1W9RA

Solution structure of choline binding protein a, domain r2, the major adhesin of streptococcus pneumoniae
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
119
structure length
119
Chain Sequence
GSHMPEKKVAEAEKKVEEAKKKAEDQKEEDRRNYPTNTYKTLELEIAESDVEVKKAELELVKEEAKEPRNEEKVKQAKAEVESKKAEATRLEKIKTDRKKAEEEAKRKAAEEDKVKEKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CHOLINE BINDING PROTEIN A
publication title Solution Structure of Choline Binding Protein A, the Major Adhesin of Streptococcus Pneumoniae
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Receptor
total genus 47
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2004-10-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.440 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 choline binding protein A 1w9rA00
1W9RA
chains in the Genus database with same CATH superfamily
1LKXA 2N2NA 2BKOA 3CQXC 1IBLT 3KINB 4PJNA 3WAKA 2J4GA 2Z6EA 5FMNA 4N78D 4LMKA 5GONE 4NUVA 4EEDA 2D0TA 2BG9E 3IBPA 4MFRA 3F57A 1HX1B 2CCQA 3L8RA 4IT4A 1SHZC 5AQMB 4MLKA 5ABFB 4ISTA 1HCIA 1E7PA 1UGOA 2FJBA 5IYZE 5JDLA 1B7TA 4ILUA 5FXZA 2K9AA 2Y8DA 3RF1A 4GIWA 5FVKA 2CEAA 3AE1A 3ZYMA 1IZNB 3QK6A 5AFUL 4QX7B 4QHOA 2CXFA 4DR5T 4U3CA 4X65T 3UUMA 4BAYB 3HI2A 1I6ZA 3QC9A 4TX5A 2WMNA 5HXEA 1MNDA 4LF8T 3ONXA 5LBMA 1KK7A 5L2LA 3AEGA 2D5UA 4IDZA 4KP3C 2XAQB 3EDUA 4I50E 4DV0T 3I9YA 3C50A 3CKDA 1OEDB 3RYCE 3P4PA 4UVBB 2XJ7A 3Q9DA 2BVMA 3MXZA 2HHHT 3AE4A 4DV3T 4YHJA 5HCMA 3ZCIA 2VKDA 5L3EB 4B3MT 3FBLA 3CX6B 4IE0A 4AKLA 3X1DA 1WYBA 5FY0A 2VVSA 1D0YA 2V6XA 3AE6A 4LFBT 3R84B 3DP7A 3LBXB 4P1NA 3L09A 2BG9B 2LSJA 3AEBA 2K24A 1KNZA 4IREA 3M3ZB 5LG3A 3RIUC 5CA1E 2D2SA 3PUZF 4X1YE 4EZ4A 4QX8B 3W15B 4JI3T 4ZXLA 2ZM2A 2Q9QD 2LJLA 4DV2T 1D0XA 2A2FX 3C4WA 4QH1A 2KXPB 4LF4T 2QGSA 3VU7H 4QKNA 4B3ST 3O4XE 3NBXX 4EZHA 3UUBA 3IEEA 2VB6A 5IWAT 3GN5B 4OK0A 5ADXL 1QSDA 3SFDA 4TWDA 4X62T 4JI4T 3EUHA 3AECA 2CRBA 2BDEA 2YDSA 2BKPA 4PK4A 3PUGA 4Z91A 4UVAB 3LK42 4CXYA 3I0QA 5FYMA 4JI6T 3BQLA 3P50A 1YQ4A 1BR0A 2J62A 3PV0F 3OJAA 4YJ3E 2Q9QC 1U4QA 3AB3B 4E7SA 3CVRA 4DUZT 4QXBB 1Z8UA 1IJ5A 4WYVA 3GMIA 3VRAA 5EZYE 3H37A 4TWHA 3ESLA 1HNXT 1NAFA 1IAPA 2ODUA 1S35A 3AA1B 3ZT6A 2KWHA 3H3MA 2CLYC 2K3WA 3NZQA 1I94T 5BR8T 2ACXA 3ZMZB 4DV4T 1N36T 2UXCT 2UXNB 2DL1A 3NVOA 2QVAA 2IC6A 2W66A 3EABA 3K3OA 2H7VC 3VKHA 5H6QB 2OA5A 2X9HA 2YK0A 2XAJB 5FXWA 3C51A 4JI8T 3JC6D 1YKEB 4X20E 3PUQA 4GK0E 1IBMT 2X51A 2V6YB 4YTNA 5JDGA 3C4ZA 5HWYA 1HNWT 1XZYA 2CBJA 2RA1A 4CI2B 5DJQC 4CI3B 1CHUA 2EHOC 4H63H 3P4SA 4NUUA 4LF5T 2LSKA 1T98A 4IL4A 4TWFA 2WWVA 4DR6T 2V7JA 4NXMT 3UTKA 3ZEFB 3RC3A 1D1BA 4NXNT 2BBHA 4B3RT 1QLBA 5J2TE 5AQQB 3Q5WA 4HFVA 3G06A 4YHHT 3JC6C 2WDRA 2CM0A 3O9XA 4U74A 3UFEA 4CN4A 2V1DB 4KHPT 4GKJT 1ZHCA 2N9DA 2WZIA 3PU3A 1WR6A 3K1SA 2W67A 3K3NA 4HFHA 1YKHB 1W9RA 5LNKA 2CBIA 4U7IA 3UU3A 4Z8XA 2QA7A 3RYHE 4DV5T 1VOMA 2X67A 5LBQB 5AQPB 2WAUA 4L9IA 5LB7B 3TLTA 3LK2B 1M7KA 3FZFB 3RHWA 3AE7A 3MK7C 3ZYLA 1OXZA 3L3PA 2CLYB 2XZEA 2KMFA 3DTOA 2UXBT 5ABEA 4HWIB 3RKOA 4PJJA 4WW0A 2RPAA 4TNWA 1JNRA 5LXTE 2XASB 4AQFC 5H6RB 5FVLA 4CQIA 5AQJB 5L4HA 4ERRA 2YDQA 3OVUA 3MACA 1R8IA 5LCYA 5AQNB 3T8OA 3AXJB 2A9UA 3FHNA 2E5VA 3EDVA 1FMWA 4WBNE 3ANWA 2CA5A 4QXHB 2RP4A 2EHOB 5JDMA 5L3GB 3RC8A 3E08A 5KXJA 4HFCA 4DR1T 3Q5DA 1E2AA 1J1JA 3ZSSA 4H63V 3OYXA 1HS7A 3KFWX 5HEHA 3HKCE 3ZLIA 3HL6A 4ZHQE 4U33A 1XNQT 3OPCA 2XM2A 3KDSE 4H9RC 5JR9A 1NENA 4CN6A 3J7Yq 1IBKT 1FEWA 2NTXA 3ABVA 1U5PA 3UFGA 1N32T 5M4YA 3PDYA 4O4LE 3ZC1A 2CWYA 3OBVE 4HFBA 3FB2A 2E9XC 2E2AA 2X9XA 2GK9A 2IIUA 4H9NC 4P09A 3RQUA 5JRCB 3CQGB 3I0OA 3KV6A 3PUSA 2H7OA 5AQHB 3LFMA 4UELA 1AJ3A 4ZS3A 2NWBA 4GK5E 2AE9A 4PK5A 2JIWA 2XAHB 5L3CB 5L3DB 2KWIB 4TV9E 1WFDA 3RGLA 2BG9A 2V7MA 2MAWA 2ZM6T 4IL9A 3GA8A 5J0ZA 4PNIA 5LHHB 2XHEB 5AQGB 1W0AA 3KV9A 4PJLA 5FNVE 4U2ZA 3RI5A 3ZJ2A 4ILCA 4HKAA 1MMGA 3NZPA 3VR9A 1CUNA 5FY7A 1FIOA 1MMDA 4WZXA 5TAOA 3PUVF 5AQOB 2VKHA 2WQYA 1XMQT 4PFOA 2UUCT 1ZEEA 5JDHA 4L5GA 2KNDA 2B1EA 2DWGA 3HKBE 3PU8A 3ZT5A 2C0SA 1M62A 3M65A 4EYUA 5FXXA 5HYAA 3Q2MA 1YD8G 3VRBA 2DWKA 3LDQB 4HN9A 3FZHB 5HEJA 2IHR1 3CX8B 3AA7B 3AE9A 3P4QA 3MA9A 5JDQA 5JTGA 2B76A 4IGUA 2LOSA 3NRXA 4IIJE 1MIYA 4H9QC 3RYIE 4HWHA 4LFAT 2X0HA 1W09A 1UK5A 4U2YA 3LG7A 2WSSV 2NW8A 4I4TE 4C90A 3PUXF 3KVBA 1JNZA 4DNDA 2E9XB 2WP9A 2YOEA 3WAJA 2OLTA 1X79A 3ONJA 4CZZB 2J47A 2XSBA 5KDMC 2ODVA 3UQ7A 2XQ8A 2LHRA 2I0MA 1XDPA 4DIDB 5AQKB 3O1JA 1UURA 3BK9A 4KBMB 4EB6E 5C3JA 2ZM8A 4ZI2D 2LSIA 2NW9A 5HEGA 2OV9A 4CI1B 1N33T 4WNKA 2SPCA 4AQGA 2IDOB 4CXXA 5CJ5A 2WU2A 3I1AA 4YTPA 3UU8A 4IDQA 4JI0T 5AQVB 4YSZA 3U3IA 4TNVA 1YXRA 2WCAA 1XMOT 2XPKA 4KI0F 2HN2A 3ONLC 2W61A 4P0AA 2X9YA 5FKYA 1Y64B 3AAEB 4NPPA 3FBZA 1US7B 3AEFA 2KT9A 2YINA 4O4HE 4QH5A 4COFA 4GYSA 3LK3B 2LEHA 2IC9A 3AVRA 1WRDA 2IMLA 5LGTB 2BBJA 2HPLA 4LF7T 2JMKA 1MNEA 4QWNB 2ES0A 5J2UE 2MOZA 4I43B 2PG8A 4IE6A 2Y6XA 2LE8A 2N1GA 2V7KA 2JQHA 4JI1T 2H3RA 3QB5K 5F8PA 2FJDA 1KNRA 3U78A 3N5LA 5DQVA 1N34T 2H89A 1T72A 4AKIA 5HXRA 2C5KT 4MHCA 3ZMUB 3ZKRA 2F4VT 4F8HA 4YT0A 2FJEA 4OHFA 3SRZA 3FZKB 3TLUA 2VK9A 4HWDA 2DNXA 4ZOLE 4AIUA 3N9NA 3MJXA 4HFDA 3HA4A 2IUBA 1UCUA 3P4RA 5C2TA 5EK2A 3CX7B 3OYZA 5FL0A 1D0ZA 3SWHA 4UF0A 4C91A 5LMNT 3KVAA 4G63A 2KINB 2PBIA 4HTEA 5LGUB 4UVCB 4I0UA 2XAGB 4J2CA 2JJ9A 2UUAT 4UV9B 1HR0T 4F6RC 3N9LA 3PUYF 4DR7T 3FZLB 1O3XA 4DR4T 4ZZCA 2WDVA 1T7SA 2BVLA 4TZ4C 2KZ7B 5ETWA 2LKGA 1YQ3A 3PJAJ 4DV1T 1D1AA 3H3AA 2K5BB 2VQFT 1VRBA 3T1HT 1UUSA 2XSAA 1SA0E 2R6GF 2W2UA 3UU6A 3AE2A 4FJOA 1V9DA 2FUPA 3ZSTA 2WS3A 1H7CA 3BQIA 3CMLA 3ZMVB 3AA0B 3ZJ1A 3RX6A 3UUXB 2ZM0A 3B5MA 1DU2A 1KF6A 1FMVA 5L47A 2Q9QB 4X64T 4O4JE 4FI5A 4JEHB 4HWCA 4ZS2A 4AXPA 5HEUA 2D0UA 5FP3A 3HKEE 2UXXB 3KBUA 4JEUB 3AA6B 4YY3T 2XQ5A 4P0BA 3NRYA 3ZMSB 3TKLB 4DBRA 2CMRA 4UR9A 3HR0A 2CWOA 2FJAA 4H9OC 1IJ6A 5KMGP 5ABFA 1L0VA 2WMOA 2JQQA 2XQ6A 2PTFA 5L3BB 5EK3A 4B3TT 3HKDE 1E1HB 2LM2A 1UX4A 3EI0A 5ABGA 2KLQA 4MALA 2WY2A 4Z90A 4OYJA 3RPUA 2BKNA 3TLVA 4K0UA 2X9WA 4A98A 4ZI3D 2YU2A 2WB5A 1KEYA 4LF6T 4EOZB 4A97A 3PE0A 3S4UA 3A7MA 2V8SV 3BQKA 2UXDT 5AQUB 1WLXA 4PJMA 4A5XA 3AAIA 1HF8A 4MBQA 3R6NA 4JI5T 3TLSA 2NW7A 3RH3A 3K3QC 2YDRA 2W00A 2WM9A 1WYCA 3MKDA 2K48A 2XQ7A 2AXDS 2XTLA 4IHJE 3VHLA 4KX6A 4O2AE 1OEDA 4EXTA 4ZZBA 3AEEA 3JAEA 1MMAA 4ZI3C 5J1GA 3ETUA 4DBQA 3EVYA 3PJAA 1VCTA 3C98B 2BS2A 4AKRB 2JQ9A 2VASA 3RYFE 4AKHA 5LGNB 2PFVA 3F31A 4G2AA 4ISSA 5AQSB 4UIGA 4H9PC 3N2KE 4WBOA 1YW0A 1MIWA 2X0YA 2UU9T 2D9DA 5HWXA 5AQFB 3N9OA 3IA3A 2V26A 5JR9C 3ZPOA 2ACZA 3N9PA 3LBXA 4LF9T 2G0UA 4IE7A 2XQ4A 3J9X1 4ILAA 2W63A 5JQGE 1W0BA 3PTRB 4QH4A 4ANJA 2VKOA 2NTYA 4EV6A 3JADA 4HGAA 1XNRT 1HNZT 3NWIA 4U7YA 3ETVA 3E22E 4UXNB 2VL0A 4NIQA 4JLEA 5CFBA 1BR4A 3CPZA 3P7IA 4GYRA 5ABHA 2BG9C 5BMVE 3PUAA 4LMJA 2WBLA 1MIVA 4EYYR 3TLWA 3GWHA 4HE8A 5LHIB 1ZOYA 3SOLA 4X66T 1HFAA 3FZMB 2C5JA 3GN5A 3ZC0A 4DV7T 4JI7T 4BA9A 4DR3T 4L0RA 5IUXA 5JDNA 2JQKA 4DO0A 3PUWF 1ZKEA 4O8SA 3ANWB 1J5WA 4XBFB 3N2GE 4A56A 3V5UA 2LT3A 2L3LA 3UU5A 3LSVA 2M67A 2C5IT 3AEAA 4XZCA 4DMVA 3T1YT 1BR1A 2VWAA 3O1IA 2WZHA 1NEKA 2UUBT 4EIWA 3RKGA 2BS3A 1Z0PA 1EZ3A 2A72A 5JR9B 5AQTB 4ZEYA 2VURA 2LSYA 1OWAA 3AE8A 3AE3A 4CN1A 4JYAT 4OFZA 5IHYA 3RRWA 4V1Av 5JVDE 3ZMTB 3SS1A 2V7LA 3CQCB 4JBWF 2VQET 3RIUA 2XQAA 2BZBA 3MZKB 4PK6A 1XWMA 1XDOA 3ZCJA 3RLFF 5FL1A 4EGWA 1VCSA 4U72A 2V6YA 4AKGA 5EK4A 3KV5A 4H9SE 2HN1A 2VVNA 2X0LB 2JRKA 4TUYE 5LA6E 3AAAB 3N2OA 2XAFB 4ZI2C 2VKJA 3P4WA 3CK6A 4DUYT 2MBGA 4M1PA 4E7ZA 3UQ4A 3LJCA 2DCFA 2X68A 4AQYT 2KSRA 3WI3A 5LG4A 1S94A 2XQ9A 4Q25A 4X1KE 3CIRA 1ZP0A 2Q9QA 2QYWA 2MYSA 2LKHA 4HFIA 4IDPA 2E8IA 2I59A 5HXCA 4JI2T 3CWZB 2LSGA 1LVKA 2LRKA 3QUJA 5HCJA 1J5ET 3ZN1B 5HEOA 3L39A 2ZLYA 4UEMA 1FJGT 3EHZA 4DMWA 2NP9A 5AQIB 2M6BA 1KNPA 4LMLA 4HWFA 4K0KT 4BJMA 5HAXA 2FBWA 3D0TA 2E5LT 2P9BA 1LVFA 1ZV4X 2I6HA 2YEVC 3VR8A 5L4EA 3F2EA 3Q5EA 3IF8B 4I55E 1G73A 3OKQA 3UU4A 4ZI7E 3JCFA 2L8KA 3UUNA 2EHOD 3QNUA 1NWMX 5LYJE 2WDQA 4YSXA 3AVSA 2DHRA 3AEDA 2LRLA 3AXJA 5C8YE 1WCRA 2DI4A 1KFYA 4UV8B 4B6XA 2HPJA 2PJQA 3B13A 1G8XA 4X5TA 4PW8A 2EHOA 5FY1A 4IE5A 3RRCA 2XUEA 3C4XA 3A5XA 4GOUA 5A1LA 4BJNA 3UT5E 3P8CD 2JMHA 2V7IA 2Y48B 3KV4A 1D1CA 2JPFA 2MPKA 3N9MA 2XQ3A 5CB4E 4YFSA 3NKZA 2CXDA 3ZYKA 5CGMA 2XQYA 3V5SA 3I9WA 3N9QA 3C64A 1HX8A 2W0GA 1QUUA 2VL8A 5F3JA 1SE7A 3SFEA 3RIFA 5L3FB 4X1IE 3RIAA 3QOFA 4YTMA 2BS4A 2CHNA 4DVDA 2YKSA 4DR2T 2CPTA 3AE5A 2XM1A 3ZT7A 4PFPA 5LJNA 4JV5T 5LJMA 5JRCA 5HXSA 5FXVA 3B57A 1HTJF 2IAKA 3PURA 4EAHA 5LMUT 4YJ2E 1T8BA 3JAFA 1UX5A 5AQLB 3RQWA 3IHRA 5JREA 4JUYA 2ZMAA 3OTOT 3FXEB 4KUMB 2J1DG 4ADZA 3K8PC 1SUMB 4AQFA 4IDNA 1HG5A 3FXDB 4PAGA 2W4XA 4U31A 2WWUA 5LOVE 2A3DA 4OYKA 2H88A 4AISA 2LLYA 2V5CA 2IW5B 3E0ZA 2W62A 2LM9A 3KBTA 4ASKA 2NOXA 4EEBA 3O1HA 4UF0B 2NR4A 3QB5A 3DJBA 5JDFA 4KMCA 1BR2A 4IDOA 5DQWA 5LHGB 4O4IE 5F5WA 2YN6A 2DLRA 3EAMA 1WR0A 3Q5XA 1HG2A 1GQEA 2E9XD 2XY8B 2MTQA 5HXHA 4YXDA 2X66A 4YLHA 4GKKT 3ZN0B 2L9QA 5DABA 2CE7A 5KX5E 2CHOA 4DV6T 1MMNA 5JH7E 5AQRB 4HFEA 4TN7B 2M6IA 2YU1A 4YSYA 2LHNA 5CA0E 1LRZA 1Y01A 4TV8E 2QRXA 2CXLA 4AI6A 3A8YC 4IE4A 2E9XA 4O2BE 4CXWA 4HEAA 2HH7A 1X9BA 2LOPA 4KHZF 5LP6E 3VKGA 2V5DA 1OEDE 4OX9T 4ILBA 5E0OA 4XAXB 3UULA 1OEDC 4LFCT 4QXCB 2WU5A
chains in the Genus database with same CATH topology
1W9RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W9R A; 
#chains in the Genus database with same CATH topology
 1LKX A;  2N2N A;  2BKO A;  3CQX C;  1IBL T;  3KIN B;  4PJN A;  3WAK A;  2J4G A;  2Z6E A;  5FMN A;  4N78 D;  4LMK A;  5GON E;  4NUV A;  4EED A;  2D0T A;  2BG9 E;  3IBP A;  4MFR A;  3F57 A;  1HX1 B;  2CCQ A;  3L8R A;  4IT4 A;  1SHZ C;  5AQM B;  4MLK A;  5ABF B;  4IST A;  1HCI A;  1E7P A;  1UGO A;  2FJB A;  5IYZ E;  5JDL A;  1B7T A;  4ILU A;  5FXZ A;  2K9A A;  2Y8D A;  3RF1 A;  4GIW A;  5FVK A;  2CEA A;  3AE1 A;  3ZYM A;  1IZN B;  3QK6 A;  5AFU L;  4QX7 B;  4QHO A;  2CXF A;  4DR5 T;  4U3C A;  4X65 T;  3UUM A;  4BAY B;  3HI2 A;  1I6Z A;  3QC9 A;  4TX5 A;  2WMN A;  5HXE A;  1MND A;  4LF8 T;  3ONX A;  5LBM A;  1KK7 A;  5L2L A;  3AEG A;  2D5U A;  4IDZ A;  4KP3 C;  2XAQ B;  3EDU A;  4I50 E;  4DV0 T;  3I9Y A;  3C50 A;  3CKD A;  1OED B;  3RYC E;  3P4P A;  4UVB B;  2XJ7 A;  3Q9D A;  2BVM A;  3MXZ A;  2HHH T;  3AE4 A;  4DV3 T;  4YHJ A;  5HCM A;  3ZCI A;  2VKD A;  5L3E B;  4B3M T;  3FBL A;  3CX6 B;  4IE0 A;  4AKL A;  3X1D A;  1WYB A;  5FY0 A;  2VVS A;  1D0Y A;  2V6X A;  3AE6 A;  4LFB T;  3R84 B;  3DP7 A;  3LBX B;  4P1N A;  3L09 A;  2BG9 B;  2LSJ A;  3AEB A;  2K24 A;  1KNZ A;  4IRE A;  3M3Z B;  5LG3 A;  3RIU C;  5CA1 E;  2D2S A;  3PUZ F;  4X1Y E;  4EZ4 A;  4QX8 B;  3W15 B;  4JI3 T;  4ZXL A;  2ZM2 A;  2Q9Q D;  2LJL A;  4DV2 T;  1D0X A;  2A2F X;  3C4W A;  4QH1 A;  2KXP B;  4LF4 T;  2QGS A;  3VU7 H;  4QKN A;  4B3S T;  3O4X E;  3NBX X;  4EZH A;  3UUB A;  3IEE A;  2VB6 A;  5IWA T;  3GN5 B;  4OK0 A;  5ADX L;  1QSD A;  3SFD A;  4TWD A;  4X62 T;  4JI4 T;  3EUH A;  3AEC A;  2CRB A;  2BDE A;  2YDS A;  2BKP A;  4PK4 A;  3PUG A;  4Z91 A;  4UVA B;  3LK4 2;  4CXY A;  3I0Q A;  5FYM A;  4JI6 T;  3BQL A;  3P50 A;  1YQ4 A;  1BR0 A;  2J62 A;  3PV0 F;  3OJA A;  4YJ3 E;  2Q9Q C;  1U4Q A;  3AB3 B;  4E7S A;  3CVR A;  4DUZ T;  4QXB B;  1Z8U A;  1IJ5 A;  4WYV A;  3GMI A;  3VRA A;  5EZY E;  3H37 A;  4TWH A;  3ESL A;  1HNX T;  1NAF A;  1IAP A;  2ODU A;  1S35 A;  3AA1 B;  3ZT6 A;  2KWH A;  3H3M A;  2CLY C;  2K3W A;  3NZQ A;  1I94 T;  5BR8 T;  2ACX A;  3ZMZ B;  4DV4 T;  1N36 T;  2UXC T;  2UXN B;  2DL1 A;  3NVO A;  2QVA A;  2IC6 A;  2W66 A;  3EAB A;  3K3O A;  2H7V C;  3VKH A;  5H6Q B;  2OA5 A;  2X9H A;  2YK0 A;  2XAJ B;  5FXW A;  3C51 A;  4JI8 T;  3JC6 D;  1YKE B;  4X20 E;  3PUQ A;  4GK0 E;  1IBM T;  2X51 A;  2V6Y B;  4YTN A;  5JDG A;  3C4Z A;  5HWY A;  1HNW T;  1XZY A;  2CBJ A;  2RA1 A;  4CI2 B;  5DJQ C;  4CI3 B;  1CHU A;  2EHO C;  4H63 H;  3P4S A;  4NUU A;  4LF5 T;  2LSK A;  1T98 A;  4IL4 A;  4TWF A;  2WWV A;  4DR6 T;  2V7J A;  4NXM T;  3UTK A;  3ZEF B;  3RC3 A;  1D1B A;  4NXN T;  2BBH A;  4B3R T;  1QLB A;  5J2T E;  5AQQ B;  3Q5W A;  4HFV A;  3G06 A;  4YHH T;  3JC6 C;  2WDR A;  2CM0 A;  3O9X A;  4U74 A;  3UFE A;  4CN4 A;  2V1D B;  4KHP T;  4GKJ T;  1ZHC A;  2N9D A;  2WZI A;  3PU3 A;  1WR6 A;  3K1S A;  2W67 A;  3K3N A;  4HFH A;  1YKH B;  1W9R A;  5LNK A;  2CBI A;  4U7I A;  3UU3 A;  4Z8X A;  2QA7 A;  3RYH E;  4DV5 T;  1VOM A;  2X67 A;  5LBQ B;  5AQP B;  2WAU A;  4L9I A;  5LB7 B;  3TLT A;  3LK2 B;  1M7K A;  3FZF B;  3RHW A;  3AE7 A;  3MK7 C;  3ZYL A;  1OXZ A;  3L3P A;  2CLY B;  2XZE A;  2KMF A;  3DTO A;  2UXB T;  5ABE A;  4HWI B;  3RKO A;  4PJJ A;  4WW0 A;  2RPA A;  4TNW A;  1JNR A;  5LXT E;  2XAS B;  4AQF C;  5H6R B;  5FVL A;  4CQI A;  5AQJ B;  5L4H A;  4ERR A;  2YDQ A;  3OVU A;  3MAC A;  1R8I A;  5LCY A;  5AQN B;  3T8O A;  3AXJ B;  2A9U A;  3FHN A;  2E5V A;  3EDV A;  1FMW A;  4WBN E;  3ANW A;  2CA5 A;  4QXH B;  2RP4 A;  2EHO B;  5JDM A;  5L3G B;  3RC8 A;  3E08 A;  5KXJ A;  4HFC A;  4DR1 T;  3Q5D A;  1E2A A;  1J1J A;  3ZSS A;  4H63 V;  3OYX A;  1HS7 A;  3KFW X;  5HEH A;  3HKC E;  3ZLI A;  3HL6 A;  4ZHQ E;  4U33 A;  1XNQ T;  3OPC A;  2XM2 A;  3KDS E;  4H9R C;  5JR9 A;  1NEN A;  4CN6 A;  3J7Y q;  1IBK T;  1FEW A;  2NTX A;  3ABV A;  1U5P A;  3UFG A;  1N32 T;  5M4Y A;  3PDY A;  4O4L E;  3ZC1 A;  2CWY A;  3OBV E;  4HFB A;  3FB2 A;  2E9X C;  2E2A A;  2X9X A;  2GK9 A;  2IIU A;  4H9N C;  4P09 A;  3RQU A;  5JRC B;  3CQG B;  3I0O A;  3KV6 A;  3PUS A;  2H7O A;  5AQH B;  3LFM A;  4UEL A;  1AJ3 A;  4ZS3 A;  2NWB A;  4GK5 E;  2AE9 A;  4PK5 A;  2JIW A;  2XAH B;  5L3C B;  5L3D B;  2KWI B;  4TV9 E;  1WFD A;  3RGL A;  2BG9 A;  2V7M A;  2MAW A;  2ZM6 T;  4IL9 A;  3GA8 A;  5J0Z A;  4PNI A;  5LHH B;  2XHE B;  5AQG B;  1W0A A;  3KV9 A;  4PJL A;  5FNV E;  4U2Z A;  3RI5 A;  3ZJ2 A;  4ILC A;  4HKA A;  1MMG A;  3NZP A;  3VR9 A;  1CUN A;  5FY7 A;  1FIO A;  1MMD A;  4WZX A;  5TAO A;  3PUV F;  5AQO B;  2VKH A;  2WQY A;  1XMQ T;  4PFO A;  2UUC T;  1ZEE A;  5JDH A;  4L5G A;  2KND A;  2B1E A;  2DWG A;  3HKB E;  3PU8 A;  3ZT5 A;  2C0S A;  1M62 A;  3M65 A;  4EYU A;  5FXX A;  5HYA A;  3Q2M A;  1YD8 G;  3VRB A;  2DWK A;  3LDQ B;  4HN9 A;  3FZH B;  5HEJ A;  2IHR 1;  3CX8 B;  3AA7 B;  3AE9 A;  3P4Q A;  3MA9 A;  5JDQ A;  5JTG A;  2B76 A;  4IGU A;  2LOS A;  3NRX A;  4IIJ E;  1MIY A;  4H9Q C;  3RYI E;  4HWH A;  4LFA T;  2X0H A;  1W09 A;  1UK5 A;  4U2Y A;  3LG7 A;  2WSS V;  2NW8 A;  4I4T E;  4C90 A;  3PUX F;  3KVB A;  1JNZ A;  4DND A;  2E9X B;  2WP9 A;  2YOE A;  3WAJ A;  2OLT A;  1X79 A;  3ONJ A;  4CZZ B;  2J47 A;  2XSB A;  5KDM C;  2ODV A;  3UQ7 A;  2XQ8 A;  2LHR A;  2I0M A;  1XDP A;  4DID B;  5AQK B;  3O1J A;  1UUR A;  3BK9 A;  4KBM B;  4EB6 E;  5C3J A;  2ZM8 A;  4ZI2 D;  2LSI A;  2NW9 A;  5HEG A;  2OV9 A;  4CI1 B;  1N33 T;  4WNK A;  2SPC A;  4AQG A;  2IDO B;  4CXX A;  5CJ5 A;  2WU2 A;  3I1A A;  4YTP A;  3UU8 A;  4IDQ A;  4JI0 T;  5AQV B;  4YSZ A;  3U3I A;  4TNV A;  1YXR A;  2WCA A;  1XMO T;  2XPK A;  4KI0 F;  2HN2 A;  3ONL C;  2W61 A;  4P0A A;  2X9Y A;  5FKY A;  1Y64 B;  3AAE B;  4NPP A;  3FBZ A;  1US7 B;  3AEF A;  2KT9 A;  2YIN A;  4O4H E;  4QH5 A;  4COF A;  4GYS A;  3LK3 B;  2LEH A;  2IC9 A;  3AVR A;  1WRD A;  2IML A;  5LGT B;  2BBJ A;  2HPL A;  4LF7 T;  2JMK A;  1MNE A;  4QWN B;  2ES0 A;  5J2U E;  2MOZ A;  4I43 B;  2PG8 A;  4IE6 A;  2Y6X A;  2LE8 A;  2N1G A;  2V7K A;  2JQH A;  4JI1 T;  2H3R A;  3QB5 K;  5F8P A;  2FJD A;  1KNR A;  3U78 A;  3N5L A;  5DQV A;  1N34 T;  2H89 A;  1T72 A;  4AKI A;  5HXR A;  2C5K T;  4MHC A;  3ZMU B;  3ZKR A;  2F4V T;  4F8H A;  4YT0 A;  2FJE A;  4OHF A;  3SRZ A;  3FZK B;  3TLU A;  2VK9 A;  4HWD A;  2DNX A;  4ZOL E;  4AIU A;  3N9N A;  3MJX A;  4HFD A;  3HA4 A;  2IUB A;  1UCU A;  3P4R A;  5C2T A;  5EK2 A;  3CX7 B;  3OYZ A;  5FL0 A;  1D0Z A;  3SWH A;  4UF0 A;  4C91 A;  5LMN T;  3KVA A;  4G63 A;  2KIN B;  2PBI A;  4HTE A;  5LGU B;  4UVC B;  4I0U A;  2XAG B;  4J2C A;  2JJ9 A;  2UUA T;  4UV9 B;  1HR0 T;  4F6R C;  3N9L A;  3PUY F;  4DR7 T;  3FZL B;  1O3X A;  4DR4 T;  4ZZC A;  2WDV A;  1T7S A;  2BVL A;  4TZ4 C;  2KZ7 B;  5ETW A;  2LKG A;  1YQ3 A;  3PJA J;  4DV1 T;  1D1A A;  3H3A A;  2K5B B;  2VQF T;  1VRB A;  3T1H T;  1UUS A;  2XSA A;  1SA0 E;  2R6G F;  2W2U A;  3UU6 A;  3AE2 A;  4FJO A;  1V9D A;  2FUP A;  3ZST A;  2WS3 A;  1H7C A;  3BQI A;  3CML A;  3ZMV B;  3AA0 B;  3ZJ1 A;  3RX6 A;  3UUX B;  2ZM0 A;  3B5M A;  1DU2 A;  1KF6 A;  1FMV A;  5L47 A;  2Q9Q B;  4X64 T;  4O4J E;  4FI5 A;  4JEH B;  4HWC A;  4ZS2 A;  4AXP A;  5HEU A;  2D0U A;  5FP3 A;  3HKE E;  2UXX B;  3KBU A;  4JEU B;  3AA6 B;  4YY3 T;  2XQ5 A;  4P0B A;  3NRY A;  3ZMS B;  3TKL B;  4DBR A;  2CMR A;  4UR9 A;  3HR0 A;  2CWO A;  2FJA A;  4H9O C;  1IJ6 A;  5KMG P;  5ABF A;  1L0V A;  2WMO A;  2JQQ A;  2XQ6 A;  2PTF A;  5L3B B;  5EK3 A;  4B3T T;  3HKD E;  1E1H B;  2LM2 A;  1UX4 A;  3EI0 A;  5ABG A;  2KLQ A;  4MAL A;  2WY2 A;  4Z90 A;  4OYJ A;  3RPU A;  2BKN A;  3TLV A;  4K0U A;  2X9W A;  4A98 A;  4ZI3 D;  2YU2 A;  2WB5 A;  1KEY A;  4LF6 T;  4EOZ B;  4A97 A;  3PE0 A;  3S4U A;  3A7M A;  2V8S V;  3BQK A;  2UXD T;  5AQU B;  1WLX A;  4PJM A;  4A5X A;  3AAI A;  1HF8 A;  4MBQ A;  3R6N A;  4JI5 T;  3TLS A;  2NW7 A;  3RH3 A;  3K3Q C;  2YDR A;  2W00 A;  2WM9 A;  1WYC A;  3MKD A;  2K48 A;  2XQ7 A;  2AXD S;  2XTL A;  4IHJ E;  3VHL A;  4KX6 A;  4O2A E;  1OED A;  4EXT A;  4ZZB A;  3AEE A;  3JAE A;  1MMA A;  4ZI3 C;  5J1G A;  3ETU A;  4DBQ A;  3EVY A;  3PJA A;  1VCT A;  3C98 B;  2BS2 A;  4AKR B;  2JQ9 A;  2VAS A;  3RYF E;  4AKH A;  5LGN B;  2PFV A;  3F31 A;  4G2A A;  4ISS A;  5AQS B;  4UIG A;  4H9P C;  3N2K E;  4WBO A;  1YW0 A;  1MIW A;  2X0Y A;  2UU9 T;  2D9D A;  5HWX A;  5AQF B;  3N9O A;  3IA3 A;  2V26 A;  5JR9 C;  3ZPO A;  2ACZ A;  3N9P A;  3LBX A;  4LF9 T;  2G0U A;  4IE7 A;  2XQ4 A;  3J9X 1;  4ILA A;  2W63 A;  5JQG E;  1W0B A;  3PTR B;  4QH4 A;  4ANJ A;  2VKO A;  2NTY A;  4EV6 A;  3JAD A;  4HGA A;  1XNR T;  1HNZ T;  3NWI A;  4U7Y A;  3ETV A;  3E22 E;  4UXN B;  2VL0 A;  4NIQ A;  4JLE A;  5CFB A;  1BR4 A;  3CPZ A;  3P7I A;  4GYR A;  5ABH A;  2BG9 C;  5BMV E;  3PUA A;  4LMJ A;  2WBL A;  1MIV A;  4EYY R;  3TLW A;  3GWH A;  4HE8 A;  5LHI B;  1ZOY A;  3SOL A;  4X66 T;  1HFA A;  3FZM B;  2C5J A;  3GN5 A;  3ZC0 A;  4DV7 T;  4JI7 T;  4BA9 A;  4DR3 T;  4L0R A;  5IUX A;  5JDN A;  2JQK A;  4DO0 A;  3PUW F;  1ZKE A;  4O8S A;  3ANW B;  1J5W A;  4XBF B;  3N2G E;  4A56 A;  3V5U A;  2LT3 A;  2L3L A;  3UU5 A;  3LSV A;  2M67 A;  2C5I T;  3AEA A;  4XZC A;  4DMV A;  3T1Y T;  1BR1 A;  2VWA A;  3O1I A;  2WZH A;  1NEK A;  2UUB T;  4EIW A;  3RKG A;  2BS3 A;  1Z0P A;  1EZ3 A;  2A72 A;  5JR9 B;  5AQT B;  4ZEY A;  2VUR A;  2LSY A;  1OWA A;  3AE8 A;  3AE3 A;  4CN1 A;  4JYA T;  4OFZ A;  5IHY A;  3RRW A;  4V1A v;  5JVD E;  3ZMT B;  3SS1 A;  2V7L A;  3CQC B;  4JBW F;  2VQE T;  3RIU A;  2XQA A;  2BZB A;  3MZK B;  4PK6 A;  1XWM A;  1XDO A;  3ZCJ A;  3RLF F;  5FL1 A;  4EGW A;  1VCS A;  4U72 A;  2V6Y A;  4AKG A;  5EK4 A;  3KV5 A;  4H9S E;  2HN1 A;  2VVN A;  2X0L B;  2JRK A;  4TUY E;  5LA6 E;  3AAA B;  3N2O A;  2XAF B;  4ZI2 C;  2VKJ A;  3P4W A;  3CK6 A;  4DUY T;  2MBG A;  4M1P A;  4E7Z A;  3UQ4 A;  3LJC A;  2DCF A;  2X68 A;  4AQY T;  2KSR A;  3WI3 A;  5LG4 A;  1S94 A;  2XQ9 A;  4Q25 A;  4X1K E;  3CIR A;  1ZP0 A;  2Q9Q A;  2QYW A;  2MYS A;  2LKH A;  4HFI A;  4IDP A;  2E8I A;  2I59 A;  5HXC A;  4JI2 T;  3CWZ B;  2LSG A;  1LVK A;  2LRK A;  3QUJ A;  5HCJ A;  1J5E T;  3ZN1 B;  5HEO A;  3L39 A;  2ZLY A;  4UEM A;  1FJG T;  3EHZ A;  4DMW A;  2NP9 A;  5AQI B;  2M6B A;  1KNP A;  4LML A;  4HWF A;  4K0K T;  4BJM A;  5HAX A;  2FBW A;  3D0T A;  2E5L T;  2P9B A;  1LVF A;  1ZV4 X;  2I6H A;  2YEV C;  3VR8 A;  5L4E A;  3F2E A;  3Q5E A;  3IF8 B;  4I55 E;  1G73 A;  3OKQ A;  3UU4 A;  4ZI7 E;  3JCF A;  2L8K A;  3UUN A;  2EHO D;  3QNU A;  1NWM X;  5LYJ E;  2WDQ A;  4YSX A;  3AVS A;  2DHR A;  3AED A;  2LRL A;  3AXJ A;  5C8Y E;  1WCR A;  2DI4 A;  1KFY A;  4UV8 B;  4B6X A;  2HPJ A;  2PJQ A;  3B13 A;  1G8X A;  4X5T A;  4PW8 A;  2EHO A;  5FY1 A;  4IE5 A;  3RRC A;  2XUE A;  3C4X A;  3A5X A;  4GOU A;  5A1L A;  4BJN A;  3UT5 E;  3P8C D;  2JMH A;  2V7I A;  2Y48 B;  3KV4 A;  1D1C A;  2JPF A;  2MPK A;  3N9M A;  2XQ3 A;  5CB4 E;  4YFS A;  3NKZ A;  2CXD A;  3ZYK A;  5CGM A;  2XQY A;  3V5S A;  3I9W A;  3N9Q A;  3C64 A;  1HX8 A;  2W0G A;  1QUU A;  2VL8 A;  5F3J A;  1SE7 A;  3SFE A;  3RIF A;  5L3F B;  4X1I E;  3RIA A;  3QOF A;  4YTM A;  2BS4 A;  2CHN A;  4DVD A;  2YKS A;  4DR2 T;  2CPT A;  3AE5 A;  2XM1 A;  3ZT7 A;  4PFP A;  5LJN A;  4JV5 T;  5LJM A;  5JRC A;  5HXS A;  5FXV A;  3B57 A;  1HTJ F;  2IAK A;  3PUR A;  4EAH A;  5LMU T;  4YJ2 E;  1T8B A;  3JAF A;  1UX5 A;  5AQL B;  3RQW A;  3IHR A;  5JRE A;  4JUY A;  2ZMA A;  3OTO T;  3FXE B;  4KUM B;  2J1D G;  4ADZ A;  3K8P C;  1SUM B;  4AQF A;  4IDN A;  1HG5 A;  3FXD B;  4PAG A;  2W4X A;  4U31 A;  2WWU A;  5LOV E;  2A3D A;  4OYK A;  2H88 A;  4AIS A;  2LLY A;  2V5C A;  2IW5 B;  3E0Z A;  2W62 A;  2LM9 A;  3KBT A;  4ASK A;  2NOX A;  4EEB A;  3O1H A;  4UF0 B;  2NR4 A;  3QB5 A;  3DJB A;  5JDF A;  4KMC A;  1BR2 A;  4IDO A;  5DQW A;  5LHG B;  4O4I E;  5F5W A;  2YN6 A;  2DLR A;  3EAM A;  1WR0 A;  3Q5X A;  1HG2 A;  1GQE A;  2E9X D;  2XY8 B;  2MTQ A;  5HXH A;  4YXD A;  2X66 A;  4YLH A;  4GKK T;  3ZN0 B;  2L9Q A;  5DAB A;  2CE7 A;  5KX5 E;  2CHO A;  4DV6 T;  1MMN A;  5JH7 E;  5AQR B;  4HFE A;  4TN7 B;  2M6I A;  2YU1 A;  4YSY A;  2LHN A;  5CA0 E;  1LRZ A;  1Y01 A;  4TV8 E;  2QRX A;  2CXL A;  4AI6 A;  3A8Y C;  4IE4 A;  2E9X A;  4O2B E;  4CXW A;  4HEA A;  2HH7 A;  1X9B A;  2LOP A;  4KHZ F;  5LP6 E;  3VKG A;  2V5D A;  1OED E;  4OX9 T;  4ILB A;  5E0O A;  4XAX B;  3UUL A;  1OED C;  4LFC T;  4QXC B;  2WU5 A; 
#chains in the Genus database with same CATH homology
 1W9R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...