYA 4AQFA 1HFAA 3NRYA 4GIWA 3T1YT 4F6RC 3PV0F 2W2UA 2X51A 4PK6A 2C5JA 2HH7A 2XQAA 4JLEA 3NZQA 2XSAA 3PE0A 2BG9E 4IT4A 5JQGE 4DMWA 3K1SA 1D0YA 4TX5A 1WCRA 4BAYB 4QXBB 4I55E 5DQWA 4O2AE 4PFPA 5FYMA 3FZHB 2XM2A 4QX7B 4HFIA 5AQHB 3HKDE 4KMCA 2IIUA 5FY0A 4AKLA 4JI0T 3LSVA 2D5UA 4TWHA 4U3CA 2WQYA 3R84B 3UU5A 4ERRA 5JH7E 5CA1E 3R6NA 1MIVA 3AAAB 3ZSTA 4ILUA 2K5BB 2LRLA 2W00A 2B1EA 2DLRA 3E22E 3MA9A 2UXXB 2X0YA 4H9QC 4O2BE 3IA3A 4BJNA 3AEGA 1E1HB 3LBXB 3UUMA 4GOUA 3MZKB 4H9OC 4HFBA 3GN5B 4EOZB 2AXDS 2VURA 3MKDA 4PK5A 2B76A 2X67A 1MMNA 4HFDA 2XUEA 5FXVA 2IUBA 1Y01A 3Q5EA 5EK4A 3N9LA 4X5TA 4JI8T 2LKHA 4H9SE 1Y64B 3RYFE 5AQGB 4HFCA 3J7Yq 4NXMT 4AISA 2V7KA 5LCYA 2KWHA 1LVKA 4TNWA 3EVYA 1UK5A 4O4JE 5FXWA 3KDSE 1KF6A 2CXFA 5H6QB 4HE8A 5DJQC 4LF4T 4Z8XA 2FJAA 2WMNA 4MFRA 3BK9A 3S4UA 5JDFA 5DABA 3QNUA 1BR4A 2E9XB 3PU8A 2WU2A 4GYRA 4WZXA 4YHJA 1YW0A 2V7LA 1FEWA 3T8OA 2VVSA 2WCAA 1BR2A 4QH5A 3IF8B 4UVCB 1XDOA 1VRBA 2I0MA 2WDVA 2LOSA 4HTEA 4DV0T 3RC3A 4QXHB 5AQFB 3AEBA 2BKOA 5LG4A 3PDYA 5GONE 3HI2A 5AQSB 3Q5WA 2WSSV 3E0ZA 5JDNA 4TWDA 2WBLA 1ZHCA 2R6GF 5L3CB 3NVOA 4LMKA 2YOEA 3C50A 5KX5E 2RA1A 2CBIA 3C98B 2LSGA 3AEDA 4WNKA 3LK3B 4PJJA 3AE2A 5JREA 2OA5A 4PW8A 2YDSA 5L47A 1MMDA 5M4YA 2CPTA 4X1IE 4ZZBA 3ZKRA 3CX6B 5EZYE 2IW5B 2M67A 4IREA 5FVKA 4JV5T 3UT5E 2F4VT 1HNWT 1JNZA 2V26A 2K9AA 2XQ8A 2UUCT 2VQET 3ANWA 4IE0A 4DVDA 1NEKA 1FIOA 2W67A 2X68A 1U4QA 4EGWA 3NWIA 4KBMB 1OWAA 3KV9A 2YDRA 5BMVE 1KFYA 4ILAA 5ABFA 2BKPA 2JQHA 5HEUA 4I50E 3HR0A 1SHZC 3AVSA 3C4XA 3KBTA 2IAKA 3FZLB 3ZLIA 5F3JA 4H9PC 1M62A 2LLYA 5HEGA 3QC9A 3N9MA 3FHNA 5LXTE 3B5MA 2CHNA 4JYAT 5L3FB 4OYJA 3AA1B 2UXDT 1YKHB 4IDOA 4KHPT 2SPCA 4O8SA 5TAOA 1GQEA 2BVMA 2CXDA 3WI3A 2XAGB 3AE3A 3NZPA 1QLBA 3PU3A 3H3MA 4PJNA 2JRKA 2EHOA 3UULA 4HFEA 5J1GA 3RI5A 3OTOT 3QB5A 2MBGA 2E8IA 1J5ET 2LJLA 3JAEA 2W66A 2E9XD 4QXCB 4NUUA 3DP7A 2H7OA 2CLYC 1N36T 2HPLA 4Q25A 3A8YC 1N34T 1OEDE 2XAQB 3KBUA 1AJ3A 4GK5E 3B13A 2VVNA 4YSXA 4YXDA 4GK0E 3RIUA 5HCJA 3ZC0A 5AQMB 2KNDA 4DR1T 3ZJ2A 2NR4A 2A2FX 2Y8DA 4EV6A 2CLYB 3ETVA 5C2TA 2V7IA 5J2TE 3JAFA 2V6XA 4TNVA 4YJ3E 3M65A 3K3QC 5HXHA 1G8XA 3ZN1B 4EB6E 3SS1A 4DV1T 2P9BA 3UU4A 4U7YA 2D9DA 2XAJB 4DV4T 2IDOB 1B7TA 2FJDA 3PURA 3AE1A 2YKSA 4TUYE 3TLUA 2V7MA 1HNXT 3K3OA 3UU8A 2V5CA 4IE5A 4CN1A 3AEAA 4PJLA 4AI6A 1XNQT 2XAHB 3AAEB 4HKAA 4QH4A 4DIDB 3P4SA 3GMIA 2FJEA 5FY7A 3CQGB 4UV8B 2CCQA 4IE7A 3FXDB 4ILBA 1IBKT 2HN2A 2KXPB 3RF1A 2X9XA 3TKLB 1UUSA 1CHUA 1HCIA 3ZYLA 2UXBT 4U33A 2WU5A 2JQQA 2KT9A 2MPKA 1E2AA 2JIWA 4YTPA 2X9WA 3RYCE 3KV5A 2V1DB 4DV6T 3MACA 3LG7A 2E5VA 2DWGA 2K3WA 4XBFB 1R8IA 4AXPA 4A56A 2CM0A 2OLTA 3K8PC 1WR6A 3N2OA 4IE6A 3AE7A 2VKOA 4EEBA 4X65T 4JBWF 4H63H 3P4PA 4EZ4A 2XPKA 4MHCA 4LFCT 4M1PA 4U2YA 5LMNT 1D1BA 1YQ3A 1L0VA 2CXLA 4EEDA 3KVAA 3AEFA 5CB4E 4ANJA 2W61A 4QKNA 5HCMA 3EABA 4CXXA 2NW8A 4XAXB 4HWDA 4CQIA 2HPJA 4ASKA 5EK2A 5AQKB 1T8BA 2CRBA 2Y6XA 3AXJA 2VASA 4J2CA 3ESLA 5BR8T 3LBXA 4HFHA 2J1DG 3VKGA 1BR1A 1M7KA 3GN5A 2D0TA 2JJ9A 2XZEA 3PUYF 3J9X1 3H37A 4AKHA 3ONLC 2D2SA 3QB5K 4DMVA 3C4WA 3X1DA 3LK2B 5KMGP 4C91A 4PFOA 4E7ZA 4JI4T 2KWIB 2KZ7B 4ISTA 5CFBA 3VHLA 4DUZT 4LF7T 3P4RA 4YJ2E 2BS3A 3RRCA 4O4IE 5E0OA 3AEEA 3BQLA 4TV8E 5L3EB 4WBOA 1XNRT 3UQ7A 4KHZF 3L8RA 3NBXX 3VRBA 4GKJT 5J0ZA 5L4EA 2GK9A 3AXJB 3PUAA 3UUXB 5FY1A 5HXRA 4IL9A 1XMQT 4ILCA 3LFMA 4MLKA 4YTNA 2L3LA 1U5PA 2QA7A 2IC6A 4UEMA 4JUYA 3ZCIA 5AQQB 3WAKA 1MMGA 4ZHQE 2J4GA 3CX8B 1HX8A 2E9XA 4X62T 2PTFA 1W0AA 4PK4A 3JC6D 3EDUA 4OYKA 4CZZB 4K0KT 1O3XA 2XTLA 2XY8B 2DI4A 4ISSA 2A9UA 1W09A 2C0SA 2XM1A 3ONJA 2WDQA 4JI7T 3I1AA 2DHRA 1VOMA 3W15B 4YSZA 4ZI3D 2E9XC 2PJQA 4IGUA 4AKIA 4AIUA 5HEJA 3AB3B 5HEHA 2X9HA 2RPAA 4DV7T 2CBJA 2YN6A 4I0UA 5L4HA 1XZYA 2VKJA 3C64A 5LA6E 1LVFA 3L09A 3RLFF 2KLQA 4B6XA 1CUNA 4DBQA 4H63V 3ZJ1A 4BJMA 2ZMAA 2V5DA 4JEUB 2X0HA 4HWIB 5A1LA 1FMWA 2BG9A 4YFSA 1KNRA 1HG2A 3C51A 5FVLA 5F8PA 1LRZA 3CWZB 2UUAT 4LF9T 1FMVA 2XQ5A 4OFZA 4P0AA 2CWYA 2E5LT 3SFEA 3UFEA 3HKBE 3F57A 2VQFT 2UU9T 2BG9C 3DTOA 2BZBA 4JEHB 5HAXA 3EAMA 1G73A 3TLWA 4OHFA 2XQYA 2LHRA 3AA7B 3PJAJ 4YY3T 1UX5A 1NENA 4DR2T 3A7MA 1WRDA 1E7PA 2WDRA 2BG9B 3OYZA 3AE9A 3CK6A 4DBRA 3OVUA 3F2EA 2J47A 2BDEA 3ONXA 5JRCA 4IIJE 4KX6A 2Q9QB 1T98A 4HN9A 2YINA 5LYJE 4ZI2D 2C5KT 3UUBA 3ZMSB 3RYHE 2ZM8A 3OYXA 5LHHB 2BKNA 3UU6A 2LSYA 3TLVA 4EAHA 2CA5A 3N9OA 2BBJA 5ABGA 4HWFA 3LK42 2Z6EA 4LFBT 3MJXA 2DL1A 1HS7A 4NXNT 4EYYR 3OJAA 2H3RA 4CXYA 4DV2T 4YT0A 5J2UE 4LMJA 2N9DA 5JRCB 4A98A 2YU1A 5AQNB 3RH3A 3UUNA 2LKGA 3TLTA 2BS4A 4LF8T 3P4QA 2LM2A 3EI0A 2YEVC 2LT3A 1IZNB 4ZS2A 3P4WA 3ZSSA 2PG8A 4KP3C 1S35A 5LBMA 4KUMB 3WAJA 2HHHT 3I9WA 3CQXC 1MNDA 1W0BA 3ZEFB 4CN6A 2XASB 2L9QA 4H9RC 5KXJA 4X1YE 5LJNA 3T1HT 4X66T 2H88A 3GA8A 3LDQB 4DUYT 5LNKA 1YKEB 4P09A 1SUMB 4JI5T 2W63A 5ADXL 1YD8G 3FXEB 2VKDA 3V5UA 5IYZE 5IHYA 3RIAA 5C8YE 1HR0T 3O4XE 1IBMT 3UTKA 3D0TA 2IMLA 2JQ9A 5JDGA 4AQGA 1UCUA 4DV3T 2ACZA 3RYIE 2CE7A 3P8CD 4AQYT 5AQLB 3AA0B 4EYUA 1SA0E 5LOVE 3M3ZB 2XQ7A 2QGSA 3RIFA 2ODVA 3L3PA 3RQWA 4JI6T 2QRXA 2M6IA 3N9NA 3B57A 2DWKA 2WM9A 2A72A 2H89A 4U2ZA 1I6ZA 3FBLA 2NOXA 5AQUB 5AQJB 2MYSA 2LM9A 3JC6C 2H7VC 1HF8A 4QH1A 4AKGA 3Q2MA 5L3GB 3QUJA 2Q9QD 5LP6E 2CWOA 2ODUA 1ZP0A 2BBHA 3LJCA 4ZI3C 4B3ST 3QOFA 4MALA 4COFA 2E2AA 2XQ6A 3PUVF 4WYVA 2LSKA 1D1AA 1T7SA 3VR9A 2I59A 5DQVA 1QSDA 1JNRA 1X9BA 3SWHA 1HG5A 5LMUT 2YDQA 3CPZA 1ZOYA 5ETWA 5L2LA 2KINB 3AE4A 4L9IA 5HWXA 2XQ9A 3CIRA
chains in the Genus database with same CATH topology
3PUAA 5LG4A 3PDYA 1D1CA 5GONE 3UUXB 3HI2A 5FY1A 5HXRA 3Q5WA 2WSSV 3E0ZA 4ZS3A 5JDNA 2WBLA 3LFMA 1ZHCA 2G0UA 2JMKA 4MLKA 3KV4A 3H3AA 5L3CB 2L3LA 1U5PA 1MNEA 3RPUA 3C50A 3KVBA 2QA7A 2IC6A 4UEMA 4JUYA 5KX5E 3ZCIA 1KK7A 4OK0A 3WAKA 1MMGA 1WYBA 2LSIA 4ZHQE 3E08A 2NTYA 2RA1A 3VU7H 3C98B 2LSGA 3CX8B 3CMLA 2V7JA 4WNKA 3LK3B 4PJJA 4GYSA 5JREA 1IJ6A 2OA5A 4PW8A 3IHRA 5LJMA 1HX8A 2E9XA 3N2GE 3NRXA 4FJOA 2XHEB 1MMDA 3AAIA 5JDHA 4K0UA 2Y48B 5M4YA 4TN7B 4HEAA 4PK4A 3JC6D 3EDUA 4OYKA 4X1IE 1X79A 3PUGA 4CZZB 3C4ZA 3AA6B 1O3XA 4BA9A 2XTLA 5JDLA 2DI4A 4ISSA 3CX6B 5EZYE 2IW5B 2M67A 3K3NA 4EIWA 1MIWA 2C0SA 3UT5E 5LGNB 2JPFA 2EHOC 2V26A 2K9AA 3ZN0B 3CX7B 3I1AA 2DHRA 3OBVE 3PUQA 1VOMA 1KNZA 3VKHA 3ANWA 3Q5XA 3W15B 4IE0A 3BQKA 1IAPA 4IDZA 2N2NA 3V5SA 4ZI3D 2E9XC 2PJQA 4IGUA 4DVDA 4AKIA 2ZM2A 1FIOA 3AB3B 5L3DB 2X9HA 3MXZA 2X68A 5AFUL 2LSJA 3HA4A 1U4QA 2WWUA 1Z0PA 3ZMUB 3I0QA 3OKQA 4CI3B 1ZKEA 2VKJA 4UIGA 4KBMB 4X1KE 3C64A 1OWAA 5LGTB 3KV9A 5LA6E 1LVFA 3AVRA 1D0ZA 2W0GA 2WMOA 3L09A 3O1HA 5BMVE 2KLQA 2EHOB 2NW7A 1CUNA 4B6XA 3KINB 4DBQA 3KFWX 5JDMA 4H63V 4ZI2C 3ZJ1A 5KDMC 4X20E 4BJMA 3ZMZB 2ZMAA 4O4LE 4AQFC 4JEUB 4I50E 1BR0A 4CI1B 3HR0A 5A1LA 1FMWA 2KMFA 5LGUB 1SHZC 3HKEE 4U74A 4YFSA 1HG2A 3AVSA 1HTJF 3C4XA 3C51A 5JDQA 3KBTA 2IAKA 3EDVA 4QX8B 3SRZA 3ZLIA 4WBNE 5F8PA 5F3JA 1LRZA 5FXXA 3CWZB 3QK6A 1H7CA 4H9PC 1NWMX 1FMVA 2D0UA 4HFVA 2MOZA 2NTXA 3FB2A 2WAUA 4OFZA 3KV6A 4EZHA 4P0AA 2CWYA 3U78A 4N78D 3QC9A 3N9MA 3FHNA 3A5XA 1WLXA 3UFEA 4ZOLE 5LXTE 2W62A 3EUHA 3HKBE 5L3FB 4OYJA 3AA1B 3F57A 1YKHB 3IBPA 5HWYA 2SPCA 3DTOA 4UVAB 4O8SA 3ZMTB 3RC8A 4O4HE 2BZBA 4JEHB 2ZLYA 5TAOA 5HAXA 4UV9B 2BVMA 2CXDA 5L3BB 1V9DA 3WI3A 1G73A 5HYAA 2XAGB 4OHFA 5HXCA 2K48A 1WYCA 2XQYA 3NZPA 3RRWA 3PU3A 4PJNA 2LHRA 3AA7B 5EK3A 4ADZA 2JRKA 4EXTA 2EHOA 3UULA 2EHOD 5J1GA 2NW9A 1UX5A 5LBQB 4H9NC 4DNDA 2MBGA 2E8IA 2LJLA 4YLHA 5FP3A 1WRDA 3ZC1A 1US7B 2E9XD 3OYZA 2UXNB 5HXSA 4QXCB 4NUUA 3DP7A 2BVLA 4DBRA 2H7OA 3F2EA 2BDEA 3ONXA 5LHGB 2CLYC 4CI2B 3PUSA 5JRCA 2VL8A 2HPLA 1ZV4X 4I4TE 3P7IA 4IIJE 1NAFA 3O1JA 4CXWA 2L8KA 2VB6A 2XAQB 2LHNA 3KBUA 2Q9QB 1T98A 2YK0A 3N5LA 4HN9A 1AJ3A 4GK5E 1QUUA 2VKHA 5CA0E 3B13A 1S94A 1MMAA 2YINA 2CEAA 4QHOA 5LYJE 4GK0E 2C5KT 4ZI2D 3ZMSB 5FMNA 4L0RA 2X0LB 2PBIA 5H6RB 2NWBA 3RYHE 3ZCJA 2ZM8A 3ZMVB 3ZC0A 3OYXA 5LHHB 1UX4A 4V1Av 4AQFA 2LSYA 1HFAA 2KNDA 3NRYA 4GIWA 3ZJ2A 3IEEA 4EAHA 2A2FX 2Y8DA 4F6RC 3RX6A 2ZM0A 2CLYB 3ZPOA 3ETVA 2V7IA 5J2TE 3I0OA 2CA5A 2N1GA 5HXEA 3N9OA 2X51A 4PK6A 4YJ3E 2C5JA 3M65A 2HH7A 3K3QC 3ZYMA 5HXHA 1G8XA 4JLEA 3NZQA 3ZN1B 3LK42 2YU2A 2Z6EA 4EB6E 2DCFA 3MJXA 3SS1A 3PE0A 1HS7A 2P9BA 5JQGE 3HKCE 4DMWA 1D0YA 4TX5A 4TZ4C 4EYYR 4BAYB 4QXBB 4I55E 2XAJB 5JR9A 3OJAA 5DQWA 4O2AE 2H3RA 4CXYA 1B7TA 4PFPA 5FYMA 4UXNB 3PURA 4QX7B 4IHJE 4TUYE 5J2UE 2LEHA 1LKXA 2N9DA 3ZYKA 5JRCB 2YU1A 2LOPA 3HKDE 3GWHA 3RH3A 4KMCA 3UUNA 2V7MA 5FY0A 4AKLA 3K3OA 1IJ5A 2D5UA 1ZEEA 4UF0A 4IE5A 2XAFB 2YEVC 3SOLA 2LT3A 2Q9QA 1IZNB 4ZS2A 2PG8A 4KP3C 1S35A 5LBMA 3R84B 4KUMB 3WAJA 4L5GA 4C90A 4PJLA 4AI6A 3I9WA 2LE8A 2XAHB 3AAEB 3CQXC 4HKAA 4ERRA 3GMIA 5JH7E 1MNDA 5JR9C 3HL6A 5FY7A 4MBQA 5CA1E 4PJMA 3R6NA 3CQGB 3ZEFB 2XASB 1MIVA 2L9QA 3AAAB 4H9RC 4UV8B 4ILUA 2K5BB 2K24A 2CCQA 4X1YE 4IE7A 2W00A 4UVBB 5LJNA 3FXDB 4PAGA 4AKRB 3GA8A 2KXPB 5LNKA 1YKEB 2X9XA 3TKLB 4P09A 2B1EA 1HCIA 2JMHA 3ZYLA 3N2KE 2X66A 2DLRA 2JQQA 2Q9QC 2KT9A 3E22E 4IE4A 3MA9A 2UXXB 2W63A 4H9QC 4O2BE 5ADXL 3ETUA 4BJNA 5JR9B 1YD8G 2X9WA 3RYCE 3FXEB 1E1HB 2VKDA 3KV5A 4G2AA 3LBXB 3N9QA 3V5UA 3MK7C 3UUMA 3BQIA 2V1DB 4NUVA 4GOUA 5IYZE 3MZKB 4H9OC 5IHYA 3GN5B 5C8YE 4EOZB 4P0BA 3O4XE 3MACA 3MKDA 4PK5A 3LG7A 3Q9DA 3UTKA 2DWGA 3D0TA 2X9YA 4WW0A 5JDGA 2X67A 4XBFB 1MMNA 2XUEA 5FXVA 4AXPA 4AQGA 5FNVE 4PNIA 4UF0B 4A56A 2MTQA 1UCUA 2CM0A 3K8PC 2CMRA 2RP4A 1WR6A 3N2OA 5EK4A 3N9LA 4IE6A 3I9YA 3RYIE 2VKOA 2CE7A 4U72A 4H9SE 1Y64B 2DNXA 3RYFE 3P8CD 4H63H 3AA0B 4EYUA 1SA0E 3J7Yq 3U3IA 4EZ4A 2V7KA 5LCYA 4MHCA 5LOVE 2A3DA 4M1PA 1D1BA 3RKOA 2KWHA 2QGSA 2CXLA 1LVKA 2ODVA 3L3PA 2C5IT 4DO0A 3KVAA 3F31A 3N9NA 3B57A 3EVYA 2DWKA 4QWNB 2WM9A 5CB4E 4ANJA 2W61A 2A72A 4O4JE 4ZI7E 4QKNA 3FBLA 5FXWA 3KDSE 2ACXA 2NOXA 4CXXA 2NW8A 4XAXB 5LHIB 3CKDA 4CQIA 4HGAA 2HPJA 4ASKA 1MIYA 4XZCA 5EK2A 2IC9A 2Y6XA 2CXFA 5H6QB 2VASA 2MYSA 3ESLA 4J2CA 3N9PA 2LM9A 3LBXA 3JC6C 4HE8A 2J1DG 3VKGA 1BR1A 2H7VC 3GN5A 2D0TA 2JJ9A 1HF8A 5DJQC 4AKGA 3J9X1 3H37A 4Z8XA 4G63A 4AKHA 2WMNA 3Q2MA 3BK9A 4MFRA 3S4UA 4E7SA 5JDFA 5L3GB 5DABA 1BR4A 2D2SA 2E9XB 3PU8A 3C4WA 3QUJA 2Q9QD 4DMVA 3CVRA 2CWOA 5LP6E 3LK2B 2ODUA 4GYRA 3PTRB 3LJCA 4FI5A 4ZI3C 5KMGP 4C91A 4PFOA 4E7ZA 5FXZA 4MALA 2KWIB 2KZ7B 4ISTA 4YHJA 1OXZA 3VHLA 1D0XA 1YW0A 2V7LA 2LSKA 1D1AA 2ES0A 3O1IA 3RRCA 4YJ2E 2PFVA 3O9XA 4TV9E 1FEWA 3T8OA 4O4IE 5E0OA 2I59A 3BQLA 1BR2A 4TV8E 5DQVA 3FBZA 3IF8B 5L3EB 4UVCB 4WBOA 1VRBA 1EZ3A 1QSDA 2LOSA 4HTEA 3SWHA 2NP9A 1HG5A 3ANWB 3NBXX 3CPZA 3CQCB 2VWAA 5ETWA 5L2LA 2KINB 4L9IA 5HWXA 3RC3A 4UELA 2VK9A 4QXHB 5JVDE 2GK9A 3DJBA 4I43B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2C5K T;  1LVF A;  4L0R A;  1IJ5 A;  4B6X A;  1LRZ A;  3QK6 A;  3S4U A;  1H7C A;  2G0U A;  3CKD A;  3FXD B;  4CQI A;  4EYY R;  2IC9 A;  2K48 A;  3QUJ A;  2X9Y A;  1QSD A;  3CVR A;  2X9X A;  2IC6 A;  2KWH A;  3P7I A;  4J2C A;  3MXZ A;  3TKL B;  4FI5 A;  3L3P A;  2XTL A;  2CA5 A;  2C5I T;  1Z0P A;  3N5L A;  1ZKE A;  2KWI B;  2C5J A;  4DND A;  1IJ6 A;  2X9W A;  3FXE B;  2MBG A; 
#chains in the Genus database with same CATH topology
 1D1C A;  1IBL T;  2G0U A;  3AE6 A;  1WFD A;  3H3A A;  1MNE A;  3RPU A;  2WB5 A;  1WYB A;  2LSI A;  3VU7 H;  2BS2 A;  5AQO B;  5F5W A;  3IHR A;  5LJM A;  3NRX A;  4FJO A;  1YXR A;  2XHE B;  4IDP A;  4X64 T;  3ZT7 A;  2Y48 B;  2LRK A;  4DR4 T;  3C4Z A;  4OX9 T;  3AA6 B;  4GKK T;  4BA9 A;  5JDL A;  5AQR B;  3K3N A;  1N33 T;  2XQ3 A;  5LGN B;  4NPP A;  2FUP A;  3OBV E;  3PUQ A;  1N32 T;  1KNZ A;  4KI0 F;  1OED A;  3BQK A;  4IDZ A;  3V5S A;  5AFU L;  3HA4 A;  2WWU A;  1Z0P A;  3ZMU B;  3I0Q A;  3OKQ A;  4CI3 B;  4X1K E;  2WMO A;  3AVR A;  2NW7 A;  3KIN B;  2WZH A;  3KFW X;  5JDM A;  4ZI2 C;  4IDQ A;  5HEO A;  4P1N A;  3RKG A;  3ZMZ B;  4O4L E;  4AQF C;  3AE5 A;  1OED C;  2KMF A;  4LFA T;  5LGU B;  4U74 A;  1HTJ F;  3SRZ A;  3EDV A;  4F8H A;  3QK6 A;  1H7C A;  4HFV A;  2NTX A;  3FB2 A;  3KV6 A;  4LF6 T;  2WWV A;  2V6Y A;  1OED B;  1WLX A;  3VRA A;  1VCS A;  3IBP A;  5HWY A;  3ZMT B;  2J62 A;  3RC8 A;  2MAW A;  4UV9 B;  3RRW A;  3FZM B;  1KEY A;  4EXT A;  2EHO D;  5LBQ B;  2XQ4 A;  5FP3 A;  3ZC1 A;  1US7 B;  2UXN B;  2FJB A;  5LHG B;  2M6B A;  3P7I A;  2L8K A;  2LHN A;  2JQK A;  2YK0 A;  4ZXL A;  3VR8 A;  1QUU A;  2VKH A;  5CA0 E;  3RHW A;  3JCF A;  4L0R A;  5H6R B;  2PBI A;  2V6Y B;  3ZCJ A;  4V1A v;  3RGL A;  3IEE A;  3RX6 A;  5FL1 A;  2ZM0 A;  3ZPO A;  3I0O A;  2N1G A;  5HXE A;  3AE8 A;  3ZYM A;  3FZF B;  4HWH A;  2UUB T;  2WS3 A;  2YU2 A;  2DCF A;  3HKC E;  4DR5 T;  4TZ4 C;  5JR9 A;  4UXN B;  4LML A;  4IHJ E;  3EHZ A;  3NKZ A;  2LEH A;  1LKX A;  3ZYK A;  2LOP A;  3GWH A;  4JI3 T;  3ZT5 A;  2FBW A;  2CHO A;  1IJ5 A;  1ZEE A;  4UF0 A;  2XAF B;  3SOL A;  2Q9Q A;  4L5G A;  4C90 A;  2LE8 A;  1HX1 B;  1T72 A;  5JR9 C;  3HL6 A;  4MBQ A;  4PJM A;  3UFG A;  4JI1 T;  4B3R T;  2K24 A;  4UVB B;  4ZEY A;  4PAG A;  4AKR B;  5ABE A;  1XWM A;  2WP9 A;  4Z90 A;  2JMH A;  3N2K E;  2X66 A;  2Q9Q C;  4IE4 A;  4B3M T;  3ETU A;  5JR9 B;  4G2A A;  3N9Q A;  2W4X A;  3MK7 C;  3BQI A;  3TLS A;  4NUV A;  4P0B A;  4CN4 A;  3Q9D A;  5AQP B;  4DR7 T;  2X9Y A;  4WW0 A;  3UQ4 A;  5FNV E;  4PNI A;  4UF0 B;  2HN1 A;  2MTQ A;  2CMR A;  2RP4 A;  4UR9 A;  3I9Y A;  4U72 A;  2DNX A;  2WZI A;  3U3I A;  5JTG A;  2A3D A;  2IHR 1;  3RKO A;  2V8S V;  2C5I T;  4DO0 A;  3F31 A;  3PUW F;  1XDP A;  4QWN B;  4ZI7 E;  4U31 A;  1YQ4 A;  5IWA T;  2ACX A;  2XJ7 A;  5LHI B;  3CKD A;  4HGA A;  1MIY A;  4XZC A;  2IC9 A;  4DR6 T;  4YHH T;  3N9P A;  4A97 A;  5IUX A;  4IDN A;  2ZM6 T;  4G63 A;  1J5W A;  2UXC T;  4E7S A;  5LB7 B;  4NIQ A;  1XMO T;  1Z8U A;  3CVR A;  3PTR B;  4FI5 A;  5FXZ A;  5CJ5 A;  5ABH A;  1OXZ A;  3Q5D A;  1D0X A;  3O9X A;  3O1I A;  2ES0 A;  2PFV A;  4TV9 E;  4U7I A;  3FBZ A;  1EZ3 A;  2VL0 A;  5CGM A;  1DU2 A;  2NP9 A;  3ANW B;  3CQC B;  2VWA A;  2AE9 A;  1HNZ T;  4UEL A;  2VK9 A;  5JVD E;  3DJB A;  4I43 B;  4ZS3 A;  2JMK A;  3KV4 A;  3PUX F;  3KVB A;  2XSB A;  1KK7 A;  4OK0 A;  3SFD A;  3ZT6 A;  3E08 A;  2NTY A;  3CML A;  2V7J A;  5ABF B;  2I6H A;  4GYS A;  1IJ6 A;  3N2G E;  3AAI A;  5JDH A;  4K0U A;  1UGO A;  4TN7 B;  4HEA A;  4A5X A;  4B3T T;  1X79 A;  3PUG A;  3ABV A;  4JI2 T;  1UUR A;  3P50 A;  3OPC A;  4EIW A;  1MIW A;  2JPF A;  4LF5 T;  2EHO C;  3PJA A;  3ZN0 B;  3CX7 B;  3JAD A;  3VKH A;  3Q5X A;  1IAP A;  4YSY A;  2N2N A;  2QVA A;  3FZK B;  5C3J A;  2ZM2 A;  2QYW A;  2OV9 A;  5L3D B;  3MXZ A;  4ZZC A;  2LSJ A;  4DV5 T;  4Z91 A;  5AQT B;  4IL4 A;  1ZKE A;  4UIG A;  5AQI B;  5LGT B;  1D0Z A;  2W0G A;  3O1H A;  2EHO B;  5KDM C;  3RIU C;  4X20 E;  4YTM A;  2KSR A;  1BR0 A;  1WR0 A;  4CI1 B;  3PUZ F;  3G06 A;  4TWF A;  3HKE E;  5JDQ A;  4QX8 B;  4WBN E;  1J1J A;  3AEC A;  5FXX A;  1NWM X;  5FL0 A;  1SE7 A;  2D0U A;  2WY2 A;  2MOZ A;  2WAU A;  4EZH A;  3U78 A;  4N78 D;  3A5X A;  4ZOL E;  2W62 A;  3EUH A;  4UVA B;  4O4H E;  3UU3 A;  2ZLY A;  1VCT A;  5L3B B;  1V9D A;  5HYA A;  5HXC A;  2K48 A;  1WYC A;  4ADZ A;  5EK3 A;  4DR3 T;  5LG3 A;  2NW9 A;  4H9N C;  4DND A;  1KNP A;  4YLH A;  1FJG T;  1I94 T;  5HXS A;  2BVL A;  4HWC A;  4CI2 B;  3PUS A;  2VL8 A;  1ZV4 X;  4I4T E;  1NAF A;  3O1J A;  4CXW A;  3RQU A;  5AQV B;  1W9R A;  2VB6 A;  3N5L A;  3L39 A;  1S94 A;  1MMA A;  2CEA A;  4QHO A;  5FMN A;  2X0L B;  2NWB A;  3ZMV B;  1UX4 A;  5FKY A;  4AQF A;  1HFA A;  3NRY A;  4GIW A;  3T1Y T;  4F6R C;  3PV0 F;  2W2U A;  2X51 A;  4PK6 A;  2C5J A;  2HH7 A;  2XQA A;  4JLE A;  3NZQ A;  2XSA A;  3PE0 A;  2BG9 E;  4IT4 A;  5JQG E;  4DMW A;  3K1S A;  1D0Y A;  4TX5 A;  1WCR A;  4BAY B;  4QXB B;  4I55 E;  5DQW A;  4O2A E;  4PFP A;  5FYM A;  3FZH B;  2XM2 A;  4QX7 B;  4HFI A;  5AQH B;  3HKD E;  4KMC A;  2IIU A;  5FY0 A;  4AKL A;  4JI0 T;  3LSV A;  2D5U A;  4TWH A;  4U3C A;  2WQY A;  3R84 B;  3UU5 A;  4ERR A;  5JH7 E;  5CA1 E;  3R6N A;  1MIV A;  3AAA B;  3ZST A;  4ILU A;  2K5B B;  2LRL A;  2W00 A;  2B1E A;  2DLR A;  3E22 E;  3MA9 A;  2UXX B;  2X0Y A;  4H9Q C;  4O2B E;  3IA3 A;  4BJN A;  3AEG A;  1E1H B;  3LBX B;  3UUM A;  4GOU A;  3MZK B;  4H9O C;  4HFB A;  3GN5 B;  4EOZ B;  2AXD S;  2VUR A;  3MKD A;  4PK5 A;  2B76 A;  2X67 A;  1MMN A;  4HFD A;  2XUE A;  5FXV A;  2IUB A;  1Y01 A;  3Q5E A;  5EK4 A;  3N9L A;  4X5T A;  4JI8 T;  2LKH A;  4H9S E;  1Y64 B;  3RYF E;  5AQG B;  4HFC A;  3J7Y q;  4NXM T;  4AIS A;  2V7K A;  5LCY A;  2KWH A;  1LVK A;  4TNW A;  3EVY A;  1UK5 A;  4O4J E;  5FXW A;  3KDS E;  1KF6 A;  2CXF A;  5H6Q B;  4HE8 A;  5DJQ C;  4LF4 T;  4Z8X A;  2FJA A;  2WMN A;  4MFR A;  3BK9 A;  3S4U A;  5JDF A;  5DAB A;  3QNU A;  1BR4 A;  2E9X B;  3PU8 A;  2WU2 A;  4GYR A;  4WZX A;  4YHJ A;  1YW0 A;  2V7L A;  1FEW A;  3T8O A;  2VVS A;  2WCA A;  1BR2 A;  4QH5 A;  3IF8 B;  4UVC B;  1XDO A;  1VRB A;  2I0M A;  2WDV A;  2LOS A;  4HTE A;  4DV0 T;  3RC3 A;  4QXH B;  5AQF B;  3AEB A;  2BKO A;  5LG4 A;  3PDY A;  5GON E;  3HI2 A;  5AQS B;  3Q5W A;  2WSS V;  3E0Z A;  5JDN A;  4TWD A;  2WBL A;  1ZHC A;  2R6G F;  5L3C B;  3NVO A;  4LMK A;  2YOE A;  3C50 A;  5KX5 E;  2RA1 A;  2CBI A;  3C98 B;  2LSG A;  3AED A;  4WNK A;  3LK3 B;  4PJJ A;  3AE2 A;  5JRE A;  2OA5 A;  4PW8 A;  2YDS A;  5L47 A;  1MMD A;  5M4Y A;  2CPT A;  4X1I E;  4ZZB A;  3ZKR A;  3CX6 B;  5EZY E;  2IW5 B;  2M67 A;  4IRE A;  5FVK A;  4JV5 T;  3UT5 E;  2F4V T;  1HNW T;  1JNZ A;  2V26 A;  2K9A A;  2XQ8 A;  2UUC T;  2VQE T;  3ANW A;  4IE0 A;  4DVD A;  1NEK A;  1FIO A;  2W67 A;  2X68 A;  1U4Q A;  4EGW A;  3NWI A;  4KBM B;  1OWA A;  3KV9 A;  2YDR A;  5BMV E;  1KFY A;  4ILA A;  5ABF A;  2BKP A;  2JQH A;  5HEU A;  4I50 E;  3HR0 A;  1SHZ C;  3AVS A;  3C4X A;  3KBT A;  2IAK A;  3FZL B;  3ZLI A;  5F3J A;  4H9P C;  1M62 A;  2LLY A;  5HEG A;  3QC9 A;  3N9M A;  3FHN A;  5LXT E;  3B5M A;  2CHN A;  4JYA T;  5L3F B;  4OYJ A;  3AA1 B;  2UXD T;  1YKH B;  4IDO A;  4KHP T;  2SPC A;  4O8S A;  5TAO A;  1GQE A;  2BVM A;  2CXD A;  3WI3 A;  2XAG B;  3AE3 A;  3NZP A;  1QLB A;  3PU3 A;  3H3M A;  4PJN A;  2JRK A;  2EHO A;  3UUL A;  4HFE A;  5J1G A;  3RI5 A;  3OTO T;  3QB5 A;  2MBG A;  2E8I A;  1J5E T;  2LJL A;  3JAE A;  2W66 A;  2E9X D;  4QXC B;  4NUU A;  3DP7 A;  2H7O A;  2CLY C;  1N36 T;  2HPL A;  4Q25 A;  3A8Y C;  1N34 T;  1OED E;  2XAQ B;  3KBU A;  1AJ3 A;  4GK5 E;  3B13 A;  2VVN A;  4YSX A;  4YXD A;  4GK0 E;  3RIU A;  5HCJ A;  3ZC0 A;  5AQM B;  2KND A;  4DR1 T;  3ZJ2 A;  2NR4 A;  2A2F X;  2Y8D A;  4EV6 A;  2CLY B;  3ETV A;  5C2T A;  2V7I A;  5J2T E;  3JAF A;  2V6X A;  4TNV A;  4YJ3 E;  3M65 A;  3K3Q C;  5HXH A;  1G8X A;  3ZN1 B;  4EB6 E;  3SS1 A;  4DV1 T;  2P9B A;  3UU4 A;  4U7Y A;  2D9D A;  2XAJ B;  4DV4 T;  2IDO B;  1B7T A;  2FJD A;  3PUR A;  3AE1 A;  2YKS A;  4TUY E;  3TLU A;  2V7M A;  1HNX T;  3K3O A;  3UU8 A;  2V5C A;  4IE5 A;  4CN1 A;  3AEA A;  4PJL A;  4AI6 A;  1XNQ T;  2XAH B;  3AAE B;  4HKA A;  4QH4 A;  4DID B;  3P4S A;  3GMI A;  2FJE A;  5FY7 A;  3CQG B;  4UV8 B;  2CCQ A;  4IE7 A;  3FXD B;  4ILB A;  1IBK T;  2HN2 A;  2KXP B;  3RF1 A;  2X9X A;  3TKL B;  1UUS A;  1CHU A;  1HCI A;  3ZYL A;  2UXB T;  4U33 A;  2WU5 A;  2JQQ A;  2KT9 A;  2MPK A;  1E2A A;  2JIW A;  4YTP A;  2X9W A;  3RYC E;  3KV5 A;  2V1D B;  4DV6 T;  3MAC A;  3LG7 A;  2E5V A;  2DWG A;  2K3W A;  4XBF B;  1R8I A;  4AXP A;  4A56 A;  2CM0 A;  2OLT A;  3K8P C;  1WR6 A;  3N2O A;  4IE6 A;  3AE7 A;  2VKO A;  4EEB A;  4X65 T;  4JBW F;  4H63 H;  3P4P A;  4EZ4 A;  2XPK A;  4MHC A;  4LFC T;  4M1P A;  4U2Y A;  5LMN T;  1D1B A;  1YQ3 A;  1L0V A;  2CXL A;  4EED A;  3KVA A;  3AEF A;  5CB4 E;  4ANJ A;  2W61 A;  4QKN A;  5HCM A;  3EAB A;  4CXX A;  2NW8 A;  4XAX B;  4HWD A;  4CQI A;  2HPJ A;  4ASK A;  5EK2 A;  5AQK B;  1T8B A;  2CRB A;  2Y6X A;  3AXJ A;  2VAS A;  4J2C A;  3ESL A;  5BR8 T;  3LBX A;  4HFH A;  2J1D G;  3VKG A;  1BR1 A;  1M7K A;  3GN5 A;  2D0T A;  2JJ9 A;  2XZE A;  3PUY F;  3J9X 1;  3H37 A;  4AKH A;  3ONL C;  2D2S A;  3QB5 K;  4DMV A;  3C4W A;  3X1D A;  3LK2 B;  5KMG P;  4C91 A;  4PFO A;  4E7Z A;  4JI4 T;  2KWI B;  2KZ7 B;  4IST A;  5CFB A;  3VHL A;  4DUZ T;  4LF7 T;  3P4R A;  4YJ2 E;  2BS3 A;  3RRC A;  4O4I E;  5E0O A;  3AEE A;  3BQL A;  4TV8 E;  5L3E B;  4WBO A;  1XNR T;  3UQ7 A;  4KHZ F;  3L8R A;  3NBX X;  3VRB A;  4GKJ T;  5J0Z A;  5L4E A;  2GK9 A;  3AXJ B;  3PUA A;  3UUX B;  5FY1 A;  5HXR A;  4IL9 A;  1XMQ T;  4ILC A;  3LFM A;  4MLK A;  4YTN A;  2L3L A;  1U5P A;  2QA7 A;  2IC6 A;  4UEM A;  4JUY A;  3ZCI A;  5AQQ B;  3WAK A;  1MMG A;  4ZHQ E;  2J4G A;  3CX8 B;  1HX8 A;  2E9X A;  4X62 T;  2PTF A;  1W0A A;  4PK4 A;  3JC6 D;  3EDU A;  4OYK A;  4CZZ B;  4K0K T;  1O3X A;  2XTL A;  2XY8 B;  2DI4 A;  4ISS A;  2A9U A;  1W09 A;  2C0S A;  2XM1 A;  3ONJ A;  2WDQ A;  4JI7 T;  3I1A A;  2DHR A;  1VOM A;  3W15 B;  4YSZ A;  4ZI3 D;  2E9X C;  2PJQ A;  4IGU A;  4AKI A;  4AIU A;  5HEJ A;  3AB3 B;  5HEH A;  2X9H A;  2RPA A;  4DV7 T;  2CBJ A;  2YN6 A;  4I0U A;  5L4H A;  1XZY A;  2VKJ A;  3C64 A;  5LA6 E;  1LVF A;  3L09 A;  3RLF F;  2KLQ A;  4B6X A;  1CUN A;  4DBQ A;  4H63 V;  3ZJ1 A;  4BJM A;  2ZMA A;  2V5D A;  4JEU B;  2X0H A;  4HWI B;  5A1L A;  1FMW A;  2BG9 A;  4YFS A;  1KNR A;  1HG2 A;  3C51 A;  5FVL A;  5F8P A;  1LRZ A;  3CWZ B;  2UUA T;  4LF9 T;  1FMV A;  2XQ5 A;  4OFZ A;  4P0A A;  2CWY A;  2E5L T;  3SFE A;  3UFE A;  3HKB E;  3F57 A;  2VQF T;  2UU9 T;  2BG9 C;  3DTO A;  2BZB A;  4JEH B;  5HAX A;  3EAM A;  1G73 A;  3TLW A;  4OHF A;  2XQY A;  2LHR A;  3AA7 B;  3PJA J;  4YY3 T;  1UX5 A;  1NEN A;  4DR2 T;  3A7M A;  1WRD A;  1E7P A;  2WDR A;  2BG9 B;  3OYZ A;  3AE9 A;  3CK6 A;  4DBR A;  3OVU A;  3F2E A;  2J47 A;  2BDE A;  3ONX A;  5JRC A;  4IIJ E;  4KX6 A;  2Q9Q B;  1T98 A;  4HN9 A;  2YIN A;  5LYJ E;  4ZI2 D;  2C5K T;  3UUB A;  3ZMS B;  3RYH E;  2ZM8 A;  3OYX A;  5LHH B;  2BKN A;  3UU6 A;  2LSY A;  3TLV A;  4EAH A;  2CA5 A;  3N9O A;  2BBJ A;  5ABG A;  4HWF A;  3LK4 2;  2Z6E A;  4LFB T;  3MJX A;  2DL1 A;  1HS7 A;  4NXN T;  4EYY R;  3OJA A;  2H3R A;  4CXY A;  4DV2 T;  4YT0 A;  5J2U E;  4LMJ A;  2N9D A;  5JRC B;  4A98 A;  2YU1 A;  5AQN B;  3RH3 A;  3UUN A;  2LKG A;  3TLT A;  2BS4 A;  4LF8 T;  3P4Q A;  2LM2 A;  3EI0 A;  2YEV C;  2LT3 A;  1IZN B;  4ZS2 A;  3P4W A;  3ZSS A;  2PG8 A;  4KP3 C;  1S35 A;  5LBM A;  4KUM B;  3WAJ A;  2HHH T;  3I9W A;  3CQX C;  1MND A;  1W0B A;  3ZEF B;  4CN6 A;  2XAS B;  2L9Q A;  4H9R C;  5KXJ A;  4X1Y E;  5LJN A;  3T1H T;  4X66 T;  2H88 A;  3GA8 A;  3LDQ B;  4DUY T;  5LNK A;  1YKE B;  4P09 A;  1SUM B;  4JI5 T;  2W63 A;  5ADX L;  1YD8 G;  3FXE B;  2VKD A;  3V5U A;  5IYZ E;  5IHY A;  3RIA A;  5C8Y E;  1HR0 T;  3O4X E;  1IBM T;  3UTK A;  3D0T A;  2IML A;  2JQ9 A;  5JDG A;  4AQG A;  1UCU A;  4DV3 T;  2ACZ A;  3RYI E;  2CE7 A;  3P8C D;  4AQY T;  5AQL B;  3AA0 B;  4EYU A;  1SA0 E;  5LOV E;  3M3Z B;  2XQ7 A;  2QGS A;  3RIF A;  2ODV A;  3L3P A;  3RQW A;  4JI6 T;  2QRX A;  2M6I A;  3N9N A;  3B57 A;  2DWK A;  2WM9 A;  2A72 A;  2H89 A;  4U2Z A;  1I6Z A;  3FBL A;  2NOX A;  5AQU B;  5AQJ B;  2MYS A;  2LM9 A;  3JC6 C;  2H7V C;  1HF8 A;  4QH1 A;  4AKG A;  3Q2M A;  5L3G B;  3QUJ A;  2Q9Q D;  5LP6 E;  2CWO A;  2ODU A;  1ZP0 A;  2BBH A;  3LJC A;  4ZI3 C;  4B3S T;  3QOF A;  4MAL A;  4COF A;  2E2A A;  2XQ6 A;  3PUV F;  4WYV A;  2LSK A;  1D1A A;  1T7S A;  3VR9 A;  2I59 A;  5DQV A;  1QSD A;  1JNR A;  1X9B A;  3SWH A;  1HG5 A;  5LMU T;  2YDQ A;  3CPZ A;  1ZOY A;  5ETW A;  5L2L A;  2KIN B;  3AE4 A;  4L9I A;  5HWX A;  2XQ9 A;  3CIR A; 
#chains in the Genus database with same CATH homology
 3PUA A;  5LG4 A;  3PDY A;  1D1C A;  5GON E;  3UUX B;  3HI2 A;  5FY1 A;  5HXR A;  3Q5W A;  2WSS V;  3E0Z A;  4ZS3 A;  5JDN A;  2WBL A;  3LFM A;  1ZHC A;  2G0U A;  2JMK A;  4MLK A;  3KV4 A;  3H3A A;  5L3C B;  2L3L A;  1U5P A;  1MNE A;  3RPU A;  3C50 A;  3KVB A;  2QA7 A;  2IC6 A;  4UEM A;  4JUY A;  5KX5 E;  3ZCI A;  1KK7 A;  4OK0 A;  3WAK A;  1MMG A;  1WYB A;  2LSI A;  4ZHQ E;  3E08 A;  2NTY A;  2RA1 A;  3VU7 H;  3C98 B;  2LSG A;  3CX8 B;  3CML A;  2V7J A;  4WNK A;  3LK3 B;  4PJJ A;  4GYS A;  5JRE A;  1IJ6 A;  2OA5 A;  4PW8 A;  3IHR A;  5LJM A;  1HX8 A;  2E9X A;  3N2G E;  3NRX A;  4FJO A;  2XHE B;  1MMD A;  3AAI A;  5JDH A;  4K0U A;  2Y48 B;  5M4Y A;  4TN7 B;  4HEA A;  4PK4 A;  3JC6 D;  3EDU A;  4OYK A;  4X1I E;  1X79 A;  3PUG A;  4CZZ B;  3C4Z A;  3AA6 B;  1O3X A;  4BA9 A;  2XTL A;  5JDL A;  2DI4 A;  4ISS A;  3CX6 B;  5EZY E;  2IW5 B;  2M67 A;  3K3N A;  4EIW A;  1MIW A;  2C0S A;  3UT5 E;  5LGN B;  2JPF A;  2EHO C;  2V26 A;  2K9A A;  3ZN0 B;  3CX7 B;  3I1A A;  2DHR A;  3OBV E;  3PUQ A;  1VOM A;  1KNZ A;  3VKH A;  3ANW A;  3Q5X A;  3W15 B;  4IE0 A;  3BQK A;  1IAP A;  4IDZ A;  2N2N A;  3V5S A;  4ZI3 D;  2E9X C;  2PJQ A;  4IGU A;  4DVD A;  4AKI A;  2ZM2 A;  1FIO A;  3AB3 B;  5L3D B;  2X9H A;  3MXZ A;  2X68 A;  5AFU L;  2LSJ A;  3HA4 A;  1U4Q A;  2WWU A;  1Z0P A;  3ZMU B;  3I0Q A;  3OKQ A;  4CI3 B;  1ZKE A;  2VKJ A;  4UIG A;  4KBM B;  4X1K E;  3C64 A;  1OWA A;  5LGT B;  3KV9 A;  5LA6 E;  1LVF A;  3AVR A;  1D0Z A;  2W0G A;  2WMO A;  3L09 A;  3O1H A;  5BMV E;  2KLQ A;  2EHO B;  2NW7 A;  1CUN A;  4B6X A;  3KIN B;  4DBQ A;  3KFW X;  5JDM A;  4H63 V;  4ZI2 C;  3ZJ1 A;  5KDM C;  4X20 E;  4BJM A;  3ZMZ B;  2ZMA A;  4O4L E;  4AQF C;  4JEU B;  4I50 E;  1BR0 A;  4CI1 B;  3HR0 A;  5A1L A;  1FMW A;  2KMF A;  5LGU B;  1SHZ C;  3HKE E;  4U74 A;  4YFS A;  1HG2 A;  3AVS A;  1HTJ F;  3C4X A;  3C51 A;  5JDQ A;  3KBT A;  2IAK A;  3EDV A;  4QX8 B;  3SRZ A;  3ZLI A;  4WBN E;  5F8P A;  5F3J A;  1LRZ A;  5FXX A;  3CWZ B;  3QK6 A;  1H7C A;  4H9P C;  1NWM X;  1FMV A;  2D0U A;  4HFV A;  2MOZ A;  2NTX A;  3FB2 A;  2WAU A;  4OFZ A;  3KV6 A;  4EZH A;  4P0A A;  2CWY A;  3U78 A;  4N78 D;  3QC9 A;  3N9M A;  3FHN A;  3A5X A;  1WLX A;  3UFE A;  4ZOL E;  5LXT E;  2W62 A;  3EUH A;  3HKB E;  5L3F B;  4OYJ A;  3AA1 B;  3F57 A;  1YKH B;  3IBP A;  5HWY A;  2SPC A;  3DTO A;  4UVA B;  4O8S A;  3ZMT B;  3RC8 A;  4O4H E;  2BZB A;  4JEH B;  2ZLY A;  5TAO A;  5HAX A;  4UV9 B;  2BVM A;  2CXD A;  5L3B B;  1V9D A;  3WI3 A;  1G73 A;  5HYA A;  2XAG B;  4OHF A;  5HXC A;  2K48 A;  1WYC A;  2XQY A;  3NZP A;  3RRW A;  3PU3 A;  4PJN A;  2LHR A;  3AA7 B;  5EK3 A;  4ADZ A;  2JRK A;  4EXT A;  2EHO A;  3UUL A;  2EHO D;  5J1G A;  2NW9 A;  1UX5 A;  5LBQ B;  4H9N C;  4DND A;  2MBG A;  2E8I A;  2LJL A;  4YLH A;  5FP3 A;  1WRD A;  3ZC1 A;  1US7 B;  2E9X D;  3OYZ A;  2UXN B;  5HXS A;  4QXC B;  4NUU A;  3DP7 A;  2BVL A;  4DBR A;  2H7O A;  3F2E A;  2BDE A;  3ONX A;  5LHG B;  2CLY C;  4CI2 B;  3PUS A;  5JRC A;  2VL8 A;  2HPL A;  1ZV4 X;  4I4T E;  3P7I A;  4IIJ E;  1NAF A;  3O1J A;  4CXW A;  2L8K A;  2VB6 A;  2XAQ B;  2LHN A;  3KBU A;  2Q9Q B;  1T98 A;  2YK0 A;  3N5L A;  4HN9 A;  1AJ3 A;  4GK5 E;  1QUU A;  2VKH A;  5CA0 E;  3B13 A;  1S94 A;  1MMA A;  2YIN A;  2CEA A;  4QHO A;  5LYJ E;  4GK0 E;  2C5K T;  4ZI2 D;  3ZMS B;  5FMN A;  4L0R A;  2X0L B;  2PBI A;  5H6R B;  2NWB A;  3RYH E;  3ZCJ A;  2ZM8 A;  3ZMV B;  3ZC0 A;  3OYX A;  5LHH B;  1UX4 A;  4V1A v;  4AQF A;  2LSY A;  1HFA A;  2KND A;  3NRY A;  4GIW A;  3ZJ2 A;  3IEE A;  4EAH A;  2A2F X;  2Y8D A;  4F6R C;  3RX6 A;  2ZM0 A;  2CLY B;  3ZPO A;  3ETV A;  2V7I A;  5J2T E;  3I0O A;  2CA5 A;  2N1G A;  5HXE A;  3N9O A;  2X51 A;  4PK6 A;  4YJ3 E;  2C5J A;  3M65 A;  2HH7 A;  3K3Q C;  3ZYM A;  5HXH A;  1G8X A;  4JLE A;  3NZQ A;  3ZN1 B;  3LK4 2;  2YU2 A;  2Z6E A;  4EB6 E;  2DCF A;  3MJX A;  3SS1 A;  3PE0 A;  1HS7 A;  2P9B A;  5JQG E;  3HKC E;  4DMW A;  1D0Y A;  4TX5 A;  4TZ4 C;  4EYY R;  4BAY B;  4QXB B;  4I55 E;  2XAJ B;  5JR9 A;  3OJA A;  5DQW A;  4O2A E;  2H3R A;  4CXY A;  1B7T A;  4PFP A;  5FYM A;  4UXN B;  3PUR A;  4QX7 B;  4IHJ E;  4TUY E;  5J2U E;  2LEH A;  1LKX A;  2N9D A;  3ZYK A;  5JRC B;  2YU1 A;  2LOP A;  3HKD E;  3GWH A;  3RH3 A;  4KMC A;  3UUN A;  2V7M A;  5FY0 A;  4AKL A;  3K3O A;  1IJ5 A;  2D5U A;  1ZEE A;  4UF0 A;  4IE5 A;  2XAF B;  2YEV C;  3SOL A;  2LT3 A;  2Q9Q A;  1IZN B;  4ZS2 A;  2PG8 A;  4KP3 C;  1S35 A;  5LBM A;  3R84 B;  4KUM B;  3WAJ A;  4L5G A;  4C90 A;  4PJL A;  4AI6 A;  3I9W A;  2LE8 A;  2XAH B;  3AAE B;  3CQX C;  4HKA A;  4ERR A;  3GMI A;  5JH7 E;  1MND A;  5JR9 C;  3HL6 A;  5FY7 A;  4MBQ A;  5CA1 E;  4PJM A;  3R6N A;  3CQG B;  3ZEF B;  2XAS B;  1MIV A;  2L9Q A;  3AAA B;  4H9R C;  4UV8 B;  4ILU A;  2K5B B;  2K24 A;  2CCQ A;  4X1Y E;  4IE7 A;  2W00 A;  4UVB B;  5LJN A;  3FXD B;  4PAG A;  4AKR B;  3GA8 A;  2KXP B;  5LNK A;  1YKE B;  2X9X A;  3TKL B;  4P09 A;  2B1E A;  1HCI A;  2JMH A;  3ZYL A;  3N2K E;  2X66 A;  2DLR A;  2JQQ A;  2Q9Q C;  2KT9 A;  3E22 E;  4IE4 A;  3MA9 A;  2UXX B;  2W63 A;  4H9Q C;  4O2B E;  5ADX L;  3ETU A;  4BJN A;  5JR9 B;  1YD8 G;  2X9W A;  3RYC E;  3FXE B;  1E1H B;  2VKD A;  3KV5 A;  4G2A A;  3LBX B;  3N9Q A;  3V5U A;  3MK7 C;  3UUM A;  3BQI A;  2V1D B;  4NUV A;  4GOU A;  5IYZ E;  3MZK B;  4H9O C;  5IHY A;  3GN5 B;  5C8Y E;  4EOZ B;  4P0B A;  3O4X E;  3MAC A;  3MKD A;  4PK5 A;  3LG7 A;  3Q9D A;  3UTK A;  2DWG A;  3D0T A;  2X9Y A;  4WW0 A;  5JDG A;  2X67 A;  4XBF B;  1MMN A;  2XUE A;  5FXV A;  4AXP A;  4AQG A;  5FNV E;  4PNI A;  4UF0 B;  4A56 A;  2MTQ A;  1UCU A;  2CM0 A;  3K8P C;  2CMR A;  2RP4 A;  1WR6 A;  3N2O A;  5EK4 A;  3N9L A;  4IE6 A;  3I9Y A;  3RYI E;  2VKO A;  2CE7 A;  4U72 A;  4H9S E;  1Y64 B;  2DNX A;  3RYF E;  3P8C D;  4H63 H;  3AA0 B;  4EYU A;  1SA0 E;  3J7Y q;  3U3I A;  4EZ4 A;  2V7K A;  5LCY A;  4MHC A;  5LOV E;  2A3D A;  4M1P A;  1D1B A;  3RKO A;  2KWH A;  2QGS A;  2CXL A;  1LVK A;  2ODV A;  3L3P A;  2C5I T;  4DO0 A;  3KVA A;  3F31 A;  3N9N A;  3B57 A;  3EVY A;  2DWK A;  4QWN B;  2WM9 A;  5CB4 E;  4ANJ A;  2W61 A;  2A72 A;  4O4J E;  4ZI7 E;  4QKN A;  3FBL A;  5FXW A;  3KDS E;  2ACX A;  2NOX A;  4CXX A;  2NW8 A;  4XAX B;  5LHI B;  3CKD A;  4CQI A;  4HGA A;  2HPJ A;  4ASK A;  1MIY A;  4XZC A;  5EK2 A;  2IC9 A;  2Y6X A;  2CXF A;  5H6Q B;  2VAS A;  2MYS A;  3ESL A;  4J2C A;  3N9P A;  2LM9 A;  3LBX A;  3JC6 C;  4HE8 A;  2J1D G;  3VKG A;  1BR1 A;  2H7V C;  3GN5 A;  2D0T A;  2JJ9 A;  1HF8 A;  5DJQ C;  4AKG A;  3J9X 1;  3H37 A;  4Z8X A;  4G63 A;  4AKH A;  2WMN A;  3Q2M A;  3BK9 A;  4MFR A;  3S4U A;  4E7S A;  5JDF A;  5L3G B;  5DAB A;  1BR4 A;  2D2S A;  2E9X B;  3PU8 A;  3C4W A;  3QUJ A;  2Q9Q D;  4DMV A;  3CVR A;  2CWO A;  5LP6 E;  3LK2 B;  2ODU A;  4GYR A;  3PTR B;  3LJC A;  4FI5 A;  4ZI3 C;  5KMG P;  4C91 A;  4PFO A;  4E7Z A;  5FXZ A;  4MAL A;  2KWI B;  2KZ7 B;  4IST A;  4YHJ A;  1OXZ A;  3VHL A;  1D0X A;  1YW0 A;  2V7L A;  2LSK A;  1D1A A;  2ES0 A;  3O1I A;  3RRC A;  4YJ2 E;  2PFV A;  3O9X A;  4TV9 E;  1FEW A;  3T8O A;  4O4I E;  5E0O A;  2I59 A;  3BQL A;  1BR2 A;  4TV8 E;  5DQV A;  3FBZ A;  3IF8 B;  5L3E B;  4UVC B;  4WBO A;  1VRB A;  1EZ3 A;  1QSD A;  2LOS A;  4HTE A;  3SWH A;  2NP9 A;  1HG5 A;  3ANW B;  3NBX X;  3CPZ A;  3CQC B;  2VWA A;  5ETW A;  5L2L A;  2KIN B;  4L9I A;  5HWX A;  3RC3 A;  4UEL A;  2VK9 A;  4QXH B;  5JVD E;  2GK9 A;  3DJB A;  4I43 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...