1W9RA

Solution structure of choline binding protein a, domain r2, the major adhesin of streptococcus pneumoniae
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
119
structure length
119
Chain Sequence
GSHMPEKKVAEAEKKVEEAKKKAEDQKEEDRRNYPTNTYKTLELEIAESDVEVKKAELELVKEEAKEPRNEEKVKQAKAEVESKKAEATRLEKIKTDRKKAEEEAKRKAAEEDKVKEKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Receptor
molecule keywords CHOLINE BINDING PROTEIN A
publication title Solution Structure of Choline Binding Protein A, the Major Adhesin of Streptococcus Pneumoniae
pubmed doi rcsb
source organism Streptococcus pneumoniae
total genus 47
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2004-10-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.440 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 choline binding protein A 1w9rA00
1W9RA
chains in the Genus database with same CATH superfamily
5CGMA 3ZKRA 5HAXA 3GMIA 5HXCA 3AEFA 5ADXL 5L3CB 4TUYE 3RRCA 1S35A 4K0KT 2W0GA 4PW8A 2DHRA 3N9QA 4H9OC 3BQKA 3UU4A 3IEEA 5JDQA 3FZFB 3ZN0B 3FHNA 4PNIA 3AA1B 2BBHA 5C2TA 4H63H 5CA0E 3ZMTB 4JI3T 4AKRB 1M62A 5JR9B 3CVRA 2V1DB 3Q5WA 5JREA 4M1PA 1J1JA 2NW8A 4UVCB 4UV8B 2MYSA 4DBRA 1FIOA 1VCSA 4IHJE 3ZCJA 5LHHB 3PU8A 2XZEA 2X67A 2JMHA 4IDOA 5FVKA 5LXTE 3PV0F 3NRXA 4U2YA 3RIAA 3LK2B 1T98A 1BR1A 2V8SV 3K3QC 3AAEB 5DJQC 4A56A 3N9NA 4U31A 1X9BA 3MXZA 3O4XE 3N2KE 1OXZA 2MPKA 1SUMB 2JJ9A 2WS3A 1MIWA 2BKOA 2VKOA 3P7IA 3E08A 4H9SE 3ZSTA 5LMNT 5LB7B 5JDHA 2IC6A 3N9MA 4CXXA 3TLSA 1VCTA 2CWOA 2X0YA 4OYJA 5L3GB 2XQ5A 2E2AA 1ZOYA 3LK42 3OYXA 3I0QA 3K1SA 2ACXA 5KDMC 4MFRA 3ETVA 4I43B 2VL0A 3P50A 4TWDA 2NOXA 2X0HA 3JAFA 2WSSV 3HKEE 2KT9A 2DCFA 5HEOA 4XBFB 2LSYA 4AQYT 1WCRA 2YKSA 1I6ZA 1UCUA 5TAOA 3C98B 4CN6A 3UU8A 3E22E 5KX5E 4JI6T 2EHOA 4PJMA 4HFDA 1QSDA 4BAYB 2FJEA 3RC3A 4ZZBA 2UXNB 2VWAA 2XAJB 2W2UA 5FL1A 3KV6A 2M6BA 3AE8A 2N1GA 4DR2T 3E0ZA 3Q5DA 4DMVA 4DUZT 4PFOA 4HWFA 2E9XA 2XHEB 4DV7T 1HNWT 4ISSA 2IW5B 2WQYA 2EHOB 3AA6B 2W67A 2CXLA 3S4UA 4UEMA 3AEEA 4PK6A 4LFAT 2CBIA 1HF8A 5FNVE 4B3MT 3MJXA 3ESLA 3SFEA 4DV0T 2KINB 4TWHA 3UU5A 3OPCA 2E9XB 1B7TA 3UULA 4EB6E 4BA9A 2WU5A 4C91A 3I9YA 4CQIA 2WU2A 4CI1B 1WFDA 1SHZC 5LCYA 3SWHA 2RP4A 4EIWA 3RYCE 2HN2A 2J4GA 2LM9A 4TV9E 1X79A 2YEVC 3RX6A 3RGLA 4PJNA 2WAUA 4DV5T 1J5WA 2YU1A 5FXWA 4YJ2E 3C51A 3HR0A 5EK2A 2H88A 2FUPA 1S94A 1HNXT 3ZN1B 3RI5A 1L0VA 4B6XA 1YW0A 3WI3A 3L3PA 4DV4T 1IBKT 2FJBA 1BR0A 3OVUA 5LG3A 2D5UA 2VVSA 2XSBA 2XQ9A 2W66A 3LBXB 2CA5A 4YJ3E 3ZPOA 2KLQA 5AQGB 2LOSA 4UXNB 1T7SA 3CQXC 4I4TE 5LHIB 2C5IT 2AE9A 2UU9T 4U33A 5JDFA 4OFZA 2V7IA 2BVLA 2NTXA 3ONJA 2EHOC 2RPAA 1SE7A 2B1EA 1ZEEA 2ZM6T 2WWUA 4QX7B 5CJ5A 1SA0E 2WY2A 4LMLA 4FJOA 1GQEA 4CXYA 5L3EB 4DMWA 4ZI7E 3ZMVB 2N9DA 3CK6A 2QYWA 3N9LA 1I94T 4HFBA 2PFVA 5FXXA 2QVAA 5LYJE 3CWZB 2J1DG 4PFPA 3RIFA 1D0YA 3I9WA 4QHOA 3TLWA 2E9XC 5AQUB 2WDVA 5L4EA 4EEDA 4ZS3A 2F4VT 2I59A 4NIQA 2ZM2A 2CRBA 2YDQA 2DLRA 3RQWA 5AQNB 4EYUA 2NW9A 4IL4A 2IUBA 5ETWA 4QX8B 2JIWA 5LMUT 3B13A 3FBZA 3M3ZB 2PG8A 4Q25A 3CQGB 3C4ZA 2XM2A 3LK3B 4H9QC 1KK7A 2ACZA 3O1IA 1WRDA 2KWHA 5LBQB 3KV4A 4DIDB 4YSZA 2HH7A 4Z90A 1ZKEA 2NTYA 1M7KA 3RQUA 4UVAB 3UU3A 1FMWA 4IDZA 2CMRA 1HG5A 4P0AA 2VVNA 2WMNA 3UUMA 4UR9A 3ZMSB 2D0TA 3ZMUB 3Q2MA 4AKIA 4H9PC 2K9AA 5HWXA 3AEDA 4DV2T 5AQSB 3MACA 3G06A 4HWDA 3D0TA 2C5JA 2JQHA 3IA3A 5FY7A 4LF7T 1U4QA 2Q9QA 3C4WA 4PJJA 5FMNA 1IBLT 4H9RC 1V9DA 5M4YA 1IZNB 3N9OA 3VR9A 3OKQA 5LG4A 4KP3C 5FP3A 2CBJA 5H6QB 5FVLA 1OWAA 5JDMA 2L8KA 3NWIA 3H3AA 2Q9QB 2KMFA 4ZI2D 2WBLA 2V7LA 3Q9DA 2XAGB 3U78A 4YTPA 2W62A 1MMDA 2VKJA 4B3TT 4TNVA 2QGSA 3K3OA 2YN6A 5EK3A 2YDSA 2XY8B 2NW7A 3RC8A 4IL9A 2OV9A 2A3DA 3ZYKA 2XQ3A 3VU7H 1MMNA 5JDLA 4OHFA 3IHRA 4DV1T 4GK5E 4WBNE 1HTJF 2CXDA 4IE0A 4DNDA 3TLVA 1ZP0A 2OA5A 1UX4A 3FXDB 2WP9A 2WZIA 4AISA 5J2TE 1KNZA 3AE1A 5LGTB 1YQ4A 3BQLA 2CLYC 4DV6T 1D0ZA 3QC9A 2XQAA 1UK5A 2JMKA 1QLBA 4ASKA 1R8IA 2J62A 5L3DB 2XQYA 2XAQB 1YXRA 4PJLA 1HX1B 2CPTA 4TV8E 3PUXF 3AE7A 4FI5A 4ZZCA 3P4QA 4P09A 3MKDA 3UFEA 4CN4A 4JI2T 4ILAA 1QUUA 4I50E 3LFMA 4O4HE 4HKAA 1HR0T 3MA9A 2BG9A 2XUEA 2UUBT 2VQET 2Q9QC 3ZSSA 4NUVA 3RF1A 5AQIB 4YLHA 3F57A 4JI4T 2XJ7A 3EDUA 3K3NA 3NBXX 5LHGB 2UXCT 1HX8A 2D9DA 4YHHT 1LRZA 3QK6A 3OBVE 3ONXA 3RLFF 2V5CA 1O3XA 3AE9A 3JCFA 1LKXA 3F2EA 1G73A 5JDNA 4KI0F 3NVOA 1JNRA 2XAHB 2BG9B 5HYAA 4P1NA 2NP9A 3VKGA 4DVDA 3ZJ2A 3RYHE 3P4PA 4YSYA 3CKDA 3ONLC 3T8OA 2XSAA 4IE6A 4ADZA 2K3WA 4IDNA 3N9PA 2IHR1 1D1BA 3ZT5A 4EGWA 3O9XA 4JI1T 5AQVB 5LGNB 4AQFA 2V6YA 4GYRA 1E2AA 4ZHQE 1XDOA 4JI8T 2DI4A 1OEDE 3I0OA 1MIVA 2V5DA 5HEGA 1HNZT 3EI0A 5HEJA 2X51A 5FYMA 2A72A 2Z6EA 3JC6D 4KUMB 2ZMAA 2V6YB 2BS3A 5HXHA 1N36T 3GN5A 3L09A 2ODUA 4JBWF 4ZI3D 1IJ6A 3C4XA 3DJBA 5CFBA 5ABFA 5FXZA 4X5TA 3AE5A 3VHLA 2ZLYA 2W63A 4JI7T 4TZ4C 2DWKA 2H7OA 3PTRB 3AE2A 5J0ZA 5AQHB 3X1DA 1W0BA 1XNQT 2NWBA 1BR4A 4EAHA 2L3LA 1Z0PA 3WAKA 2K48A 3ZT6A 4HFIA 3GN5B 1XNRT 4HWHA 3HL6A 4TNWA 2PTFA 4G63A 4EV6A 1VOMA 2X9WA 3B57A 5ABFB 4QH4A 2CHNA 2H7VC 3RYIE 3V5SA 2CCQA 1HG2A 3L39A 3P4RA 2BG9C 4HEAA 4WYVA 4YSXA 3PUVF 2CM0A 2UUCT 4A98A 3ZMZB 4LF4T 5AQRB 2WWVA 2V6XA 3HKCE 2MBGA 2BS4A 5L47A 3SOLA 3KBUA 4EXTA 3CX6B 3RIUC 3QB5A 3KFWX 4YFSA 3CIRA 4ZXLA 4U7IA 1U5PA 2BDEA 2ZM8A 3AEAA 4PAGA 2B76A 5AQMB 3Q5EA 4YXDA 3K8PC 4HFCA 4JI0T 3OYZA 3IF8B 2YDRA 3MK7C 4HFHA 3AAAB 4H9NC 2LLYA 3T1YT 3AVSA 3SRZA 3AEBA 5HEUA 3RKOA 3CPZA 4IE7A 2LSKA 4N78D 1H7CA 3UQ7A 4U74A 3JADA 5AFUL 4IIJE 4EZ4A 4NXNT 4CI3B 3EUHA 1DU2A 1NAFA 2ODVA 4AQFC 5JQGE 4IT4A 3CMLA 3PU3A 4QXHB 4ILCA 3UUNA 4F8HA 3R6NA 3QNUA 5BR8T 3TKLB 2VKHA 2PBIA 2SPCA 1FMVA 5IUXA 4CZZB 3LDQB 3AE6A 3BQIA 2K5BB 2WCAA 4G2AA 2Y48B 3ZLIA 1YD8G 1EZ3A 4BJNA 2BVMA 5E0OA 3L8RA 2V7KA 4DR4T 4L5GA 4ZS2A 3SFDA 2KSRA 1KF6A 1D1AA 2BZBA 3LJCA 4X62T 4NPPA 2X9HA 4U7YA 4AKLA 3ABVA 2MAWA 3CX7B 1WR0A 2LHRA 5F8PA 4AI6A 5HWYA 3PJAA 3JAEA 3AXJA 4ISTA 4GKKT 3P8CD 4GIWA 4A5XA 3AB3B 3C64A 2CLYB 4WW0A 4YHJA 2E5LT 4YTMA 3NZPA 4ILBA 5HXSA 2W4XA 5H6RB 3HKDE 2DWGA 3I1AA 5AQFB 2KNDA 2WMOA 1W9RA 1IJ5A 1XMOT 2IDOB 3AXJB 3AE3A 1XWMA 3ANWA 2E5VA 4QXBB 2IIUA 1MIYA 4NXMT 2UXDT 3A7MA 2VL8A 5FL0A 5AQLB 5LBMA 2XQ4A 1FEWA 1E1HB 5C3JA 2GK9A 3FXEB 4YTNA 2KZ7B 4L9IA 2NR4A 5ABHA 2LSIA 3PUWF 5J2UE 2WDRA 4OX9T 4X66T 2LKHA 4PK4A 3EABA 2JQKA 4H63V 5LJMA 1JNZA 2H3RA 2X9XA 2C0SA 2KWIB 1FJGT 2L9QA 4HFEA 4DR5T 1IAPA 2VQFT 3ZYLA 3ZEFB 2FBWA 1KNPA 3A8YC 3HA4A 5IWAT 4UV9B 2R6GF 3C50A 1YKEB 2M6IA 4O4LE 3PUYF 5GONE 2CEAA 4X1IE 5JR9A 5LOVE 1Z8UA 3V5UA 5LJNA 3NKZA 3VRAA 5DQVA 2LRLA 1CHUA 4WNKA 1XZYA 3ZT7A 1BR2A 3ZC1A 3N2OA 3AECA 2QA7A 3QOFA 3FZHB 4HWIB 1HCIA 2E8IA 3CX8B 1NWMX 1W09A 2LRKA 4JYAT 3O1JA 5HCJA 2IC9A 5FY1A 4AIUA 3AA0B 2PJQA 4MBQA 4O4IE 3VR8A 3QB5K 5HEHA 3ZC0A 3N5LA 1YKHB 3U3IA 4DR7T 2BKNA 2V7MA 3TLUA 1MMGA 2LSGA 5EZYE 4KBMB 2QRXA 3HKBE 3UTKA 3SS1A 4JI5T 4JUYA 2JPFA 2YK0A 3KVAA 3MZKB 2UXXB 4CXWA 2C5KT 2I6HA 4V1Av 4O2BE 2WM9A 4LF8T 3ZCIA 4O4JE 2D2SA 4GYSA 2YU2A 3KDSE 2MOZA 4HN9A 4DUYT 4UELA 3RH3A 3AEGA 4LMKA 1KEYA 3RIUA 5BMVE 4I55E 2DL1A 3PUAA 4HGAA 2BS2A 4KHZF 4ZI2C 2A2FX 4AQGA 4QWNB 4UIGA 1US7B 3ZYMA 2XQ6A 5LGUB 2H89A 3AVRA 3RHWA 1J5ET 2W00A 2JQ9A 4LF5T 3AAIA 4E7SA 4B3RT 4IGUA 3AA7B 4GKJT 5IHYA 3P4WA 3IBPA 5KXJA 3FZMB 4A97A 2VKDA 2LHNA 2YINA 5JRCA 3A5XA 2XASB 2X0LB 5L4HA 5ABEA 1WR6A 2HN1A 3RRWA 2LEHA 5AQJB 5A1LA 4TN7B 5LNKA 5JR9C 4IDQA 2EHOD 1IBMT 2FJAA 4MLKA 5KMGP 1WYBA 5AQTB 1WLXA 5AQPB 2P9BA 3VKHA 4WZXA 2UXBT 4MHCA 5FXVA 4CN1A 1HFAA 3UT5E 5EK4A 5JRCB 2IMLA 3KV5A 1UURA 5L3FB 3P4SA 5IYZE 1Y01A 3OTOT 2E9XD 2LOPA 1N34T 1T72A 5JH7E 2HPJA 1E7PA 1W0AA 4GK0E 4ANJA 4CI2B 3EAMA 2X9YA 2IAKA 2XAFB 3M65A 1MMAA 3RPUA 4IE4A 4X1YE 2VK9A 5DQWA 5J1GA 4JEHB 2LE8A 3OJAA 3PUSA 3NRYA 3PUQA 5JVDE 3AE4A 4X1KE 3N2GE 3O1HA 5JTGA 4JEUB 3DTOA 4XZCA 3LSVA 4COFA 3EVYA 1LVKA 3UU6A 3WAJA 4X64T 2M67A 1D0XA 3H37A 4IDPA 4EEBA 3FZLB 4AKGA 1AJ3A 1KNRA 5CA1E 2K24A 3PE0A 2VB6A 2FJDA 2VURA 3LBXA 3PJAJ 3F31A 3RKGA 4NUUA 5CB4E 4PK5A 3W15B 1NENA 1UGOA 3UUBA 3KVBA 4XAXB 4GOUA 1UX5A 2VASA 2XM1A 4K0UA 2D0UA 2JQQA 1HS7A 3VRBA 2WDQA 2CE7A 4HTEA 4EYYR 2HPLA 2BKPA 5DABA 4QXCB 2V7JA 4Z91A 3J9X1 2XPKA 4LF9T 4DO0A 3HI2A 4QKNA 3ZJ1A 4L0RA 4ZOLE 2LM2A 4LFCT 2RA1A 4IE5A 5AQKB 4TWFA 4LMJA 2LKGA 2LT3A 2UUAT 1CUNA 2HHHT 3PUZF 1XMQT 3Q5XA 1LVFA 1OEDA 1NEKA 4DR1T 4DR6T 3QUJA 1WYCA 1VRBA 4ERRA 4EOZB 2V26A 3JC6C 4YT0A 3PURA 4KX6A 2WB5A 2MTQA 4ZI3C 2CXFA 4F6RC 3KBTA 3B5MA 5AQOB 3H3MA 5FKYA 1OEDB 3FBLA 3ETUA 4AXPA 3UUXB 1XDPA 2YOEA 5L3BB 4C90A 5L2LA 3GA8A 4E7ZA 5ABGA 5LP6E 1MNEA 4U2ZA 2CWYA 2OLTA 4B3ST 2WZHA 3PDYA 3CQCB 3TLTA 1Y64B 4AKHA 2AXDS 1N33T 2XQ8A 4J2CA 2KXPB 4YY3T 4MALA 4OYKA 2CHOA 4UF0A 2J47A 2X68A 3FB2A 4U3CA 4DR3T 2G0UA 3GWHA 2I0MA 4LF6T 1ZV4X 4P0BA 3UQ4A 4EZHA 5HXEA 2A9UA 2ZM0A 4O8SA 3T1HT 4KMCA 4U72A 3PUGA 4QH5A 4JLEA 5LA6E 4X65T 2Y6XA 4JV5T 3FZKB 2BG9E 4UF0B 1MNDA 3RYFE 1G8XA 3UFGA 1ZHCA 4DBQA 2DNXA 4ZEYA 3EHZA 1YQ3A 2LSJA 4ILUA 4BJMA 4HE8A 5HXRA 3DP7A 1UUSA 3ANWB 3KV9A 4HFVA 5F5WA 2Q9QD 4QH1A 4O2AE 5JDGA 4HWCA 1KFYA 4LFBT 5FY0A 3NZQA 1N32T 2N2NA 2XQ7A 4UVBB 5C8YE 5F3JA 3J7Yq 2W61A 4I0UA 4Z8XA 2JRKA 2BBJA 2LJLA 4OK0A 1D1CA 3BK9A 4WBOA 1OEDC 3R84B 4TX5A 2XTLA 5AQQB 5HCMA 3KINB 1T8BA 4DV3T 4KHPT 4X20E 2X66A 2ES0A 3LG7A 3EDVA 2Y8DA 4IREA
chains in the Genus database with same CATH topology
1W9RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W9R A; 
#chains in the Genus database with same CATH topology
 5CGM A;  3ZKR A;  5HAX A;  3GMI A;  5HXC A;  3AEF A;  5ADX L;  5L3C B;  4TUY E;  3RRC A;  1S35 A;  4K0K T;  2W0G A;  4PW8 A;  2DHR A;  3N9Q A;  4H9O C;  3BQK A;  3UU4 A;  3IEE A;  5JDQ A;  3FZF B;  3ZN0 B;  3FHN A;  4PNI A;  3AA1 B;  2BBH A;  5C2T A;  4H63 H;  5CA0 E;  3ZMT B;  4JI3 T;  4AKR B;  1M62 A;  5JR9 B;  3CVR A;  2V1D B;  3Q5W A;  5JRE A;  4M1P A;  1J1J A;  2NW8 A;  4UVC B;  4UV8 B;  2MYS A;  4DBR A;  1FIO A;  1VCS A;  4IHJ E;  3ZCJ A;  5LHH B;  3PU8 A;  2XZE A;  2X67 A;  2JMH A;  4IDO A;  5FVK A;  5LXT E;  3PV0 F;  3NRX A;  4U2Y A;  3RIA A;  3LK2 B;  1T98 A;  1BR1 A;  2V8S V;  3K3Q C;  3AAE B;  5DJQ C;  4A56 A;  3N9N A;  4U31 A;  1X9B A;  3MXZ A;  3O4X E;  3N2K E;  1OXZ A;  2MPK A;  1SUM B;  2JJ9 A;  2WS3 A;  1MIW A;  2BKO A;  2VKO A;  3P7I A;  3E08 A;  4H9S E;  3ZST A;  5LMN T;  5LB7 B;  5JDH A;  2IC6 A;  3N9M A;  4CXX A;  3TLS A;  1VCT A;  2CWO A;  2X0Y A;  4OYJ A;  5L3G B;  2XQ5 A;  2E2A A;  1ZOY A;  3LK4 2;  3OYX A;  3I0Q A;  3K1S A;  2ACX A;  5KDM C;  4MFR A;  3ETV A;  4I43 B;  2VL0 A;  3P50 A;  4TWD A;  2NOX A;  2X0H A;  3JAF A;  2WSS V;  3HKE E;  2KT9 A;  2DCF A;  5HEO A;  4XBF B;  2LSY A;  4AQY T;  1WCR A;  2YKS A;  1I6Z A;  1UCU A;  5TAO A;  3C98 B;  4CN6 A;  3UU8 A;  3E22 E;  5KX5 E;  4JI6 T;  2EHO A;  4PJM A;  4HFD A;  1QSD A;  4BAY B;  2FJE A;  3RC3 A;  4ZZB A;  2UXN B;  2VWA A;  2XAJ B;  2W2U A;  5FL1 A;  3KV6 A;  2M6B A;  3AE8 A;  2N1G A;  4DR2 T;  3E0Z A;  3Q5D A;  4DMV A;  4DUZ T;  4PFO A;  4HWF A;  2E9X A;  2XHE B;  4DV7 T;  1HNW T;  4ISS A;  2IW5 B;  2WQY A;  2EHO B;  3AA6 B;  2W67 A;  2CXL A;  3S4U A;  4UEM A;  3AEE A;  4PK6 A;  4LFA T;  2CBI A;  1HF8 A;  5FNV E;  4B3M T;  3MJX A;  3ESL A;  3SFE A;  4DV0 T;  2KIN B;  4TWH A;  3UU5 A;  3OPC A;  2E9X B;  1B7T A;  3UUL A;  4EB6 E;  4BA9 A;  2WU5 A;  4C91 A;  3I9Y A;  4CQI A;  2WU2 A;  4CI1 B;  1WFD A;  1SHZ C;  5LCY A;  3SWH A;  2RP4 A;  4EIW A;  3RYC E;  2HN2 A;  2J4G A;  2LM9 A;  4TV9 E;  1X79 A;  2YEV C;  3RX6 A;  3RGL A;  4PJN A;  2WAU A;  4DV5 T;  1J5W A;  2YU1 A;  5FXW A;  4YJ2 E;  3C51 A;  3HR0 A;  5EK2 A;  2H88 A;  2FUP A;  1S94 A;  1HNX T;  3ZN1 B;  3RI5 A;  1L0V A;  4B6X A;  1YW0 A;  3WI3 A;  3L3P A;  4DV4 T;  1IBK T;  2FJB A;  1BR0 A;  3OVU A;  5LG3 A;  2D5U A;  2VVS A;  2XSB A;  2XQ9 A;  2W66 A;  3LBX B;  2CA5 A;  4YJ3 E;  3ZPO A;  2KLQ A;  5AQG B;  2LOS A;  4UXN B;  1T7S A;  3CQX C;  4I4T E;  5LHI B;  2C5I T;  2AE9 A;  2UU9 T;  4U33 A;  5JDF A;  4OFZ A;  2V7I A;  2BVL A;  2NTX A;  3ONJ A;  2EHO C;  2RPA A;  1SE7 A;  2B1E A;  1ZEE A;  2ZM6 T;  2WWU A;  4QX7 B;  5CJ5 A;  1SA0 E;  2WY2 A;  4LML A;  4FJO A;  1GQE A;  4CXY A;  5L3E B;  4DMW A;  4ZI7 E;  3ZMV B;  2N9D A;  3CK6 A;  2QYW A;  3N9L A;  1I94 T;  4HFB A;  2PFV A;  5FXX A;  2QVA A;  5LYJ E;  3CWZ B;  2J1D G;  4PFP A;  3RIF A;  1D0Y A;  3I9W A;  4QHO A;  3TLW A;  2E9X C;  5AQU B;  2WDV A;  5L4E A;  4EED A;  4ZS3 A;  2F4V T;  2I59 A;  4NIQ A;  2ZM2 A;  2CRB A;  2YDQ A;  2DLR A;  3RQW A;  5AQN B;  4EYU A;  2NW9 A;  4IL4 A;  2IUB A;  5ETW A;  4QX8 B;  2JIW A;  5LMU T;  3B13 A;  3FBZ A;  3M3Z B;  2PG8 A;  4Q25 A;  3CQG B;  3C4Z A;  2XM2 A;  3LK3 B;  4H9Q C;  1KK7 A;  2ACZ A;  3O1I A;  1WRD A;  2KWH A;  5LBQ B;  3KV4 A;  4DID B;  4YSZ A;  2HH7 A;  4Z90 A;  1ZKE A;  2NTY A;  1M7K A;  3RQU A;  4UVA B;  3UU3 A;  1FMW A;  4IDZ A;  2CMR A;  1HG5 A;  4P0A A;  2VVN A;  2WMN A;  3UUM A;  4UR9 A;  3ZMS B;  2D0T A;  3ZMU B;  3Q2M A;  4AKI A;  4H9P C;  2K9A A;  5HWX A;  3AED A;  4DV2 T;  5AQS B;  3MAC A;  3G06 A;  4HWD A;  3D0T A;  2C5J A;  2JQH A;  3IA3 A;  5FY7 A;  4LF7 T;  1U4Q A;  2Q9Q A;  3C4W A;  4PJJ A;  5FMN A;  1IBL T;  4H9R C;  1V9D A;  5M4Y A;  1IZN B;  3N9O A;  3VR9 A;  3OKQ A;  5LG4 A;  4KP3 C;  5FP3 A;  2CBJ A;  5H6Q B;  5FVL A;  1OWA A;  5JDM A;  2L8K A;  3NWI A;  3H3A A;  2Q9Q B;  2KMF A;  4ZI2 D;  2WBL A;  2V7L A;  3Q9D A;  2XAG B;  3U78 A;  4YTP A;  2W62 A;  1MMD A;  2VKJ A;  4B3T T;  4TNV A;  2QGS A;  3K3O A;  2YN6 A;  5EK3 A;  2YDS A;  2XY8 B;  2NW7 A;  3RC8 A;  4IL9 A;  2OV9 A;  2A3D A;  3ZYK A;  2XQ3 A;  3VU7 H;  1MMN A;  5JDL A;  4OHF A;  3IHR A;  4DV1 T;  4GK5 E;  4WBN E;  1HTJ F;  2CXD A;  4IE0 A;  4DND A;  3TLV A;  1ZP0 A;  2OA5 A;  1UX4 A;  3FXD B;  2WP9 A;  2WZI A;  4AIS A;  5J2T E;  1KNZ A;  3AE1 A;  5LGT B;  1YQ4 A;  3BQL A;  2CLY C;  4DV6 T;  1D0Z A;  3QC9 A;  2XQA A;  1UK5 A;  2JMK A;  1QLB A;  4ASK A;  1R8I A;  2J62 A;  5L3D B;  2XQY A;  2XAQ B;  1YXR A;  4PJL A;  1HX1 B;  2CPT A;  4TV8 E;  3PUX F;  3AE7 A;  4FI5 A;  4ZZC A;  3P4Q A;  4P09 A;  3MKD A;  3UFE A;  4CN4 A;  4JI2 T;  4ILA A;  1QUU A;  4I50 E;  3LFM A;  4O4H E;  4HKA A;  1HR0 T;  3MA9 A;  2BG9 A;  2XUE A;  2UUB T;  2VQE T;  2Q9Q C;  3ZSS A;  4NUV A;  3RF1 A;  5AQI B;  4YLH A;  3F57 A;  4JI4 T;  2XJ7 A;  3EDU A;  3K3N A;  3NBX X;  5LHG B;  2UXC T;  1HX8 A;  2D9D A;  4YHH T;  1LRZ A;  3QK6 A;  3OBV E;  3ONX A;  3RLF F;  2V5C A;  1O3X A;  3AE9 A;  3JCF A;  1LKX A;  3F2E A;  1G73 A;  5JDN A;  4KI0 F;  3NVO A;  1JNR A;  2XAH B;  2BG9 B;  5HYA A;  4P1N A;  2NP9 A;  3VKG A;  4DVD A;  3ZJ2 A;  3RYH E;  3P4P A;  4YSY A;  3CKD A;  3ONL C;  3T8O A;  2XSA A;  4IE6 A;  4ADZ A;  2K3W A;  4IDN A;  3N9P A;  2IHR 1;  1D1B A;  3ZT5 A;  4EGW A;  3O9X A;  4JI1 T;  5AQV B;  5LGN B;  4AQF A;  2V6Y A;  4GYR A;  1E2A A;  4ZHQ E;  1XDO A;  4JI8 T;  2DI4 A;  1OED E;  3I0O A;  1MIV A;  2V5D A;  5HEG A;  1HNZ T;  3EI0 A;  5HEJ A;  2X51 A;  5FYM A;  2A72 A;  2Z6E A;  3JC6 D;  4KUM B;  2ZMA A;  2V6Y B;  2BS3 A;  5HXH A;  1N36 T;  3GN5 A;  3L09 A;  2ODU A;  4JBW F;  4ZI3 D;  1IJ6 A;  3C4X A;  3DJB A;  5CFB A;  5ABF A;  5FXZ A;  4X5T A;  3AE5 A;  3VHL A;  2ZLY A;  2W63 A;  4JI7 T;  4TZ4 C;  2DWK A;  2H7O A;  3PTR B;  3AE2 A;  5J0Z A;  5AQH B;  3X1D A;  1W0B A;  1XNQ T;  2NWB A;  1BR4 A;  4EAH A;  2L3L A;  1Z0P A;  3WAK A;  2K48 A;  3ZT6 A;  4HFI A;  3GN5 B;  1XNR T;  4HWH A;  3HL6 A;  4TNW A;  2PTF A;  4G63 A;  4EV6 A;  1VOM A;  2X9W A;  3B57 A;  5ABF B;  4QH4 A;  2CHN A;  2H7V C;  3RYI E;  3V5S A;  2CCQ A;  1HG2 A;  3L39 A;  3P4R A;  2BG9 C;  4HEA A;  4WYV A;  4YSX A;  3PUV F;  2CM0 A;  2UUC T;  4A98 A;  3ZMZ B;  4LF4 T;  5AQR B;  2WWV A;  2V6X A;  3HKC E;  2MBG A;  2BS4 A;  5L47 A;  3SOL A;  3KBU A;  4EXT A;  3CX6 B;  3RIU C;  3QB5 A;  3KFW X;  4YFS A;  3CIR A;  4ZXL A;  4U7I A;  1U5P A;  2BDE A;  2ZM8 A;  3AEA A;  4PAG A;  2B76 A;  5AQM B;  3Q5E A;  4YXD A;  3K8P C;  4HFC A;  4JI0 T;  3OYZ A;  3IF8 B;  2YDR A;  3MK7 C;  4HFH A;  3AAA B;  4H9N C;  2LLY A;  3T1Y T;  3AVS A;  3SRZ A;  3AEB A;  5HEU A;  3RKO A;  3CPZ A;  4IE7 A;  2LSK A;  4N78 D;  1H7C A;  3UQ7 A;  4U74 A;  3JAD A;  5AFU L;  4IIJ E;  4EZ4 A;  4NXN T;  4CI3 B;  3EUH A;  1DU2 A;  1NAF A;  2ODV A;  4AQF C;  5JQG E;  4IT4 A;  3CML A;  3PU3 A;  4QXH B;  4ILC A;  3UUN A;  4F8H A;  3R6N A;  3QNU A;  5BR8 T;  3TKL B;  2VKH A;  2PBI A;  2SPC A;  1FMV A;  5IUX A;  4CZZ B;  3LDQ B;  3AE6 A;  3BQI A;  2K5B B;  2WCA A;  4G2A A;  2Y48 B;  3ZLI A;  1YD8 G;  1EZ3 A;  4BJN A;  2BVM A;  5E0O A;  3L8R A;  2V7K A;  4DR4 T;  4L5G A;  4ZS2 A;  3SFD A;  2KSR A;  1KF6 A;  1D1A A;  2BZB A;  3LJC A;  4X62 T;  4NPP A;  2X9H A;  4U7Y A;  4AKL A;  3ABV A;  2MAW A;  3CX7 B;  1WR0 A;  2LHR A;  5F8P A;  4AI6 A;  5HWY A;  3PJA A;  3JAE A;  3AXJ A;  4IST A;  4GKK T;  3P8C D;  4GIW A;  4A5X A;  3AB3 B;  3C64 A;  2CLY B;  4WW0 A;  4YHJ A;  2E5L T;  4YTM A;  3NZP A;  4ILB A;  5HXS A;  2W4X A;  5H6R B;  3HKD E;  2DWG A;  3I1A A;  5AQF B;  2KND A;  2WMO A;  1W9R A;  1IJ5 A;  1XMO T;  2IDO B;  3AXJ B;  3AE3 A;  1XWM A;  3ANW A;  2E5V A;  4QXB B;  2IIU A;  1MIY A;  4NXM T;  2UXD T;  3A7M A;  2VL8 A;  5FL0 A;  5AQL B;  5LBM A;  2XQ4 A;  1FEW A;  1E1H B;  5C3J A;  2GK9 A;  3FXE B;  4YTN A;  2KZ7 B;  4L9I A;  2NR4 A;  5ABH A;  2LSI A;  3PUW F;  5J2U E;  2WDR A;  4OX9 T;  4X66 T;  2LKH A;  4PK4 A;  3EAB A;  2JQK A;  4H63 V;  5LJM A;  1JNZ A;  2H3R A;  2X9X A;  2C0S A;  2KWI B;  1FJG T;  2L9Q A;  4HFE A;  4DR5 T;  1IAP A;  2VQF T;  3ZYL A;  3ZEF B;  2FBW A;  1KNP A;  3A8Y C;  3HA4 A;  5IWA T;  4UV9 B;  2R6G F;  3C50 A;  1YKE B;  2M6I A;  4O4L E;  3PUY F;  5GON E;  2CEA A;  4X1I E;  5JR9 A;  5LOV E;  1Z8U A;  3V5U A;  5LJN A;  3NKZ A;  3VRA A;  5DQV A;  2LRL A;  1CHU A;  4WNK A;  1XZY A;  3ZT7 A;  1BR2 A;  3ZC1 A;  3N2O A;  3AEC A;  2QA7 A;  3QOF A;  3FZH B;  4HWI B;  1HCI A;  2E8I A;  3CX8 B;  1NWM X;  1W09 A;  2LRK A;  4JYA T;  3O1J A;  5HCJ A;  2IC9 A;  5FY1 A;  4AIU A;  3AA0 B;  2PJQ A;  4MBQ A;  4O4I E;  3VR8 A;  3QB5 K;  5HEH A;  3ZC0 A;  3N5L A;  1YKH B;  3U3I A;  4DR7 T;  2BKN A;  2V7M A;  3TLU A;  1MMG A;  2LSG A;  5EZY E;  4KBM B;  2QRX A;  3HKB E;  3UTK A;  3SS1 A;  4JI5 T;  4JUY A;  2JPF A;  2YK0 A;  3KVA A;  3MZK B;  2UXX B;  4CXW A;  2C5K T;  2I6H A;  4V1A v;  4O2B E;  2WM9 A;  4LF8 T;  3ZCI A;  4O4J E;  2D2S A;  4GYS A;  2YU2 A;  3KDS E;  2MOZ A;  4HN9 A;  4DUY T;  4UEL A;  3RH3 A;  3AEG A;  4LMK A;  1KEY A;  3RIU A;  5BMV E;  4I55 E;  2DL1 A;  3PUA A;  4HGA A;  2BS2 A;  4KHZ F;  4ZI2 C;  2A2F X;  4AQG A;  4QWN B;  4UIG A;  1US7 B;  3ZYM A;  2XQ6 A;  5LGU B;  2H89 A;  3AVR A;  3RHW A;  1J5E T;  2W00 A;  2JQ9 A;  4LF5 T;  3AAI A;  4E7S A;  4B3R T;  4IGU A;  3AA7 B;  4GKJ T;  5IHY A;  3P4W A;  3IBP A;  5KXJ A;  3FZM B;  4A97 A;  2VKD A;  2LHN A;  2YIN A;  5JRC A;  3A5X A;  2XAS B;  2X0L B;  5L4H A;  5ABE A;  1WR6 A;  2HN1 A;  3RRW A;  2LEH A;  5AQJ B;  5A1L A;  4TN7 B;  5LNK A;  5JR9 C;  4IDQ A;  2EHO D;  1IBM T;  2FJA A;  4MLK A;  5KMG P;  1WYB A;  5AQT B;  1WLX A;  5AQP B;  2P9B A;  3VKH A;  4WZX A;  2UXB T;  4MHC A;  5FXV A;  4CN1 A;  1HFA A;  3UT5 E;  5EK4 A;  5JRC B;  2IML A;  3KV5 A;  1UUR A;  5L3F B;  3P4S A;  5IYZ E;  1Y01 A;  3OTO T;  2E9X D;  2LOP A;  1N34 T;  1T72 A;  5JH7 E;  2HPJ A;  1E7P A;  1W0A A;  4GK0 E;  4ANJ A;  4CI2 B;  3EAM A;  2X9Y A;  2IAK A;  2XAF B;  3M65 A;  1MMA A;  3RPU A;  4IE4 A;  4X1Y E;  2VK9 A;  5DQW A;  5J1G A;  4JEH B;  2LE8 A;  3OJA A;  3PUS A;  3NRY A;  3PUQ A;  5JVD E;  3AE4 A;  4X1K E;  3N2G E;  3O1H A;  5JTG A;  4JEU B;  3DTO A;  4XZC A;  3LSV A;  4COF A;  3EVY A;  1LVK A;  3UU6 A;  3WAJ A;  4X64 T;  2M67 A;  1D0X A;  3H37 A;  4IDP A;  4EEB A;  3FZL B;  4AKG A;  1AJ3 A;  1KNR A;  5CA1 E;  2K24 A;  3PE0 A;  2VB6 A;  2FJD A;  2VUR A;  3LBX A;  3PJA J;  3F31 A;  3RKG A;  4NUU A;  5CB4 E;  4PK5 A;  3W15 B;  1NEN A;  1UGO A;  3UUB A;  3KVB A;  4XAX B;  4GOU A;  1UX5 A;  2VAS A;  2XM1 A;  4K0U A;  2D0U A;  2JQQ A;  1HS7 A;  3VRB A;  2WDQ A;  2CE7 A;  4HTE A;  4EYY R;  2HPL A;  2BKP A;  5DAB A;  4QXC B;  2V7J A;  4Z91 A;  3J9X 1;  2XPK A;  4LF9 T;  4DO0 A;  3HI2 A;  4QKN A;  3ZJ1 A;  4L0R A;  4ZOL E;  2LM2 A;  4LFC T;  2RA1 A;  4IE5 A;  5AQK B;  4TWF A;  4LMJ A;  2LKG A;  2LT3 A;  2UUA T;  1CUN A;  2HHH T;  3PUZ F;  1XMQ T;  3Q5X A;  1LVF A;  1OED A;  1NEK A;  4DR1 T;  4DR6 T;  3QUJ A;  1WYC A;  1VRB A;  4ERR A;  4EOZ B;  2V26 A;  3JC6 C;  4YT0 A;  3PUR A;  4KX6 A;  2WB5 A;  2MTQ A;  4ZI3 C;  2CXF A;  4F6R C;  3KBT A;  3B5M A;  5AQO B;  3H3M A;  5FKY A;  1OED B;  3FBL A;  3ETU A;  4AXP A;  3UUX B;  1XDP A;  2YOE A;  5L3B B;  4C90 A;  5L2L A;  3GA8 A;  4E7Z A;  5ABG A;  5LP6 E;  1MNE A;  4U2Z A;  2CWY A;  2OLT A;  4B3S T;  2WZH A;  3PDY A;  3CQC B;  3TLT A;  1Y64 B;  4AKH A;  2AXD S;  1N33 T;  2XQ8 A;  4J2C A;  2KXP B;  4YY3 T;  4MAL A;  4OYK A;  2CHO A;  4UF0 A;  2J47 A;  2X68 A;  3FB2 A;  4U3C A;  4DR3 T;  2G0U A;  3GWH A;  2I0M A;  4LF6 T;  1ZV4 X;  4P0B A;  3UQ4 A;  4EZH A;  5HXE A;  2A9U A;  2ZM0 A;  4O8S A;  3T1H T;  4KMC A;  4U72 A;  3PUG A;  4QH5 A;  4JLE A;  5LA6 E;  4X65 T;  2Y6X A;  4JV5 T;  3FZK B;  2BG9 E;  4UF0 B;  1MND A;  3RYF E;  1G8X A;  3UFG A;  1ZHC A;  4DBQ A;  2DNX A;  4ZEY A;  3EHZ A;  1YQ3 A;  2LSJ A;  4ILU A;  4BJM A;  4HE8 A;  5HXR A;  3DP7 A;  1UUS A;  3ANW B;  3KV9 A;  4HFV A;  5F5W A;  2Q9Q D;  4QH1 A;  4O2A E;  5JDG A;  4HWC A;  1KFY A;  4LFB T;  5FY0 A;  3NZQ A;  1N32 T;  2N2N A;  2XQ7 A;  4UVB B;  5C8Y E;  5F3J A;  3J7Y q;  2W61 A;  4I0U A;  4Z8X A;  2JRK A;  2BBJ A;  2LJL A;  4OK0 A;  1D1C A;  3BK9 A;  4WBO A;  1OED C;  3R84 B;  4TX5 A;  2XTL A;  5AQQ B;  5HCM A;  3KIN B;  1T8B A;  4DV3 T;  4KHP T;  4X20 E;  2X66 A;  2ES0 A;  3LG7 A;  3EDV A;  2Y8D A;  4IRE A; 
#chains in the Genus database with same CATH homology
 1W9R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...