1W9RA

Solution structure of choline binding protein a, domain r2, the major adhesin of streptococcus pneumoniae
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
119
structure length
119
Chain Sequence
GSHMPEKKVAEAEKKVEEAKKKAEDQKEEDRRNYPTNTYKTLELEIAESDVEVKKAELELVKEEAKEPRNEEKVKQAKAEVESKKAEATRLEKIKTDRKKAEEEAKRKAAEEDKVKEKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution Structure of Choline Binding Protein A, the Major Adhesin of Streptococcus Pneumoniae
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Receptor
molecule keywords CHOLINE BINDING PROTEIN A
total genus 47
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2004-10-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.440 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 choline binding protein A 1w9rA00
1W9RA
chains in the Genus database with same CATH superfamily
3ZPOA 5HWXA 4M1PA 4TNVA 2W67A 2K5BB 3RRCA 3ZC1A 4YTNA 2EHOA 2CWOA 2VVNA 4X66T 3C4WA 1DU2A 4HFEA 3AAEB 3PV0F 3RIUC 5LJMA 3KV6A 3HA4A 3FZKB 3AE8A 3ANWA 2Q9QC 4AKHA 3N9NA 1WCRA 4LFCT 1D0YA 1H7CA 2D5UA 4UELA 5AQJB 4H9OC 4EIWA 1G8XA 3HKEE 5A1LA 4DV1T 4PAGA 4QHOA 4JI7T 1KFYA 3FHNA 4XBFB 4AISA 2KLQA 2N2NA 3P4PA 5HAXA 3AAIA 4PJNA 1N32T 5J2UE 3GN5A 4NUUA 2CPTA 1M7KA 2BG9B 3OYZA 1WRDA 2N9DA 2J4GA 5F3JA 5AQTB 3F2EA 2J47A 4AQYT 2ODUA 3R84B 1YW0A 1YQ4A 3SS1A 3R6NA 4JEHB 1LVFA 2Q9QA 4JYAT 2YDSA 5AFUL 2XUEA 5FP3A 4WNKA 3TLTA 4TWFA 4LF8T 4LF9T 4PJMA 4TV9E 4LMLA 3LJCA 3ETUA 2X9YA 5CFBA 4GK0E 2OA5A 2LOPA 3P50A 5AQNB 5LMNT 4IL9A 3RH3A 3JC6D 4HGAA 3FZLB 3KVBA 4XZCA 1FMVA 1WFDA 4YSXA 5FY7A 2LRLA 2XASB 2V6YA 2CWYA 3ESLA 1J5WA 2LEHA 5TAOA 3RHWA 2YKSA 2E9XC 1Y64B 4O2AE 3RC8A 1JNZA 1WYCA 1BR1A 2DL1A 3IF8B 4CN6A 3HI2A 2P9BA 2DLRA 2PJQA 2QA7A 3PUGA 4TNWA 3FZMB 2I6HA 2SPCA 4JUYA 3KVAA 3UU8A 4ANJA 5JDGA 4JI8T 4UF0B 2DNXA 3ZKRA 1GQEA 4LFBT 4GK5E 2IUBA 1ZV4X 3OVUA 5L3BB 3VR9A 1VCTA 3N9MA 1KNRA 1SE7A 2NTXA 2XQ6A 4E7SA 4ZI3D 2PG8A 4IDNA 3IA3A 4CXXA 3TLWA 4HFDA 3CK6A 3NZPA 4L5GA 3L09A 3PU3A 2NTYA 1WR6A 1YKEB 4Z90A 1XMQT 4MHCA 4IT4A 2JMKA 2JQ9A 2Y8DA 4UIGA 2FUPA 2LM9A 2YDQA 1UX4A 3B57A 3P4QA 2UXBT 2V7IA 4QX8B 1MIYA 3DP7A 5L4HA 2WQYA 3ZYLA 5CA0E 4JLEA 4CN1A 4KP3C 4DVDA 3GA8A 3RKGA 2K24A 2WBLA 2AE9A 2WP9A 3U3IA 4ADZA 4CN4A 4GKJT 4YLHA 3N9PA 4FJOA 3VHLA 3C4XA 4EZ4A 1VCSA 2A9UA 3C64A 3RIUA 2MYSA 3UU4A 2XM1A 2V7MA 2VK9A 2WMOA 3T1HT 1R8IA 2NOXA 2IIUA 3MK7C 4PK5A 5E0OA 4ILAA 5LOVE 4QXBB 5FKYA 3K3OA 2WWVA 2A3DA 4O4JE 5C8YE 5AQLB 5HXSA 1HNZT 4LF6T 2KSRA 2CE7A 1FJGT 3AA0B 3RPUA 2HPLA 2FJBA 3QK6A 2L8KA 3O1HA 3GMIA 2JMHA 4BAYB 2KNDA 2V26A 2W2UA 3JAFA 4UXNB 3KINB 5ETWA 5JR9B 4YHHT 5KXJA 5HXEA 3L8RA 3AE7A 2E5LT 4BJNA 2X51A 4GKKT 5F8PA 1XWMA 3T8OA 3KV9A 3EABA 3QOFA 3CQCB 4BJMA 5HEHA 1OEDA 1MNEA 2EHOB 1NAFA 2K48A 4HFBA 4X1KE 3SFEA 1HG2A 3H3AA 2ACXA 4EXTA 4O4HE 5L4EA 3LFMA 4WZXA 5EK3A 5ABEA 1W09A 1LKXA 5LBMA 4Z91A 2E8IA 3RKOA 3CQGB 2QGSA 4YXDA 2WCAA 1Z8UA 4YSZA 2IW5B 1CHUA 2YOEA 3OPCA 2IC6A 4JV5T 4LFAT 2FJDA 2ZM6T 4EOZB 2IC9A 3SOLA 5AQGB 2V7KA 3PUZF 3RIAA 3AEGA 1T7SA 5AQPB 4DR7T 2BDEA 4UEMA 3ZEFB 3KBTA 5LJNA 1HR0T 1NWMX 2Q9QD 2W4XA 3CX7B 4I50E 4AQFA 2BG9A 2WZHA 4UF0A 3E22E 2WM9A 2UXXB 1QUUA 4HFHA 2JJ9A 1T72A 3P8CD 3Q9DA 5FY0A 5LGTB 2X66A 4EB6E 5IHYA 4HE8A 5LP6E 2GK9A 2WY2A 2LJLA 2XQYA 3CQXC 1KF6A 3TLVA 4I55E 3FXEB 3ZC0A 1HNWT 2XPKA 2XQ3A 3CIRA 3VRAA 4U2YA 4IL4A 3ZJ1A 5JDHA 3ZMVB 4YTMA 2HHHT 3IBPA 4JI4T 4G2AA 2X9HA 2CRBA 1L0VA 3EUHA 3J9X1 4AXPA 2IMLA 3FBZA 3LK42 4TN7B 2LRKA 1HF8A 2XY8B 3TKLB 3RYHE 2XQ8A 3UULA 3PUAA 4P09A 3FZHB 5L3FB 3AE2A 4IDQA 1ZOYA 3EAMA 3RC3A 4DMVA 2Q9QB 4DV6T 4XAXB 4MFRA 3CX8B 4WYVA 2VKDA 1X79A 2W62A 2UU9T 3CPZA 2VURA 4TV8E 3Q5XA 3AA1B 3ZJ2A 4DV7T 3UTKA 3ZMTB 5BR8T 4B3ST 1HFAA 2WZIA 3V5SA 5AQSB 5JDNA 4P0BA 2X0HA 2X67A 3UFGA 3UU3A 3RI5A 3NWIA 2H3RA 3AB3B 2PFVA 2ACZA 3M3ZB 5JR9A 4ASKA 1WR0A 1MMNA 1EZ3A 2N1GA 3K1SA 5AQMB 4OYJA 2XJ7A 3B5MA 4ILUA 4O2BE 3ZMSB 3EDUA 4IE6A 3LK3B 4C90A 5HEJA 1D0XA 2DCFA 4K0KT 2VQET 2I0MA 2E9XD 4OHFA 3ZN1B 4QKNA 1XNQT 2XQ5A 4DBQA 5HXHA 3QC9A 2LKHA 4CZZB 3MA9A 3PDYA 4H9NC 5JDMA 4ZHQE 2LM2A 2HN1A 3I0OA 5L3GB 5AQFB 2JQKA 3M65A 5JR9C 1YQ3A 2X9XA 4ZZBA 4CXYA 3AE6A 2V5CA 5IWAT 3ONXA 3ZCJA 2FJAA 3KDSE 3ZCIA 3FB2A 2VKHA 3MACA 4ZEYA 2L9QA 5LYJE 2XAHB 1NENA 2BKOA 4A98A 3ETVA 3N9OA 3OKQA 3O9XA 2PTFA 3G06A 4COFA 2W63A 2XHEB 2KXPB 5FVLA 4MALA 1US7B 3L3PA 1U5PA 3I1AA 3NKZA 4EEDA 2M6IA 1ZEEA 4DO0A 4EEBA 1I6ZA 3OTOT 4KI0F 5KX5E 4BA9A 1E1HB 4HFCA 4I4TE 4CQIA 3AEAA 4AIUA 3N9QA 4ZI2D 2FBWA 5AQOB 3O4XE 2K3WA 2XAJB 4ERRA 4IREA 4UVBB 4KHZF 5HXRA 4B3TT 4P1NA 3TLUA 1UGOA 3F57A 1AJ3A 4A97A 4YHJA 4EAHA 4EZHA 1IAPA 2QRXA 1LVKA 1N36T 5LBQB 3HL6A 4PJJA 4F6RC 5L3EB 3OBVE 4J2CA 5AQUB 2E9XA 2CEAA 2BZBA 1WLXA 2AXDS 2WMNA 2WS3A 4IHJE 3UT5E 4YJ2E 5DQVA 4QWNB 1HTJF 2W61A 4CI2B 3QB5K 2CLYB 2UXNB 2BVLA 2CXLA 3JCFA 1IJ6A 3N2KE 2RA1A 4U3CA 2LSJA 2LSYA 2ZM0A 4UV9B 3VRBA 4ZZCA 5HYAA 3AA7B 2HH7A 1HS7A 1FEWA 3GWHA 3LK2B 3N5LA 2CLYC 3I0QA 5J1GA 3UUXB 1OWAA 2W0GA 4O4LE 3K3QC 3RRWA 1Z0PA 3LSVA 2UXDT 4GYSA 4UV8B 3AE5A 1BR2A 3AE4A 1MIVA 1SHZC 1UURA 2PBIA 2VL0A 3A5XA 4AQGA 4ZI7E 3UFEA 4HN9A 2WWUA 3HKBE 3I9YA 3AVRA 2Z6EA 1OEDE 5EK4A 3RF1A 3ZT5A 5CGMA 5KMGP 2LLYA 3RQUA 2V7JA 4IE0A 3J7Yq 1ZHCA 2XQAA 3Q2MA 2DWKA 5ADXL 2XAGB 2CBJA 2XAQB 5LNKA 4DV4T 2F4VT 5IUXA 5LXTE 3EHZA 1D1AA 4U2ZA 5LG4A 2H89A 4ISTA 2RP4A 4JI0T 3PUWF 3SWHA 3PURA 1J1JA 1B7TA 2MPKA 3CX6B 2W66A 4DNDA 3QUJA 4V1Av 5AQKB 2WB5A 1VRBA 4EYUA 3AEFA 2KMFA 3C50A 2HN2A 1YXRA 4P0AA 4DUYT 3SRZA 2D9DA 3FBLA 1T98A 3AA6B 3AEEA 3E0ZA 3BQIA 5FMNA 5FYMA 3AEBA 3PUSA 4DBRA 4QXCB 2YINA 2BG9C 1W0BA 2WU2A 2XAFB 4KUMB 3PUVF 4JBWF 3DJBA 5JRCA 1T8BA 5FY1A 3I9WA 4QXHB 3ZN0B 3PUQA 1XZYA 2DWGA 2CHNA 2LT3A 2V8SV 2BS4A 4YY3T 1XMOT 3ZYKA 3PJAJ 4U74A 4IE4A 5ABFA 3AECA 4TZ4C 4DR1T 4DV0T 3VKHA 2VB6A 2JQQA 2CMRA 5LHGB 1D1BA 2V6XA 5JDFA 2K9AA 4GYRA 4OFZA 5LCYA 3MJXA 5H6RB 2I59A 3P4WA 4KHPT 2EHOD 4ZI2C 4AKGA 2BBJA 1XDOA 2EHOC 2X68A 2KZ7B 2MTQA 4ZOLE 5DJQC 1HNXT 3F31A 4CI3B 3HKDE 5LMUT 1UX5A 2DI4A 2YU1A 4HKAA 3VKGA 5HWYA 2JQHA 2LHNA 4QX7B 3RGLA 1G73A 1D0ZA 3AE3A 2C5KT 3LBXB 3ZMZB 1ZKEA 1KNPA 5EZYE 4X1YE 4YTPA 2XM2A 5FL0A 3BQLA 2YU2A 5L3DB 3HR0A 4NXMT 2D0TA 2LKGA 2LSKA 3LDQB 1MNDA 4K0UA 3K8PC 3NRYA 4NXNT 1QLBA 3L39A 4PNIA 2HPJA 4HWDA 3UU6A 4YSYA 4IDPA 4QH1A 5JTGA 4PFOA 5J0ZA 2L3LA 4DR6T 4YT0A 2MOZA 2WSSV 4PK6A 4JI2T 1SUMB 4CXWA 2JRKA 5FVKA 2LSIA 3C4ZA 2J1DG 3ONLC 3TLSA 5ABHA 4H9SE 2BVMA 2JPFA 4DIDB 5CA1E 3QNUA 5FXZA 1FIOA 4EYYR 4H63V 4KBMB 2C5JA 5AQQB 2WDRA 3PJAA 4IE7A 1V9DA 1WYBA 2YK0A 3ABVA 4MBQA 4O4IE 3AXJB 3UUNA 4AI6A 3KFWX 3O1IA 2WDVA 3RYCE 5JRCB 4KX6A 4UVCB 2VL8A 4U7IA 2IDOB 4PJLA 2CM0A 4FI5A 2C0SA 3T1YT 4LF4T 3WAJA 1M62A 2BKNA 2W00A 1YKHB 2X0YA 4A56A 5LHHB 2A2FX 3UU5A 2NW8A 4ILBA 1IBMT 1IJ5A 2LE8A 2VKOA 3AVSA 4X64T 2XTLA 5DABA 4PK4A 3KV4A 2NR4A 5C2TA 2B76A 5HEOA 2V5DA 5HEGA 5FXXA 5CJ5A 2H7VC 3IHRA 4DV3T 2B1EA 2UXCT 4EV6A 1KNZA 1IZNB 2WDQA 2UUAT 2XQ7A 5LG3A 4H9QC 5LB7B 4DUZT 2E9XB 4UR9A 5LA6E 3P4SA 5JQGE 1XNRT 3LBXA 1KK7A 3ZLIA 3RQWA 2OV9A 1U4QA 1CUNA 2CXDA 3NRXA 4U72A 3MKDA 4ZXLA 4U7YA 4HWIB 4WW0A 2DHRA 1MIWA 2WAUA 2KWIB 3DTOA 3Q5DA 1S35A 2M6BA 1MMAA 3U78A 3ZT7A 4F8HA 2VQFT 2WU5A 4DV5T 3PE0A 3C51A 2KINB 2ODVA 4O8SA 2ZLYA 4ZI3C 4HWHA 4LF5T 4X1IE 4AKIA 4HFIA 1HX8A 4H63H 3AE9A 5HCMA 4ILCA 3ZSTA 4MLKA 4HFVA 3O1JA 4QH5A 3VU7H 5J2TE 2XSAA 3SFDA 1N33T 2NP9A 5L3CB 3LG7A 1D1CA 3B13A 2R6GF 3ONJA 1I94T 2V1DB 4UVAB 4G63A 5FNVE 4NIQA 4TWDA 3RX6A 4E7ZA 2BKPA 1NEKA 4HWCA 1HG5A 4H9RC 4WBNE 2KWHA 4HTEA 5HXCA 4JI5T 4DR2T 4ISSA 1E7PA 1QSDA 2VWAA 3A7MA 2E5VA 2Y48B 4B6XA 4GIWA 4B3MT 4X62T 4JI6T 5EK2A 3PTRB 4I0UA 3CMLA 4IDOA 4NPPA 4DV2T 1SA0E 3BK9A 3JC6C 3S4UA 4B3RT 4GOUA 2ZM8A 1HX1B 5FXVA 3ZMUB 4Q25A 1ZP0A 3N9LA 4IGUA 2NWBA 2VKJA 5FXWA 3JADA 3N2GE 2UUCT 4U31A 4IE5A 2A72A 2CA5A 1KEYA 5HCJA 2VASA 2LSGA 1XDPA 2V7LA 3WAKA 3MZKB 1OEDC 2CCQA 3WI3A 1YD8G 2BS2A 1HCIA 2YDRA 2G0UA 4IDZA 2YEVC 3EI0A 3AE1A 3OYXA 2LOSA 3PU8A 4X5TA 5BMVE 4YJ3E 4X65T 4AKLA 4IIJE 3ZSSA 3ZYMA 3ZT6A 4L9IA 5H6QB 1IBLT 4HWFA 4LMJA 2J62A 4KMCA 5ABFB 2ZM2A 5JDQA 1FMWA 3RYIE 1UCUA 1X9BA 3UUBA 4AKRB 3H37A 5FL1A 3K3NA 2CHOA 4N78D 5F5WA 5L47A 5LHIB 5JREA 4JI1T 4PFPA 5JH7E 5LGNB 1MMDA 3AEDA 3CKDA 2QVAA 2D0UA 4L0RA 4YFSA 1BR4A 2BBHA 2XSBA 3KV5A 5AQRB 2NW7A 2X0LB 5GONE 1JNRA 4TUYE 3E08A 3FXDB 3NZQA 3PUXF 3ANWB 2FJEA 4HEAA 2IHR1 4JI3T 4LF7T 4DMWA 1W9RA 4U33A 2E2AA 3UUMA 2D2SA 2MAWA 4PW8A 4DR5T 2M67A 3EVYA 3JAEA 2IAKA 4ZS2A 4WBOA 3RLFF 3GN5B 4EGWA 5L2LA 4DR4T 3D0TA 1N34T 2XQ9A 3EDVA 3H3MA 2JIWA 3AXJA 2LHRA 3FZFB 3C98B 3NBXX 3OJAA 4TX5A 4TWHA 3BQKA 2MBGA 3KBUA 2YN6A 4JEUB 1UUSA 2KT9A 3NVOA 4QH4A 1OXZA 4Z8XA 3IEEA 5C3JA 1J5ET 2H88A 3Q5EA 1UK5A 2XZEA 2Y6XA 3VR8A 3A8YC 2UUBT 5JVDE 4OYKA 1MMGA 1E2AA 4DR3T 3W15B 3X1DA 5AQIB 5JDLA 3QB5A 5IYZE 3AAAB 2BG9E 2QYWA 2XQ4A 4X20E 5AQHB 1IBKT 2NW9A 2OLTA 3RYFE 2V6YB 4H9PC 5ABGA 4AQFC 1BR0A 4CI1B 3CWZB 3HKCE 4OK0A 2C5IT 4ZS3A 3V5UA 2CXFA 1S94A 1VOMA 5CB4E 5KDMC 2H7OA 3P7IA 5HEUA 1Y01A 4LMKA 3P4RA 4OX9T 4NUVA 3CVRA 1W0AA 1O3XA 2BS3A 5M4YA 3PUYF 4I43B 3UQ7A 1OEDB 3Q5WA 3UQ4A 4A5XA 2X9WA 2ZMAA 5AQVB 5DQWA 2ES0A 4C91A 1LRZA 3RIFA 5LGUB 2VVSA 3N2OA 3MXZA 2CBIA 2RPAA
chains in the Genus database with same CATH topology
1W9RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W9R A; 
#chains in the Genus database with same CATH topology
 3ZPO A;  5HWX A;  4M1P A;  4TNV A;  2W67 A;  2K5B B;  3RRC A;  3ZC1 A;  4YTN A;  2EHO A;  2CWO A;  2VVN A;  4X66 T;  3C4W A;  1DU2 A;  4HFE A;  3AAE B;  3PV0 F;  3RIU C;  5LJM A;  3KV6 A;  3HA4 A;  3FZK B;  3AE8 A;  3ANW A;  2Q9Q C;  4AKH A;  3N9N A;  1WCR A;  4LFC T;  1D0Y A;  1H7C A;  2D5U A;  4UEL A;  5AQJ B;  4H9O C;  4EIW A;  1G8X A;  3HKE E;  5A1L A;  4DV1 T;  4PAG A;  4QHO A;  4JI7 T;  1KFY A;  3FHN A;  4XBF B;  4AIS A;  2KLQ A;  2N2N A;  3P4P A;  5HAX A;  3AAI A;  4PJN A;  1N32 T;  5J2U E;  3GN5 A;  4NUU A;  2CPT A;  1M7K A;  2BG9 B;  3OYZ A;  1WRD A;  2N9D A;  2J4G A;  5F3J A;  5AQT B;  3F2E A;  2J47 A;  4AQY T;  2ODU A;  3R84 B;  1YW0 A;  1YQ4 A;  3SS1 A;  3R6N A;  4JEH B;  1LVF A;  2Q9Q A;  4JYA T;  2YDS A;  5AFU L;  2XUE A;  5FP3 A;  4WNK A;  3TLT A;  4TWF A;  4LF8 T;  4LF9 T;  4PJM A;  4TV9 E;  4LML A;  3LJC A;  3ETU A;  2X9Y A;  5CFB A;  4GK0 E;  2OA5 A;  2LOP A;  3P50 A;  5AQN B;  5LMN T;  4IL9 A;  3RH3 A;  3JC6 D;  4HGA A;  3FZL B;  3KVB A;  4XZC A;  1FMV A;  1WFD A;  4YSX A;  5FY7 A;  2LRL A;  2XAS B;  2V6Y A;  2CWY A;  3ESL A;  1J5W A;  2LEH A;  5TAO A;  3RHW A;  2YKS A;  2E9X C;  1Y64 B;  4O2A E;  3RC8 A;  1JNZ A;  1WYC A;  1BR1 A;  2DL1 A;  3IF8 B;  4CN6 A;  3HI2 A;  2P9B A;  2DLR A;  2PJQ A;  2QA7 A;  3PUG A;  4TNW A;  3FZM B;  2I6H A;  2SPC A;  4JUY A;  3KVA A;  3UU8 A;  4ANJ A;  5JDG A;  4JI8 T;  4UF0 B;  2DNX A;  3ZKR A;  1GQE A;  4LFB T;  4GK5 E;  2IUB A;  1ZV4 X;  3OVU A;  5L3B B;  3VR9 A;  1VCT A;  3N9M A;  1KNR A;  1SE7 A;  2NTX A;  2XQ6 A;  4E7S A;  4ZI3 D;  2PG8 A;  4IDN A;  3IA3 A;  4CXX A;  3TLW A;  4HFD A;  3CK6 A;  3NZP A;  4L5G A;  3L09 A;  3PU3 A;  2NTY A;  1WR6 A;  1YKE B;  4Z90 A;  1XMQ T;  4MHC A;  4IT4 A;  2JMK A;  2JQ9 A;  2Y8D A;  4UIG A;  2FUP A;  2LM9 A;  2YDQ A;  1UX4 A;  3B57 A;  3P4Q A;  2UXB T;  2V7I A;  4QX8 B;  1MIY A;  3DP7 A;  5L4H A;  2WQY A;  3ZYL A;  5CA0 E;  4JLE A;  4CN1 A;  4KP3 C;  4DVD A;  3GA8 A;  3RKG A;  2K24 A;  2WBL A;  2AE9 A;  2WP9 A;  3U3I A;  4ADZ A;  4CN4 A;  4GKJ T;  4YLH A;  3N9P A;  4FJO A;  3VHL A;  3C4X A;  4EZ4 A;  1VCS A;  2A9U A;  3C64 A;  3RIU A;  2MYS A;  3UU4 A;  2XM1 A;  2V7M A;  2VK9 A;  2WMO A;  3T1H T;  1R8I A;  2NOX A;  2IIU A;  3MK7 C;  4PK5 A;  5E0O A;  4ILA A;  5LOV E;  4QXB B;  5FKY A;  3K3O A;  2WWV A;  2A3D A;  4O4J E;  5C8Y E;  5AQL B;  5HXS A;  1HNZ T;  4LF6 T;  2KSR A;  2CE7 A;  1FJG T;  3AA0 B;  3RPU A;  2HPL A;  2FJB A;  3QK6 A;  2L8K A;  3O1H A;  3GMI A;  2JMH A;  4BAY B;  2KND A;  2V26 A;  2W2U A;  3JAF A;  4UXN B;  3KIN B;  5ETW A;  5JR9 B;  4YHH T;  5KXJ A;  5HXE A;  3L8R A;  3AE7 A;  2E5L T;  4BJN A;  2X51 A;  4GKK T;  5F8P A;  1XWM A;  3T8O A;  3KV9 A;  3EAB A;  3QOF A;  3CQC B;  4BJM A;  5HEH A;  1OED A;  1MNE A;  2EHO B;  1NAF A;  2K48 A;  4HFB A;  4X1K E;  3SFE A;  1HG2 A;  3H3A A;  2ACX A;  4EXT A;  4O4H E;  5L4E A;  3LFM A;  4WZX A;  5EK3 A;  5ABE A;  1W09 A;  1LKX A;  5LBM A;  4Z91 A;  2E8I A;  3RKO A;  3CQG B;  2QGS A;  4YXD A;  2WCA A;  1Z8U A;  4YSZ A;  2IW5 B;  1CHU A;  2YOE A;  3OPC A;  2IC6 A;  4JV5 T;  4LFA T;  2FJD A;  2ZM6 T;  4EOZ B;  2IC9 A;  3SOL A;  5AQG B;  2V7K A;  3PUZ F;  3RIA A;  3AEG A;  1T7S A;  5AQP B;  4DR7 T;  2BDE A;  4UEM A;  3ZEF B;  3KBT A;  5LJN A;  1HR0 T;  1NWM X;  2Q9Q D;  2W4X A;  3CX7 B;  4I50 E;  4AQF A;  2BG9 A;  2WZH A;  4UF0 A;  3E22 E;  2WM9 A;  2UXX B;  1QUU A;  4HFH A;  2JJ9 A;  1T72 A;  3P8C D;  3Q9D A;  5FY0 A;  5LGT B;  2X66 A;  4EB6 E;  5IHY A;  4HE8 A;  5LP6 E;  2GK9 A;  2WY2 A;  2LJL A;  2XQY A;  3CQX C;  1KF6 A;  3TLV A;  4I55 E;  3FXE B;  3ZC0 A;  1HNW T;  2XPK A;  2XQ3 A;  3CIR A;  3VRA A;  4U2Y A;  4IL4 A;  3ZJ1 A;  5JDH A;  3ZMV B;  4YTM A;  2HHH T;  3IBP A;  4JI4 T;  4G2A A;  2X9H A;  2CRB A;  1L0V A;  3EUH A;  3J9X 1;  4AXP A;  2IML A;  3FBZ A;  3LK4 2;  4TN7 B;  2LRK A;  1HF8 A;  2XY8 B;  3TKL B;  3RYH E;  2XQ8 A;  3UUL A;  3PUA A;  4P09 A;  3FZH B;  5L3F B;  3AE2 A;  4IDQ A;  1ZOY A;  3EAM A;  3RC3 A;  4DMV A;  2Q9Q B;  4DV6 T;  4XAX B;  4MFR A;  3CX8 B;  4WYV A;  2VKD A;  1X79 A;  2W62 A;  2UU9 T;  3CPZ A;  2VUR A;  4TV8 E;  3Q5X A;  3AA1 B;  3ZJ2 A;  4DV7 T;  3UTK A;  3ZMT B;  5BR8 T;  4B3S T;  1HFA A;  2WZI A;  3V5S A;  5AQS B;  5JDN A;  4P0B A;  2X0H A;  2X67 A;  3UFG A;  3UU3 A;  3RI5 A;  3NWI A;  2H3R A;  3AB3 B;  2PFV A;  2ACZ A;  3M3Z B;  5JR9 A;  4ASK A;  1WR0 A;  1MMN A;  1EZ3 A;  2N1G A;  3K1S A;  5AQM B;  4OYJ A;  2XJ7 A;  3B5M A;  4ILU A;  4O2B E;  3ZMS B;  3EDU A;  4IE6 A;  3LK3 B;  4C90 A;  5HEJ A;  1D0X A;  2DCF A;  4K0K T;  2VQE T;  2I0M A;  2E9X D;  4OHF A;  3ZN1 B;  4QKN A;  1XNQ T;  2XQ5 A;  4DBQ A;  5HXH A;  3QC9 A;  2LKH A;  4CZZ B;  3MA9 A;  3PDY A;  4H9N C;  5JDM A;  4ZHQ E;  2LM2 A;  2HN1 A;  3I0O A;  5L3G B;  5AQF B;  2JQK A;  3M65 A;  5JR9 C;  1YQ3 A;  2X9X A;  4ZZB A;  4CXY A;  3AE6 A;  2V5C A;  5IWA T;  3ONX A;  3ZCJ A;  2FJA A;  3KDS E;  3ZCI A;  3FB2 A;  2VKH A;  3MAC A;  4ZEY A;  2L9Q A;  5LYJ E;  2XAH B;  1NEN A;  2BKO A;  4A98 A;  3ETV A;  3N9O A;  3OKQ A;  3O9X A;  2PTF A;  3G06 A;  4COF A;  2W63 A;  2XHE B;  2KXP B;  5FVL A;  4MAL A;  1US7 B;  3L3P A;  1U5P A;  3I1A A;  3NKZ A;  4EED A;  2M6I A;  1ZEE A;  4DO0 A;  4EEB A;  1I6Z A;  3OTO T;  4KI0 F;  5KX5 E;  4BA9 A;  1E1H B;  4HFC A;  4I4T E;  4CQI A;  3AEA A;  4AIU A;  3N9Q A;  4ZI2 D;  2FBW A;  5AQO B;  3O4X E;  2K3W A;  2XAJ B;  4ERR A;  4IRE A;  4UVB B;  4KHZ F;  5HXR A;  4B3T T;  4P1N A;  3TLU A;  1UGO A;  3F57 A;  1AJ3 A;  4A97 A;  4YHJ A;  4EAH A;  4EZH A;  1IAP A;  2QRX A;  1LVK A;  1N36 T;  5LBQ B;  3HL6 A;  4PJJ A;  4F6R C;  5L3E B;  3OBV E;  4J2C A;  5AQU B;  2E9X A;  2CEA A;  2BZB A;  1WLX A;  2AXD S;  2WMN A;  2WS3 A;  4IHJ E;  3UT5 E;  4YJ2 E;  5DQV A;  4QWN B;  1HTJ F;  2W61 A;  4CI2 B;  3QB5 K;  2CLY B;  2UXN B;  2BVL A;  2CXL A;  3JCF A;  1IJ6 A;  3N2K E;  2RA1 A;  4U3C A;  2LSJ A;  2LSY A;  2ZM0 A;  4UV9 B;  3VRB A;  4ZZC A;  5HYA A;  3AA7 B;  2HH7 A;  1HS7 A;  1FEW A;  3GWH A;  3LK2 B;  3N5L A;  2CLY C;  3I0Q A;  5J1G A;  3UUX B;  1OWA A;  2W0G A;  4O4L E;  3K3Q C;  3RRW A;  1Z0P A;  3LSV A;  2UXD T;  4GYS A;  4UV8 B;  3AE5 A;  1BR2 A;  3AE4 A;  1MIV A;  1SHZ C;  1UUR A;  2PBI A;  2VL0 A;  3A5X A;  4AQG A;  4ZI7 E;  3UFE A;  4HN9 A;  2WWU A;  3HKB E;  3I9Y A;  3AVR A;  2Z6E A;  1OED E;  5EK4 A;  3RF1 A;  3ZT5 A;  5CGM A;  5KMG P;  2LLY A;  3RQU A;  2V7J A;  4IE0 A;  3J7Y q;  1ZHC A;  2XQA A;  3Q2M A;  2DWK A;  5ADX L;  2XAG B;  2CBJ A;  2XAQ B;  5LNK A;  4DV4 T;  2F4V T;  5IUX A;  5LXT E;  3EHZ A;  1D1A A;  4U2Z A;  5LG4 A;  2H89 A;  4IST A;  2RP4 A;  4JI0 T;  3PUW F;  3SWH A;  3PUR A;  1J1J A;  1B7T A;  2MPK A;  3CX6 B;  2W66 A;  4DND A;  3QUJ A;  4V1A v;  5AQK B;  2WB5 A;  1VRB A;  4EYU A;  3AEF A;  2KMF A;  3C50 A;  2HN2 A;  1YXR A;  4P0A A;  4DUY T;  3SRZ A;  2D9D A;  3FBL A;  1T98 A;  3AA6 B;  3AEE A;  3E0Z A;  3BQI A;  5FMN A;  5FYM A;  3AEB A;  3PUS A;  4DBR A;  4QXC B;  2YIN A;  2BG9 C;  1W0B A;  2WU2 A;  2XAF B;  4KUM B;  3PUV F;  4JBW F;  3DJB A;  5JRC A;  1T8B A;  5FY1 A;  3I9W A;  4QXH B;  3ZN0 B;  3PUQ A;  1XZY A;  2DWG A;  2CHN A;  2LT3 A;  2V8S V;  2BS4 A;  4YY3 T;  1XMO T;  3ZYK A;  3PJA J;  4U74 A;  4IE4 A;  5ABF A;  3AEC A;  4TZ4 C;  4DR1 T;  4DV0 T;  3VKH A;  2VB6 A;  2JQQ A;  2CMR A;  5LHG B;  1D1B A;  2V6X A;  5JDF A;  2K9A A;  4GYR A;  4OFZ A;  5LCY A;  3MJX A;  5H6R B;  2I59 A;  3P4W A;  4KHP T;  2EHO D;  4ZI2 C;  4AKG A;  2BBJ A;  1XDO A;  2EHO C;  2X68 A;  2KZ7 B;  2MTQ A;  4ZOL E;  5DJQ C;  1HNX T;  3F31 A;  4CI3 B;  3HKD E;  5LMU T;  1UX5 A;  2DI4 A;  2YU1 A;  4HKA A;  3VKG A;  5HWY A;  2JQH A;  2LHN A;  4QX7 B;  3RGL A;  1G73 A;  1D0Z A;  3AE3 A;  2C5K T;  3LBX B;  3ZMZ B;  1ZKE A;  1KNP A;  5EZY E;  4X1Y E;  4YTP A;  2XM2 A;  5FL0 A;  3BQL A;  2YU2 A;  5L3D B;  3HR0 A;  4NXM T;  2D0T A;  2LKG A;  2LSK A;  3LDQ B;  1MND A;  4K0U A;  3K8P C;  3NRY A;  4NXN T;  1QLB A;  3L39 A;  4PNI A;  2HPJ A;  4HWD A;  3UU6 A;  4YSY A;  4IDP A;  4QH1 A;  5JTG A;  4PFO A;  5J0Z A;  2L3L A;  4DR6 T;  4YT0 A;  2MOZ A;  2WSS V;  4PK6 A;  4JI2 T;  1SUM B;  4CXW A;  2JRK A;  5FVK A;  2LSI A;  3C4Z A;  2J1D G;  3ONL C;  3TLS A;  5ABH A;  4H9S E;  2BVM A;  2JPF A;  4DID B;  5CA1 E;  3QNU A;  5FXZ A;  1FIO A;  4EYY R;  4H63 V;  4KBM B;  2C5J A;  5AQQ B;  2WDR A;  3PJA A;  4IE7 A;  1V9D A;  1WYB A;  2YK0 A;  3ABV A;  4MBQ A;  4O4I E;  3AXJ B;  3UUN A;  4AI6 A;  3KFW X;  3O1I A;  2WDV A;  3RYC E;  5JRC B;  4KX6 A;  4UVC B;  2VL8 A;  4U7I A;  2IDO B;  4PJL A;  2CM0 A;  4FI5 A;  2C0S A;  3T1Y T;  4LF4 T;  3WAJ A;  1M62 A;  2BKN A;  2W00 A;  1YKH B;  2X0Y A;  4A56 A;  5LHH B;  2A2F X;  3UU5 A;  2NW8 A;  4ILB A;  1IBM T;  1IJ5 A;  2LE8 A;  2VKO A;  3AVS A;  4X64 T;  2XTL A;  5DAB A;  4PK4 A;  3KV4 A;  2NR4 A;  5C2T A;  2B76 A;  5HEO A;  2V5D A;  5HEG A;  5FXX A;  5CJ5 A;  2H7V C;  3IHR A;  4DV3 T;  2B1E A;  2UXC T;  4EV6 A;  1KNZ A;  1IZN B;  2WDQ A;  2UUA T;  2XQ7 A;  5LG3 A;  4H9Q C;  5LB7 B;  4DUZ T;  2E9X B;  4UR9 A;  5LA6 E;  3P4S A;  5JQG E;  1XNR T;  3LBX A;  1KK7 A;  3ZLI A;  3RQW A;  2OV9 A;  1U4Q A;  1CUN A;  2CXD A;  3NRX A;  4U72 A;  3MKD A;  4ZXL A;  4U7Y A;  4HWI B;  4WW0 A;  2DHR A;  1MIW A;  2WAU A;  2KWI B;  3DTO A;  3Q5D A;  1S35 A;  2M6B A;  1MMA A;  3U78 A;  3ZT7 A;  4F8H A;  2VQF T;  2WU5 A;  4DV5 T;  3PE0 A;  3C51 A;  2KIN B;  2ODV A;  4O8S A;  2ZLY A;  4ZI3 C;  4HWH A;  4LF5 T;  4X1I E;  4AKI A;  4HFI A;  1HX8 A;  4H63 H;  3AE9 A;  5HCM A;  4ILC A;  3ZST A;  4MLK A;  4HFV A;  3O1J A;  4QH5 A;  3VU7 H;  5J2T E;  2XSA A;  3SFD A;  1N33 T;  2NP9 A;  5L3C B;  3LG7 A;  1D1C A;  3B13 A;  2R6G F;  3ONJ A;  1I94 T;  2V1D B;  4UVA B;  4G63 A;  5FNV E;  4NIQ A;  4TWD A;  3RX6 A;  4E7Z A;  2BKP A;  1NEK A;  4HWC A;  1HG5 A;  4H9R C;  4WBN E;  2KWH A;  4HTE A;  5HXC A;  4JI5 T;  4DR2 T;  4ISS A;  1E7P A;  1QSD A;  2VWA A;  3A7M A;  2E5V A;  2Y48 B;  4B6X A;  4GIW A;  4B3M T;  4X62 T;  4JI6 T;  5EK2 A;  3PTR B;  4I0U A;  3CML A;  4IDO A;  4NPP A;  4DV2 T;  1SA0 E;  3BK9 A;  3JC6 C;  3S4U A;  4B3R T;  4GOU A;  2ZM8 A;  1HX1 B;  5FXV A;  3ZMU B;  4Q25 A;  1ZP0 A;  3N9L A;  4IGU A;  2NWB A;  2VKJ A;  5FXW A;  3JAD A;  3N2G E;  2UUC T;  4U31 A;  4IE5 A;  2A72 A;  2CA5 A;  1KEY A;  5HCJ A;  2VAS A;  2LSG A;  1XDP A;  2V7L A;  3WAK A;  3MZK B;  1OED C;  2CCQ A;  3WI3 A;  1YD8 G;  2BS2 A;  1HCI A;  2YDR A;  2G0U A;  4IDZ A;  2YEV C;  3EI0 A;  3AE1 A;  3OYX A;  2LOS A;  3PU8 A;  4X5T A;  5BMV E;  4YJ3 E;  4X65 T;  4AKL A;  4IIJ E;  3ZSS A;  3ZYM A;  3ZT6 A;  4L9I A;  5H6Q B;  1IBL T;  4HWF A;  4LMJ A;  2J62 A;  4KMC A;  5ABF B;  2ZM2 A;  5JDQ A;  1FMW A;  3RYI E;  1UCU A;  1X9B A;  3UUB A;  4AKR B;  3H37 A;  5FL1 A;  3K3N A;  2CHO A;  4N78 D;  5F5W A;  5L47 A;  5LHI B;  5JRE A;  4JI1 T;  4PFP A;  5JH7 E;  5LGN B;  1MMD A;  3AED A;  3CKD A;  2QVA A;  2D0U A;  4L0R A;  4YFS A;  1BR4 A;  2BBH A;  2XSB A;  3KV5 A;  5AQR B;  2NW7 A;  2X0L B;  5GON E;  1JNR A;  4TUY E;  3E08 A;  3FXD B;  3NZQ A;  3PUX F;  3ANW B;  2FJE A;  4HEA A;  2IHR 1;  4JI3 T;  4LF7 T;  4DMW A;  1W9R A;  4U33 A;  2E2A A;  3UUM A;  2D2S A;  2MAW A;  4PW8 A;  4DR5 T;  2M67 A;  3EVY A;  3JAE A;  2IAK A;  4ZS2 A;  4WBO A;  3RLF F;  3GN5 B;  4EGW A;  5L2L A;  4DR4 T;  3D0T A;  1N34 T;  2XQ9 A;  3EDV A;  3H3M A;  2JIW A;  3AXJ A;  2LHR A;  3FZF B;  3C98 B;  3NBX X;  3OJA A;  4TX5 A;  4TWH A;  3BQK A;  2MBG A;  3KBU A;  2YN6 A;  4JEU B;  1UUS A;  2KT9 A;  3NVO A;  4QH4 A;  1OXZ A;  4Z8X A;  3IEE A;  5C3J A;  1J5E T;  2H88 A;  3Q5E A;  1UK5 A;  2XZE A;  2Y6X A;  3VR8 A;  3A8Y C;  2UUB T;  5JVD E;  4OYK A;  1MMG A;  1E2A A;  4DR3 T;  3W15 B;  3X1D A;  5AQI B;  5JDL A;  3QB5 A;  5IYZ E;  3AAA B;  2BG9 E;  2QYW A;  2XQ4 A;  4X20 E;  5AQH B;  1IBK T;  2NW9 A;  2OLT A;  3RYF E;  2V6Y B;  4H9P C;  5ABG A;  4AQF C;  1BR0 A;  4CI1 B;  3CWZ B;  3HKC E;  4OK0 A;  2C5I T;  4ZS3 A;  3V5U A;  2CXF A;  1S94 A;  1VOM A;  5CB4 E;  5KDM C;  2H7O A;  3P7I A;  5HEU A;  1Y01 A;  4LMK A;  3P4R A;  4OX9 T;  4NUV A;  3CVR A;  1W0A A;  1O3X A;  2BS3 A;  5M4Y A;  3PUY F;  4I43 B;  3UQ7 A;  1OED B;  3Q5W A;  3UQ4 A;  4A5X A;  2X9W A;  2ZMA A;  5AQV B;  5DQW A;  2ES0 A;  4C91 A;  1LRZ A;  3RIF A;  5LGU B;  2VVS A;  3N2O A;  3MXZ A;  2CBI A;  2RPA A; 
#chains in the Genus database with same CATH homology
 1W9R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...