2C5JA

N-terminal domain of tlg1, domain-swapped dimer
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
87
structure length
82
Chain Sequence
b'DPFQQVVKDTKEQLNRINNYITRHNTAEEEIQDILKDVEETIVDLDRSIIVMKRDENEDVSGREAQVKNIKQQLDALKLRFD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords T-SNARE AFFECTING A LATE GOLGI COMPARTMENT PROTEIN 1
molecule tags Protein transport
source organism Saccharomyces cerevisiae
publication title Structural Analysis of the Interaction between the Snare Tlg1 and Vps51.
pubmed doi rcsb
total genus 39
structure length 82
sequence length 87
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-10-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.90 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2c5jA00
4CQIA 4DNDA 4EYYR 4L0RA 3FXDB 2G0UA 2X9WA 3CKDA 3L3PA 2C5IT 2KWHA 3CVRA 2IC6A 3QK6A 4FI5A 1LRZA 3FXEB 3N5LA 2XTLA 2K48A 2KWIB 4B6XA 3MXZA 1ZKEA 3S4UA 1H7CA 1Z0PA 1LVFA 1QSDA 2C5KT 2X9XA 3QUJA 1IJ6A 2MBGA 4J2CA 1IJ5A 2IC9A 2X9YA 2C5JA 2CA5A 3TKLB 3P7IA
chains in the Genus database with same CATH superfamily
2FJDA 3GMIA 4COFA 2ZM8A 3RRCA 4HFCA 2BZBA 4AKHA 4OYJA 1XNRT 4L9IA 2WCAA 4EZ4A 1CHUA 2SPCA 2PBIA 3L8RA 5JDQA 1SHZC 1N36T 5LMNT 3H3MA 2XQ9A 3CX6B 3LK42 5JH7E 3CQXC 5L3DB 1WYBA 4JV5T 4H9SE 5AQMB 5HEUA 3HKEE 3UULA 4LFAT 3L39A 5E0OA 2D2SA 2CBIA 2PFVA 3AECA 3GA8A 4PJMA 2V7JA 4ZOLE 3ZJ1A 2PTFA 1WR0A 3AXJA 4TN7B 1VRBA 4PK5A 1UX5A 2MYSA 2YKSA 2OV9A 3FBZA 3P4RA 3HA4A 3N2OA 4YSZA 2LT3A 3RIFA 1OEDE 2H3RA 3WAJA 3AEDA 2JMKA 4X5TA 3RGLA 3QB5K 2OA5A 5LCYA 3PDYA 3T1YT 1XWMA 3EAMA 4CXWA 4EYUA 3PV0F 1MIVA 3RKGA 2NW8A 2WDQA 2W00A 1GQEA 2V5CA 4JUYA 4AQFC 2KXPB 3JC6D 3AVRA 2LRLA 4O8SA 5AQKB 3O4XE 4DR2T 2V8SV 1G8XA 3N2KE 4NIQA 4WYVA 4YT0A 4Z91A 3UQ4A 2AXDS 4LF6T 3AEEA 1VOMA 3ANWA 3CWZB 3LFMA 2UUBT 4JEUB 4EIWA 2KT9A 3BQLA 2XUEA 4QWNB 3I1AA 5HAXA 3SOLA 4YJ2E 4ZI2D 5LXTE 1U4QA 2Q9QC 4HEAA 2WWVA 1YQ4A 3NWIA 1XZYA 1HNWT 1I6ZA 5L2LA 3EHZA 3ETUA 3MK7C 4DV1T 2AE9A 2V26A 3RYCE 2JQHA 4U31A 1EZ3A 4JI2T 4DMVA 3K3NA 5A1LA 1UCUA 5JDGA 3H3AA 5CA0E 2BDEA 2WU2A 2X9YA 3PJAJ 3RRWA 3SRZA 3I9YA 2VKDA 1XMOT 4AI6A 5H6RB 3FZLB 1IBKT 1D1AA 4DV0T 4DNDA 1U5PA 3ZMZB 2DWKA 4TV9E 4GKKT 1L0VA 3EABA 4IE0A 2FBWA 2VQET 4JI6T 2DHRA 2WSSV 2XPKA 4ANJA 2A3DA 2YDRA 1HNXT 2EHOB 4KP3C 3O1HA 1HFAA 2ODVA 1ZV4X 4QXCB 4AQYT 5LHHB 2YK0A 3WI3A 3VKGA 1WLXA 3AE4A 2YN6A 2VASA 1HX8A 3BQKA 4HFEA 4I4TE 5J1GA 5BR8T 4ERRA 3S4UA 2CHOA 1NENA 5EK3A 3ONJA 3U3IA 5DQVA 3UUNA 4AKIA 3JAEA 4B3TT 1IZNB 1OXZA 5F3JA 4DR6T 5GONE 3A5XA 1MNDA 4UVAB 1G73A 3RQWA 5FYMA 2YDQA 3C4ZA 4JI4T 3KV4A 4AKRB 2X68A 5CJ5A 2UXBT 4IE7A 4XBFB 1X9BA 3SS1A 2LLYA 4GYSA 2N1GA 2XQ8A 3KINB 3KVBA 2KWHA 3IHRA 4PW8A 2B76A 3MKDA 1NEKA 2V6XA 5FVKA 3FZMB 4PK6A 3MACA 2JMHA 5HCMA 5JR9C 5LHIB 1T72A 3AE1A 2J4GA 2M6BA 5AQTB 2BS2A 3HKDE 3AAAB 1HF8A 5FXXA 4EB6E 1W0AA 2CPTA 2FJAA 1R8IA 4DR4T 4V1Av 3D0TA 5AQOB 3AVSA 4PJJA 2MBGA 2UXCT 5ETWA 4EGWA 2PG8A 3PUXF 3OTOT 3ZCJA 1IJ5A 3H37A 3ZMTB 5CFBA 5EZYE 2XAGB 1MMDA 3N9LA 3KV5A 3P7IA 4AKLA 1YKHB 3F2EA 2LM2A 3QNUA 3O1JA 1UX4A 3EDVA 2YDSA 4UIGA 4Z8XA 1BR2A 3UTKA 4QXHB 1N34T 3UU4A 1WCRA 3ZYKA 5L3FB 3RYIE 4CI1B 3AEGA 4NUVA 4JI0T 3P4SA 2W0GA 3TLWA 4CI2B 2KWIB 3FZKB 1OEDC 4KBMB 2QYWA 3CQCB 3MXZA 2D9DA 5HYAA 3SFEA 1YKEB 4DV7T 1W09A 2LHNA 3N9OA 3RYFE 4ZXLA 1Z0PA 4IGUA 1AJ3A 2A9UA 1BR0A 3X1DA 5AQPB 3SWHA 1IAPA 2X0HA 1Y64B 1LKXA 2NTYA 4KI0F 3UFGA 2VVNA 4DV4T 2NW7A 1D0YA 2YOEA 1SA0E 2LM9A 4H9NC 4QXBB 3J9X1 3RIUC 3UU6A 4EEDA 5CGMA 1N33T 1SE7A 3B13A 2VL8A 4QKNA 4UELA 2WY2A 3P4QA 4WW0A 3AEBA 1LVKA 4UR9A 1E7PA 3ZN1B 4OFZA 4E7SA 2L3LA 5KX5E 2UXXB 3NRXA 4LMLA 1WR6A 2HH7A 3CMLA 2C0SA 5EK2A 3ABVA 2BG9E 3KVAA 1UURA 2B1EA 4CN1A 4I55E 4HFHA 3F31A 3MJXA 2RPAA 4MLKA 4WNKA 3SFDA 2F4VT 1HNZT 5JRCA 5KXJA 3ZSTA 4CN4A 3NBXX 2YU1A 3C98B 3M65A 2DI4A 2XQ6A 4N78D 5L4EA 3OVUA 3VU7H 4YY3T 4GIWA 3UT5E 2MAWA 2VKOA 4JI1T 3ETVA 4HWCA 4CI3B 3IEEA 5JR9B 2XSBA 4ILUA 2JRKA 1FIOA 1FMWA 3PE0A 2WU5A 4KMCA 3RQUA 2UU9T 5DABA 2JQQA 2Y6XA 1FMVA 3OJAA 2H88A 3CK6A 5C3JA 4DR5T 5LOVE 2UUAT 4QHOA 3OYXA 5LA6E 2LSJA 4BJNA 2BG9A 4Q25A 2D5UA 2KINB 2WMNA 4H63V 3RYHE 3W15B 4A56A 4DV3T 3AE8A 4JI3T 3RIAA 1VCTA 4OX9T 1S35A 3ZLIA 1E2AA 3N9QA 2PJQA 3P4PA 2LKGA 2QGSA 3JADA 4P0BA 3ZKRA 1T98A 2V6YA 2CRBA 4U2ZA 2D0UA 2NTXA 2K48A 3ZPOA 4BA9A 2KSRA 4EOZB 2E9XC 3HKCE 2JQKA 3OBVE 2A72A 2XQYA 3PURA 3U78A 2I59A 3LDQB 1BR4A 3Q5WA 1QSDA 3VRAA 2C5KT 3K3OA 2X9XA 4IL4A 4E7ZA 5LGUB 4EZHA 5HEOA 5LHGB 2CA5A 2XAQB 1UUSA 3RLFF 3AA0B 4JI8T 4K0UA 5LYJE 4X64T 4QH5A 3AEFA 4UV9B 5CB4E 1ZP0A 2D0TA 4DIDB 2VKJA 3Q9DA 4IDOA 1D0XA 3DP7A 4LF8T 3NVOA 4JI5T 5JDLA 4HFIA 5IWAT 4NXNT 5HXSA 3CKDA 3ZCIA 4ZI2C 4B3ST 3Q5EA 4AQFA 1MMAA 4AIUA 3TLUA 5JREA 2BBHA 4BAYB 1LRZA 3PUAA 2R6GF 4HWDA 2WM9A 3F57A 3GN5B 5CA1E 4UVCB 5L3BB 3PUSA 1FEWA 3CX7B 4YTMA 2X0LB 3RF1A 3AA6B 2MOZA 3VHLA 4TWHA 3RC3A 2MPKA 4UF0B 4DBRA 4EXTA 3C4WA 3PJAA 2WZHA 3QB5A 1YXRA 4IDQA 4IDNA 4ZZBA 1YW0A 3PUWF 5HWXA 2IC9A 2IDOB 3AE5A 2BG9B 2C5JA 3OYZA 3I0OA 4ZS3A 4P1NA 3PUYF 3JC6C 4NPPA 4QX8B 4EAHA 3LK2B 4LFCT 3ZYLA 4YSXA 3AE6A 5ABEA 3GN5A 4UVBB 3T1HT 4EEBA 3KV9A 3HKBE 1YD8G 2CEAA 2IUBA 2K24A 4YTNA 4YHHT 3ANWB 4PJLA 5AQGB 3AE9A 1J5ET 4MHCA 2Y48B 4HKAA 1CUNA 4PFOA 1T7SA 2CXFA 2KMFA 5L3GB 3LBXA 3I0QA 2W4XA 3E0ZA 1KK7A 3C4XA 4LMJA 3QK6A 1KNZA 2JJ9A 4QH4A 3C51A 1M62A 5HXRA 3J7Yq 3ZMVB 1XDOA 2XQ7A 1MMNA 3A8YC 3AA7B 5AQUB 5H6QB 2H7VC 2W2UA 2HN2A 3N9NA 4G63A 4I0UA 2CLYB 3KBUA 4KHPT 2CCQA 2UUCT 3MA9A 4WBNE 2ZM2A 5DJQC 3ZT6A 2ACXA 2IHR1 1YQ3A 2XQ5A 1ZEEA 2VWAA 3CQGB 4IIJE 4U3CA 3NZQA 4YLHA 3TLVA 2N2NA 2V7IA 3T8OA 2ZM6T 2CWOA 2J62A 2XSAA 3PUQA 3Q5XA 2QRXA 1MIYA 2X67A 3AAEB 4IREA 4ILBA 4TX5A 5ABGA 5FP3A 5J0ZA 4HWIB 2XAHB 2V7KA 2XQAA 3ZC1A 5HXHA 3ZT5A 5FMNA 5F5WA 4B6XA 5AFUL 1KEYA 4PFPA 3RX6A 2E9XD 2NR4A 3MZKB 2XAFB 4HGAA 3UU5A 5HXEA 4KX6A 2J1DG 4TZ4C 4ZI3D 1UK5A 2VB6A 4FJOA 4JYAT 3ONXA 5HWYA 5FY7A 1MNEA 1HCIA 2E5VA 4DUYT 3PU3A 3AXJB 3K1SA 4X1IE 1HG2A 2LEHA 2NP9A 2A2FX 4IT4A 2ZLYA 2M67A 3BQIA 2BG9C 5LG3A 2IW5B 3V5SA 4LF4T 2H89A 2LOSA 1WFDA 2I0MA 3E22E 1JNZA 3C64A 4KHZF 3PUVF 3O9XA 5FL1A 1XMQT 5ABHA 4HN9A 2EHOD 4ISTA 1JNRA 2LSKA 4DVDA 2DNXA 1QLBA 2JPFA 1W0BA 3K8PC 2X9WA 4Z90A 2BS3A 3L3PA 4IDZA 4A5XA 5JDHA 4HTEA 3WAKA 2LOPA 1KNRA 1B7TA 2IC6A 2VKHA 1OWAA 4UEMA 4JBWF 5AQVB 1HR0T 1WYCA 4LF5T 3OKQA 4ZI3C 5HEJA 1DU2A 2V7MA 4O4HE 2W62A 2EHOC 1ZOYA 4YHJA 4AISA 3RHWA 5JDNA 1VCSA 4GK5E 5LJMA 4HE8A 4I43B 5AQSB 4ADZA 2V7LA 2E2AA 2CLYC 3P8CD 4DV2T 2W67A 4YFSA 4DV6T 3TKLB 3ZMSB 3LK3B 3ZEFB 2XJ7A 4CXYA 2Z6EA 2XAJB 4X66T 2WP9A 2KNDA 3ZYMA 2HHHT 5BMVE 3ZMUB 1Y01A 5JQGE 2BKNA 5LB7B 3LJCA 4YTPA 3KBTA 4C90A 4WBOA 3ZJ2A 3RH3A 1T8BA 2CHNA 4GK0E 5LBQB 3RIUA 4HFDA 4MFRA 1KF6A 1D1BA 1D1CA 3UU3A 4H9OC 2X9HA 4X1KE 2LSGA 3IF8B 4FI5A 5ADXL 3JAFA 4H9PC 2XTLA 3P4WA 5HCJA 1NWMX 2Q9QB 3HR0A 5KMGP 5JDMA 3NZPA 2HPLA 2V5DA 1HG5A 4KUMB 3L09A 4P09A 1US7B 4DBQA 3UUXB 1I94T 5JVDE 1ZHCA 4X62T 2VURA 2EHOA 1S94A 2BKOA 3PUGA 1QUUA 4PK4A 3ZC0A 4U7IA 4QX7B 2W66A 3UUBA 3RPUA 3LSVA 2NW9A 2H7OA 3Q5DA 2K3WA 2XM2A 3B57A 1D0ZA 4AKGA 4GOUA 4UV8B 3RI5A 5L3CB 2XZEA 5AQIB 2V1DB 2J47A 3A7MA 2IMLA 3E08A 3UFEA 4DMWA 3FBLA 5JRCB 5M4YA 5FL0A 2VL0A 3P50A 3UUMA 3KFWX 4JI7T 3VRBA 1MMGA 2L9QA 1O3XA 2WB5A 3NRYA 2E9XB 4TNVA 4NUUA 5AQHB 2BVMA 2M6IA 3VR9A 4YSYA 1XNQT 2DCFA 4U74A 3VKHA 2WMOA 2UXDT 3EUHA 3N5LA 5C8YE 4AQGA 2LE8A 2W63A 2BBJA 3O1IA 2HN1A 4U72A 2FJEA 3PU8A 5AQJB 2P9BA 2CBJA 4H9QC 4HWHA 4O4LE 5FXWA 5L47A 1LVFA 3HI2A 2YEVC 4HFVA 2LKHA 2WS3A 3AE3A 5JDFA 3QUJA 5J2TE 2WDRA 2CMRA 5AQRB 1WRDA 2NWBA 4A97A 4F8HA 4HWFA 4ZZCA 2VK9A 4IL9A 2E5LT 3GWHA 2ODUA 4L5GA 2WZIA 4OHFA 4X20E 4XZCA 4LF7T 2JQ9A 4O2BE 4DR1T 4CXXA 2V6YB 2CM0A 4TWFA 4EYYR 5LMUT 4P0AA 2X66A 4L0RA 3AB3B 3C50A 2G0UA 1V9DA 4ILAA 3AAIA 2ZM0A 2WQYA 2C5IT 5AQFB 4DR7T 1IBMT 2KLQA 4CN6A 4DV5T 5LG4A 2CWYA 4C91A 1HTJF 1UGOA 3TLTA 4GYRA 2XQ4A 2QA7A 3AA1B 4IE4A 5FXZA 5C2TA 4DUZT 1KNPA 3ESLA 4H9RC 4IDPA 2KZ7B 2UXNB 2ZMAA 2LRKA 5AQQB 4H63H 1FJGT 3RC8A 3ZT7A 4X1YE 4ILCA 2WBLA 2ACZA 4A98A 1MIWA 4ASKA 2ES0A 2GK9A 3JCFA 3PUZF 1IJ6A 2YU2A 3QC9A 3QOFA 2QVAA 4U7YA 2LSYA 3EDUA 3N9PA 2DWGA 4J2CA 4ZHQE 2IAKA 4AXPA 2RP4A 5FKYA 2FJBA 3EI0A 4PJNA 5J2UE 5LNKA 3BK9A 4NXMT 4B3RT 5L4HA 4CQIA 2LHRA 4ZEYA 5ABFA 2YINA 3B5MA 2X0YA 2VVSA 4O4JE 5FY1A 5TAOA 3RKOA 1OEDB 4OK0A 2E9XA 2DL1A 2XM1A 2X51A 3CVRA 4I50E 4JLEA 2Y8DA 4M1PA 3FB2A 3HL6A 3Q2MA 3DTOA 4MBQA 2LSIA 4QH1A 2BVLA 5FY0A 2HPJA 1E1HB 1HX1B 2W61A 1M7KA 3AE2A 3M3ZB 4IE6A 2N9DA 5EK4A 4YXDA 2Q9QA 4UXNB 1J5WA 2Q9QD 5L3EB 1HS7A 1ZKEA 2LJLA 1H7CA 5LP6E 2IIUA 5FVLA 5HEHA 5IHYA 4IE5A 5KDMC 3R84B 2OLTA 4O2AE 2DLRA 2I6HA 3IBPA 3N9MA 5LGNB 2E8IA 1OEDA 2XQ3A 3FHNA 5JR9A 5LBMA 4DO0A 1J1JA 5IYZE 3KV6A 4LMKA 3TLSA 2XASB 4TWDA 2K5BB 2CXLA 5DQWA 3R6NA 3ZSSA 4CZZB 5JTGA 4LF9T 2WWUA 3OPCA 4YJ3E 1KFYA 4PNIA 4GKJT 4U33A 2BKPA 4MALA 4TV8E 1SUMB 1W9RA 5AQNB 3VR8A 5FXVA 4BJMA 4EV6A 1BR1A 2FUPA 3FXDB 4ISSA 2CE7A 4IHJE 3LBXB 3ZN0B 5LGTB 2CXDA 4LFBT 3PTRB 2RA1A 3NKZA 3KDSE 3ONLC 1Z8UA 2WAUA 3EVYA 2VQFT 3UU8A 3AE7A 4O4IE 3CX8B 3DJBA 3FXEB 3LG7A 2NOXA 3CIRA 4PAGA 5AQLB 2MTQA 4X65T 5F8PA 4ZS2A 3FZFB 3G06A 3N2GE 2K9AA 4OYKA 2JIWA 3CPZA 4TNWA 2WDVA 4U2YA 3K3QC 5IUXA 4WZXA 4ZI7E 5HEGA 5HXCA 4F6RC 2XY8B 4HFBA 3I9WA 4B3MT 3IA3A 1XDPA 1IBLT 2XHEB 5LJNA 4K0KT 4UF0A 3UQ7A 3FZHB 1NAFA 2BS4A 4G2AA 4JEHB 4DR3T 4TUYE 1X79A 4XAXB 3AEAA 3V5UA 5ABFB 1N32T 2L8KA 5FNVE
chains in the Genus database with same CATH topology
3GMIA 2ZM8A 3RRCA 2BZBA 4AKHA 4OYJA 4L9IA 4EZ4A 5JDQA 2PBIA 2SPCA 1SHZC 3CX6B 3LK42 5JH7E 5L3DB 3CQXC 1WYBA 4H9SE 3HKEE 3UULA 5E0OA 2D2SA 2PFVA 3GA8A 4ZOLE 4PJMA 2V7JA 3ZJ1A 4TN7B 1VRBA 4PK5A 1UX5A 2MYSA 3FBZA 3HA4A 3N2OA 2LT3A 2H3RA 3WAJA 2JMKA 2OA5A 5LCYA 3PDYA 4EYUA 4CXWA 1MIVA 2NW8A 4JUYA 2W00A 4AQFC 2KXPB 3JC6D 3AVRA 4O8SA 3O4XE 1G8XA 3N2KE 1VOMA 3ANWA 3CWZB 3LFMA 4JEUB 4EIWA 2KT9A 3BQLA 2XUEA 4QWNB 3I1AA 5HAXA 3SOLA 4YJ2E 4ZI2D 5LXTE 1U4QA 2Q9QC 4HEAA 5L2LA 3MK7C 3ETUA 2V26A 3RYCE 1EZ3A 4DMVA 3K3NA 5A1LA 1UCUA 5JDGA 3H3AA 5CA0E 2BDEA 2X9YA 3RRWA 3SRZA 3I9YA 2VKDA 4AI6A 5H6RB 1D1AA 4DNDA 1U5PA 3ZMZB 2DWKA 4TV9E 4IE0A 2DHRA 2WSSV 4ANJA 2A3DA 2EHOB 4KP3C 3O1HA 1HFAA 2ODVA 1ZV4X 4QXCB 5LHHB 2YK0A 3WI3A 3VKGA 1WLXA 3BQKA 2VASA 1HX8A 5J1GA 4I4TE 4ERRA 3S4UA 3U3IA 4AKIA 5EK3A 3UUNA 5DQVA 1IZNB 1OXZA 5F3JA 5GONE 3A5XA 1MNDA 4UVAB 1G73A 5FYMA 3C4ZA 3KV4A 4AKRB 2X68A 4IE7A 3SS1A 4GYSA 2N1GA 3KINB 3KVBA 2KWHA 3IHRA 4PW8A 3MKDA 4PK6A 3MACA 2JMHA 5JR9C 5LHIB 3HKDE 5FXXA 3AAAB 1HF8A 4EB6E 4V1Av 3D0TA 3AVSA 4PJJA 5ETWA 2PG8A 3ZCJA 1IJ5A 3H37A 3ZMTB 5EZYE 2XAGB 1MMDA 3N9LA 3KV5A 3P7IA 4AKLA 1YKHB 3F2EA 3UTKA 3O1JA 1UX4A 3EDVA 4UIGA 4Z8XA 4C91A 1BR2A 4QXHB 3ZYKA 5L3FB 3RYIE 4CI1B 4NUVA 2W0GA 4CI2B 2KWIB 4KBMB 3MXZA 3CQCB 5HYAA 1YKEB 3N9OA 2LHNA 3RYFE 1Z0PA 4IGUA 1AJ3A 1BR0A 3SWHA 1IAPA 1Y64B 1LKXA 2NTYA 2NW7A 1D0YA 4H9NC 1SA0E 2LM9A 4QXBB 3J9X1 3B13A 2VL8A 4QKNA 4UELA 4WW0A 1LVKA 3ZN1B 4OFZA 4E7SA 2L3LA 5KX5E 2UXXB 3NRXA 1WR6A 2HH7A 3CMLA 2C0SA 5EK2A 3KVAA 2B1EA 4I55E 3F31A 3MJXA 4MLKA 4WNKA 5JRCA 3NBXX 2YU1A 3C98B 3M65A 2DI4A 4N78D 3VU7H 4GIWA 3UT5E 2VKOA 3ETVA 4CI3B 3IEEA 5JR9B 4ILUA 2JRKA 1FIOA 1FMWA 3PE0A 4KMCA 5DABA 2JQQA 2Y6XA 1FMVA 3OJAA 5LOVE 4QHOA 3OYXA 5LA6E 2LSJA 4BJNA 2D5UA 2KINB 2WMNA 4H63V 3RYHE 3W15B 4A56A 1S35A 3ZLIA 3N9QA 2PJQA 2QGSA 4P0BA 3ZPOA 1T98A 4BA9A 2D0UA 2NTXA 2K48A 4EOZB 2E9XC 3HKCE 3OBVE 2A72A 2XQYA 3PURA 3U78A 2I59A 1BR4A 3Q5WA 1QSDA 4E7ZA 2C5KT 3K3OA 2X9XA 5LGUB 4EZHA 5LHGB 2CA5A 2XAQB 3AA0B 4K0UA 5LYJE 4UV9B 5CB4E 2D0TA 2VKJA 3Q9DA 1D0XA 3DP7A 5HXSA 3CKDA 3ZCIA 4ZI2C 4AQFA 1MMAA 5JREA 4BAYB 1LRZA 3PUAA 2WM9A 3F57A 3GN5B 5CA1E 4UVCB 5L3BB 3PUSA 1FEWA 3CX7B 2X0LB 3AA6B 2MOZA 3VHLA 3RC3A 4UF0B 4DBRA 4EXTA 3C4WA 5HWXA 1YW0A 2IC9A 2C5JA 3OYZA 3I0OA 4ZS3A 4EAHA 3JC6C 4QX8B 3LK2B 3ZYLA 3GN5A 4UVBB 3KV9A 3HKBE 1YD8G 2CEAA 2K24A 3ANWB 4PJLA 4MHCA 2Y48B 4HKAA 1CUNA 4PFOA 2CXFA 2KMFA 5L3GB 3LBXA 3I0QA 3E0ZA 1KK7A 3C4XA 1KNZA 3QK6A 2JJ9A 3C51A 5HXRA 3J7Yq 3ZMVB 1MMNA 3AA7B 5H6QB 2H7VC 3N9NA 4G63A 2CLYB 3KBUA 2CCQA 3MA9A 4WBNE 2ZM2A 5DJQC 2ACXA 3CQGB 5IHYA 1ZEEA 2VWAA 4IIJE 3NZQA 4YLHA 2N2NA 2V7IA 3T8OA 2CWOA 3PUQA 3Q5XA 3AAEB 1MIYA 2X67A 4TX5A 5FP3A 2XAHB 2V7KA 3ZC1A 5HXHA 5FMNA 4B6XA 5AFUL 4PFPA 3RX6A 2E9XD 3MZKB 2XAFB 4HGAA 5HXEA 2J1DG 4TZ4C 4ZI3D 4FJOA 2VB6A 3ONXA 5HWYA 5FY7A 1MNEA 1HCIA 3PU3A 4X1IE 1HG2A 2LEHA 2NP9A 2A2FX 2ZLYA 2M67A 3BQIA 2IW5B 3V5SA 2LOSA 3O9XA 3E22E 3C64A 4HN9A 2EHOD 4ISTA 2LSKA 2DNXA 2JPFA 3K8PC 2X9WA 5JDHA 3L3PA 4IDZA 4HTEA 3WAKA 2LOPA 4UEMA 1B7TA 2IC6A 2VKHA 1OWAA 1WYCA 3OKQA 4ZI3C 2V7MA 4O4HE 2W62A 2EHOC 4YHJA 5JDNA 4GK5E 5LJMA 4HE8A 4I43B 4ADZA 2V7LA 2CLYC 3P8CD 4YFSA 3TKLB 3ZMSB 3LK3B 3ZEFB 4CXYA 2Z6EA 2XAJB 2KNDA 3ZYMA 5BMVE 3ZMUB 5JQGE 3LJCA 3KBTA 4C90A 4WBOA 3ZJ2A 3RH3A 4GK0E 5LBQB 4MFRA 1D1BA 1D1CA 4H9OC 2X9HA 4X1KE 2LSGA 3IF8B 4FI5A 5ADXL 4H9PC 2XTLA 1NWMX 2Q9QB 3HR0A 5KMGP 5JDMA 3NZPA 2HPLA 4KUMB 1HG5A 4P09A 3L09A 4DBQA 1US7B 3UUXB 5JVDE 1ZHCA 2EHOA 1S94A 3PUGA 4PK4A 1QUUA 3ZC0A 4QX7B 3RPUA 2NW9A 2H7OA 3B57A 1D0ZA 4AKGA 4GOUA 4UV8B 5L3CB 2V1DB 3E08A 4DMWA 3UFEA 3FBLA 5JRCB 5M4YA 3UUMA 3KFWX 1MMGA 2L9QA 1O3XA 3NRYA 2E9XB 4NUUA 2BVMA 3VKHA 2DCFA 4U74A 2WMOA 3EUHA 3N5LA 5C8YE 4AQGA 2LE8A 2W63A 3O1IA 4U72A 3PU8A 2P9BA 4H9QC 4O4LE 5FXWA 1LVFA 3HI2A 2YEVC 4HFVA 5JDFA 3QUJA 5J2TE 2CMRA 1WRDA 2NWBA 2VK9A 3GWHA 2ODUA 4L5GA 4X20E 4OHFA 4XZCA 4O2BE 4CXXA 4EYYR 2CM0A 4P0AA 2X66A 4L0RA 3AB3B 3C50A 2G0UA 1V9DA 3AAIA 2ZM0A 2C5IT 2KLQA 5LG4A 2CWYA 1HTJF 4GYRA 2QA7A 3AA1B 4IE4A 5FXZA 3ESLA 4H9RC 2KZ7B 2UXNB 2ZMAA 4H63H 3RC8A 4X1YE 2WBLA 1MIWA 4ASKA 2ES0A 2GK9A 3QC9A 1IJ6A 2YU2A 2MBGA 2LSYA 3EDUA 3N9PA 2DWGA 4J2CA 4ZHQE 2IAKA 4AXPA 2RP4A 4PJNA 5J2UE 5LNKA 3BK9A 4CQIA 2LHRA 2YINA 5FY1A 4O4JE 5TAOA 3RKOA 4OK0A 2E9XA 3CVRA 2X51A 4I50E 4JLEA 4M1PA 2Y8DA 3FB2A 3HL6A 3Q2MA 3DTOA 4MBQA 2LSIA 2BVLA 5FY0A 2HPJA 1E1HB 2W61A 4IE6A 5EK4A 5JDLA 2N9DA 2Q9QA 4UXNB 1HS7A 2Q9QD 5L3EB 1ZKEA 2LJLA 1H7CA 5LP6E 5KDMC 4IE5A 3R84B 4O2AE 2DLRA 3IBPA 3N9MA 5LGNB 2E8IA 3FHNA 5JR9A 5LBMA 4DO0A 5IYZE 3KV6A 2XASB 5DQWA 2K5BB 2CXLA 3R6NA 4CZZB 2WWUA 4YJ3E 4PNIA 4DVDA 4XBFB 4MALA 4TV8E 4BJMA 5FXVA 1BR1A 3ZN0B 3FXDB 4ISSA 2CE7A 4IHJE 3LBXB 5LGTB 2CXDA 3PTRB 2RA1A 3KDSE 3EVYA 2WAUA 4O4IE 3CX8B 3DJBA 3FXEB 3LG7A 2NOXA 4PAGA 2MTQA 5F8PA 4ZS2A 3N2GE 2K9AA 4OYKA 3CPZA 3K3QC 4ZI7E 5HXCA 4F6RC 3I9WA 2XHEB 5LJNA 4UF0A 1NAFA 4G2AA 4JEHB 4TUYE 1X79A 4XAXB 3V5UA 2L8KA 5FNVE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CQI A;  4DND A;  4EYY R;  4L0R A;  3FXD B;  2G0U A;  2X9W A;  3CKD A;  3L3P A;  2C5I T;  2KWH A;  3CVR A;  2IC6 A;  3QK6 A;  4FI5 A;  1LRZ A;  3FXE B;  3N5L A;  2XTL A;  2K48 A;  2KWI B;  4B6X A;  3MXZ A;  1ZKE A;  3S4U A;  1H7C A;  1Z0P A;  1LVF A;  1QSD A;  2C5K T;  2X9X A;  3QUJ A;  1IJ6 A;  2MBG A;  4J2C A;  1IJ5 A;  2IC9 A;  2X9Y A;  2C5J A;  2CA5 A;  3TKL B;  3P7I A; 
#chains in the Genus database with same CATH topology
 2FJD A;  3GMI A;  4COF A;  2ZM8 A;  3RRC A;  4HFC A;  2BZB A;  4AKH A;  4OYJ A;  1XNR T;  4L9I A;  2WCA A;  4EZ4 A;  1CHU A;  2SPC A;  2PBI A;  3L8R A;  5JDQ A;  1SHZ C;  1N36 T;  5LMN T;  3H3M A;  2XQ9 A;  3CX6 B;  3LK4 2;  5JH7 E;  3CQX C;  5L3D B;  1WYB A;  4JV5 T;  4H9S E;  5AQM B;  5HEU A;  3HKE E;  3UUL A;  4LFA T;  3L39 A;  5E0O A;  2D2S A;  2CBI A;  2PFV A;  3AEC A;  3GA8 A;  4PJM A;  2V7J A;  4ZOL E;  3ZJ1 A;  2PTF A;  1WR0 A;  3AXJ A;  4TN7 B;  1VRB A;  4PK5 A;  1UX5 A;  2MYS A;  2YKS A;  2OV9 A;  3FBZ A;  3P4R A;  3HA4 A;  3N2O A;  4YSZ A;  2LT3 A;  3RIF A;  1OED E;  2H3R A;  3WAJ A;  3AED A;  2JMK A;  4X5T A;  3RGL A;  3QB5 K;  2OA5 A;  5LCY A;  3PDY A;  3T1Y T;  1XWM A;  3EAM A;  4CXW A;  4EYU A;  3PV0 F;  1MIV A;  3RKG A;  2NW8 A;  2WDQ A;  2W00 A;  1GQE A;  2V5C A;  4JUY A;  4AQF C;  2KXP B;  3JC6 D;  3AVR A;  2LRL A;  4O8S A;  5AQK B;  3O4X E;  4DR2 T;  2V8S V;  1G8X A;  3N2K E;  4NIQ A;  4WYV A;  4YT0 A;  4Z91 A;  3UQ4 A;  2AXD S;  4LF6 T;  3AEE A;  1VOM A;  3ANW A;  3CWZ B;  3LFM A;  2UUB T;  4JEU B;  4EIW A;  2KT9 A;  3BQL A;  2XUE A;  4QWN B;  3I1A A;  5HAX A;  3SOL A;  4YJ2 E;  4ZI2 D;  5LXT E;  1U4Q A;  2Q9Q C;  4HEA A;  2WWV A;  1YQ4 A;  3NWI A;  1XZY A;  1HNW T;  1I6Z A;  5L2L A;  3EHZ A;  3ETU A;  3MK7 C;  4DV1 T;  2AE9 A;  2V26 A;  3RYC E;  2JQH A;  4U31 A;  1EZ3 A;  4JI2 T;  4DMV A;  3K3N A;  5A1L A;  1UCU A;  5JDG A;  3H3A A;  5CA0 E;  2BDE A;  2WU2 A;  2X9Y A;  3PJA J;  3RRW A;  3SRZ A;  3I9Y A;  2VKD A;  1XMO T;  4AI6 A;  5H6R B;  3FZL B;  1IBK T;  1D1A A;  4DV0 T;  4DND A;  1U5P A;  3ZMZ B;  2DWK A;  4TV9 E;  4GKK T;  1L0V A;  3EAB A;  4IE0 A;  2FBW A;  2VQE T;  4JI6 T;  2DHR A;  2WSS V;  2XPK A;  4ANJ A;  2A3D A;  2YDR A;  1HNX T;  2EHO B;  4KP3 C;  3O1H A;  1HFA A;  2ODV A;  1ZV4 X;  4QXC B;  4AQY T;  5LHH B;  2YK0 A;  3WI3 A;  3VKG A;  1WLX A;  3AE4 A;  2YN6 A;  2VAS A;  1HX8 A;  3BQK A;  4HFE A;  4I4T E;  5J1G A;  5BR8 T;  4ERR A;  3S4U A;  2CHO A;  1NEN A;  5EK3 A;  3ONJ A;  3U3I A;  5DQV A;  3UUN A;  4AKI A;  3JAE A;  4B3T T;  1IZN B;  1OXZ A;  5F3J A;  4DR6 T;  5GON E;  3A5X A;  1MND A;  4UVA B;  1G73 A;  3RQW A;  5FYM A;  2YDQ A;  3C4Z A;  4JI4 T;  3KV4 A;  4AKR B;  2X68 A;  5CJ5 A;  2UXB T;  4IE7 A;  4XBF B;  1X9B A;  3SS1 A;  2LLY A;  4GYS A;  2N1G A;  2XQ8 A;  3KIN B;  3KVB A;  2KWH A;  3IHR A;  4PW8 A;  2B76 A;  3MKD A;  1NEK A;  2V6X A;  5FVK A;  3FZM B;  4PK6 A;  3MAC A;  2JMH A;  5HCM A;  5JR9 C;  5LHI B;  1T72 A;  3AE1 A;  2J4G A;  2M6B A;  5AQT B;  2BS2 A;  3HKD E;  3AAA B;  1HF8 A;  5FXX A;  4EB6 E;  1W0A A;  2CPT A;  2FJA A;  1R8I A;  4DR4 T;  4V1A v;  3D0T A;  5AQO B;  3AVS A;  4PJJ A;  2MBG A;  2UXC T;  5ETW A;  4EGW A;  2PG8 A;  3PUX F;  3OTO T;  3ZCJ A;  1IJ5 A;  3H37 A;  3ZMT B;  5CFB A;  5EZY E;  2XAG B;  1MMD A;  3N9L A;  3KV5 A;  3P7I A;  4AKL A;  1YKH B;  3F2E A;  2LM2 A;  3QNU A;  3O1J A;  1UX4 A;  3EDV A;  2YDS A;  4UIG A;  4Z8X A;  1BR2 A;  3UTK A;  4QXH B;  1N34 T;  3UU4 A;  1WCR A;  3ZYK A;  5L3F B;  3RYI E;  4CI1 B;  3AEG A;  4NUV A;  4JI0 T;  3P4S A;  2W0G A;  3TLW A;  4CI2 B;  2KWI B;  3FZK B;  1OED C;  4KBM B;  2QYW A;  3CQC B;  3MXZ A;  2D9D A;  5HYA A;  3SFE A;  1YKE B;  4DV7 T;  1W09 A;  2LHN A;  3N9O A;  3RYF E;  4ZXL A;  1Z0P A;  4IGU A;  1AJ3 A;  2A9U A;  1BR0 A;  3X1D A;  5AQP B;  3SWH A;  1IAP A;  2X0H A;  1Y64 B;  1LKX A;  2NTY A;  4KI0 F;  3UFG A;  2VVN A;  4DV4 T;  2NW7 A;  1D0Y A;  2YOE A;  1SA0 E;  2LM9 A;  4H9N C;  4QXB B;  3J9X 1;  3RIU C;  3UU6 A;  4EED A;  5CGM A;  1N33 T;  1SE7 A;  3B13 A;  2VL8 A;  4QKN A;  4UEL A;  2WY2 A;  3P4Q A;  4WW0 A;  3AEB A;  1LVK A;  4UR9 A;  1E7P A;  3ZN1 B;  4OFZ A;  4E7S A;  2L3L A;  5KX5 E;  2UXX B;  3NRX A;  4LML A;  1WR6 A;  2HH7 A;  3CML A;  2C0S A;  5EK2 A;  3ABV A;  2BG9 E;  3KVA A;  1UUR A;  2B1E A;  4CN1 A;  4I55 E;  4HFH A;  3F31 A;  3MJX A;  2RPA A;  4MLK A;  4WNK A;  3SFD A;  2F4V T;  1HNZ T;  5JRC A;  5KXJ A;  3ZST A;  4CN4 A;  3NBX X;  2YU1 A;  3C98 B;  3M65 A;  2DI4 A;  2XQ6 A;  4N78 D;  5L4E A;  3OVU A;  3VU7 H;  4YY3 T;  4GIW A;  3UT5 E;  2MAW A;  2VKO A;  4JI1 T;  3ETV A;  4HWC A;  4CI3 B;  3IEE A;  5JR9 B;  2XSB A;  4ILU A;  2JRK A;  1FIO A;  1FMW A;  3PE0 A;  2WU5 A;  4KMC A;  3RQU A;  2UU9 T;  5DAB A;  2JQQ A;  2Y6X A;  1FMV A;  3OJA A;  2H88 A;  3CK6 A;  5C3J A;  4DR5 T;  5LOV E;  2UUA T;  4QHO A;  3OYX A;  5LA6 E;  2LSJ A;  4BJN A;  2BG9 A;  4Q25 A;  2D5U A;  2KIN B;  2WMN A;  4H63 V;  3RYH E;  3W15 B;  4A56 A;  4DV3 T;  3AE8 A;  4JI3 T;  3RIA A;  1VCT A;  4OX9 T;  1S35 A;  3ZLI A;  1E2A A;  3N9Q A;  2PJQ A;  3P4P A;  2LKG A;  2QGS A;  3JAD A;  4P0B A;  3ZKR A;  1T98 A;  2V6Y A;  2CRB A;  4U2Z A;  2D0U A;  2NTX A;  2K48 A;  3ZPO A;  4BA9 A;  2KSR A;  4EOZ B;  2E9X C;  3HKC E;  2JQK A;  3OBV E;  2A72 A;  2XQY A;  3PUR A;  3U78 A;  2I59 A;  3LDQ B;  1BR4 A;  3Q5W A;  1QSD A;  3VRA A;  2C5K T;  3K3O A;  2X9X A;  4IL4 A;  4E7Z A;  5LGU B;  4EZH A;  5HEO A;  5LHG B;  2CA5 A;  2XAQ B;  1UUS A;  3RLF F;  3AA0 B;  4JI8 T;  4K0U A;  5LYJ E;  4X64 T;  4QH5 A;  3AEF A;  4UV9 B;  5CB4 E;  1ZP0 A;  2D0T A;  4DID B;  2VKJ A;  3Q9D A;  4IDO A;  1D0X A;  3DP7 A;  4LF8 T;  3NVO A;  4JI5 T;  5JDL A;  4HFI A;  5IWA T;  4NXN T;  5HXS A;  3CKD A;  3ZCI A;  4ZI2 C;  4B3S T;  3Q5E A;  4AQF A;  1MMA A;  4AIU A;  3TLU A;  5JRE A;  2BBH A;  4BAY B;  1LRZ A;  3PUA A;  2R6G F;  4HWD A;  2WM9 A;  3F57 A;  3GN5 B;  5CA1 E;  4UVC B;  5L3B B;  3PUS A;  1FEW A;  3CX7 B;  4YTM A;  2X0L B;  3RF1 A;  3AA6 B;  2MOZ A;  3VHL A;  4TWH A;  3RC3 A;  2MPK A;  4UF0 B;  4DBR A;  4EXT A;  3C4W A;  3PJA A;  2WZH A;  3QB5 A;  1YXR A;  4IDQ A;  4IDN A;  4ZZB A;  1YW0 A;  3PUW F;  5HWX A;  2IC9 A;  2IDO B;  3AE5 A;  2BG9 B;  2C5J A;  3OYZ A;  3I0O A;  4ZS3 A;  4P1N A;  3PUY F;  3JC6 C;  4NPP A;  4QX8 B;  4EAH A;  3LK2 B;  4LFC T;  3ZYL A;  4YSX A;  3AE6 A;  5ABE A;  3GN5 A;  4UVB B;  3T1H T;  4EEB A;  3KV9 A;  3HKB E;  1YD8 G;  2CEA A;  2IUB A;  2K24 A;  4YTN A;  4YHH T;  3ANW B;  4PJL A;  5AQG B;  3AE9 A;  1J5E T;  4MHC A;  2Y48 B;  4HKA A;  1CUN A;  4PFO A;  1T7S A;  2CXF A;  2KMF A;  5L3G B;  3LBX A;  3I0Q A;  2W4X A;  3E0Z A;  1KK7 A;  3C4X A;  4LMJ A;  3QK6 A;  1KNZ A;  2JJ9 A;  4QH4 A;  3C51 A;  1M62 A;  5HXR A;  3J7Y q;  3ZMV B;  1XDO A;  2XQ7 A;  1MMN A;  3A8Y C;  3AA7 B;  5AQU B;  5H6Q B;  2H7V C;  2W2U A;  2HN2 A;  3N9N A;  4G63 A;  4I0U A;  2CLY B;  3KBU A;  4KHP T;  2CCQ A;  2UUC T;  3MA9 A;  4WBN E;  2ZM2 A;  5DJQ C;  3ZT6 A;  2ACX A;  2IHR 1;  1YQ3 A;  2XQ5 A;  1ZEE A;  2VWA A;  3CQG B;  4IIJ E;  4U3C A;  3NZQ A;  4YLH A;  3TLV A;  2N2N A;  2V7I A;  3T8O A;  2ZM6 T;  2CWO A;  2J62 A;  2XSA A;  3PUQ A;  3Q5X A;  2QRX A;  1MIY A;  2X67 A;  3AAE B;  4IRE A;  4ILB A;  4TX5 A;  5ABG A;  5FP3 A;  5J0Z A;  4HWI B;  2XAH B;  2V7K A;  2XQA A;  3ZC1 A;  5HXH A;  3ZT5 A;  5FMN A;  5F5W A;  4B6X A;  5AFU L;  1KEY A;  4PFP A;  3RX6 A;  2E9X D;  2NR4 A;  3MZK B;  2XAF B;  4HGA A;  3UU5 A;  5HXE A;  4KX6 A;  2J1D G;  4TZ4 C;  4ZI3 D;  1UK5 A;  2VB6 A;  4FJO A;  4JYA T;  3ONX A;  5HWY A;  5FY7 A;  1MNE A;  1HCI A;  2E5V A;  4DUY T;  3PU3 A;  3AXJ B;  3K1S A;  4X1I E;  1HG2 A;  2LEH A;  2NP9 A;  2A2F X;  4IT4 A;  2ZLY A;  2M67 A;  3BQI A;  2BG9 C;  5LG3 A;  2IW5 B;  3V5S A;  4LF4 T;  2H89 A;  2LOS A;  1WFD A;  2I0M A;  3E22 E;  1JNZ A;  3C64 A;  4KHZ F;  3PUV F;  3O9X A;  5FL1 A;  1XMQ T;  5ABH A;  4HN9 A;  2EHO D;  4IST A;  1JNR A;  2LSK A;  4DVD A;  2DNX A;  1QLB A;  2JPF A;  1W0B A;  3K8P C;  2X9W A;  4Z90 A;  2BS3 A;  3L3P A;  4IDZ A;  4A5X A;  5JDH A;  4HTE A;  3WAK A;  2LOP A;  1KNR A;  1B7T A;  2IC6 A;  2VKH A;  1OWA A;  4UEM A;  4JBW F;  5AQV B;  1HR0 T;  1WYC A;  4LF5 T;  3OKQ A;  4ZI3 C;  5HEJ A;  1DU2 A;  2V7M A;  4O4H E;  2W62 A;  2EHO C;  1ZOY A;  4YHJ A;  4AIS A;  3RHW A;  5JDN A;  1VCS A;  4GK5 E;  5LJM A;  4HE8 A;  4I43 B;  5AQS B;  4ADZ A;  2V7L A;  2E2A A;  2CLY C;  3P8C D;  4DV2 T;  2W67 A;  4YFS A;  4DV6 T;  3TKL B;  3ZMS B;  3LK3 B;  3ZEF B;  2XJ7 A;  4CXY A;  2Z6E A;  2XAJ B;  4X66 T;  2WP9 A;  2KND A;  3ZYM A;  2HHH T;  5BMV E;  3ZMU B;  1Y01 A;  5JQG E;  2BKN A;  5LB7 B;  3LJC A;  4YTP A;  3KBT A;  4C90 A;  4WBO A;  3ZJ2 A;  3RH3 A;  1T8B A;  2CHN A;  4GK0 E;  5LBQ B;  3RIU A;  4HFD A;  4MFR A;  1KF6 A;  1D1B A;  1D1C A;  3UU3 A;  4H9O C;  2X9H A;  4X1K E;  2LSG A;  3IF8 B;  4FI5 A;  5ADX L;  3JAF A;  4H9P C;  2XTL A;  3P4W A;  5HCJ A;  1NWM X;  2Q9Q B;  3HR0 A;  5KMG P;  5JDM A;  3NZP A;  2HPL A;  2V5D A;  1HG5 A;  4KUM B;  3L09 A;  4P09 A;  1US7 B;  4DBQ A;  3UUX B;  1I94 T;  5JVD E;  1ZHC A;  4X62 T;  2VUR A;  2EHO A;  1S94 A;  2BKO A;  3PUG A;  1QUU A;  4PK4 A;  3ZC0 A;  4U7I A;  4QX7 B;  2W66 A;  3UUB A;  3RPU A;  3LSV A;  2NW9 A;  2H7O A;  3Q5D A;  2K3W A;  2XM2 A;  3B57 A;  1D0Z A;  4AKG A;  4GOU A;  4UV8 B;  3RI5 A;  5L3C B;  2XZE A;  5AQI B;  2V1D B;  2J47 A;  3A7M A;  2IML A;  3E08 A;  3UFE A;  4DMW A;  3FBL A;  5JRC B;  5M4Y A;  5FL0 A;  2VL0 A;  3P50 A;  3UUM A;  3KFW X;  4JI7 T;  3VRB A;  1MMG A;  2L9Q A;  1O3X A;  2WB5 A;  3NRY A;  2E9X B;  4TNV A;  4NUU A;  5AQH B;  2BVM A;  2M6I A;  3VR9 A;  4YSY A;  1XNQ T;  2DCF A;  4U74 A;  3VKH A;  2WMO A;  2UXD T;  3EUH A;  3N5L A;  5C8Y E;  4AQG A;  2LE8 A;  2W63 A;  2BBJ A;  3O1I A;  2HN1 A;  4U72 A;  2FJE A;  3PU8 A;  5AQJ B;  2P9B A;  2CBJ A;  4H9Q C;  4HWH A;  4O4L E;  5FXW A;  5L47 A;  1LVF A;  3HI2 A;  2YEV C;  4HFV A;  2LKH A;  2WS3 A;  3AE3 A;  5JDF A;  3QUJ A;  5J2T E;  2WDR A;  2CMR A;  5AQR B;  1WRD A;  2NWB A;  4A97 A;  4F8H A;  4HWF A;  4ZZC A;  2VK9 A;  4IL9 A;  2E5L T;  3GWH A;  2ODU A;  4L5G A;  2WZI A;  4OHF A;  4X20 E;  4XZC A;  4LF7 T;  2JQ9 A;  4O2B E;  4DR1 T;  4CXX A;  2V6Y B;  2CM0 A;  4TWF A;  4EYY R;  5LMU T;  4P0A A;  2X66 A;  4L0R A;  3AB3 B;  3C50 A;  2G0U A;  1V9D A;  4ILA A;  3AAI A;  2ZM0 A;  2WQY A;  2C5I T;  5AQF B;  4DR7 T;  1IBM T;  2KLQ A;  4CN6 A;  4DV5 T;  5LG4 A;  2CWY A;  4C91 A;  1HTJ F;  1UGO A;  3TLT A;  4GYR A;  2XQ4 A;  2QA7 A;  3AA1 B;  4IE4 A;  5FXZ A;  5C2T A;  4DUZ T;  1KNP A;  3ESL A;  4H9R C;  4IDP A;  2KZ7 B;  2UXN B;  2ZMA A;  2LRK A;  5AQQ B;  4H63 H;  1FJG T;  3RC8 A;  3ZT7 A;  4X1Y E;  4ILC A;  2WBL A;  2ACZ A;  4A98 A;  1MIW A;  4ASK A;  2ES0 A;  2GK9 A;  3JCF A;  3PUZ F;  1IJ6 A;  2YU2 A;  3QC9 A;  3QOF A;  2QVA A;  4U7Y A;  2LSY A;  3EDU A;  3N9P A;  2DWG A;  4J2C A;  4ZHQ E;  2IAK A;  4AXP A;  2RP4 A;  5FKY A;  2FJB A;  3EI0 A;  4PJN A;  5J2U E;  5LNK A;  3BK9 A;  4NXM T;  4B3R T;  5L4H A;  4CQI A;  2LHR A;  4ZEY A;  5ABF A;  2YIN A;  3B5M A;  2X0Y A;  2VVS A;  4O4J E;  5FY1 A;  5TAO A;  3RKO A;  1OED B;  4OK0 A;  2E9X A;  2DL1 A;  2XM1 A;  2X51 A;  3CVR A;  4I50 E;  4JLE A;  2Y8D A;  4M1P A;  3FB2 A;  3HL6 A;  3Q2M A;  3DTO A;  4MBQ A;  2LSI A;  4QH1 A;  2BVL A;  5FY0 A;  2HPJ A;  1E1H B;  1HX1 B;  2W61 A;  1M7K A;  3AE2 A;  3M3Z B;  4IE6 A;  2N9D A;  5EK4 A;  4YXD A;  2Q9Q A;  4UXN B;  1J5W A;  2Q9Q D;  5L3E B;  1HS7 A;  1ZKE A;  2LJL A;  1H7C A;  5LP6 E;  2IIU A;  5FVL A;  5HEH A;  5IHY A;  4IE5 A;  5KDM C;  3R84 B;  2OLT A;  4O2A E;  2DLR A;  2I6H A;  3IBP A;  3N9M A;  5LGN B;  2E8I A;  1OED A;  2XQ3 A;  3FHN A;  5JR9 A;  5LBM A;  4DO0 A;  1J1J A;  5IYZ E;  3KV6 A;  4LMK A;  3TLS A;  2XAS B;  4TWD A;  2K5B B;  2CXL A;  5DQW A;  3R6N A;  3ZSS A;  4CZZ B;  5JTG A;  4LF9 T;  2WWU A;  3OPC A;  4YJ3 E;  1KFY A;  4PNI A;  4GKJ T;  4U33 A;  2BKP A;  4MAL A;  4TV8 E;  1SUM B;  1W9R A;  5AQN B;  3VR8 A;  5FXV A;  4BJM A;  4EV6 A;  1BR1 A;  2FUP A;  3FXD B;  4ISS A;  2CE7 A;  4IHJ E;  3LBX B;  3ZN0 B;  5LGT B;  2CXD A;  4LFB T;  3PTR B;  2RA1 A;  3NKZ A;  3KDS E;  3ONL C;  1Z8U A;  2WAU A;  3EVY A;  2VQF T;  3UU8 A;  3AE7 A;  4O4I E;  3CX8 B;  3DJB A;  3FXE B;  3LG7 A;  2NOX A;  3CIR A;  4PAG A;  5AQL B;  2MTQ A;  4X65 T;  5F8P A;  4ZS2 A;  3FZF B;  3G06 A;  3N2G E;  2K9A A;  4OYK A;  2JIW A;  3CPZ A;  4TNW A;  2WDV A;  4U2Y A;  3K3Q C;  5IUX A;  4WZX A;  4ZI7 E;  5HEG A;  5HXC A;  4F6R C;  2XY8 B;  4HFB A;  3I9W A;  4B3M T;  3IA3 A;  1XDP A;  1IBL T;  2XHE B;  5LJN A;  4K0K T;  4UF0 A;  3UQ7 A;  3FZH B;  1NAF A;  2BS4 A;  4G2A A;  4JEH B;  4DR3 T;  4TUY E;  1X79 A;  4XAX B;  3AEA A;  3V5U A;  5ABF B;  1N32 T;  2L8K A;  5FNV E; 
#chains in the Genus database with same CATH homology
 3GMI A;  2ZM8 A;  3RRC A;  2BZB A;  4AKH A;  4OYJ A;  4L9I A;  4EZ4 A;  5JDQ A;  2PBI A;  2SPC A;  1SHZ C;  3CX6 B;  3LK4 2;  5JH7 E;  5L3D B;  3CQX C;  1WYB A;  4H9S E;  3HKE E;  3UUL A;  5E0O A;  2D2S A;  2PFV A;  3GA8 A;  4ZOL E;  4PJM A;  2V7J A;  3ZJ1 A;  4TN7 B;  1VRB A;  4PK5 A;  1UX5 A;  2MYS A;  3FBZ A;  3HA4 A;  3N2O A;  2LT3 A;  2H3R A;  3WAJ A;  2JMK A;  2OA5 A;  5LCY A;  3PDY A;  4EYU A;  4CXW A;  1MIV A;  2NW8 A;  4JUY A;  2W00 A;  4AQF C;  2KXP B;  3JC6 D;  3AVR A;  4O8S A;  3O4X E;  1G8X A;  3N2K E;  1VOM A;  3ANW A;  3CWZ B;  3LFM A;  4JEU B;  4EIW A;  2KT9 A;  3BQL A;  2XUE A;  4QWN B;  3I1A A;  5HAX A;  3SOL A;  4YJ2 E;  4ZI2 D;  5LXT E;  1U4Q A;  2Q9Q C;  4HEA A;  5L2L A;  3MK7 C;  3ETU A;  2V26 A;  3RYC E;  1EZ3 A;  4DMV A;  3K3N A;  5A1L A;  1UCU A;  5JDG A;  3H3A A;  5CA0 E;  2BDE A;  2X9Y A;  3RRW A;  3SRZ A;  3I9Y A;  2VKD A;  4AI6 A;  5H6R B;  1D1A A;  4DND A;  1U5P A;  3ZMZ B;  2DWK A;  4TV9 E;  4IE0 A;  2DHR A;  2WSS V;  4ANJ A;  2A3D A;  2EHO B;  4KP3 C;  3O1H A;  1HFA A;  2ODV A;  1ZV4 X;  4QXC B;  5LHH B;  2YK0 A;  3WI3 A;  3VKG A;  1WLX A;  3BQK A;  2VAS A;  1HX8 A;  5J1G A;  4I4T E;  4ERR A;  3S4U A;  3U3I A;  4AKI A;  5EK3 A;  3UUN A;  5DQV A;  1IZN B;  1OXZ A;  5F3J A;  5GON E;  3A5X A;  1MND A;  4UVA B;  1G73 A;  5FYM A;  3C4Z A;  3KV4 A;  4AKR B;  2X68 A;  4IE7 A;  3SS1 A;  4GYS A;  2N1G A;  3KIN B;  3KVB A;  2KWH A;  3IHR A;  4PW8 A;  3MKD A;  4PK6 A;  3MAC A;  2JMH A;  5JR9 C;  5LHI B;  3HKD E;  5FXX A;  3AAA B;  1HF8 A;  4EB6 E;  4V1A v;  3D0T A;  3AVS A;  4PJJ A;  5ETW A;  2PG8 A;  3ZCJ A;  1IJ5 A;  3H37 A;  3ZMT B;  5EZY E;  2XAG B;  1MMD A;  3N9L A;  3KV5 A;  3P7I A;  4AKL A;  1YKH B;  3F2E A;  3UTK A;  3O1J A;  1UX4 A;  3EDV A;  4UIG A;  4Z8X A;  4C91 A;  1BR2 A;  4QXH B;  3ZYK A;  5L3F B;  3RYI E;  4CI1 B;  4NUV A;  2W0G A;  4CI2 B;  2KWI B;  4KBM B;  3MXZ A;  3CQC B;  5HYA A;  1YKE B;  3N9O A;  2LHN A;  3RYF E;  1Z0P A;  4IGU A;  1AJ3 A;  1BR0 A;  3SWH A;  1IAP A;  1Y64 B;  1LKX A;  2NTY A;  2NW7 A;  1D0Y A;  4H9N C;  1SA0 E;  2LM9 A;  4QXB B;  3J9X 1;  3B13 A;  2VL8 A;  4QKN A;  4UEL A;  4WW0 A;  1LVK A;  3ZN1 B;  4OFZ A;  4E7S A;  2L3L A;  5KX5 E;  2UXX B;  3NRX A;  1WR6 A;  2HH7 A;  3CML A;  2C0S A;  5EK2 A;  3KVA A;  2B1E A;  4I55 E;  3F31 A;  3MJX A;  4MLK A;  4WNK A;  5JRC A;  3NBX X;  2YU1 A;  3C98 B;  3M65 A;  2DI4 A;  4N78 D;  3VU7 H;  4GIW A;  3UT5 E;  2VKO A;  3ETV A;  4CI3 B;  3IEE A;  5JR9 B;  4ILU A;  2JRK A;  1FIO A;  1FMW A;  3PE0 A;  4KMC A;  5DAB A;  2JQQ A;  2Y6X A;  1FMV A;  3OJA A;  5LOV E;  4QHO A;  3OYX A;  5LA6 E;  2LSJ A;  4BJN A;  2D5U A;  2KIN B;  2WMN A;  4H63 V;  3RYH E;  3W15 B;  4A56 A;  1S35 A;  3ZLI A;  3N9Q A;  2PJQ A;  2QGS A;  4P0B A;  3ZPO A;  1T98 A;  4BA9 A;  2D0U A;  2NTX A;  2K48 A;  4EOZ B;  2E9X C;  3HKC E;  3OBV E;  2A72 A;  2XQY A;  3PUR A;  3U78 A;  2I59 A;  1BR4 A;  3Q5W A;  1QSD A;  4E7Z A;  2C5K T;  3K3O A;  2X9X A;  5LGU B;  4EZH A;  5LHG B;  2CA5 A;  2XAQ B;  3AA0 B;  4K0U A;  5LYJ E;  4UV9 B;  5CB4 E;  2D0T A;  2VKJ A;  3Q9D A;  1D0X A;  3DP7 A;  5HXS A;  3CKD A;  3ZCI A;  4ZI2 C;  4AQF A;  1MMA A;  5JRE A;  4BAY B;  1LRZ A;  3PUA A;  2WM9 A;  3F57 A;  3GN5 B;  5CA1 E;  4UVC B;  5L3B B;  3PUS A;  1FEW A;  3CX7 B;  2X0L B;  3AA6 B;  2MOZ A;  3VHL A;  3RC3 A;  4UF0 B;  4DBR A;  4EXT A;  3C4W A;  5HWX A;  1YW0 A;  2IC9 A;  2C5J A;  3OYZ A;  3I0O A;  4ZS3 A;  4EAH A;  3JC6 C;  4QX8 B;  3LK2 B;  3ZYL A;  3GN5 A;  4UVB B;  3KV9 A;  3HKB E;  1YD8 G;  2CEA A;  2K24 A;  3ANW B;  4PJL A;  4MHC A;  2Y48 B;  4HKA A;  1CUN A;  4PFO A;  2CXF A;  2KMF A;  5L3G B;  3LBX A;  3I0Q A;  3E0Z A;  1KK7 A;  3C4X A;  1KNZ A;  3QK6 A;  2JJ9 A;  3C51 A;  5HXR A;  3J7Y q;  3ZMV B;  1MMN A;  3AA7 B;  5H6Q B;  2H7V C;  3N9N A;  4G63 A;  2CLY B;  3KBU A;  2CCQ A;  3MA9 A;  4WBN E;  2ZM2 A;  5DJQ C;  2ACX A;  3CQG B;  5IHY A;  1ZEE A;  2VWA A;  4IIJ E;  3NZQ A;  4YLH A;  2N2N A;  2V7I A;  3T8O A;  2CWO A;  3PUQ A;  3Q5X A;  3AAE B;  1MIY A;  2X67 A;  4TX5 A;  5FP3 A;  2XAH B;  2V7K A;  3ZC1 A;  5HXH A;  5FMN A;  4B6X A;  5AFU L;  4PFP A;  3RX6 A;  2E9X D;  3MZK B;  2XAF B;  4HGA A;  5HXE A;  2J1D G;  4TZ4 C;  4ZI3 D;  4FJO A;  2VB6 A;  3ONX A;  5HWY A;  5FY7 A;  1MNE A;  1HCI A;  3PU3 A;  4X1I E;  1HG2 A;  2LEH A;  2NP9 A;  2A2F X;  2ZLY A;  2M67 A;  3BQI A;  2IW5 B;  3V5S A;  2LOS A;  3O9X A;  3E22 E;  3C64 A;  4HN9 A;  2EHO D;  4IST A;  2LSK A;  2DNX A;  2JPF A;  3K8P C;  2X9W A;  5JDH A;  3L3P A;  4IDZ A;  4HTE A;  3WAK A;  2LOP A;  4UEM A;  1B7T A;  2IC6 A;  2VKH A;  1OWA A;  1WYC A;  3OKQ A;  4ZI3 C;  2V7M A;  4O4H E;  2W62 A;  2EHO C;  4YHJ A;  5JDN A;  4GK5 E;  5LJM A;  4HE8 A;  4I43 B;  4ADZ A;  2V7L A;  2CLY C;  3P8C D;  4YFS A;  3TKL B;  3ZMS B;  3LK3 B;  3ZEF B;  4CXY A;  2Z6E A;  2XAJ B;  2KND A;  3ZYM A;  5BMV E;  3ZMU B;  5JQG E;  3LJC A;  3KBT A;  4C90 A;  4WBO A;  3ZJ2 A;  3RH3 A;  4GK0 E;  5LBQ B;  4MFR A;  1D1B A;  1D1C A;  4H9O C;  2X9H A;  4X1K E;  2LSG A;  3IF8 B;  4FI5 A;  5ADX L;  4H9P C;  2XTL A;  1NWM X;  2Q9Q B;  3HR0 A;  5KMG P;  5JDM A;  3NZP A;  2HPL A;  4KUM B;  1HG5 A;  4P09 A;  3L09 A;  4DBQ A;  1US7 B;  3UUX B;  5JVD E;  1ZHC A;  2EHO A;  1S94 A;  3PUG A;  4PK4 A;  1QUU A;  3ZC0 A;  4QX7 B;  3RPU A;  2NW9 A;  2H7O A;  3B57 A;  1D0Z A;  4AKG A;  4GOU A;  4UV8 B;  5L3C B;  2V1D B;  3E08 A;  4DMW A;  3UFE A;  3FBL A;  5JRC B;  5M4Y A;  3UUM A;  3KFW X;  1MMG A;  2L9Q A;  1O3X A;  3NRY A;  2E9X B;  4NUU A;  2BVM A;  3VKH A;  2DCF A;  4U74 A;  2WMO A;  3EUH A;  3N5L A;  5C8Y E;  4AQG A;  2LE8 A;  2W63 A;  3O1I A;  4U72 A;  3PU8 A;  2P9B A;  4H9Q C;  4O4L E;  5FXW A;  1LVF A;  3HI2 A;  2YEV C;  4HFV A;  5JDF A;  3QUJ A;  5J2T E;  2CMR A;  1WRD A;  2NWB A;  2VK9 A;  3GWH A;  2ODU A;  4L5G A;  4X20 E;  4OHF A;  4XZC A;  4O2B E;  4CXX A;  4EYY R;  2CM0 A;  4P0A A;  2X66 A;  4L0R A;  3AB3 B;  3C50 A;  2G0U A;  1V9D A;  3AAI A;  2ZM0 A;  2C5I T;  2KLQ A;  5LG4 A;  2CWY A;  1HTJ F;  4GYR A;  2QA7 A;  3AA1 B;  4IE4 A;  5FXZ A;  3ESL A;  4H9R C;  2KZ7 B;  2UXN B;  2ZMA A;  4H63 H;  3RC8 A;  4X1Y E;  2WBL A;  1MIW A;  4ASK A;  2ES0 A;  2GK9 A;  3QC9 A;  1IJ6 A;  2YU2 A;  2MBG A;  2LSY A;  3EDU A;  3N9P A;  2DWG A;  4J2C A;  4ZHQ E;  2IAK A;  4AXP A;  2RP4 A;  4PJN A;  5J2U E;  5LNK A;  3BK9 A;  4CQI A;  2LHR A;  2YIN A;  5FY1 A;  4O4J E;  5TAO A;  3RKO A;  4OK0 A;  2E9X A;  3CVR A;  2X51 A;  4I50 E;  4JLE A;  4M1P A;  2Y8D A;  3FB2 A;  3HL6 A;  3Q2M A;  3DTO A;  4MBQ A;  2LSI A;  2BVL A;  5FY0 A;  2HPJ A;  1E1H B;  2W61 A;  4IE6 A;  5EK4 A;  5JDL A;  2N9D A;  2Q9Q A;  4UXN B;  1HS7 A;  2Q9Q D;  5L3E B;  1ZKE A;  2LJL A;  1H7C A;  5LP6 E;  5KDM C;  4IE5 A;  3R84 B;  4O2A E;  2DLR A;  3IBP A;  3N9M A;  5LGN B;  2E8I A;  3FHN A;  5JR9 A;  5LBM A;  4DO0 A;  5IYZ E;  3KV6 A;  2XAS B;  5DQW A;  2K5B B;  2CXL A;  3R6N A;  4CZZ B;  2WWU A;  4YJ3 E;  4PNI A;  4DVD A;  4XBF B;  4MAL A;  4TV8 E;  4BJM A;  5FXV A;  1BR1 A;  3ZN0 B;  3FXD B;  4ISS A;  2CE7 A;  4IHJ E;  3LBX B;  5LGT B;  2CXD A;  3PTR B;  2RA1 A;  3KDS E;  3EVY A;  2WAU A;  4O4I E;  3CX8 B;  3DJB A;  3FXE B;  3LG7 A;  2NOX A;  4PAG A;  2MTQ A;  5F8P A;  4ZS2 A;  3N2G E;  2K9A A;  4OYK A;  3CPZ A;  3K3Q C;  4ZI7 E;  5HXC A;  4F6R C;  3I9W A;  2XHE B;  5LJN A;  4UF0 A;  1NAF A;  4G2A A;  4JEH B;  4TUY E;  1X79 A;  4XAX B;  3V5U A;  2L8K A;  5FNV E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...