2C5JA

N-terminal domain of tlg1, domain-swapped dimer
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
87
structure length
82
Chain Sequence
DPFQQVVKDTKEQLNRINNYITRHNTAEEEIQDILKDVEETIVDLDRSIIVMKRDENEDVSGREAQVKNIKQQLDALKLRFD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords T-SNARE AFFECTING A LATE GOLGI COMPARTMENT PROTEIN 1
publication title Structural Analysis of the Interaction between the Snare Tlg1 and Vps51.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein transport
total genus 39
structure length 82
sequence length 87
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-10-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.90 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2c5jA00
3S4UA 1QSDA 2KWIB 2K48A 4FI5A 2IC9A 2X9XA 2KWHA 2XTLA 1IJ5A 3CKDA 1LVFA 3FXEB 3TKLB 2CA5A 2MBGA 4B6XA 3FXDB 2G0UA 3P7IA 2C5KT 2X9YA 3MXZA 3L3PA 1LRZA 4DNDA 2C5IT 2X9WA 3N5LA 4EYYR 1ZKEA 1IJ6A 4J2CA 2IC6A 4L0RA 1H7CA 3QK6A 3QUJA 2C5JA 1Z0PA 3CVRA 4CQIA
chains in the Genus database with same CATH superfamily
3EABA 3ZN0B 2A2FX 5JDHA 3AE9A 4ILAA 4IE4A 2M6BA 3O1IA 3C4WA 3Q5EA 1ZV4X 2WDRA 4U72A 4DIDB 3ONLC 2UUBT 3UFEA 2WY2A 4B3RT 1YKHB 4P0BA 3OYZA 3JC6D 4O4JE 5LHGB 1FEWA 3AA1B 4F8HA 4WZXA 1D0YA 2RA1A 2F4VT 5J2UE 3MK7C 2BG9A 3ZMUB 2XSAA 4ZHQE 1MMGA 3AE2A 4AI6A 2Q9QC 3QUJA 5HAXA 4A56A 2CHNA 5JTGA 1JNZA 5L3BB 1I6ZA 4C90A 2D0TA 1MMDA 4OYKA 3EDUA 3C4ZA 2XQ5A 4YTNA 3P4WA 3SFDA 1UUSA 3FB2A 3UUXB 2XQ9A 3NBXX 4CQIA 2YOEA 5F3JA 4UVAB 5L4EA 4DBRA 2MBGA 4DV3T 2V1DB 3SOLA 3EI0A 4N78D 5HXEA 3N5LA 2XHEB 2JQKA 4HFIA 3ZKRA 5F8PA 3AE4A 4H9NC 4GKKT 1HS7A 2NW7A 4TNVA 2OLTA 4IREA 3OJAA 4U31A 1SA0E 4IDZA 2D9DA 2YINA 3T8OA 3FZHB 2LSKA 2WM9A 4DV5T 4AKIA 3ZT6A 5J1GA 4JYAT 3IEEA 3HKDE 5LBQB 3PUVF 5L3DB 2LLYA 3DTOA 3KV5A 2NW9A 4YLHA 5DJQC 5ADXL 2E9XB 4X62T 3E08A 3CKDA 3HI2A 4GYSA 1T7SA 4AKGA 4EYUA 2KXPB 3RQUA 2CEAA 4AXPA 3RHWA 2SPCA 1KFYA 5HEUA 4Z91A 5J2TE 3RRWA 5FXZA 5HCMA 5H6RB 4CXXA 1US7B 4E7ZA 3O1JA 4I0UA 4WNKA 1LVKA 4X1YE 2IUBA 4UR9A 4YHHT 3ZMVB 4YTMA 3ZC0A 1YXRA 3ZT7A 2PBIA 3CQCB 1WYBA 3NRXA 3PUGA 4OK0A 5HEOA 2LJLA 4UIGA 4ZXLA 2LM2A 2ODUA 4HWFA 3PTRB 5HWXA 4MFRA 3JAFA 3VKHA 3CX8B 5EK4A 2Q9QB 3EAMA 2BKPA 1L0VA 3ABVA 2BVLA 4H9PC 2D5UA 3H3AA 5JVDE 4IL9A 1HCIA 4LFCT 2GK9A 3M65A 1KNRA 2JMKA 4C91A 3EUHA 3LJCA 1T98A 3Q2MA 2N1GA 3RGLA 4ZI7E 4IT4A 3BK9A 1WLXA 1FMWA 3I9YA 2MYSA 2QRXA 2MOZA 2KWHA 2YN6A 3FXEB 4JI7T 2X0LB 4PK4A 3L3PA 3EHZA 2J1DG 3QB5A 1WR6A 1OXZA 2FJEA 3V5UA 1MIWA 4YT0A 3ETVA 4LF9T 5GONE 1KNPA 2V6XA 5JR9A 2X9YA 4YJ3E 1U4QA 2H89A 4CI1B 2Y8DA 4JI5T 5FXVA 4J2CA 2X68A 4YHJA 3BQIA 4NUVA 4K0UA 4PK5A 4WBOA 4MHCA 1LKXA 5ABFB 4AISA 4JLEA 3WAKA 3P50A 5KDMC 4U7YA 5HCJA 4ZI3D 2WAUA 4LFAT 3K3OA 5ABEA 1R8IA 4IE0A 4X20E 1N36T 3CQGB 2CLYC 1MIYA 4HFDA 2X0YA 2LRKA 3UULA 4U2ZA 2FUPA 3TLTA 4AKHA 3DJBA 3N9LA 3E0ZA 1HNZT 1SE7A 4IDPA 1VOMA 5AQPB 2VVNA 2W66A 1IJ5A 4HFVA 4IL4A 1HTJF 1T8BA 2R6GF 3PU3A 4X66T 5TAOA 3BQLA 1OWAA 4DR3T 2HPJA 4IDOA 4HFEA 3T1YT 3TLWA 4ERRA 2W2UA 3ANWA 3FZKB 2VL0A 1BR2A 1YQ4A 4ZOLE 2VKOA 4JUYA 2EHOD 2XQ3A 3CX7B 4DNDA 3AA6B 4OHFA 4H63V 1VRBA 2DL1A 1J1JA 5E0OA 1IBMT 1HX1B 3NRYA 1GQEA 2UXCT 1FJGT 2ES0A 1XNRT 4JI4T 2I0MA 4BJMA 2E5VA 3LBXA 3U3IA 2WMNA 3FXDB 3RC8A 5LHHB 3O4XE 4DV7T 3LDQB 4Z90A 4HGAA 5CA0E 3A8YC 4HWHA 3CX6B 1O3XA 2V8SV 5AQJB 3PUXF 1UX5A 2XUEA 1LVFA 3CMLA 2XQAA 1I94T 4IGUA 1IBLT 2NOXA 4O2AE 2LOSA 4QH1A 3AEEA 4X5TA 4HKAA 1D1CA 4PK6A 5FXWA 5JH7E 5DQVA 2CCQA 4X1IE 4UF0B 5LJNA 1E7PA 1OEDA 5AQIB 5LB7B 1XNQT 2XASB 2QGSA 3ZYLA 2VVSA 4NIQA 2CXDA 3RPUA 4DR7T 4U7IA 1X79A 2VKDA 4F6RC 5LMNT 4TX5A 3SWHA 3ZPOA 3K3QC 4U2YA 2XAHB 2H7OA 5LYJE 3ZSTA 4OYJA 2IW5B 5JDFA 2X9HA 1G73A 2CXLA 2XAGB 3OPCA 3AVSA 1IBKT 2CLYB 2LEHA 1AJ3A 2IIUA 4YXDA 2XM1A 4O4IE 2WDVA 3TLSA 3WAJA 3LK2B 4ZZCA 2UXXB 1W0AA 4IE7A 1ZHCA 2I59A 4KMCA 3RYCE 4YJ2E 2PJQA 3N2OA 4ZEYA 2JPFA 2HHHT 4YSZA 2M67A 2WB5A 4CN1A 4LF4T 2AE9A 5FY1A 4HFHA 3MJXA 1XDPA 3FHNA 1HG5A 5L3CB 4P09A 2BS3A 4YY3T 1E2AA 1XMOT 3ZT5A 3GWHA 3UT5E 2VWAA 2VKJA 4V1Av 4AKLA 3AB3B 2V7JA 5H6QB 4EIWA 4KP3C 1W0BA 4I55E 4ISTA 4TWHA 3AAIA 1G8XA 3RLFF 1YW0A 2UXDT 3PUSA 4KBMB 1T72A 3N9MA 4KUMB 3HKBE 5FXXA 4ILUA 1EZ3A 3RF1A 1H7CA 3KV4A 3IHRA 2LHNA 2WP9A 4KI0F 2LSIA 2YK0A 4JI3T 2W0GA 2E9XD 4HFBA 4CI2B 3UTKA 2N9DA 2E5LT 2YDSA 1QLBA 5FYMA 4PNIA 3C50A 3S4UA 3ESLA 4UV9B 2V7IA 4QXHB 4B6XA 4XBFB 2Y6XA 5AQOB 4DR4T 2BS2A 3B5MA 2WU2A 4CI3B 3ZCIA 1QUUA 4KHZF 5HXRA 1QSDA 3NWIA 4PJMA 3OKQA 4XAXB 2BBHA 3UU3A 1JNRA 2W62A 5HXCA 3PU8A 3OVUA 1CHUA 2ZM8A 4TWFA 4EGWA 3RIAA 3BQKA 3GMIA 2KZ7B 3T1HT 5AQGB 2HN2A 1NENA 4YSXA 3JCFA 4L9IA 2Y48B 2Q9QD 5FMNA 3X1DA 4E7SA 3AEGA 3MACA 3PV0F 3VR9A 4HEAA 2LE8A 4QKNA 5KMGP 2V6YA 1Y64B 5DABA 2WZHA 5LXTE 5HXSA 2JIWA 2ODVA 2XJ7A 4Z8XA 4AIUA 3RIFA 4GOUA 2BS4A 3LK42 4PJNA 5HWYA 4B3TT 3D0TA 4ILBA 4PFPA 4G63A 1HF8A 2M6IA 2JMHA 1D0XA 2CXFA 3ZC1A 1BR0A 4GYRA 2CRBA 3P8CD 4EXTA 1HR0T 3O9XA 3C4XA 3UQ4A 4DR5T 3PUZF 3K1SA 3FZMB 3PURA 5AQMB 1MNEA 3AXJB 5AQSB 2DI4A 4M1PA 3TKLB 4LF6T 5LOVE 5LGTB 2DHRA 3FBZA 2DWKA 2A72A 5EK2A 1IJ6A 3KDSE 3QK6A 3LSVA 3ZCJA 3UU8A 3RI5A 2YKSA 1NAFA 1UX4A 2ACXA 4X64T 3KV9A 4DUYT 3ZJ2A 3GN5A 3NKZA 4O4LE 4IE6A 1OEDC 3OYXA 4QH5A 3VRBA 5JR9B 1YD8G 3B13A 3PJAJ 5CB4E 1D1AA 5DQWA 1V9DA 4TN7B 3KVAA 4X1KE 2OA5A 4EEDA 4QX7B 2XTLA 1WFDA 5FVLA 3C98B 4PJLA 3AE1A 3FZFB 2LKGA 3V5SA 4PAGA 4ISSA 4HN9A 1FMVA 3R84B 2X0HA 5AQRB 3ZSSA 2RPAA 3R6NA 4TUYE 3RH3A 2CM0A 2B76A 1MIVA 3RRCA 3U78A 2NW8A 2K48A 2YU2A 2WWUA 4B3MT 5FKYA 5JQGE 2JQ9A 4K0KT 4L5GA 1IAPA 4UELA 2MPKA 3Q5WA 4JV5T 2XQ7A 3OBVE 2E8IA 5LA6E 2UUAT 2VB6A 1XDOA 4LMJA 2LSYA 1N32T 4DBQA 5LCYA 3K3NA 3HA4A 4HWCA 3TLVA 4EOZB 2XAJB 3UQ7A 5JRCA 3LG7A 1MMAA 2NWBA 2UU9T 5L4HA 3E22E 3ANWB 2X66A 2BZBA 3A5XA 3N2KE 4U3CA 3KVBA 2XQYA 4PFOA 1D0ZA 5EK3A 2UXBT 2D2SA 3N9NA 4EZHA 2UUCT 2BG9C 3N2GE 1W09A 3ZLIA 3MZKB 4ZI2C 4QX8B 2NR4A 3HKEE 4MLKA 3ZJ1A 3LBXB 5AQHB 2I6HA 1WRDA 4IE5A 3OTOT 3UU5A 5LJMA 2V5DA 4NUUA 3K8PC 2WMOA 3ZEFB 4FI5A 2JJ9A 1J5ET 4QXCB 1S94A 3C51A 3NVOA 2MTQA 4I50E 2EHOA 2W63A 1DU2A 4AQFA 3ONXA 2FJAA 4GKJT 1VCSA 3CVRA 5J0ZA 2CE7A 2RP4A 2YDQA 1UGOA 3AA0B 4IIJE 2XPKA 1OEDB 2A3DA 3TLUA 5AQVB 4HFCA 2XZEA 2W00A 2WZIA 2VL8A 2XAQB 3C64A 2NTXA 4A5XA 2X9XA 2MAWA 1WCRA 3UU4A 4H63H 4JEHB 2FJDA 2XM2A 1LRZA 4CZZB 1M62A 4YFSA 2X9WA 2K24A 1Z8UA 4BJNA 2K5BB 2LM9A 2YEVC 1HNWT 5CA1E 4Q25A 4ADZA 5IWAT 2W61A 5LGUB 1OEDE 1ZEEA 2ZM6T 3PUWF 4LF8T 4XZCA 5AQFB 3HR0A 1Z0PA 3IBPA 2CBIA 2JQQA 4AKRB 4KX6A 4TV8E 3KV6A 1X9BA 2ACZA 1N34T 3HKCE 3HL6A 4H9RC 4H9QC 3CQXC 3SS1A 4MALA 3LK3B 2C0SA 4HWIB 5M4YA 2V7KA 5FY0A 3B57A 3RIUA 4DV0T 4JI1T 3CWZB 4UVCB 4TV9E 4IHJE 2AXDS 1HX8A 3AAEB 4YTPA 3AE6A 3I9WA 4JI2T 4ASKA 4IDQA 5JDMA 2BG9B 5FVKA 3I0QA 4H9SE 5IUXA 1KF6A 2N2NA 2KLQA 2WCAA 2CBJA 1NEKA 3QB5K 3UFGA 4JEUB 5JDQA 3ZMSB 2JQHA 5AQTB 1KEYA 3CIRA 4OX9T 5LHIB 3ONJA 5AQNB 2CWOA 4QWNB 1D1BA 2A9UA 4X65T 3AEBA 4ZS3A 3MXZA 3W15B 3ZMTB 2LHRA 3KBTA 3P4PA 3ETUA 4TZ4C 2IMLA 3ZMZB 1XZYA 2H7VC 2K3WA 1ZP0A 4HTEA 2ZLYA 3QNUA 5FNVE 4CXYA 2WDQA 4DMVA 2BG9E 3AA7B 5ABHA 2D0UA 4WBNE 5HEHA 2PTFA 4DV6T 2XY8B 5LG3A 3M3ZB 4WW0A 5CGMA 2X51A 5JR9C 4L0RA 3CPZA 4LMKA 3QC9A 4FJOA 2CPTA 2KNDA 4UEMA 3Q9DA 5IYZE 4QHOA 2ZM0A 5FP3A 4EB6E 1WYCA 3FZLB 4DMWA 4PW8A 4DV2T 1KK7A 4JI8T 5C2TA 4EEBA 3AE5A 2WSSV 4AQGA 3ZYMA 2H3RA 3UUMA 5C8YE 1U5PA 2BDEA 2QYWA 3L8RA 3NZPA 2DCFA 3AE8A 3RYFE 5F5WA 5C3JA 4I43B 2IHR1 4KHPT 2E9XA 3N9QA 2Z6EA 1IZNB 4OFZA 2C5JA 2B1EA 5HEGA 2LOPA 2L9QA 3O1HA 5L47A 4O2BE 2WU5A 4HWDA 2VURA 3J9X1 3NZQA 3F31A 3RYHE 5JDLA 5CJ5A 5ETWA 3RYIE 2IC9A 4ZI3C 2LKHA 4BA9A 2V6YB 3CK6A 4COFA 3RKGA 5EZYE 4IDNA 2VK9A 2DNXA 4G2AA 5KX5E 3AAAB 2WQYA 5BR8T 1MMNA 2CWYA 2FJBA 5LGNB 4JBWF 3GA8A 3H37A 5LG4A 2XQ8A 3I0OA 1J5WA 2NP9A 5AQUB 4NXMT 2BKOA 2BBJA 2YDRA 2ZM2A 2J62A 2KSRA 1SUMB 2E2AA 2Q9QA 3WI3A 5LP6E 3JAEA 1WR0A 2IC6A 3F57A 1ZOYA 3QOFA 3PJAA 5FL0A 2V26A 2XQ4A 5AFUL 1S35A 4CXWA 1UURA 2VQET 3DP7A 2CMRA 2LT3A 4ZS2A 4GK5E 3AXJA 2J4GA 2FBWA 2EHOC 1BR4A 4B3ST 4DUZT 4CN6A 5L3GB 4AQFC 3AEDA 3AVRA 2V7LA 1M7KA 3MA9A 3FBLA 4HE8A 5IHYA 2V7MA 2H88A 3GN5B 2VASA 2LRLA 2CHOA 5KXJA 1HFAA 4EZ4A 4LMLA 2KMFA 4A97A 4LFBT 1W9RA 2PFVA 1XMQT 3KFWX 3ZYKA 3Q5DA 2UXNB 5ABFA 3EVYA 4DR1T 4ZZBA 4O4HE 4WYVA 1KNZA 2CA5A 4UVBB 3L09A 5AQKB 2C5KT 5JREA 4LF5T 3IF8B 4I4TE 4LF7T 3RC3A 4JI0T 4P0AA 2X67A 5L2LA 4TWDA 3AEFA 3AE7A 4O8SA 4DR6T 1YQ3A 4ILCA 2W4XA 3KINB 2V5CA 5ABGA 4DV4T 4UXNB 3IA3A 4EAHA 2ZMAA 3PDYA 3PUQA 5LNKA 3P4QA 2XAFB 5L3EB 5LBMA 5JRCB 4MBQA 2QA7A 3I1AA 4U33A 1B7TA 3RIUC 5A1LA 3A7MA 5HEJA 1N33T 2NTYA 4UV8B 1XWMA 2J47A 3Q5XA 4DO0A 1VCTA 1HNXT 4QH4A 2KT9A 4U74A 1E1HB 2HPLA 1YKEB 2VQFT 2WWVA 4EYYR 3JADA 2BVMA 2LSJA 5LMUT 2KINB 4GIWA 2VKHA 5BMVE 2K9AA 3VR8A 2IDOB 5JDGA 3L39A 5HYAA 4QXBB 3AEAA 3RQWA 3RX6A 5CFBA 1MNDA 4TNWA 3UUNA 1CUNA 2WS3A 2JRKA 2BKNA 5FY7A 4AQYT 3JC6C 1BR1A 2PG8A 3VU7H 2EHOB 1UK5A 4H9OC 5L3FB 1Y01A 3KBUA 2DWGA 3RKOA 5AQQB 2W67A 3ZN1B 3UU6A 3G06A 2P9BA 1ZKEA 2IAKA 2LSGA 3VHLA 2L3LA 2L8KA 3PUYF 4UF0A 4ANJA 3VRAA 3AECA 4PJJA 1FIOA 3P4RA 2OV9A 4DVDA 3H3MA 1HG2A 4DV1T 1SHZC 3AE3A 3PUAA 2KWIB 2QVAA 3SFEA 4P1NA 3MKDA 2G0UA 2XQ6A 3P7IA 4A98A 3F2EA 2HH7A 4DR2T 2DLRA 1UCUA 4YSYA 4NXNT 3N9PA 3VKGA 2E9XC 2XSBA 2WBLA 5AQLB 3PE0A 3LFMA 5FL1A 4EV6A 4NPPA 5JDNA 3J7Yq 4BAYB 4GK0E 3N9OA 3EDVA 2C5IT 2HN1A 2YU1A 3UUBA 5HXHA 4CN4A 1NWMX 4ZI2D 3SRZA 3P4SA 4JI6T
chains in the Genus database with same CATH topology
4BJMA 1NAFA 1UX4A 3ZN0B 2ACXA 3LBXA 3U3IA 2A2FX 3KV9A 5JDHA 2WMNA 3FXDB 3ZJ2A 3GN5A 3RC8A 3NZPA 5LHHB 4O4LE 2DCFA 4IE6A 4IE4A 3O4XE 3OYXA 3RYFE 4I43B 3O1IA 5JR9B 1YD8G 3B13A 3C4WA 2E9XA 3N9QA 2Z6EA 4HGAA 5CB4E 5CA0E 1D1AA 1ZV4X 4U72A 5DQWA 3CX6B 1O3XA 1IZNB 1V9DA 4OFZA 4TN7B 2C5JA 3KVAA 4X1KE 2B1EA 2OA5A 3UFEA 1UX5A 2LOPA 4QX7B 1YKHB 2XUEA 2XTLA 2L9QA 4P0BA 1LVFA 3OYZA 3JC6D 4O4JE 3C98B 3O1HA 4PJLA 3CMLA 5LHGB 1FEWA 4IGUA 3AA1B 4O2BE 3V5SA 2NOXA 4O2AE 1D0YA 2LOSA 2RA1A 4PAGA 4ISSA 5J2UE 3MK7C 4HN9A 1FMVA 3R84B 3J9X1 3NZQA 3F31A 4HKAA 3ZMUB 1D1CA 1MMGA 4ZHQE 3RYHE 3R6NA 4PK6A 5FXWA 5JH7E 2Q9QC 3QUJA 5DQVA 5HAXA 4AI6A 5JDLA 4TUYE 3RH3A 2CM0A 5ETWA 4A56A 3RYIE 2CCQA 1MIVA 3RRCA 3U78A 2NW8A 4X1IE 2K48A 4UF0B 5LJNA 2IC9A 2YU2A 4ZI3C 4BA9A 5L3BB 4C90A 2D0TA 1MMDA 2WWUA 4OYKA 3EDUA 3C4ZA 5EZYE 5JQGE 2XASB 4L5GA 2VK9A 2DNXA 4G2AA 5KX5E 3AAAB 2QGSA 3FB2A 1IAPA 4UELA 3ZYLA 3Q5WA 1MMNA 3UUXB 2CWYA 5LGNB 3GA8A 3H37A 3NBXX 5LG4A 2CXDA 3RPUA 3OBVE 2E8IA 4CQIA 3I0OA 5LA6E 5F3JA 2NP9A 4UVAB 4DBRA 1X79A 2MBGA 2VB6A 2V1DB 2VKDA 3SOLA 4F6RC 4TX5A 3SWHA 3ZPOA 3K3QC 2ZM2A 4N78D 2XAHB 2LSYA 2H7OA 5HXEA 3N5LA 2Q9QA 2XHEB 3WI3A 5LP6E 5LYJE 4DBQA 4OYJA 5F8PA 2IC6A 3F57A 5LCYA 2IW5B 3K3NA 3HA4A 5JDFA 2X9HA 4EOZB 4H9NC 2XAJB 2V26A 1G73A 5AFUL 5JRCA 3LG7A 1HS7A 1MMAA 2CXLA 2NW7A 2XAGB 3AVSA 2NWBA 1S35A 4CXWA 2CLYB 2LEHA 3E22E 3ANWB 1AJ3A 3DP7A 2X66A 3OJAA 2CMRA 2BZBA 3A5XA 3N2KE 4O4IE 2LT3A 4ZS2A 3KVBA 4GK5E 3WAJA 2XQYA 4PFOA 1D0ZA 1SA0E 5EK3A 4IDZA 3LK2B 2YINA 2EHOC 1BR4A 2D2SA 3N9NA 3T8OA 4EZHA 2UXXB 4IE7A 1ZHCA 2I59A 2LSKA 2WM9A 4KMCA 5L3GB 4AQFC 3RYCE 3N2GE 3AVRA 4YJ2E 2PJQA 3ZLIA 3N2OA 4AKIA 2V7LA 3MZKB 2JPFA 4ZI2C 5J1GA 3MA9A 4QX8B 3FBLA 4HE8A 3HKEE 2M67A 4MLKA 5IHYA 2V7MA 3LBXB 3IEEA 3ZJ1A 3HKDE 1WRDA 3GN5B 2VASA 5LBQB 4IE5A 5FY1A 5LJMA 4NUUA 5L3DB 3DTOA 3KV5A 2NW9A 1HFAA 3MJXA 4YLHA 4EZ4A 5DJQC 5ADXL 2E9XB 3FHNA 1HG5A 2KMFA 3K8PC 5L3CB 2WMOA 4P09A 3ZEFB 4FI5A 2JJ9A 3E08A 3CKDA 3HI2A 4GYSA 4QXCB 1S94A 4AKGA 4EYUA 3C51A 2KXPB 2CEAA 4AXPA 2PFVA 2MTQA 4I50E 2EHOA 2SPCA 2W63A 3KFWX 3ZYKA 3GWHA 3UT5E 2UXNB 4AQFA 5J2TE 3EVYA 2VWAA 3ONXA 2VKJA 3RRWA 3CVRA 4V1Av 5FXZA 2CE7A 5H6RB 4CXXA 4O4HE 4AKLA 3AB3B 1KNZA 2RP4A 2CA5A 4UVBB 3L09A 2V7JA 2C5KT 3AA0B 5JREA 4IIJE 1US7B 4E7ZA 3O1JA 3IF8B 4I4TE 4WNKA 2A3DA 1LVKA 5H6QB 4X1YE 3RC3A 4EIWA 4KP3C 3ZMVB 4P0AA 2W00A 2X67A 4I55E 4ISTA 5L2LA 3ZC0A 2VL8A 2XAQB 3C64A 2PBIA 3CQCB 2NTXA 4O8SA 1WYBA 3NRXA 3AAIA 2X9XA 1G8XA 3PUGA 4OK0A 1YW0A 4H63H 3PUSA 4JEHB 2LJLA 4KBMB 4UIGA 3KINB 3N9MA 1LRZA 4KUMB 4CZZB 3HKBE 4YFSA 5FXXA 4ILUA 1EZ3A 2ODUA 2X9WA 2K24A 3PTRB 4BJNA 5HWXA 2K5BB 4MFRA 2LM9A 3VKHA 2YEVC 4UXNB 3CX8B 5EK4A 1H7CA 4EAHA 2Q9QB 3KV4A 2ZMAA 3PDYA 3PUQA 3IHRA 2LHNA 2BVLA 4H9PC 5CA1E 2D5UA 5LNKA 3H3AA 2XAFB 2LSIA 5JVDE 4ADZA 5L3EB 5LBMA 5JRCB 2YK0A 4MBQA 2QA7A 1HCIA 3I1AA 1B7TA 2W0GA 2E9XD 2GK9A 2W61A 3M65A 5LGUB 4CI2B 5A1LA 1ZEEA 2JMKA 3UTKA 2N9DA 4C91A 3EUHA 4XZCA 3LJCA 1T98A 3Q2MA 2N1GA 2NTYA 4ZI7E 4UV8B 5FYMA 3HR0A 4PNIA 3BK9A 1WLXA 1Z0PA 1FMWA 3C50A 3IBPA 3S4UA 3I9YA 2MYSA 3ESLA 2MOZA 2KWHA 3Q5XA 4UV9B 2JQQA 3FXEB 4DO0A 2V7IA 2X0LB 4QXHB 4PK4A 4AKRB 4TV8E 4B6XA 4XBFB 3KV6A 2Y6XA 3L3PA 2KT9A 4U74A 3HKCE 1E1HB 3HL6A 4H9RC 4H9QC 3CQXC 2HPLA 2J1DG 1YKEB 3SS1A 4EYYR 2BVMA 4MALA 1WR6A 1OXZA 3LK3B 2LSJA 3V5UA 2C0SA 2KINB 4CI3B 5M4YA 4GIWA 3ZCIA 1MIWA 2VKHA 5BMVE 2V7KA 5FY0A 2K9AA 1QUUA 3B57A 5HXRA 5JDGA 1QSDA 4PJMA 3ETVA 5HYAA 3OKQA 5GONE 4XAXB 4QXBB 2W62A 5HXCA 3PU8A 5JR9A 2X9YA 4YJ3E 1U4QA 3RX6A 3CWZB 4UVCB 2ZM8A 4TV9E 4CI1B 4IHJE 1MNDA 2Y8DA 3UUNA 3BQKA 1CUNA 1HX8A 3AAEB 3GMIA 2KZ7B 2JRKA 5FXVA 5FY7A 4J2CA 2X68A 4YHJA 3BQIA 1BR1A 3JC6C 3I9WA 2PG8A 4NUVA 3VU7H 4K0UA 4PK5A 4WBOA 2EHOB 4ASKA 4H9OC 5L3FB 5JDMA 4L9IA 4MHCA 1LKXA 3KBUA 3I0QA 2DWGA 4H9SE 2Y48B 3RKOA 2N2NA 2KLQA 4JLEA 3WAKA 2Q9QD 5FMNA 4E7SA 3ZN1B 5KDMC 3MACA 2P9BA 4JEUB 4ZI3D 2WAUA 1ZKEA 5JDQA 2IAKA 2LSGA 3ZMSB 4HEAA 3VHLA 2L3LA 2LE8A 5LHIB 2L8KA 4QKNA 4UF0A 3K3OA 5KMGP 2CWOA 4ANJA 4QWNB 1Y64B 1D1BA 5DABA 5LXTE 5HXSA 4IE0A 2ODVA 4Z8XA 4X20E 4GOUA 4ZS3A 3CQGB 2CLYC 3LK42 4PJJA 4PJNA 1MIYA 1FIOA 3MXZA 5HWYA 3W15B 3D0TA 3ZMTB 2LHRA 3KBTA 3ETUA 4TZ4C 3UULA 3ZMZB 4AKHA 4PFPA 3DJBA 4DVDA 2H7VC 4G63A 1HF8A 4HTEA 2ZLYA 2JMHA 3N9LA 1D0XA 1HG2A 2CXFA 3E0ZA 5FNVE 4CXYA 1VOMA 3ZC1A 1SHZC 3PUAA 4DMVA 2KWIB 3AA7B 4GYRA 1BR0A 2D0UA 4WBNE 1IJ5A 4HFVA 3MKDA 2G0UA 3P7IA 3P8CD 4EXTA 3F2EA 1HTJF 2HH7A 3PU3A 3O9XA 3C4XA 4WW0A 2DLRA 2X51A 5JR9C 5TAOA 1UCUA 3BQLA 3CPZA 3N9PA 4L0RA 1OWAA 2HPJA 3QC9A 4FJOA 3VKGA 3PURA 2E9XC 4ERRA 2KNDA 1MNEA 2WBLA 3PE0A 3LFMA 4UEMA 3Q9DA 3ANWA 5IYZE 2DI4A 4M1PA 4QHOA 5JDNA 1BR2A 2ZM0A 5FP3A 4ZOLE 3TKLB 4BAYB 4EB6E 4GK0E 1WYCA 2VKOA 3J7Yq 5LOVE 4JUYA 5LGTB 2DHRA 2EHOD 4DMWA 4PW8A 3N9OA 3FBZA 3CX7B 1KK7A 3EDVA 4DNDA 2C5IT 3AA6B 4H63V 1VRBA 4OHFA 2YU1A 2DWKA 2A72A 5EK2A 2WSSV 5HXHA 5E0OA 4AQGA 1IJ6A 1NWMX 3NRYA 4ZI2D 3SRZA 3KDSE 3ZYMA 3QK6A 2H3RA 3UUMA 5C8YE 1U5PA 2BDEA 2ES0A 3ZCJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S4U A;  1QSD A;  2KWI B;  2K48 A;  4FI5 A;  2IC9 A;  2X9X A;  2KWH A;  2XTL A;  1IJ5 A;  3CKD A;  1LVF A;  3FXE B;  3TKL B;  2CA5 A;  2MBG A;  4B6X A;  3FXD B;  2G0U A;  3P7I A;  2C5K T;  2X9Y A;  3MXZ A;  3L3P A;  1LRZ A;  4DND A;  2C5I T;  2X9W A;  3N5L A;  4EYY R;  1ZKE A;  1IJ6 A;  4J2C A;  2IC6 A;  4L0R A;  1H7C A;  3QK6 A;  3QUJ A;  2C5J A;  1Z0P A;  3CVR A;  4CQI A; 
#chains in the Genus database with same CATH topology
 3EAB A;  3ZN0 B;  2A2F X;  5JDH A;  3AE9 A;  4ILA A;  4IE4 A;  2M6B A;  3O1I A;  3C4W A;  3Q5E A;  1ZV4 X;  2WDR A;  4U72 A;  4DID B;  3ONL C;  2UUB T;  3UFE A;  2WY2 A;  4B3R T;  1YKH B;  4P0B A;  3OYZ A;  3JC6 D;  4O4J E;  5LHG B;  1FEW A;  3AA1 B;  4F8H A;  4WZX A;  1D0Y A;  2RA1 A;  2F4V T;  5J2U E;  3MK7 C;  2BG9 A;  3ZMU B;  2XSA A;  4ZHQ E;  1MMG A;  3AE2 A;  4AI6 A;  2Q9Q C;  3QUJ A;  5HAX A;  4A56 A;  2CHN A;  5JTG A;  1JNZ A;  5L3B B;  1I6Z A;  4C90 A;  2D0T A;  1MMD A;  4OYK A;  3EDU A;  3C4Z A;  2XQ5 A;  4YTN A;  3P4W A;  3SFD A;  1UUS A;  3FB2 A;  3UUX B;  2XQ9 A;  3NBX X;  4CQI A;  2YOE A;  5F3J A;  4UVA B;  5L4E A;  4DBR A;  2MBG A;  4DV3 T;  2V1D B;  3SOL A;  3EI0 A;  4N78 D;  5HXE A;  3N5L A;  2XHE B;  2JQK A;  4HFI A;  3ZKR A;  5F8P A;  3AE4 A;  4H9N C;  4GKK T;  1HS7 A;  2NW7 A;  4TNV A;  2OLT A;  4IRE A;  3OJA A;  4U31 A;  1SA0 E;  4IDZ A;  2D9D A;  2YIN A;  3T8O A;  3FZH B;  2LSK A;  2WM9 A;  4DV5 T;  4AKI A;  3ZT6 A;  5J1G A;  4JYA T;  3IEE A;  3HKD E;  5LBQ B;  3PUV F;  5L3D B;  2LLY A;  3DTO A;  3KV5 A;  2NW9 A;  4YLH A;  5DJQ C;  5ADX L;  2E9X B;  4X62 T;  3E08 A;  3CKD A;  3HI2 A;  4GYS A;  1T7S A;  4AKG A;  4EYU A;  2KXP B;  3RQU A;  2CEA A;  4AXP A;  3RHW A;  2SPC A;  1KFY A;  5HEU A;  4Z91 A;  5J2T E;  3RRW A;  5FXZ A;  5HCM A;  5H6R B;  4CXX A;  1US7 B;  4E7Z A;  3O1J A;  4I0U A;  4WNK A;  1LVK A;  4X1Y E;  2IUB A;  4UR9 A;  4YHH T;  3ZMV B;  4YTM A;  3ZC0 A;  1YXR A;  3ZT7 A;  2PBI A;  3CQC B;  1WYB A;  3NRX A;  3PUG A;  4OK0 A;  5HEO A;  2LJL A;  4UIG A;  4ZXL A;  2LM2 A;  2ODU A;  4HWF A;  3PTR B;  5HWX A;  4MFR A;  3JAF A;  3VKH A;  3CX8 B;  5EK4 A;  2Q9Q B;  3EAM A;  2BKP A;  1L0V A;  3ABV A;  2BVL A;  4H9P C;  2D5U A;  3H3A A;  5JVD E;  4IL9 A;  1HCI A;  4LFC T;  2GK9 A;  3M65 A;  1KNR A;  2JMK A;  4C91 A;  3EUH A;  3LJC A;  1T98 A;  3Q2M A;  2N1G A;  3RGL A;  4ZI7 E;  4IT4 A;  3BK9 A;  1WLX A;  1FMW A;  3I9Y A;  2MYS A;  2QRX A;  2MOZ A;  2KWH A;  2YN6 A;  3FXE B;  4JI7 T;  2X0L B;  4PK4 A;  3L3P A;  3EHZ A;  2J1D G;  3QB5 A;  1WR6 A;  1OXZ A;  2FJE A;  3V5U A;  1MIW A;  4YT0 A;  3ETV A;  4LF9 T;  5GON E;  1KNP A;  2V6X A;  5JR9 A;  2X9Y A;  4YJ3 E;  1U4Q A;  2H89 A;  4CI1 B;  2Y8D A;  4JI5 T;  5FXV A;  4J2C A;  2X68 A;  4YHJ A;  3BQI A;  4NUV A;  4K0U A;  4PK5 A;  4WBO A;  4MHC A;  1LKX A;  5ABF B;  4AIS A;  4JLE A;  3WAK A;  3P50 A;  5KDM C;  4U7Y A;  5HCJ A;  4ZI3 D;  2WAU A;  4LFA T;  3K3O A;  5ABE A;  1R8I A;  4IE0 A;  4X20 E;  1N36 T;  3CQG B;  2CLY C;  1MIY A;  4HFD A;  2X0Y A;  2LRK A;  3UUL A;  4U2Z A;  2FUP A;  3TLT A;  4AKH A;  3DJB A;  3N9L A;  3E0Z A;  1HNZ T;  1SE7 A;  4IDP A;  1VOM A;  5AQP B;  2VVN A;  2W66 A;  1IJ5 A;  4HFV A;  4IL4 A;  1HTJ F;  1T8B A;  2R6G F;  3PU3 A;  4X66 T;  5TAO A;  3BQL A;  1OWA A;  4DR3 T;  2HPJ A;  4IDO A;  4HFE A;  3T1Y T;  3TLW A;  4ERR A;  2W2U A;  3ANW A;  3FZK B;  2VL0 A;  1BR2 A;  1YQ4 A;  4ZOL E;  2VKO A;  4JUY A;  2EHO D;  2XQ3 A;  3CX7 B;  4DND A;  3AA6 B;  4OHF A;  4H63 V;  1VRB A;  2DL1 A;  1J1J A;  5E0O A;  1IBM T;  1HX1 B;  3NRY A;  1GQE A;  2UXC T;  1FJG T;  2ES0 A;  1XNR T;  4JI4 T;  2I0M A;  4BJM A;  2E5V A;  3LBX A;  3U3I A;  2WMN A;  3FXD B;  3RC8 A;  5LHH B;  3O4X E;  4DV7 T;  3LDQ B;  4Z90 A;  4HGA A;  5CA0 E;  3A8Y C;  4HWH A;  3CX6 B;  1O3X A;  2V8S V;  5AQJ B;  3PUX F;  1UX5 A;  2XUE A;  1LVF A;  3CML A;  2XQA A;  1I94 T;  4IGU A;  1IBL T;  2NOX A;  4O2A E;  2LOS A;  4QH1 A;  3AEE A;  4X5T A;  4HKA A;  1D1C A;  4PK6 A;  5FXW A;  5JH7 E;  5DQV A;  2CCQ A;  4X1I E;  4UF0 B;  5LJN A;  1E7P A;  1OED A;  5AQI B;  5LB7 B;  1XNQ T;  2XAS B;  2QGS A;  3ZYL A;  2VVS A;  4NIQ A;  2CXD A;  3RPU A;  4DR7 T;  4U7I A;  1X79 A;  2VKD A;  4F6R C;  5LMN T;  4TX5 A;  3SWH A;  3ZPO A;  3K3Q C;  4U2Y A;  2XAH B;  2H7O A;  5LYJ E;  3ZST A;  4OYJ A;  2IW5 B;  5JDF A;  2X9H A;  1G73 A;  2CXL A;  2XAG B;  3OPC A;  3AVS A;  1IBK T;  2CLY B;  2LEH A;  1AJ3 A;  2IIU A;  4YXD A;  2XM1 A;  4O4I E;  2WDV A;  3TLS A;  3WAJ A;  3LK2 B;  4ZZC A;  2UXX B;  1W0A A;  4IE7 A;  1ZHC A;  2I59 A;  4KMC A;  3RYC E;  4YJ2 E;  2PJQ A;  3N2O A;  4ZEY A;  2JPF A;  2HHH T;  4YSZ A;  2M67 A;  2WB5 A;  4CN1 A;  4LF4 T;  2AE9 A;  5FY1 A;  4HFH A;  3MJX A;  1XDP A;  3FHN A;  1HG5 A;  5L3C B;  4P09 A;  2BS3 A;  4YY3 T;  1E2A A;  1XMO T;  3ZT5 A;  3GWH A;  3UT5 E;  2VWA A;  2VKJ A;  4V1A v;  4AKL A;  3AB3 B;  2V7J A;  5H6Q B;  4EIW A;  4KP3 C;  1W0B A;  4I55 E;  4IST A;  4TWH A;  3AAI A;  1G8X A;  3RLF F;  1YW0 A;  2UXD T;  3PUS A;  4KBM B;  1T72 A;  3N9M A;  4KUM B;  3HKB E;  5FXX A;  4ILU A;  1EZ3 A;  3RF1 A;  1H7C A;  3KV4 A;  3IHR A;  2LHN A;  2WP9 A;  4KI0 F;  2LSI A;  2YK0 A;  4JI3 T;  2W0G A;  2E9X D;  4HFB A;  4CI2 B;  3UTK A;  2N9D A;  2E5L T;  2YDS A;  1QLB A;  5FYM A;  4PNI A;  3C50 A;  3S4U A;  3ESL A;  4UV9 B;  2V7I A;  4QXH B;  4B6X A;  4XBF B;  2Y6X A;  5AQO B;  4DR4 T;  2BS2 A;  3B5M A;  2WU2 A;  4CI3 B;  3ZCI A;  1QUU A;  4KHZ F;  5HXR A;  1QSD A;  3NWI A;  4PJM A;  3OKQ A;  4XAX B;  2BBH A;  3UU3 A;  1JNR A;  2W62 A;  5HXC A;  3PU8 A;  3OVU A;  1CHU A;  2ZM8 A;  4TWF A;  4EGW A;  3RIA A;  3BQK A;  3GMI A;  2KZ7 B;  3T1H T;  5AQG B;  2HN2 A;  1NEN A;  4YSX A;  3JCF A;  4L9I A;  2Y48 B;  2Q9Q D;  5FMN A;  3X1D A;  4E7S A;  3AEG A;  3MAC A;  3PV0 F;  3VR9 A;  4HEA A;  2LE8 A;  4QKN A;  5KMG P;  2V6Y A;  1Y64 B;  5DAB A;  2WZH A;  5LXT E;  5HXS A;  2JIW A;  2ODV A;  2XJ7 A;  4Z8X A;  4AIU A;  3RIF A;  4GOU A;  2BS4 A;  3LK4 2;  4PJN A;  5HWY A;  4B3T T;  3D0T A;  4ILB A;  4PFP A;  4G63 A;  1HF8 A;  2M6I A;  2JMH A;  1D0X A;  2CXF A;  3ZC1 A;  1BR0 A;  4GYR A;  2CRB A;  3P8C D;  4EXT A;  1HR0 T;  3O9X A;  3C4X A;  3UQ4 A;  4DR5 T;  3PUZ F;  3K1S A;  3FZM B;  3PUR A;  5AQM B;  1MNE A;  3AXJ B;  5AQS B;  2DI4 A;  4M1P A;  3TKL B;  4LF6 T;  5LOV E;  5LGT B;  2DHR A;  3FBZ A;  2DWK A;  2A72 A;  5EK2 A;  1IJ6 A;  3KDS E;  3QK6 A;  3LSV A;  3ZCJ A;  3UU8 A;  3RI5 A;  2YKS A;  1NAF A;  1UX4 A;  2ACX A;  4X64 T;  3KV9 A;  4DUY T;  3ZJ2 A;  3GN5 A;  3NKZ A;  4O4L E;  4IE6 A;  1OED C;  3OYX A;  4QH5 A;  3VRB A;  5JR9 B;  1YD8 G;  3B13 A;  3PJA J;  5CB4 E;  1D1A A;  5DQW A;  1V9D A;  4TN7 B;  3KVA A;  4X1K E;  2OA5 A;  4EED A;  4QX7 B;  2XTL A;  1WFD A;  5FVL A;  3C98 B;  4PJL A;  3AE1 A;  3FZF B;  2LKG A;  3V5S A;  4PAG A;  4ISS A;  4HN9 A;  1FMV A;  3R84 B;  2X0H A;  5AQR B;  3ZSS A;  2RPA A;  3R6N A;  4TUY E;  3RH3 A;  2CM0 A;  2B76 A;  1MIV A;  3RRC A;  3U78 A;  2NW8 A;  2K48 A;  2YU2 A;  2WWU A;  4B3M T;  5FKY A;  5JQG E;  2JQ9 A;  4K0K T;  4L5G A;  1IAP A;  4UEL A;  2MPK A;  3Q5W A;  4JV5 T;  2XQ7 A;  3OBV E;  2E8I A;  5LA6 E;  2UUA T;  2VB6 A;  1XDO A;  4LMJ A;  2LSY A;  1N32 T;  4DBQ A;  5LCY A;  3K3N A;  3HA4 A;  4HWC A;  3TLV A;  4EOZ B;  2XAJ B;  3UQ7 A;  5JRC A;  3LG7 A;  1MMA A;  2NWB A;  2UU9 T;  5L4H A;  3E22 E;  3ANW B;  2X66 A;  2BZB A;  3A5X A;  3N2K E;  4U3C A;  3KVB A;  2XQY A;  4PFO A;  1D0Z A;  5EK3 A;  2UXB T;  2D2S A;  3N9N A;  4EZH A;  2UUC T;  2BG9 C;  3N2G E;  1W09 A;  3ZLI A;  3MZK B;  4ZI2 C;  4QX8 B;  2NR4 A;  3HKE E;  4MLK A;  3ZJ1 A;  3LBX B;  5AQH B;  2I6H A;  1WRD A;  4IE5 A;  3OTO T;  3UU5 A;  5LJM A;  2V5D A;  4NUU A;  3K8P C;  2WMO A;  3ZEF B;  4FI5 A;  2JJ9 A;  1J5E T;  4QXC B;  1S94 A;  3C51 A;  3NVO A;  2MTQ A;  4I50 E;  2EHO A;  2W63 A;  1DU2 A;  4AQF A;  3ONX A;  2FJA A;  4GKJ T;  1VCS A;  3CVR A;  5J0Z A;  2CE7 A;  2RP4 A;  2YDQ A;  1UGO A;  3AA0 B;  4IIJ E;  2XPK A;  1OED B;  2A3D A;  3TLU A;  5AQV B;  4HFC A;  2XZE A;  2W00 A;  2WZI A;  2VL8 A;  2XAQ B;  3C64 A;  2NTX A;  4A5X A;  2X9X A;  2MAW A;  1WCR A;  3UU4 A;  4H63 H;  4JEH B;  2FJD A;  2XM2 A;  1LRZ A;  4CZZ B;  1M62 A;  4YFS A;  2X9W A;  2K24 A;  1Z8U A;  4BJN A;  2K5B B;  2LM9 A;  2YEV C;  1HNW T;  5CA1 E;  4Q25 A;  4ADZ A;  5IWA T;  2W61 A;  5LGU B;  1OED E;  1ZEE A;  2ZM6 T;  3PUW F;  4LF8 T;  4XZC A;  5AQF B;  3HR0 A;  1Z0P A;  3IBP A;  2CBI A;  2JQQ A;  4AKR B;  4KX6 A;  4TV8 E;  3KV6 A;  1X9B A;  2ACZ A;  1N34 T;  3HKC E;  3HL6 A;  4H9R C;  4H9Q C;  3CQX C;  3SS1 A;  4MAL A;  3LK3 B;  2C0S A;  4HWI B;  5M4Y A;  2V7K A;  5FY0 A;  3B57 A;  3RIU A;  4DV0 T;  4JI1 T;  3CWZ B;  4UVC B;  4TV9 E;  4IHJ E;  2AXD S;  1HX8 A;  3AAE B;  4YTP A;  3AE6 A;  3I9W A;  4JI2 T;  4ASK A;  4IDQ A;  5JDM A;  2BG9 B;  5FVK A;  3I0Q A;  4H9S E;  5IUX A;  1KF6 A;  2N2N A;  2KLQ A;  2WCA A;  2CBJ A;  1NEK A;  3QB5 K;  3UFG A;  4JEU B;  5JDQ A;  3ZMS B;  2JQH A;  5AQT B;  1KEY A;  3CIR A;  4OX9 T;  5LHI B;  3ONJ A;  5AQN B;  2CWO A;  4QWN B;  1D1B A;  2A9U A;  4X65 T;  3AEB A;  4ZS3 A;  3MXZ A;  3W15 B;  3ZMT B;  2LHR A;  3KBT A;  3P4P A;  3ETU A;  4TZ4 C;  2IML A;  3ZMZ B;  1XZY A;  2H7V C;  2K3W A;  1ZP0 A;  4HTE A;  2ZLY A;  3QNU A;  5FNV E;  4CXY A;  2WDQ A;  4DMV A;  2BG9 E;  3AA7 B;  5ABH A;  2D0U A;  4WBN E;  5HEH A;  2PTF A;  4DV6 T;  2XY8 B;  5LG3 A;  3M3Z B;  4WW0 A;  5CGM A;  2X51 A;  5JR9 C;  4L0R A;  3CPZ A;  4LMK A;  3QC9 A;  4FJO A;  2CPT A;  2KND A;  4UEM A;  3Q9D A;  5IYZ E;  4QHO A;  2ZM0 A;  5FP3 A;  4EB6 E;  1WYC A;  3FZL B;  4DMW A;  4PW8 A;  4DV2 T;  1KK7 A;  4JI8 T;  5C2T A;  4EEB A;  3AE5 A;  2WSS V;  4AQG A;  3ZYM A;  2H3R A;  3UUM A;  5C8Y E;  1U5P A;  2BDE A;  2QYW A;  3L8R A;  3NZP A;  2DCF A;  3AE8 A;  3RYF E;  5F5W A;  5C3J A;  4I43 B;  2IHR 1;  4KHP T;  2E9X A;  3N9Q A;  2Z6E A;  1IZN B;  4OFZ A;  2C5J A;  2B1E A;  5HEG A;  2LOP A;  2L9Q A;  3O1H A;  5L47 A;  4O2B E;  2WU5 A;  4HWD A;  2VUR A;  3J9X 1;  3NZQ A;  3F31 A;  3RYH E;  5JDL A;  5CJ5 A;  5ETW A;  3RYI E;  2IC9 A;  4ZI3 C;  2LKH A;  4BA9 A;  2V6Y B;  3CK6 A;  4COF A;  3RKG A;  5EZY E;  4IDN A;  2VK9 A;  2DNX A;  4G2A A;  5KX5 E;  3AAA B;  2WQY A;  5BR8 T;  1MMN A;  2CWY A;  2FJB A;  5LGN B;  4JBW F;  3GA8 A;  3H37 A;  5LG4 A;  2XQ8 A;  3I0O A;  1J5W A;  2NP9 A;  5AQU B;  4NXM T;  2BKO A;  2BBJ A;  2YDR A;  2ZM2 A;  2J62 A;  2KSR A;  1SUM B;  2E2A A;  2Q9Q A;  3WI3 A;  5LP6 E;  3JAE A;  1WR0 A;  2IC6 A;  3F57 A;  1ZOY A;  3QOF A;  3PJA A;  5FL0 A;  2V26 A;  2XQ4 A;  5AFU L;  1S35 A;  4CXW A;  1UUR A;  2VQE T;  3DP7 A;  2CMR A;  2LT3 A;  4ZS2 A;  4GK5 E;  3AXJ A;  2J4G A;  2FBW A;  2EHO C;  1BR4 A;  4B3S T;  4DUZ T;  4CN6 A;  5L3G B;  4AQF C;  3AED A;  3AVR A;  2V7L A;  1M7K A;  3MA9 A;  3FBL A;  4HE8 A;  5IHY A;  2V7M A;  2H88 A;  3GN5 B;  2VAS A;  2LRL A;  2CHO A;  5KXJ A;  1HFA A;  4EZ4 A;  4LML A;  2KMF A;  4A97 A;  4LFB T;  1W9R A;  2PFV A;  1XMQ T;  3KFW X;  3ZYK A;  3Q5D A;  2UXN B;  5ABF A;  3EVY A;  4DR1 T;  4ZZB A;  4O4H E;  4WYV A;  1KNZ A;  2CA5 A;  4UVB B;  3L09 A;  5AQK B;  2C5K T;  5JRE A;  4LF5 T;  3IF8 B;  4I4T E;  4LF7 T;  3RC3 A;  4JI0 T;  4P0A A;  2X67 A;  5L2L A;  4TWD A;  3AEF A;  3AE7 A;  4O8S A;  4DR6 T;  1YQ3 A;  4ILC A;  2W4X A;  3KIN B;  2V5C A;  5ABG A;  4DV4 T;  4UXN B;  3IA3 A;  4EAH A;  2ZMA A;  3PDY A;  3PUQ A;  5LNK A;  3P4Q A;  2XAF B;  5L3E B;  5LBM A;  5JRC B;  4MBQ A;  2QA7 A;  3I1A A;  4U33 A;  1B7T A;  3RIU C;  5A1L A;  3A7M A;  5HEJ A;  1N33 T;  2NTY A;  4UV8 B;  1XWM A;  2J47 A;  3Q5X A;  4DO0 A;  1VCT A;  1HNX T;  4QH4 A;  2KT9 A;  4U74 A;  1E1H B;  2HPL A;  1YKE B;  2VQF T;  2WWV A;  4EYY R;  3JAD A;  2BVM A;  2LSJ A;  5LMU T;  2KIN B;  4GIW A;  2VKH A;  5BMV E;  2K9A A;  3VR8 A;  2IDO B;  5JDG A;  3L39 A;  5HYA A;  4QXB B;  3AEA A;  3RQW A;  3RX6 A;  5CFB A;  1MND A;  4TNW A;  3UUN A;  1CUN A;  2WS3 A;  2JRK A;  2BKN A;  5FY7 A;  4AQY T;  3JC6 C;  1BR1 A;  2PG8 A;  3VU7 H;  2EHO B;  1UK5 A;  4H9O C;  5L3F B;  1Y01 A;  3KBU A;  2DWG A;  3RKO A;  5AQQ B;  2W67 A;  3ZN1 B;  3UU6 A;  3G06 A;  2P9B A;  1ZKE A;  2IAK A;  2LSG A;  3VHL A;  2L3L A;  2L8K A;  3PUY F;  4UF0 A;  4ANJ A;  3VRA A;  3AEC A;  4PJJ A;  1FIO A;  3P4R A;  2OV9 A;  4DVD A;  3H3M A;  1HG2 A;  4DV1 T;  1SHZ C;  3AE3 A;  3PUA A;  2KWI B;  2QVA A;  3SFE A;  4P1N A;  3MKD A;  2G0U A;  2XQ6 A;  3P7I A;  4A98 A;  3F2E A;  2HH7 A;  4DR2 T;  2DLR A;  1UCU A;  4YSY A;  4NXN T;  3N9P A;  3VKG A;  2E9X C;  2XSB A;  2WBL A;  5AQL B;  3PE0 A;  3LFM A;  5FL1 A;  4EV6 A;  4NPP A;  5JDN A;  3J7Y q;  4BAY B;  4GK0 E;  3N9O A;  3EDV A;  2C5I T;  2HN1 A;  2YU1 A;  3UUB A;  5HXH A;  4CN4 A;  1NWM X;  4ZI2 D;  3SRZ A;  3P4S A;  4JI6 T; 
#chains in the Genus database with same CATH homology
 4BJM A;  1NAF A;  1UX4 A;  3ZN0 B;  2ACX A;  3LBX A;  3U3I A;  2A2F X;  3KV9 A;  5JDH A;  2WMN A;  3FXD B;  3ZJ2 A;  3GN5 A;  3RC8 A;  3NZP A;  5LHH B;  4O4L E;  2DCF A;  4IE6 A;  4IE4 A;  3O4X E;  3OYX A;  3RYF E;  4I43 B;  3O1I A;  5JR9 B;  1YD8 G;  3B13 A;  3C4W A;  2E9X A;  3N9Q A;  2Z6E A;  4HGA A;  5CB4 E;  5CA0 E;  1D1A A;  1ZV4 X;  4U72 A;  5DQW A;  3CX6 B;  1O3X A;  1IZN B;  1V9D A;  4OFZ A;  4TN7 B;  2C5J A;  3KVA A;  4X1K E;  2B1E A;  2OA5 A;  3UFE A;  1UX5 A;  2LOP A;  4QX7 B;  1YKH B;  2XUE A;  2XTL A;  2L9Q A;  4P0B A;  1LVF A;  3OYZ A;  3JC6 D;  4O4J E;  3C98 B;  3O1H A;  4PJL A;  3CML A;  5LHG B;  1FEW A;  4IGU A;  3AA1 B;  4O2B E;  3V5S A;  2NOX A;  4O2A E;  1D0Y A;  2LOS A;  2RA1 A;  4PAG A;  4ISS A;  5J2U E;  3MK7 C;  4HN9 A;  1FMV A;  3R84 B;  3J9X 1;  3NZQ A;  3F31 A;  4HKA A;  3ZMU B;  1D1C A;  1MMG A;  4ZHQ E;  3RYH E;  3R6N A;  4PK6 A;  5FXW A;  5JH7 E;  2Q9Q C;  3QUJ A;  5DQV A;  5HAX A;  4AI6 A;  5JDL A;  4TUY E;  3RH3 A;  2CM0 A;  5ETW A;  4A56 A;  3RYI E;  2CCQ A;  1MIV A;  3RRC A;  3U78 A;  2NW8 A;  4X1I E;  2K48 A;  4UF0 B;  5LJN A;  2IC9 A;  2YU2 A;  4ZI3 C;  4BA9 A;  5L3B B;  4C90 A;  2D0T A;  1MMD A;  2WWU A;  4OYK A;  3EDU A;  3C4Z A;  5EZY E;  5JQG E;  2XAS B;  4L5G A;  2VK9 A;  2DNX A;  4G2A A;  5KX5 E;  3AAA B;  2QGS A;  3FB2 A;  1IAP A;  4UEL A;  3ZYL A;  3Q5W A;  1MMN A;  3UUX B;  2CWY A;  5LGN B;  3GA8 A;  3H37 A;  3NBX X;  5LG4 A;  2CXD A;  3RPU A;  3OBV E;  2E8I A;  4CQI A;  3I0O A;  5LA6 E;  5F3J A;  2NP9 A;  4UVA B;  4DBR A;  1X79 A;  2MBG A;  2VB6 A;  2V1D B;  2VKD A;  3SOL A;  4F6R C;  4TX5 A;  3SWH A;  3ZPO A;  3K3Q C;  2ZM2 A;  4N78 D;  2XAH B;  2LSY A;  2H7O A;  5HXE A;  3N5L A;  2Q9Q A;  2XHE B;  3WI3 A;  5LP6 E;  5LYJ E;  4DBQ A;  4OYJ A;  5F8P A;  2IC6 A;  3F57 A;  5LCY A;  2IW5 B;  3K3N A;  3HA4 A;  5JDF A;  2X9H A;  4EOZ B;  4H9N C;  2XAJ B;  2V26 A;  1G73 A;  5AFU L;  5JRC A;  3LG7 A;  1HS7 A;  1MMA A;  2CXL A;  2NW7 A;  2XAG B;  3AVS A;  2NWB A;  1S35 A;  4CXW A;  2CLY B;  2LEH A;  3E22 E;  3ANW B;  1AJ3 A;  3DP7 A;  2X66 A;  3OJA A;  2CMR A;  2BZB A;  3A5X A;  3N2K E;  4O4I E;  2LT3 A;  4ZS2 A;  3KVB A;  4GK5 E;  3WAJ A;  2XQY A;  4PFO A;  1D0Z A;  1SA0 E;  5EK3 A;  4IDZ A;  3LK2 B;  2YIN A;  2EHO C;  1BR4 A;  2D2S A;  3N9N A;  3T8O A;  4EZH A;  2UXX B;  4IE7 A;  1ZHC A;  2I59 A;  2LSK A;  2WM9 A;  4KMC A;  5L3G B;  4AQF C;  3RYC E;  3N2G E;  3AVR A;  4YJ2 E;  2PJQ A;  3ZLI A;  3N2O A;  4AKI A;  2V7L A;  3MZK B;  2JPF A;  4ZI2 C;  5J1G A;  3MA9 A;  4QX8 B;  3FBL A;  4HE8 A;  3HKE E;  2M67 A;  4MLK A;  5IHY A;  2V7M A;  3LBX B;  3IEE A;  3ZJ1 A;  3HKD E;  1WRD A;  3GN5 B;  2VAS A;  5LBQ B;  4IE5 A;  5FY1 A;  5LJM A;  4NUU A;  5L3D B;  3DTO A;  3KV5 A;  2NW9 A;  1HFA A;  3MJX A;  4YLH A;  4EZ4 A;  5DJQ C;  5ADX L;  2E9X B;  3FHN A;  1HG5 A;  2KMF A;  3K8P C;  5L3C B;  2WMO A;  4P09 A;  3ZEF B;  4FI5 A;  2JJ9 A;  3E08 A;  3CKD A;  3HI2 A;  4GYS A;  4QXC B;  1S94 A;  4AKG A;  4EYU A;  3C51 A;  2KXP B;  2CEA A;  4AXP A;  2PFV A;  2MTQ A;  4I50 E;  2EHO A;  2SPC A;  2W63 A;  3KFW X;  3ZYK A;  3GWH A;  3UT5 E;  2UXN B;  4AQF A;  5J2T E;  3EVY A;  2VWA A;  3ONX A;  2VKJ A;  3RRW A;  3CVR A;  4V1A v;  5FXZ A;  2CE7 A;  5H6R B;  4CXX A;  4O4H E;  4AKL A;  3AB3 B;  1KNZ A;  2RP4 A;  2CA5 A;  4UVB B;  3L09 A;  2V7J A;  2C5K T;  3AA0 B;  5JRE A;  4IIJ E;  1US7 B;  4E7Z A;  3O1J A;  3IF8 B;  4I4T E;  4WNK A;  2A3D A;  1LVK A;  5H6Q B;  4X1Y E;  3RC3 A;  4EIW A;  4KP3 C;  3ZMV B;  4P0A A;  2W00 A;  2X67 A;  4I55 E;  4IST A;  5L2L A;  3ZC0 A;  2VL8 A;  2XAQ B;  3C64 A;  2PBI A;  3CQC B;  2NTX A;  4O8S A;  1WYB A;  3NRX A;  3AAI A;  2X9X A;  1G8X A;  3PUG A;  4OK0 A;  1YW0 A;  4H63 H;  3PUS A;  4JEH B;  2LJL A;  4KBM B;  4UIG A;  3KIN B;  3N9M A;  1LRZ A;  4KUM B;  4CZZ B;  3HKB E;  4YFS A;  5FXX A;  4ILU A;  1EZ3 A;  2ODU A;  2X9W A;  2K24 A;  3PTR B;  4BJN A;  5HWX A;  2K5B B;  4MFR A;  2LM9 A;  3VKH A;  2YEV C;  4UXN B;  3CX8 B;  5EK4 A;  1H7C A;  4EAH A;  2Q9Q B;  3KV4 A;  2ZMA A;  3PDY A;  3PUQ A;  3IHR A;  2LHN A;  2BVL A;  4H9P C;  5CA1 E;  2D5U A;  5LNK A;  3H3A A;  2XAF B;  2LSI A;  5JVD E;  4ADZ A;  5L3E B;  5LBM A;  5JRC B;  2YK0 A;  4MBQ A;  2QA7 A;  1HCI A;  3I1A A;  1B7T A;  2W0G A;  2E9X D;  2GK9 A;  2W61 A;  3M65 A;  5LGU B;  4CI2 B;  5A1L A;  1ZEE A;  2JMK A;  3UTK A;  2N9D A;  4C91 A;  3EUH A;  4XZC A;  3LJC A;  1T98 A;  3Q2M A;  2N1G A;  2NTY A;  4ZI7 E;  4UV8 B;  5FYM A;  3HR0 A;  4PNI A;  3BK9 A;  1WLX A;  1Z0P A;  1FMW A;  3C50 A;  3IBP A;  3S4U A;  3I9Y A;  2MYS A;  3ESL A;  2MOZ A;  2KWH A;  3Q5X A;  4UV9 B;  2JQQ A;  3FXE B;  4DO0 A;  2V7I A;  2X0L B;  4QXH B;  4PK4 A;  4AKR B;  4TV8 E;  4B6X A;  4XBF B;  3KV6 A;  2Y6X A;  3L3P A;  2KT9 A;  4U74 A;  3HKC E;  1E1H B;  3HL6 A;  4H9R C;  4H9Q C;  3CQX C;  2HPL A;  2J1D G;  1YKE B;  3SS1 A;  4EYY R;  2BVM A;  4MAL A;  1WR6 A;  1OXZ A;  3LK3 B;  2LSJ A;  3V5U A;  2C0S A;  2KIN B;  4CI3 B;  5M4Y A;  4GIW A;  3ZCI A;  1MIW A;  2VKH A;  5BMV E;  2V7K A;  5FY0 A;  2K9A A;  1QUU A;  3B57 A;  5HXR A;  5JDG A;  1QSD A;  4PJM A;  3ETV A;  5HYA A;  3OKQ A;  5GON E;  4XAX B;  4QXB B;  2W62 A;  5HXC A;  3PU8 A;  5JR9 A;  2X9Y A;  4YJ3 E;  1U4Q A;  3RX6 A;  3CWZ B;  4UVC B;  2ZM8 A;  4TV9 E;  4CI1 B;  4IHJ E;  1MND A;  2Y8D A;  3UUN A;  3BQK A;  1CUN A;  1HX8 A;  3AAE B;  3GMI A;  2KZ7 B;  2JRK A;  5FXV A;  5FY7 A;  4J2C A;  2X68 A;  4YHJ A;  3BQI A;  1BR1 A;  3JC6 C;  3I9W A;  2PG8 A;  4NUV A;  3VU7 H;  4K0U A;  4PK5 A;  4WBO A;  2EHO B;  4ASK A;  4H9O C;  5L3F B;  5JDM A;  4L9I A;  4MHC A;  1LKX A;  3KBU A;  3I0Q A;  2DWG A;  4H9S E;  2Y48 B;  3RKO A;  2N2N A;  2KLQ A;  4JLE A;  3WAK A;  2Q9Q D;  5FMN A;  4E7S A;  3ZN1 B;  5KDM C;  3MAC A;  2P9B A;  4JEU B;  4ZI3 D;  2WAU A;  1ZKE A;  5JDQ A;  2IAK A;  2LSG A;  3ZMS B;  4HEA A;  3VHL A;  2L3L A;  2LE8 A;  5LHI B;  2L8K A;  4QKN A;  4UF0 A;  3K3O A;  5KMG P;  2CWO A;  4ANJ A;  4QWN B;  1Y64 B;  1D1B A;  5DAB A;  5LXT E;  5HXS A;  4IE0 A;  2ODV A;  4Z8X A;  4X20 E;  4GOU A;  4ZS3 A;  3CQG B;  2CLY C;  3LK4 2;  4PJJ A;  4PJN A;  1MIY A;  1FIO A;  3MXZ A;  5HWY A;  3W15 B;  3D0T A;  3ZMT B;  2LHR A;  3KBT A;  3ETU A;  4TZ4 C;  3UUL A;  3ZMZ B;  4AKH A;  4PFP A;  3DJB A;  4DVD A;  2H7V C;  4G63 A;  1HF8 A;  4HTE A;  2ZLY A;  2JMH A;  3N9L A;  1D0X A;  1HG2 A;  2CXF A;  3E0Z A;  5FNV E;  4CXY A;  1VOM A;  3ZC1 A;  1SHZ C;  3PUA A;  4DMV A;  2KWI B;  3AA7 B;  4GYR A;  1BR0 A;  2D0U A;  4WBN E;  1IJ5 A;  4HFV A;  3MKD A;  2G0U A;  3P7I A;  3P8C D;  4EXT A;  3F2E A;  1HTJ F;  2HH7 A;  3PU3 A;  3O9X A;  3C4X A;  4WW0 A;  2DLR A;  2X51 A;  5JR9 C;  5TAO A;  1UCU A;  3BQL A;  3CPZ A;  3N9P A;  4L0R A;  1OWA A;  2HPJ A;  3QC9 A;  4FJO A;  3VKG A;  3PUR A;  2E9X C;  4ERR A;  2KND A;  1MNE A;  2WBL A;  3PE0 A;  3LFM A;  4UEM A;  3Q9D A;  3ANW A;  5IYZ E;  2DI4 A;  4M1P A;  4QHO A;  5JDN A;  1BR2 A;  2ZM0 A;  5FP3 A;  4ZOL E;  3TKL B;  4BAY B;  4EB6 E;  4GK0 E;  1WYC A;  2VKO A;  3J7Y q;  5LOV E;  4JUY A;  5LGT B;  2DHR A;  2EHO D;  4DMW A;  4PW8 A;  3N9O A;  3FBZ A;  3CX7 B;  1KK7 A;  3EDV A;  4DND A;  2C5I T;  3AA6 B;  4H63 V;  1VRB A;  4OHF A;  2YU1 A;  2DWK A;  2A72 A;  5EK2 A;  2WSS V;  5HXH A;  5E0O A;  4AQG A;  1IJ6 A;  1NWM X;  3NRY A;  4ZI2 D;  3SRZ A;  3KDS E;  3ZYM A;  3QK6 A;  2H3R A;  3UUM A;  5C8Y E;  1U5P A;  2BDE A;  2ES0 A;  3ZCJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...