1W9RA

Solution structure of choline binding protein a, domain r2, the major adhesin of streptococcus pneumoniae
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
119
structure length
119
Chain Sequence
b'GSHMPEKKVAEAEKKVEEAKKKAEDQKEEDRRNYPTNTYKTLELEIAESDVEVKKAELELVKEEAKEPRNEEKVKQAKAEVESKKAEATRLEKIKTDRKKAEEEAKRKAAEEDKVKEKP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CHOLINE BINDING PROTEIN A
publication title Solution Structure of Choline Binding Protein A, the Major Adhesin of Streptococcus Pneumoniae
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Receptor
total genus 47
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2004-10-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.440 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 choline binding protein A 1w9rA00
1W9RA
chains in the Genus database with same CATH superfamily
4A5XA 2LKGA 4HFDA 2BG9C 4UVBB 4DNDA 3M65A 2DCFA 4YTNA 3DP7A 3AVSA 1IJ6A 1MIYA 2IDOB 3JCFA 3AAAB 2IUBA 4O8SA 3G06A 1MMNA 1OWAA 2GK9A 4JEUB 4QXHB 4KHZF 4TUYE 3MKDA 2OV9A 4YXDA 1N32T 2VURA 2ZMAA 2CA5A 5M4YA 3CIRA 4JYAT 4CI1B 1W0BA 3DTOA 4YSYA 3AECA 3VRAA 2B1EA 2CM0A 3AE3A 3DJBA 2I0MA 5ADXL 1XDOA 2VK9A 3AEGA 2LRKA 3A7MA 3ZJ1A 2YN6A 3SWHA 2UXXB 4AIUA 5LXTE 2LOPA 4I4TE 2ZM8A 4U72A 4TX5A 4KX6A 1IBMT 3FZKB 5ABEA 5DABA 1QLBA 1N33T 3FZHB 3P4PA 4LF6T 1T7SA 2KINB 4CXYA 2VASA 2LM2A 2ACZA 3PV0F 4HFHA 5L3EB 2NP9A 4YSZA 4XZCA 3UUNA 1XNRT 1HNWT 4GYRA 4NUUA 1HG5A 5JDHA 2CRBA 2WY2A 1D1BA 2CCQA 2WB5A 3FZFB 5AQSB 2NR4A 5LA6E 3N9MA 4DR3T 4DR1T 4FJOA 4ZS2A 4X66T 3CKDA 2RA1A 2WU2A 1KNRA 2D0UA 4ZHQE 1D1CA 3VRBA 2W61A 4UR9A 3UQ4A 3C51A 2Q9QC 3PUXF 4U31A 3HKCE 3WI3A 5ABHA 4LF7T 3ANWB 4IREA 3RYCE 2JMKA 3SFEA 4YT0A 3RC3A 5JRCA 5FY0A 4WBOA 4AXPA 3RH3A 2ZM0A 1R8IA 5JR9A 3OYZA 4P09A 2LE8A 4DV6T 2XQ7A 3UU8A 5AQVB 3RI5A 4X64T 2X0YA 4PJJA 4Z8XA 2Z6EA 4JI5T 1IAPA 4ZI7E 5DQWA 5LG4A 1D0XA 3UFEA 4O4LE 3R6NA 1ZOYA 2DLRA 2KMFA 2Y8DA 4QWNB 2E5VA 2WDRA 2W66A 2M6BA 3UUXB 3OTOT 4CN1A 3A8YC 4I55E 2V7MA 4PW8A 3FHNA 3F2EA 5H6RB 4H9OC 1YKEB 2YU1A 3ETVA 3EABA 3P7IA 5LBMA 4NXMT 2LSYA 4HWIB 3NVOA 4P1NA 4WBNE 2NWBA 4TWDA 4ILBA 1VCSA 3AEDA 4NIQA 4EZ4A 1IBKT 4HWDA 3CPZA 2JJ9A 3N9OA 4EOZB 3VKGA 3ESLA 4B3TT 2JMHA 2BKOA 3RX6A 2V5CA 2H3RA 5HWYA 2BZBA 4P0AA 1HX1B 2W2UA 2Y6XA 3EDUA 1WCRA 3N5LA 4PAGA 3PUVF 4YTPA 2UXDT 3KFWX 3K3NA 2LSJA 1OEDE 2VVSA 4EAHA 1D1AA 2J47A 4Z90A 5LJNA 5CJ5A 2V7JA 5IUXA 3FXDB 1LVFA 4MBQA 2M6IA 2SPCA 2C5IT 4JBWF 1YXRA 3MZKB 4JI8T 3AXJB 2NTXA 1J5WA 1N36T 4EGWA 2WSSV 3ZYMA 2NW7A 2ODVA 5CA1E 2XPKA 4B3ST 5ETWA 5L3BB 3PJAA 3PUGA 4AQFC 5CGMA 2CPTA 1BR4A 4YHHT 5ABFB 4DV3T 4DR6T 2XQAA 2XQ8A 3CMLA 3AE7A 3JAFA 3KV5A 4LF9T 3UU4A 5FY7A 4HWHA 4TN7B 3ZCJA 5LGNB 5J0ZA 2CEAA 4X20E 2A72A 3ABVA 2LEHA 4YTMA 4A98A 2RPAA 3AE6A 4N78D 5L3FB 4X1YE 4JI7T 4GIWA 2KZ7B 2MYSA 1JNZA 3KV4A 1U5PA 2CHOA 4WW0A 2V6YA 2HPJA 4U7YA 4A56A 4BA9A 3HR0A 2NW8A 4AKLA 4ZI2C 4CXWA 1J5ET 3P4RA 4LF5T 3LFMA 3NZPA 2L8KA 2OA5A 3QC9A 3CQXC 3I0QA 4H9NC 2K9AA 3SRZA 5FL0A 4O4HE 1QSDA 2DWKA 2BS4A 3FB2A 2CXDA 3NKZA 2WCAA 3C64A 4JI6T 2BS2A 2VWAA 3S4UA 1YKHB 3JC6C 3AAIA 3IBPA 3Q5XA 5FVKA 5BR8T 4LMLA 2ZM6T 4JI4T 4ZEYA 2LSGA 2FJDA 1S94A 5HCMA 4YLHA 3LBXA 5HYAA 2W4XA 4U2YA 4MFRA 4FI5A 2BBHA 3RLFF 4Q25A 5EK2A 3BK9A 3Q2MA 4TNVA 3P4WA 3UT5E 2I59A 3NBXX 3VKHA 1OXZA 3KINB 4DV4T 2X0LB 1M7KA 3P4QA 3E0ZA 2X68A 2DHRA 2E5LT 3QOFA 3AE2A 5FXVA 2G0UA 4IT4A 2NOXA 1YW0A 5LNKA 3ONLC 2YU2A 2KWIB 2VKHA 3L09A 4OYKA 4EV6A 4H9PC 2C0SA 1VOMA 4L0RA 4LF8T 4TV9E 5LHGB 3UU6A 3P50A 5FYMA 1HF8A 3FXEB 3GN5B 5JDQA 1LVKA 3RKGA 2JPFA 2CXFA 3ZKRA 2BDEA 2V8SV 1Y01A 4GYSA 2JQKA 1WR0A 2LSIA 4GKKT 3PUQA 3ZSSA 4EIWA 3RRWA 2CWOA 2Q9QB 1HR0T 2WZHA 3EAMA 3IHRA 5L47A 2WWUA 4EZHA 2BG9E 1ZHCA 4DR7T 4LMJA 2W00A 1H7CA 3ZSTA 4O4IE 4J2CA 3N2KE 4I50E 2MTQA 3ZPOA 3QB5K 4HKAA 2JRKA 5GONE 3ZT5A 5E0OA 4G2AA 4H9SE 3UULA 2ACXA 4IE4A 2WP9A 5HEGA 1XNQT 5LCYA 4CN4A 1FIOA 4E7SA 3QNUA 2XHEB 3V5UA 3FBZA 4H63V 3WAKA 2IMLA 3HL6A 4X62T 4DMWA 4PJLA 2YINA 3AEBA 3N2GE 3F31A 4DR2T 2VKOA 1SUMB 1U4QA 3OJAA 4DVDA 3GA8A 3FBLA 3ZEFB 4YHJA 5AQLB 2UXBT 1X9BA 4I0UA 4MLKA 3O4XE 2W62A 3QB5A 4JV5T 4HTEA 4F8HA 3B57A 2BKNA 2JQQA 3C4ZA 2K5BB 2YDRA 1HCIA 4JI3T 2EHOA 4AKIA 4QH4A 3QK6A 4IDPA 4PK6A 1KNZA 1UK5A 2ES0A 1W0AA 4UXNB 5AQMB 3CX7B 5TAOA 2D9DA 2DL1A 2UXNB 5A1LA 3UTKA 4UV9B 3FZMB 1FEWA 5JTGA 4TNWA 1WYBA 4EB6E 3C4WA 4X1KE 4KUMB 5JRCB 5FXXA 4O2AE 2CBJA 2FJBA 1CUNA 5JH7E 2FJEA 3P4SA 3RC8A 4UF0A 2WMOA 5JR9B 1OEDA 4OK0A 3UU3A 3PJAJ 2YEVC 5AQUB 3A5XA 4JLEA 4LMKA 5LBQB 4NUVA 4COFA 4DV1T 5HXHA 1YD8G 4AKHA 1KK7A 5IYZE 4XBFB 1NENA 4U3CA 4TZ4C 2DI4A 5EK4A 4PFOA 3OVUA 5F5WA 4QXCB 2H7VC 2D2SA 4H63H 4CQIA 2V7LA 3LDQB 1UUSA 2CHNA 5LHHB 3ZN0B 3ZT7A 2PBIA 3O1JA 4LFBT 3PE0A 2D5UA 4YJ3E 3C4XA 2EHOD 2LLYA 2CWYA 3U78A 1E7PA 1O3XA 4GK5E 2WBLA 3L39A 4PJNA 2LJLA 1J1JA 3CQCB 2X51A 4MHCA 1XMQT 3PU3A 2XQ6A 3RQUA 4IE0A 4DV5T 4U74A 5JDMA 4IGUA 3E08A 3N9LA 3IEEA 4L5GA 1T8BA 5HXCA 4HFIA 4GKJT 1UCUA 4K0UA 1MNEA 3RF1A 1EZ3A 1D0ZA 4ZI3D 5LB7B 3JAEA 4OFZA 4QKNA 3TLSA 4CXXA 4MALA 5IWAT 3MJXA 3PDYA 4X5TA 3VR9A 3T1HT 5JDNA 1MMGA 3ZMUB 1YQ3A 3MACA 4YFSA 3MXZA 2E2AA 4IDZA 4TWHA 1HFAA 4BJMA 1BR1A 3LSVA 3OPCA 3AA6B 3HKDE 3LK42 4GK0E 1E2AA 3UQ7A 3MA9A 1BR2A 3VHLA 1ZKEA 5HXSA 5JR9C 3RPUA 4DR4T 1GQEA 3AE9A 2IW5B 3ONXA 5DQVA 4QHOA 2FUPA 2A9UA 2Y48B 4V1Av 1XDPA 4QXBB 5CA0E 3J7Yq 2RP4A 2ODUA 5HEUA 3ZCIA 4AKRB 4HFEA 2E8IA 2LKHA 2OLTA 4DMVA 3SFDA 2WS3A 4ADZA 1ZEEA 2V6YB 5AQQB 4LFCT 1LKXA 4UELA 4NXNT 4QH1A 5JVDE 3CK6A 5FP3A 4UEMA 2UXCT 4UV8B 2CLYC 4DV0T 3MK7C 4C90A 2E9XA 3RHWA 1US7B 5EK3A 4H9QC 1I6ZA 3T8OA 5LMUT 4PNIA 3PU8A 1I94T 5ABFA 2XAGB 5HAXA 4IL9A 4DUYT 2J4GA 2KWHA 1ZP0A 2V6XA 1HX8A 3U3IA 4IDOA 1KEYA 2XM1A 3KDSE 3H3AA 2VL0A 2UUAT 3ZYKA 2QGSA 3X1DA 5J2TE 4HWFA 3AB3B 4PJMA 3RQWA 3ZMZB 2QA7A 3Q5EA 2JQ9A 2XSBA 1SE7A 2XQ4A 2WM9A 5L3DB 3AAEB 3BQLA 2PTFA 3NZQA 2LHNA 1T72A 2AXDS 3LBXB 5L4HA 4JEHB 5FXZA 5LGUB 2IIUA 5DJQC 4TWFA 4HEAA 3CVRA 4AQGA 2BG9A 3RYHE 2YDSA 4IHJE 5LOVE 4YY3T 4B3MT 2CXLA 1Z8UA 5FMNA 4BAYB 2PG8A 2PFVA 4X65T 5JDFA 4B3RT 4KI0F 5LG3A 2DWGA 1WLXA 3K3OA 1LRZA 2XQ5A 5AQTB 4H9RC 3HKEE 5AFUL 3RYFE 4P0BA 2E9XD 3AEFA 5HEHA 3K1SA 2X67A 2HN1A 3UU5A 2HPLA 2K48A 5JDGA 2IC9A 3KBUA 2LSKA 1FJGT 4PK4A 2V7KA 2X9WA 3RIFA 3AE4A 2XZEA 3HI2A 2XJ7A 5KXJA 4JI2T 3SOLA 2AE9A 4ZXLA 4L9IA 2JIWA 1YQ4A 3AE1A 5HCJA 4ERRA 3WAJA 3EI0A 2BKPA 2N2NA 4I43B 3K8PC 2K24A 2KT9A 2P9BA 5FL1A 3KVAA 5C3JA 3ZMSB 2WDQA 1B7TA 3AA7B 3PUSA 2I6HA 2YDQA 5AQHB 3ONJA 3PUAA 2KSRA 2BBJA 2BVLA 1L0VA 3ZLIA 4KHPT 4U2ZA 3AE8A 1HS7A 2H88A 2W0GA 4ILAA 2UUBT 4UIGA 3TLUA 4LFAT 2WU5A 1MIWA 4QH5A 3D0TA 4G63A 2HHHT 1VCTA 5AQKB 4DUZT 1WFDA 3KV9A 2XAFB 3HKBE 4YSXA 2DNXA 5FKYA 5L3CB 1Z0PA 5AQGB 5J2UE 2XUEA 4DO0A 3GMIA 3VU7H 3QUJA 3Q5WA 1UX4A 4B6XA 3OYXA 1XWMA 5LYJE 5AQJB 3TKLB 4ISSA 5HEOA 1V9DA 5IHYA 4QX8B 3R84B 3C50A 4IE6A 5AQNB 3L8RA 4IL4A 3ZYLA 2A2FX 2EHOB 2XAHB 4O4JE 4ZZBA 4WZXA 5BMVE 1XMOT 2H7OA 4AKGA 3T1YT 2IHR1 3PTRB 2WAUA 1WYCA 2L3LA 4WNKA 3O1IA 3ZC0A 4BJNA 5FVLA 3TLWA 4UVCB 2Q9QD 4IE7A 3C98B 3KBTA 5LP6E 4UF0B 2C5KT 1OEDB 4O2BE 5H6QB 3PURA 2V1DB 3ZN1B 4HN9A 2C5JA 3CX6B 1HTJF 4ZOLE 2D0TA 2B76A 3CWZB 5KX5E 4KBMB 2VB6A 1CHUA 5FXWA 4HFCA 2XQ3A 2NW9A 3ZMTB 3I0OA 3OBVE 4AQYT 3TLTA 1XZYA 4CN6A 1MNDA 2J62A 2XAJB 1NEKA 4IE5A 3E22E 3EVYA 1Y64B 5CB4E 3KV6A 3ZT6A 4OHFA 3ANWA 1HNXT 2WDVA 2CLYB 3TLVA 5LHIB 1IZNB 1KF6A 3SS1A 4AQFA 4NPPA 3UFGA 3O9XA 1FMWA 3LK2B 2IAKA 4IIJE 2V5DA 3O1HA 2JQHA 2CE7A 2FBWA 4EYYR 5L2LA 3I9WA 3EUHA 4M1PA 1KFYA 5F8PA 4HFVA 1DU2A 4OYJA 3N9PA 2K3WA 4PFPA 3AA0B 2XSAA 1NAFA 3RKOA 2X66A 3Q5DA 4DV7T 4TV8E 4DIDB 2EHOC 5JQGE 3KVBA 2R6GF 3EDVA 5HEJA 4E7ZA 3NRYA 2WZIA 5AQRB 4CI2B 1AJ3A 3AEEA 4KP3C 3NRXA 3LG7A 3ETUA 1JNRA 3CQGB 2QRXA 5JREA 3B13A 3IF8B 1QUUA 3N9NA 1IJ5A 2X9XA 3Q9DA 3AEAA 3VR8A 2L9QA 5LJMA 3ZJ2A 1MMDA 2PJQA 5AQOB 1NWMX 1SA0E 4UVAB 5AQIB 1OEDC 3P8CD 2NTYA 2MPKA 3ZMVB 4GOUA 4DR5T 4ZI3C 3NWIA 3LJCA 4ASKA 5L4EA 3B5MA 2FJAA 1X79A 4IDQA 2XQYA 4EYUA 4EEBA 5HXRA 3UUBA 4ZS3A 4F6RC 5HWXA 3J9X1 1UURA 1D0YA 1W09A 3V5SA 5JDLA 3N9QA 3K3QC 2QVAA 3AXJA 2E9XB 2KXPB 2LRLA 3RRCA 3JADA 4U7IA 1M62A 3AA1B 1HG2A 5FNVE 2VL8A 3N2OA 2ZM2A 5CFBA 5LGTB 4A97A 5KMGP 2LM9A 2A3DA 4ZI2D 5KDMC 4HWCA 5LMNT 4JI1T 2F4VT 2H89A 2MOZA 3AVRA 2BVMA 1MMAA 2HN2A 4U33A 2UU9T 3RIUA 4AISA 2X0HA 2UUCT 4JI0T 1UX5A 3PUYF 2X9HA 4YJ2E 1W9RA 1E1HB 4KMCA 2XTLA 2VVNA 1SHZC 3JC6D 3RYIE 2VQFT 5F3JA 4WYVA 2XY8B 2BG9B 3IA3A 4OX9T 1HNZT 2V7IA 3EHZA 4IDNA 3RIAA 3F57A 2CMRA 4HGAA 2J1DG 2VQET 3AE5A 2VKDA 3RGLA 4Z91A 3W15B 4HE8A 2W67A 3BQKA 2MBGA 2WWVA 3LK3B 2YOEA 1FMVA 1BR0A 2LHRA 2LOSA 5L3GB 3UUMA 1IBLT 3L3PA 4K0KT 3PUWF 2XASB 2N1GA 4ZZCA 3HA4A 4EEDA 5C8YE 5AQFB 2V26A 2KLQA 1VRBA 2W63A 4DV2T 4HFBA 4ISTA 3M3ZB 2WMNA 2QYWA 4ILCA 1N34T 2LT3A 4DBRA 5HXEA 5ABGA 5C2TA 1S35A 2YKSA 2XM2A 3H3MA 4CI3B 3I1AA 2YK0A 2BS3A 2N9DA 2XQ9A 2KNDA 2IC6A 3CX8B 4QX7B 4XAXB 5J1GA 3PUZF 3ZC1A 1T98A 1WRDA 1UGOA 2ZLYA 2E9XC 2XAQB 4LF4T 4X1IE 1G73A 4ILUA 4DBQA 3BQIA 2M67A 1G8XA 1KNPA 4EXTA 5EZYE 5AQPB 4C91A 3RIUC 2MAWA 2WQYA 3H37A 1WR6A 3GN5A 3I9YA 1MIVA 3FZLB 5FY1A 4AI6A 2CBIA 4ANJA 3GWHA 4JUYA 2VKJA 4CZZB 2X9YA 1ZV4X 2HH7A 4PK5A 3OKQA 2Q9QA
chains in the Genus database with same CATH topology
1W9RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W9R A; 
#chains in the Genus database with same CATH topology
 4A5X A;  2LKG A;  4HFD A;  2BG9 C;  4UVB B;  4DND A;  3M65 A;  2DCF A;  4YTN A;  3DP7 A;  3AVS A;  1IJ6 A;  1MIY A;  2IDO B;  3JCF A;  3AAA B;  2IUB A;  4O8S A;  3G06 A;  1MMN A;  1OWA A;  2GK9 A;  4JEU B;  4QXH B;  4KHZ F;  4TUY E;  3MKD A;  2OV9 A;  4YXD A;  1N32 T;  2VUR A;  2ZMA A;  2CA5 A;  5M4Y A;  3CIR A;  4JYA T;  4CI1 B;  1W0B A;  3DTO A;  4YSY A;  3AEC A;  3VRA A;  2B1E A;  2CM0 A;  3AE3 A;  3DJB A;  2I0M A;  5ADX L;  1XDO A;  2VK9 A;  3AEG A;  2LRK A;  3A7M A;  3ZJ1 A;  2YN6 A;  3SWH A;  2UXX B;  4AIU A;  5LXT E;  2LOP A;  4I4T E;  2ZM8 A;  4U72 A;  4TX5 A;  4KX6 A;  1IBM T;  3FZK B;  5ABE A;  5DAB A;  1QLB A;  1N33 T;  3FZH B;  3P4P A;  4LF6 T;  1T7S A;  2KIN B;  4CXY A;  2VAS A;  2LM2 A;  2ACZ A;  3PV0 F;  4HFH A;  5L3E B;  2NP9 A;  4YSZ A;  4XZC A;  3UUN A;  1XNR T;  1HNW T;  4GYR A;  4NUU A;  1HG5 A;  5JDH A;  2CRB A;  2WY2 A;  1D1B A;  2CCQ A;  2WB5 A;  3FZF B;  5AQS B;  2NR4 A;  5LA6 E;  3N9M A;  4DR3 T;  4DR1 T;  4FJO A;  4ZS2 A;  4X66 T;  3CKD A;  2RA1 A;  2WU2 A;  1KNR A;  2D0U A;  4ZHQ E;  1D1C A;  3VRB A;  2W61 A;  4UR9 A;  3UQ4 A;  3C51 A;  2Q9Q C;  3PUX F;  4U31 A;  3HKC E;  3WI3 A;  5ABH A;  4LF7 T;  3ANW B;  4IRE A;  3RYC E;  2JMK A;  3SFE A;  4YT0 A;  3RC3 A;  5JRC A;  5FY0 A;  4WBO A;  4AXP A;  3RH3 A;  2ZM0 A;  1R8I A;  5JR9 A;  3OYZ A;  4P09 A;  2LE8 A;  4DV6 T;  2XQ7 A;  3UU8 A;  5AQV B;  3RI5 A;  4X64 T;  2X0Y A;  4PJJ A;  4Z8X A;  2Z6E A;  4JI5 T;  1IAP A;  4ZI7 E;  5DQW A;  5LG4 A;  1D0X A;  3UFE A;  4O4L E;  3R6N A;  1ZOY A;  2DLR A;  2KMF A;  2Y8D A;  4QWN B;  2E5V A;  2WDR A;  2W66 A;  2M6B A;  3UUX B;  3OTO T;  4CN1 A;  3A8Y C;  4I55 E;  2V7M A;  4PW8 A;  3FHN A;  3F2E A;  5H6R B;  4H9O C;  1YKE B;  2YU1 A;  3ETV A;  3EAB A;  3P7I A;  5LBM A;  4NXM T;  2LSY A;  4HWI B;  3NVO A;  4P1N A;  4WBN E;  2NWB A;  4TWD A;  4ILB A;  1VCS A;  3AED A;  4NIQ A;  4EZ4 A;  1IBK T;  4HWD A;  3CPZ A;  2JJ9 A;  3N9O A;  4EOZ B;  3VKG A;  3ESL A;  4B3T T;  2JMH A;  2BKO A;  3RX6 A;  2V5C A;  2H3R A;  5HWY A;  2BZB A;  4P0A A;  1HX1 B;  2W2U A;  2Y6X A;  3EDU A;  1WCR A;  3N5L A;  4PAG A;  3PUV F;  4YTP A;  2UXD T;  3KFW X;  3K3N A;  2LSJ A;  1OED E;  2VVS A;  4EAH A;  1D1A A;  2J47 A;  4Z90 A;  5LJN A;  5CJ5 A;  2V7J A;  5IUX A;  3FXD B;  1LVF A;  4MBQ A;  2M6I A;  2SPC A;  2C5I T;  4JBW F;  1YXR A;  3MZK B;  4JI8 T;  3AXJ B;  2NTX A;  1J5W A;  1N36 T;  4EGW A;  2WSS V;  3ZYM A;  2NW7 A;  2ODV A;  5CA1 E;  2XPK A;  4B3S T;  5ETW A;  5L3B B;  3PJA A;  3PUG A;  4AQF C;  5CGM A;  2CPT A;  1BR4 A;  4YHH T;  5ABF B;  4DV3 T;  4DR6 T;  2XQA A;  2XQ8 A;  3CML A;  3AE7 A;  3JAF A;  3KV5 A;  4LF9 T;  3UU4 A;  5FY7 A;  4HWH A;  4TN7 B;  3ZCJ A;  5LGN B;  5J0Z A;  2CEA A;  4X20 E;  2A72 A;  3ABV A;  2LEH A;  4YTM A;  4A98 A;  2RPA A;  3AE6 A;  4N78 D;  5L3F B;  4X1Y E;  4JI7 T;  4GIW A;  2KZ7 B;  2MYS A;  1JNZ A;  3KV4 A;  1U5P A;  2CHO A;  4WW0 A;  2V6Y A;  2HPJ A;  4U7Y A;  4A56 A;  4BA9 A;  3HR0 A;  2NW8 A;  4AKL A;  4ZI2 C;  4CXW A;  1J5E T;  3P4R A;  4LF5 T;  3LFM A;  3NZP A;  2L8K A;  2OA5 A;  3QC9 A;  3CQX C;  3I0Q A;  4H9N C;  2K9A A;  3SRZ A;  5FL0 A;  4O4H E;  1QSD A;  2DWK A;  2BS4 A;  3FB2 A;  2CXD A;  3NKZ A;  2WCA A;  3C64 A;  4JI6 T;  2BS2 A;  2VWA A;  3S4U A;  1YKH B;  3JC6 C;  3AAI A;  3IBP A;  3Q5X A;  5FVK A;  5BR8 T;  4LML A;  2ZM6 T;  4JI4 T;  4ZEY A;  2LSG A;  2FJD A;  1S94 A;  5HCM A;  4YLH A;  3LBX A;  5HYA A;  2W4X A;  4U2Y A;  4MFR A;  4FI5 A;  2BBH A;  3RLF F;  4Q25 A;  5EK2 A;  3BK9 A;  3Q2M A;  4TNV A;  3P4W A;  3UT5 E;  2I59 A;  3NBX X;  3VKH A;  1OXZ A;  3KIN B;  4DV4 T;  2X0L B;  1M7K A;  3P4Q A;  3E0Z A;  2X68 A;  2DHR A;  2E5L T;  3QOF A;  3AE2 A;  5FXV A;  2G0U A;  4IT4 A;  2NOX A;  1YW0 A;  5LNK A;  3ONL C;  2YU2 A;  2KWI B;  2VKH A;  3L09 A;  4OYK A;  4EV6 A;  4H9P C;  2C0S A;  1VOM A;  4L0R A;  4LF8 T;  4TV9 E;  5LHG B;  3UU6 A;  3P50 A;  5FYM A;  1HF8 A;  3FXE B;  3GN5 B;  5JDQ A;  1LVK A;  3RKG A;  2JPF A;  2CXF A;  3ZKR A;  2BDE A;  2V8S V;  1Y01 A;  4GYS A;  2JQK A;  1WR0 A;  2LSI A;  4GKK T;  3PUQ A;  3ZSS A;  4EIW A;  3RRW A;  2CWO A;  2Q9Q B;  1HR0 T;  2WZH A;  3EAM A;  3IHR A;  5L47 A;  2WWU A;  4EZH A;  2BG9 E;  1ZHC A;  4DR7 T;  4LMJ A;  2W00 A;  1H7C A;  3ZST A;  4O4I E;  4J2C A;  3N2K E;  4I50 E;  2MTQ A;  3ZPO A;  3QB5 K;  4HKA A;  2JRK A;  5GON E;  3ZT5 A;  5E0O A;  4G2A A;  4H9S E;  3UUL A;  2ACX A;  4IE4 A;  2WP9 A;  5HEG A;  1XNQ T;  5LCY A;  4CN4 A;  1FIO A;  4E7S A;  3QNU A;  2XHE B;  3V5U A;  3FBZ A;  4H63 V;  3WAK A;  2IML A;  3HL6 A;  4X62 T;  4DMW A;  4PJL A;  2YIN A;  3AEB A;  3N2G E;  3F31 A;  4DR2 T;  2VKO A;  1SUM B;  1U4Q A;  3OJA A;  4DVD A;  3GA8 A;  3FBL A;  3ZEF B;  4YHJ A;  5AQL B;  2UXB T;  1X9B A;  4I0U A;  4MLK A;  3O4X E;  2W62 A;  3QB5 A;  4JV5 T;  4HTE A;  4F8H A;  3B57 A;  2BKN A;  2JQQ A;  3C4Z A;  2K5B B;  2YDR A;  1HCI A;  4JI3 T;  2EHO A;  4AKI A;  4QH4 A;  3QK6 A;  4IDP A;  4PK6 A;  1KNZ A;  1UK5 A;  2ES0 A;  1W0A A;  4UXN B;  5AQM B;  3CX7 B;  5TAO A;  2D9D A;  2DL1 A;  2UXN B;  5A1L A;  3UTK A;  4UV9 B;  3FZM B;  1FEW A;  5JTG A;  4TNW A;  1WYB A;  4EB6 E;  3C4W A;  4X1K E;  4KUM B;  5JRC B;  5FXX A;  4O2A E;  2CBJ A;  2FJB A;  1CUN A;  5JH7 E;  2FJE A;  3P4S A;  3RC8 A;  4UF0 A;  2WMO A;  5JR9 B;  1OED A;  4OK0 A;  3UU3 A;  3PJA J;  2YEV C;  5AQU B;  3A5X A;  4JLE A;  4LMK A;  5LBQ B;  4NUV A;  4COF A;  4DV1 T;  5HXH A;  1YD8 G;  4AKH A;  1KK7 A;  5IYZ E;  4XBF B;  1NEN A;  4U3C A;  4TZ4 C;  2DI4 A;  5EK4 A;  4PFO A;  3OVU A;  5F5W A;  4QXC B;  2H7V C;  2D2S A;  4H63 H;  4CQI A;  2V7L A;  3LDQ B;  1UUS A;  2CHN A;  5LHH B;  3ZN0 B;  3ZT7 A;  2PBI A;  3O1J A;  4LFB T;  3PE0 A;  2D5U A;  4YJ3 E;  3C4X A;  2EHO D;  2LLY A;  2CWY A;  3U78 A;  1E7P A;  1O3X A;  4GK5 E;  2WBL A;  3L39 A;  4PJN A;  2LJL A;  1J1J A;  3CQC B;  2X51 A;  4MHC A;  1XMQ T;  3PU3 A;  2XQ6 A;  3RQU A;  4IE0 A;  4DV5 T;  4U74 A;  5JDM A;  4IGU A;  3E08 A;  3N9L A;  3IEE A;  4L5G A;  1T8B A;  5HXC A;  4HFI A;  4GKJ T;  1UCU A;  4K0U A;  1MNE A;  3RF1 A;  1EZ3 A;  1D0Z A;  4ZI3 D;  5LB7 B;  3JAE A;  4OFZ A;  4QKN A;  3TLS A;  4CXX A;  4MAL A;  5IWA T;  3MJX A;  3PDY A;  4X5T A;  3VR9 A;  3T1H T;  5JDN A;  1MMG A;  3ZMU B;  1YQ3 A;  3MAC A;  4YFS A;  3MXZ A;  2E2A A;  4IDZ A;  4TWH A;  1HFA A;  4BJM A;  1BR1 A;  3LSV A;  3OPC A;  3AA6 B;  3HKD E;  3LK4 2;  4GK0 E;  1E2A A;  3UQ7 A;  3MA9 A;  1BR2 A;  3VHL A;  1ZKE A;  5HXS A;  5JR9 C;  3RPU A;  4DR4 T;  1GQE A;  3AE9 A;  2IW5 B;  3ONX A;  5DQV A;  4QHO A;  2FUP A;  2A9U A;  2Y48 B;  4V1A v;  1XDP A;  4QXB B;  5CA0 E;  3J7Y q;  2RP4 A;  2ODU A;  5HEU A;  3ZCI A;  4AKR B;  4HFE A;  2E8I A;  2LKH A;  2OLT A;  4DMV A;  3SFD A;  2WS3 A;  4ADZ A;  1ZEE A;  2V6Y B;  5AQQ B;  4LFC T;  1LKX A;  4UEL A;  4NXN T;  4QH1 A;  5JVD E;  3CK6 A;  5FP3 A;  4UEM A;  2UXC T;  4UV8 B;  2CLY C;  4DV0 T;  3MK7 C;  4C90 A;  2E9X A;  3RHW A;  1US7 B;  5EK3 A;  4H9Q C;  1I6Z A;  3T8O A;  5LMU T;  4PNI A;  3PU8 A;  1I94 T;  5ABF A;  2XAG B;  5HAX A;  4IL9 A;  4DUY T;  2J4G A;  2KWH A;  1ZP0 A;  2V6X A;  1HX8 A;  3U3I A;  4IDO A;  1KEY A;  2XM1 A;  3KDS E;  3H3A A;  2VL0 A;  2UUA T;  3ZYK A;  2QGS A;  3X1D A;  5J2T E;  4HWF A;  3AB3 B;  4PJM A;  3RQW A;  3ZMZ B;  2QA7 A;  3Q5E A;  2JQ9 A;  2XSB A;  1SE7 A;  2XQ4 A;  2WM9 A;  5L3D B;  3AAE B;  3BQL A;  2PTF A;  3NZQ A;  2LHN A;  1T72 A;  2AXD S;  3LBX B;  5L4H A;  4JEH B;  5FXZ A;  5LGU B;  2IIU A;  5DJQ C;  4TWF A;  4HEA A;  3CVR A;  4AQG A;  2BG9 A;  3RYH E;  2YDS A;  4IHJ E;  5LOV E;  4YY3 T;  4B3M T;  2CXL A;  1Z8U A;  5FMN A;  4BAY B;  2PG8 A;  2PFV A;  4X65 T;  5JDF A;  4B3R T;  4KI0 F;  5LG3 A;  2DWG A;  1WLX A;  3K3O A;  1LRZ A;  2XQ5 A;  5AQT B;  4H9R C;  3HKE E;  5AFU L;  3RYF E;  4P0B A;  2E9X D;  3AEF A;  5HEH A;  3K1S A;  2X67 A;  2HN1 A;  3UU5 A;  2HPL A;  2K48 A;  5JDG A;  2IC9 A;  3KBU A;  2LSK A;  1FJG T;  4PK4 A;  2V7K A;  2X9W A;  3RIF A;  3AE4 A;  2XZE A;  3HI2 A;  2XJ7 A;  5KXJ A;  4JI2 T;  3SOL A;  2AE9 A;  4ZXL A;  4L9I A;  2JIW A;  1YQ4 A;  3AE1 A;  5HCJ A;  4ERR A;  3WAJ A;  3EI0 A;  2BKP A;  2N2N A;  4I43 B;  3K8P C;  2K24 A;  2KT9 A;  2P9B A;  5FL1 A;  3KVA A;  5C3J A;  3ZMS B;  2WDQ A;  1B7T A;  3AA7 B;  3PUS A;  2I6H A;  2YDQ A;  5AQH B;  3ONJ A;  3PUA A;  2KSR A;  2BBJ A;  2BVL A;  1L0V A;  3ZLI A;  4KHP T;  4U2Z A;  3AE8 A;  1HS7 A;  2H88 A;  2W0G A;  4ILA A;  2UUB T;  4UIG A;  3TLU A;  4LFA T;  2WU5 A;  1MIW A;  4QH5 A;  3D0T A;  4G63 A;  2HHH T;  1VCT A;  5AQK B;  4DUZ T;  1WFD A;  3KV9 A;  2XAF B;  3HKB E;  4YSX A;  2DNX A;  5FKY A;  5L3C B;  1Z0P A;  5AQG B;  5J2U E;  2XUE A;  4DO0 A;  3GMI A;  3VU7 H;  3QUJ A;  3Q5W A;  1UX4 A;  4B6X A;  3OYX A;  1XWM A;  5LYJ E;  5AQJ B;  3TKL B;  4ISS A;  5HEO A;  1V9D A;  5IHY A;  4QX8 B;  3R84 B;  3C50 A;  4IE6 A;  5AQN B;  3L8R A;  4IL4 A;  3ZYL A;  2A2F X;  2EHO B;  2XAH B;  4O4J E;  4ZZB A;  4WZX A;  5BMV E;  1XMO T;  2H7O A;  4AKG A;  3T1Y T;  2IHR 1;  3PTR B;  2WAU A;  1WYC A;  2L3L A;  4WNK A;  3O1I A;  3ZC0 A;  4BJN A;  5FVL A;  3TLW A;  4UVC B;  2Q9Q D;  4IE7 A;  3C98 B;  3KBT A;  5LP6 E;  4UF0 B;  2C5K T;  1OED B;  4O2B E;  5H6Q B;  3PUR A;  2V1D B;  3ZN1 B;  4HN9 A;  2C5J A;  3CX6 B;  1HTJ F;  4ZOL E;  2D0T A;  2B76 A;  3CWZ B;  5KX5 E;  4KBM B;  2VB6 A;  1CHU A;  5FXW A;  4HFC A;  2XQ3 A;  2NW9 A;  3ZMT B;  3I0O A;  3OBV E;  4AQY T;  3TLT A;  1XZY A;  4CN6 A;  1MND A;  2J62 A;  2XAJ B;  1NEK A;  4IE5 A;  3E22 E;  3EVY A;  1Y64 B;  5CB4 E;  3KV6 A;  3ZT6 A;  4OHF A;  3ANW A;  1HNX T;  2WDV A;  2CLY B;  3TLV A;  5LHI B;  1IZN B;  1KF6 A;  3SS1 A;  4AQF A;  4NPP A;  3UFG A;  3O9X A;  1FMW A;  3LK2 B;  2IAK A;  4IIJ E;  2V5D A;  3O1H A;  2JQH A;  2CE7 A;  2FBW A;  4EYY R;  5L2L A;  3I9W A;  3EUH A;  4M1P A;  1KFY A;  5F8P A;  4HFV A;  1DU2 A;  4OYJ A;  3N9P A;  2K3W A;  4PFP A;  3AA0 B;  2XSA A;  1NAF A;  3RKO A;  2X66 A;  3Q5D A;  4DV7 T;  4TV8 E;  4DID B;  2EHO C;  5JQG E;  3KVB A;  2R6G F;  3EDV A;  5HEJ A;  4E7Z A;  3NRY A;  2WZI A;  5AQR B;  4CI2 B;  1AJ3 A;  3AEE A;  4KP3 C;  3NRX A;  3LG7 A;  3ETU A;  1JNR A;  3CQG B;  2QRX A;  5JRE A;  3B13 A;  3IF8 B;  1QUU A;  3N9N A;  1IJ5 A;  2X9X A;  3Q9D A;  3AEA A;  3VR8 A;  2L9Q A;  5LJM A;  3ZJ2 A;  1MMD A;  2PJQ A;  5AQO B;  1NWM X;  1SA0 E;  4UVA B;  5AQI B;  1OED C;  3P8C D;  2NTY A;  2MPK A;  3ZMV B;  4GOU A;  4DR5 T;  4ZI3 C;  3NWI A;  3LJC A;  4ASK A;  5L4E A;  3B5M A;  2FJA A;  1X79 A;  4IDQ A;  2XQY A;  4EYU A;  4EEB A;  5HXR A;  3UUB A;  4ZS3 A;  4F6R C;  5HWX A;  3J9X 1;  1UUR A;  1D0Y A;  1W09 A;  3V5S A;  5JDL A;  3N9Q A;  3K3Q C;  2QVA A;  3AXJ A;  2E9X B;  2KXP B;  2LRL A;  3RRC A;  3JAD A;  4U7I A;  1M62 A;  3AA1 B;  1HG2 A;  5FNV E;  2VL8 A;  3N2O A;  2ZM2 A;  5CFB A;  5LGT B;  4A97 A;  5KMG P;  2LM9 A;  2A3D A;  4ZI2 D;  5KDM C;  4HWC A;  5LMN T;  4JI1 T;  2F4V T;  2H89 A;  2MOZ A;  3AVR A;  2BVM A;  1MMA A;  2HN2 A;  4U33 A;  2UU9 T;  3RIU A;  4AIS A;  2X0H A;  2UUC T;  4JI0 T;  1UX5 A;  3PUY F;  2X9H A;  4YJ2 E;  1W9R A;  1E1H B;  4KMC A;  2XTL A;  2VVN A;  1SHZ C;  3JC6 D;  3RYI E;  2VQF T;  5F3J A;  4WYV A;  2XY8 B;  2BG9 B;  3IA3 A;  4OX9 T;  1HNZ T;  2V7I A;  3EHZ A;  4IDN A;  3RIA A;  3F57 A;  2CMR A;  4HGA A;  2J1D G;  2VQE T;  3AE5 A;  2VKD A;  3RGL A;  4Z91 A;  3W15 B;  4HE8 A;  2W67 A;  3BQK A;  2MBG A;  2WWV A;  3LK3 B;  2YOE A;  1FMV A;  1BR0 A;  2LHR A;  2LOS A;  5L3G B;  3UUM A;  1IBL T;  3L3P A;  4K0K T;  3PUW F;  2XAS B;  2N1G A;  4ZZC A;  3HA4 A;  4EED A;  5C8Y E;  5AQF B;  2V26 A;  2KLQ A;  1VRB A;  2W63 A;  4DV2 T;  4HFB A;  4IST A;  3M3Z B;  2WMN A;  2QYW A;  4ILC A;  1N34 T;  2LT3 A;  4DBR A;  5HXE A;  5ABG A;  5C2T A;  1S35 A;  2YKS A;  2XM2 A;  3H3M A;  4CI3 B;  3I1A A;  2YK0 A;  2BS3 A;  2N9D A;  2XQ9 A;  2KND A;  2IC6 A;  3CX8 B;  4QX7 B;  4XAX B;  5J1G A;  3PUZ F;  3ZC1 A;  1T98 A;  1WRD A;  1UGO A;  2ZLY A;  2E9X C;  2XAQ B;  4LF4 T;  4X1I E;  1G73 A;  4ILU A;  4DBQ A;  3BQI A;  2M67 A;  1G8X A;  1KNP A;  4EXT A;  5EZY E;  5AQP B;  4C91 A;  3RIU C;  2MAW A;  2WQY A;  3H37 A;  1WR6 A;  3GN5 A;  3I9Y A;  1MIV A;  3FZL B;  5FY1 A;  4AI6 A;  2CBI A;  4ANJ A;  3GWH A;  4JUY A;  2VKJ A;  4CZZ B;  2X9Y A;  1ZV4 X;  2HH7 A;  4PK5 A;  3OKQ A;  2Q9Q A; 
#chains in the Genus database with same CATH homology
 1W9R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...