2C5JA

N-terminal domain of tlg1, domain-swapped dimer
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
87
structure length
82
Chain Sequence
DPFQQVVKDTKEQLNRINNYITRHNTAEEEIQDILKDVEETIVDLDRSIIVMKRDENEDVSGREAQVKNIKQQLDALKLRFD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein transport
molecule keywords T-SNARE AFFECTING A LATE GOLGI COMPARTMENT PROTEIN 1
publication title Structural Analysis of the Interaction between the Snare Tlg1 and Vps51.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 39
structure length 82
sequence length 87
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-10-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.90 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2c5jA00
2K48A 3MXZA 3S4UA 3L3PA 2KWHA 3N5LA 2IC9A 2X9XA 4DNDA 3TKLB 2C5KT 2C5JA 4EYYR 3QK6A 4CQIA 3P7IA 4L0RA 2G0UA 3QUJA 1QSDA 2X9YA 2IC6A 3CVRA 1Z0PA 3FXEB 2C5IT 2MBGA 3CKDA 4B6XA 1H7CA 2CA5A 1IJ5A 3FXDB 2KWIB 1ZKEA 1LVFA 4FI5A 4J2CA 1IJ6A 2XTLA 2X9WA 1LRZA
chains in the Genus database with same CATH superfamily
3L3PA 4IDOA 3RRWA 1ZV4X 4UVBB 4DR2T 1IBLT 5ABEA 1UCUA 2BS3A 4DBRA 2N2NA 3PE0A 5GONE 2BKOA 1MIVA 2WCAA 3ONJA 1WYBA 4ZI2C 1XZYA 1D0XA 4WBNE 4B3ST 2PFVA 4HE8A 5LXTE 4JYAT 5C3JA 2BDEA 4B6XA 5J0ZA 1HG2A 4DV1T 3ETUA 4KHPT 3CQXC 4JI6T 5JRCA 4LMJA 5AQNB 2A9UA 4BJMA 3AEEA 3MJXA 5FL0A 2FJAA 3EDUA 3H37A 3KBTA 4IDNA 2N1GA 1Y01A 3UUNA 4KHZF 2L8KA 2FUPA 3EDVA 5LJMA 3VKHA 3N2GE 2WU5A 3ZMTB 2I59A 4OYKA 3PUQA 2PBIA 4MBQA 1B7TA 3O4XE 3NZQA 4ZZCA 3IEEA 3K3QC 1AJ3A 3UU5A 2UXBT 3AE1A 2JRKA 4GK5E 1N32T 4ZI3C 1FEWA 3L8RA 4EEBA 3CWZB 4WW0A 3RYIE 2KT9A 4CN6A 3U78A 2CXFA 3J7Yq 2D0TA 2WSSV 4CXYA 4DV6T 2LHRA 3UUMA 5HEUA 3AE6A 1HF8A 4O2AE 4UF0B 2XM2A 4I43B 3O1IA 5JDLA 2H7VC 4YHHT 4B3MT 2JQHA 4F8HA 2QA7A 2LE8A 2X9XA 2QVAA 1X9BA 2K9AA 2DNXA 2CWYA 4H63V 3OTOT 3VRBA 4YJ2E 2L3LA 4U72A 1GQEA 1Z0PA 2YDRA 4L5GA 3TLVA 3CKDA 1D0YA 2H89A 4TZ4C 2JMKA 4ADZA 4ZHQE 4IDPA 1J5WA 3B13A 2PTFA 3W15B 1XWMA 5KMGP 2VQET 2ZM8A 4U7IA 5HEHA 2XQYA 1OEDC 3MKDA 2E5LT 4B3TT 1H7CA 1KNZA 2JQ9A 4BA9A 5KDMC 3QNUA 4NXNT 1VRBA 2K3WA 4EGWA 3LBXB 3K1SA 4DR5T 4AIUA 2X9HA 5J2TE 2NTXA 2SPCA 4KX6A 3QOFA 2CBJA 4EYUA 2XAQB 3Q9DA 1FIOA 4HWHA 2V5CA 2XTLA 4UELA 2CWOA 4PFOA 5BMVE 5ABHA 4EAHA 3SOLA 3SRZA 1MMNA 3UTKA 3ZLIA 2E9XB 4AI6A 4O4JE 3N2KE 1IZNB 3EVYA 3RGLA 3T8OA 4AKHA 4KI0F 2EHOA 4AQFC 4TNWA 5ABFB 4YSYA 2IW5B 2XQ5A 4LFCT 1HS7A 3DTOA 4LF6T 5F3JA 1WR6A 1XDPA 2WDRA 4HFVA 1BR2A 2YEVC 2YDQA 2JQQA 5JR9B 2WMOA 3AEBA 3ONXA 2WBLA 4ISTA 5IYZE 3GN5A 2OV9A 2VVNA 4CN4A 2LRKA 4O4IE 3KVAA 1MMAA 4Z91A 3UU3A 1QLBA 3VU7H 3N2OA 2V1DB 1HG5A 2V6YA 3ZJ2A 3CX7B 3G06A 2MAWA 4LFAT 5LCYA 2X9WA 3AE7A 3RQWA 4U33A 4Z8XA 4EXTA 1XDOA 3L39A 4G63A 4AISA 3C51A 2VB6A 5FL1A 3ZKRA 1ZOYA 4YSZA 1YQ4A 1XMQT 1VOMA 1OEDA 1EZ3A 1UX5A 4IL4A 4QX8B 2JQKA 5HEOA 5LGUB 2BBHA 2K5BB 3TLUA 1U4QA 4H63H 5EK2A 2LSJA 4U2YA 4HGAA 2X0HA 5AQMB 5HXHA 2BS4A 2FJEA 3VR8A 3FZLB 4LF7T 4MLKA 4WZXA 1HCIA 2X67A 3PTRB 2KINB 2NTYA 5DQVA 3HI2A 2AXDS 3FZKB 2Q9QA 4CZZB 1FJGT 3P8CD 2V26A 5FXWA 1UX4A 2UUBT 2PJQA 2BBJA 5CB4E 4M1PA 2NP9A 2C0SA 3AEFA 4YSXA 5EK3A 4NXMT 3AE9A 3P4RA 1MNEA 2WWVA 3TLSA 5EZYE 2LEHA 4K0UA 2C5KT 1OWAA 2WWUA 4PK5A 1T7SA 4HWIB 5AQIB 3UU6A 5FKYA 2K24A 3PJAA 5L3FB 3FBZA 3CVRA 4HN9A 4ZXLA 4UIGA 5FXXA 5JH7E 1QUUA 3AEAA 3UQ7A 3WAKA 5IWAT 4L9IA 5F5WA 1D1AA 3KV6A 2A72A 3QK6A 5L2LA 4ILCA 3ZSTA 1JNRA 2XUEA 2IHR1 2BVMA 5HXCA 4JI4T 1IBMT 2X66A 4JI2T 3M65A 3HL6A 5LB7B 3V5UA 2BG9B 4YT0A 2ES0A 5FYMA 2A3DA 2DL1A 2UXDT 3ZMUB 4X65T 1R8IA 3RLFF 2ODUA 1KF6A 4ILBA 2E9XD 5ABGA 4EV6A 1ZKEA 2H3RA 3KV9A 3UU8A 5AQOB 4LF4T 3X1DA 2J47A 3ZYKA 5FXVA 1ZEEA 5LMUT 2MYSA 4NIQA 5L4HA 2DCFA 1FMWA 3HKBE 3I1AA 2IDOB 1MIWA 3RC8A 3FBLA 2W67A 5LHHB 5LP6E 5CGMA 1YD8G 2B1EA 3MZKB 4QXBB 5DABA 4CXWA 3VHLA 3A8YC 5KXJA 2JPFA 2Y6XA 3PU3A 3T1YT 4EYYR 4HFEA 4DIDB 2V7LA 3Q5WA 2KSRA 3ZMZB 3KV4A 5FY1A 1W0BA 4O4LE 2X68A 4ZI7E 2HN2A 4GK0E 3P50A 3NKZA 5JDFA 3SFEA 3CK6A 2IUBA 4ZS2A 4MALA 2YN6A 1UK5A 4HFHA 4UVCB 1ZP0A 2J4GA 4QH4A 4YTPA 4PAGA 3HKEE 3WAJA 4HKAA 4ZI2D 4DUZT 4A56A 3I0OA 3RC3A 1YXRA 3C50A 4IE6A 4QWNB 2W66A 5DQWA 2XQ8A 2XHEB 4XBFB 3CIRA 3ZJ1A 2K48A 3AE5A 1E2AA 1MMDA 4P09A 3N5LA 3NRXA 3AAIA 2HPLA 3VKGA 2JMHA 2Y48B 3MACA 2IMLA 3RYFE 3JCFA 2XAJB 3PJAJ 4NUUA 2E5VA 5FMNA 4ZEYA 3Q2MA 3QB5A 4DR3T 1D0ZA 3N9QA 3P4QA 2HPJA 4U7YA 4DBQA 3NBXX 1X79A 4C90A 2M67A 4V1Av 4AKIA 2Y8DA 1J1JA 2X51A 1D1BA 2E2AA 3UULA 2LKGA 4QH5A 2LSKA 2KNDA 4IIJE 4JEUB 4KUMB 2V7KA 3KBUA 2EHOC 4H9RC 2YDSA 5ADXL 3EAMA 1T8BA 1T72A 3RIUC 2FBWA 3PUYF 5BR8T 3ZCIA 5TAOA 4IREA 3PUWF 3JC6C 2KXPB 2XQAA 5LA6E 4CI3B 5HEGA 1SA0E 5L3EB 1NENA 2CRBA 2E8IA 2YKSA 5FXZA 2ACXA 3UUBA 5AQLB 4L0RA 4XAXB 4A97A 2XM1A 1LKXA 5JDQA 3VRAA 4JEHB 3PU8A 3AAAB 4HFBA 4IE5A 4U2ZA 2M6IA 2CXLA 3RYCE 3C64A 2LHNA 3SFDA 5AFUL 2X9YA 3O1HA 2MBGA 2HH7A 3ANWA 5KX5E 2IIUA 4ZOLE 5JVDE 1I6ZA 2HN1A 2WMNA 5HYAA 3ZT7A 2DWGA 3KINB 4PJMA 1HR0T 4U31A 5DJQC 3PV0F 5HWXA 4DVDA 3H3MA 4DV3T 5HXEA 3RKOA 3CPZA 4HFIA 3AECA 5LBQB 3CX6B 5AQVB 4JI7T 3H3AA 4KP3C 2CBIA 2YU1A 2WAUA 3ZPOA 3B5MA 3RH3A 2CHNA 2FJBA 1UURA 5FP3A 4UR9A 3PUXF 2YK0A 2XPKA 2W4XA 4HEAA 5JRCB 4WNKA 2XASB 2IAKA 4ASKA 3IF8B 3P4SA 3ZYLA 5AQFB 3R6NA 5CA0E 2UXNB 3AA6B 5LG3A 4DV4T 2ZM2A 1N34T 2Q9QC 2BZBA 4NUVA 1BR1A 4TNVA 3KFWX 4N78D 3N9LA 3RIUA 5LBMA 2WU2A 2QRXA 2I0MA 2YINA 4DR6T 3OJAA 3AE8A 4IDZA 3ZMSB 4KBMB 3AA1B 3AB3B 3HA4A 1MMGA 1W9RA 2ODVA 3M3ZB 1HNWT 3ZC0A 2VK9A 3F2EA 2J62A 3MA9A 3EABA 4O4HE 5C8YE 2CHOA 5AQPB 3N9MA 1US7B 2CLYC 4DMVA 2NWBA 3QC9A 3NZPA 4IE0A 4F6RC 5AQQB 4GYSA 4G2AA 2W61A 2YU2A 2WZHA 4LF5T 2VQFT 3UU4A 1FMVA 3LFMA 3ESLA 3F31A 2KLQA 5L3CB 3O9XA 4WYVA 2UUAT 3AXJA 2DLRA 2B76A 2OLTA 3SS1A 4X20E 2V8SV 2LSYA 4EZHA 5HAXA 2KMFA 4QXHB 4J2CA 1L0VA 5ETWA 2L9QA 4TV9E 2H88A 2YOEA 4JI0T 1UGOA 3B57A 2GK9A 5JQGE 3P7IA 1YW0A 4FJOA 2NOXA 2D9DA 2KWHA 2J1DG 1M7KA 4LFBT 4QX7B 5FVLA 5H6QB 4GKJT 3F57A 1UUSA 3UUXB 3J9X1 5CFBA 3HKCE 2VVSA 3ZMVB 3JAFA 5LNKA 2MPKA 1W0AA 2WS3A 1D1CA 2VKJA 4Q25A 2ACZA 2EHOB 2FJDA 3EI0A 4TV8E 2LSIA 3CMLA 4CI2B 1MNDA 5J1GA 2XQ3A 4H9OC 2BKNA 4BAYB 4LMLA 4UV8B 2BVLA 4LMKA 5AQJB 4CN1A 3CQGB 3HR0A 4I0UA 1HTJF 2LRLA 3BQLA 2WDVA 3LSVA 4I55E 2V5DA 2WM9A 2DI4A 4O8SA 3ZN0B 4DV0T 3GN5B 1IJ6A 4EEDA 1LRZA 5E0OA 3P4WA 2VL0A 3T1HT 2V7MA 2CXDA 1NWMX 3PUVF 3CX8B 3D0TA 2BG9E 2V6YB 2XQ7A 2LM2A 3OKQA 3ZC1A 4H9PC 1VCTA 2OA5A 3RF1A 4PK6A 2UU9T 3R84B 3BQKA 5AQUB 3FHNA 2E9XC 4DV2T 4DMWA 2LKHA 3RKGA 3WI3A 2G0UA 3C4XA 3I9YA 5IUXA 3TLWA 1OEDB 2XAFB 3K3OA 1XNQT 3LK3B 3SWHA 3NRYA 4TWDA 1S94A 1T98A 2VWAA 2CPTA 1S35A 2Z6EA 5H6RB 4QH1A 1XNRT 3NVOA 1WFDA 3Q5EA 4UF0A 5AQSB 4CXXA 4A5XA 5JDNA 4AKLA 3N9NA 5C2TA 3DJBA 4CI1B 2QGSA 4DNDA 3KVBA 4AQYT 2RP4A 3PURA 3ZEFB 3RIAA 3N9OA 5AQHB 2H7OA 5L4EA 4PJLA 2CA5A 2Q9QB 4ILUA 1HFAA 2KZ7B 3C4WA 2XQ6A 2ZMAA 1WR0A 4YHJA 2WZIA 3LK42 3KDSE 4JUYA 3AEDA 5M4YA 2N9DA 3RQUA 4AQGA 1LVKA 1JNZA 3QUJA 4TN7B 4EIWA 2LJLA 4JI5T 2QYWA 4OK0A 4E7ZA 2WB5A 1WLXA 2R6GF 3LBXA 1Z8UA 4MHCA 4XZCA 4YTNA 3E22E 3JAEA 2D5UA 5FY7A 4PFPA 3KV5A 3RRCA 4YJ3E 2CLYB 2UXXB 2CE7A 5JDMA 5J2UE 2E9XA 4QHOA 1LVFA 2BS2A 5F8PA 5ABFA 1I94T 4IT4A 1MIYA 2CMRA 2W2UA 3MK7C 1YKHB 4HWDA 2C5JA 1HX8A 2VASA 1HNZT 2JIWA 3RI5A 4O2BE 3A5XA 5FVKA 4X5TA 2CM0A 4ZI3D 2EHOD 5JR9A 2JJ9A 4EB6E 4IDQA 3AA0B 3JC6D 1M62A 4ISSA 2HHHT 3O1JA 3ZSSA 3FZHB 4KMCA 3BQIA 5AQGB 5LOVE 3BK9A 5HWYA 4U3CA 5LGNB 1U5PA 5JREA 2DHRA 1N36T 4IE7A 3ZT5A 4GKKT 3C98B 5LMNT 2RA1A 3IBPA 1ZHCA 4ERRA 3UFGA 3AE2A 1CHUA 3AEGA 3QB5K 4OFZA 2BG9C 2XZEA 4IHJE 1IAPA 4IL9A 4UXNB 5CA1E 4X1KE 3FZFB 1OXZA 4GOUA 3GA8A 5LGTB 5AQKB 2BKPA 4TX5A 3DP7A 2MTQA 3IHRA 1NAFA 2LLYA 3S4UA 4E7SA 4UVAB 3GMIA 3PUGA 5HXRA 3N9PA 4TWFA 1SUMB 2W63A 4Z90A 1WRDA 1HNXT 4OHFA 4C91A 3RYHE 4MFRA 3LK2B 2W62A 3PDYA 5L3DB 3FB2A 4QXCB 4PJNA 1SE7A 2CCQA 4TUYE 2VL8A 1BR0A 4DR4T 3AA7B 3GWHA 2WY2A 1YQ3A 5LJNA 2X0YA 4PW8A 2NR4A 3IA3A 2XQ9A 4DO0A 1SHZC 3RX6A 2XSBA 1HX1B 3AVRA 1O3XA 2VKHA 5CJ5A 3VR9A 2Q9QD 4K0KT 1DU2A 3Q5DA 3E0ZA 2MOZA 2DWKA 5HCMA 3AAEB 3HKDE 2XAGB 3OYZA 5IHYA 4HWCA 2V7IA 1W09A 1YKEB 4JI8T 5LG4A 3FZMB 5AQTB 2ZM6T 3PUZF 4EZ4A 2XAHB 4H9NC 5A1LA 4HFDA 2IC6A 1N33T 2W00A 2V7JA 4GYRA 4QKNA 3PUSA 2V6XA 2CEAA 4OYJA 3ONLC 4I4TE 2XQ4A 4X64T 2BG9A 4YY3T 2VURA 1J5ET 3UT5E 4UV9B 4YLHA 4TWHA 5L3BB 2LOPA 3TLTA 4HTEA 4ZZBA 5JTGA 3LG7A 3PUAA 3UQ4A 3LJCA 3ANWB 3OBVE 4YTMA 4ILAA 4H9QC 3LDQB 4AKGA 2NW7A 3MXZA 3V5SA 2LSGA 5HCJA 2ZLYA 1G8XA 3ZCJA 5HXSA 4X66T 4CQIA 4BJNA 5JDGA 2ZM0A 5FY0A 2NW8A 3I0QA 4DR1T 3FXDB 2KWIB 3AE3A 4X62T 2P9BA 4JI1T 2XJ7A 3AVSA 1IBKT 2XY8B 4HFCA 3E08A 4UEMA 2UXCT 1V9DA 4U74A 3L09A 4PK4A 4DV5T 3CQCB 4DV7T 1KNPA 1IJ5A 1VCSA 4WBOA 4AQFA 2IC9A 3ABVA 1WCRA 5LHGB 4X1YE 4LF9T 5JDHA 4A98A 1NEKA 3ZYMA 2AE9A 4JBWF 1XMOT 3ZN1B 3TKLB 4GIWA 2D0UA 4B3RT 1QSDA 4YFSA 5HEJA 2PG8A 1E7PA 3UFEA 2LOSA 4JI3T 3RIFA 1KK7A 4LF8T 2WQYA 5EK4A 4X1IE 4P1NA 4DUYT 3OVUA 4YXDA 4PNIA 1G73A 3I9WA 2C5IT 3EHZA 4ANJA 4COFA 3U3IA 4FI5A 2WDQA 5L3GB 4IE4A 3AE4A 4PJJA 2WP9A 3OYXA 1WYCA 1KEYA 1KFYA 2X0LB 2RPAA 3ETVA 1BR4A 2VKOA 5AQRB 4HWFA 2M6BA 3K8PC 4OX9T 1OEDE 1E1HB 4NPPA 4AKRB 3AXJB 2I6HA 2A2FX 3K3NA 2LT3A 3A7MA 4IGUA 2LM9A 5JR9C 3Q5XA 5L47A 5FNVE 4EOZB 2VKDA 3NWIA 5LYJE 1KNRA 2W0GA 4P0BA 3RPUA 4JLEA 5LHIB 4JV5T 3RHWA 2XSAA 3JADA 2NW9A 1Y64B 3P4PA 2UUCT 4AXPA 4I50E 3EUHA 3ZT6A 2F4VT 1CUNA 3FXEB 4DR7T 2D2SA 3OPCA 4P0AA 4ZS3A 4H9SE 3C4ZA
chains in the Genus database with same CATH topology
2DHRA 3L3PA 3RRWA 2ODVA 4IE7A 1ZV4X 2LEHA 3C98B 4K0UA 4UVBB 2C5KT 1OWAA 2WWUA 2RA1A 4PK5A 3IBPA 1UCUA 1ZHCA 3ZC0A 4ERRA 2K24A 2VK9A 4DBRA 2N2NA 3F2EA 5L3FB 3PE0A 3FBZA 3MA9A 5GONE 3CVRA 4HN9A 1MIVA 4UIGA 4O4HE 5C8YE 5FXXA 4OFZA 5JH7E 1QUUA 1WYBA 4ZI2C 3N9MA 1US7B 3WAKA 4L9IA 2CLYC 4DMVA 1D0XA 4IHJE 2NWBA 1IAPA 4WBNE 3QC9A 4UXNB 1D1AA 3NZPA 4X1KE 3KV6A 2A72A 5CA1E 1OXZA 3QK6A 4IE0A 2PFVA 4HE8A 5L2LA 4F6RC 4GOUA 5LXTE 3GA8A 4GYSA 4G2AA 2W61A 2XUEA 5LGTB 2YU2A 2BDEA 2BVMA 4B6XA 4TX5A 5HXCA 3DP7A 1HG2A 2MTQA 2X66A 3IHRA 1NAFA 1FMVA 3LFMA 3S4UA 3ESLA 4E7SA 4UVAB 3F31A 3M65A 2KLQA 3GMIA 3PUGA 3HL6A 3ETUA 3V5UA 5HXRA 3N9PA 5L3CB 3O9XA 3CQXC 2ES0A 5FYMA 2A3DA 2W63A 1WRDA 5JRCA 3ZMUB 4OHFA 2DLRA 4BJMA 2ODUA 4C91A 3RYHE 3MJXA 3EDUA 3SS1A 4X20E 3H37A 2E9XD 2LSYA 3KBTA 4MFRA 4EZHA 2N1GA 3LK2B 5HAXA 2KMFA 2W62A 4QXHB 3UUNA 1ZKEA 2H3RA 3KV9A 3PDYA 4J2CA 3FB2A 5L3DB 4QXCB 5ETWA 2L9QA 4PJNA 4TV9E 3ZYKA 5FXVA 2L8KA 3EDVA 1ZEEA 2CCQA 2MYSA 2DCFA 4TUYE 1FMWA 5LJMA 2VL8A 3HKBE 3B57A 3I1AA 1BR0A 3AA7B 3VKHA 2GK9A 3GWHA 1MIWA 5JQGE 3N2GE 3P7IA 5LJNA 4PW8A 3FBLA 3ZMTB 3RC8A 2I59A 5LHHB 5LP6E 4OYKA 3PUQA 2PBIA 4MBQA 4DO0A 1SHZC 3RX6A 1B7TA 3O4XE 1YD8G 1YW0A 2B1EA 3AVRA 3MZKB 3NZQA 2VKHA 1O3XA 4QXBB 5DABA 4FJOA 2NOXA 3IEEA 2Q9QD 2KWHA 3K3QC 4CXWA 1AJ3A 2J1DG 4QX7B 3VHLA 5H6QB 2JRKA 4GK5E 3F57A 2JPFA 2Y6XA 4ZI3C 1FEWA 3PU3A 3UUXB 4EYYR 3J9X1 3E0ZA 2MOZA 3CWZB 4WW0A 3RYIE 2KT9A 2DWKA 3HKCE 3U78A 3AAEB 3HKDE 2V7LA 2XAGB 2CXFA 3Q5WA 3J7Yq 3ZMZB 3KV4A 3ZMVB 3OYZA 5FY1A 5IHYA 2D0TA 4O4LE 5LNKA 2V7IA 2X68A 4ZI7E 2WSSV 4GK0E 4CXYA 2LHRA 1YKEB 3UUMA 5LG4A 1D1CA 1HF8A 4O2AE 2VKJA 4UF0B 5JDFA 4ZS2A 4EZ4A 2EHOB 4I43B 3O1IA 4TV8E 2XAHB 5JDLA 2H7VC 4H9NC 4MALA 2LSIA 3CMLA 5A1LA 2IC6A 2W00A 4CI2B 1MNDA 2QA7A 5J1GA 2V7JA 4H9OC 4GYRA 4UVCB 4QKNA 2LE8A 3PUSA 4BAYB 4UV8B 2BVLA 3CQGB 4PAGA 2X9XA 2CEAA 4OYJA 3HKEE 3WAJA 4HKAA 4I4TE 3HR0A 2K9AA 1HTJF 2DNXA 4ZI2D 2CWYA 4A56A 4H63V 4YJ2E 3BQLA 3I0OA 3RC3A 4IE6A 3C50A 2L3LA 4I55E 4QWNB 4U72A 5DQWA 4L5GA 1Z0PA 2XHEB 2WM9A 3CKDA 1D0YA 3UT5E 4XBFB 4UV9B 4YLHA 2DI4A 4O8SA 2JMKA 4TZ4C 3ZN0B 4ADZA 3GN5B 1IJ6A 3ZJ1A 4ZHQE 1LRZA 5E0OA 2K48A 5L3BB 2LOPA 2V7MA 4P09A 1MMDA 3N5LA 2CXDA 3B13A 3NRXA 4HTEA 3AAIA 3W15B 2HPLA 3VKGA 2JMHA 1NWMX 3LG7A 3PUAA 3CX8B 3D0TA 5KMGP 2Y48B 2ZM8A 3MACA 3LJCA 3ANWB 3OBVE 2XQYA 3RYFE 3MKDA 4H9QC 2XAJB 3OKQA 3ZC1A 4H9PC 4NUUA 1H7CA 1KNZA 4BA9A 5KDMC 4AKGA 5FMNA 2OA5A 1VRBA 2NW7A 4PK6A 3MXZA 3Q2MA 3V5SA 2LSGA 3LBXB 1D0ZA 3N9QA 2HPJA 2ZLYA 1G8XA 3ZCJA 3R84B 2X9HA 3BQKA 4DBQA 5HXSA 3FHNA 3NBXX 2E9XC 1X79A 5J2TE 4C90A 2M67A 4V1Av 4CQIA 4DMWA 4AKIA 3WI3A 2Y8DA 2G0UA 2X51A 4BJNA 5JDGA 1D1BA 2NTXA 2SPCA 3C4XA 2ZM0A 3I9YA 5FY0A 2NW8A 3I0QA 3UULA 4EYUA 2XAQB 2XAFB 3K3OA 3Q9DA 3LK3B 3FXDB 1FIOA 2KWIB 3SWHA 2XTLA 3NRYA 1S94A 1T98A 2CWOA 2VWAA 4PFOA 4UELA 2P9BA 5BMVE 1S35A 2LSKA 2Z6EA 2KNDA 4IIJE 4JEUB 4EAHA 3SOLA 4KUMB 2V7KA 3KBUA 3AVSA 3SRZA 5H6RB 1MMNA 3E08A 2EHOC 3UTKA 4H9RC 3ZLIA 4UEMA 5JREA 2E9XB 5ADXL 4O4JE 4AI6A 3N2KE 1IZNB 1V9DA 3EVYA 3L09A 4U74A 4UF0A 4PK4A 3T8OA 4AKHA 2EHOA 3CQCB 4AQFC 2IW5B 4CXXA 5JDNA 4AKLA 1IJ5A 1HS7A 3ZCIA 3N9NA 5TAOA 3DTOA 3JC6C 2KXPB 5F3JA 1WR6A 5LA6E 4WBOA 3DJBA 2IC9A 4AQFA 4CI3B 4CI1B 2QGSA 4DNDA 1SA0E 5L3EB 5FXZA 2E8IA 4HFVA 1BR2A 2YEVC 2ACXA 3KVBA 4L0RA 4XAXB 5LHGB 2JQQA 5JR9B 2RP4A 3PURA 3ZEFB 1LKXA 2WMOA 3N9OA 4X1YE 2H7OA 5JDQA 4PJLA 5JDHA 4JEHB 2CA5A 2Q9QB 4ILUA 3ONXA 3ZYMA 3PU8A 2WBLA 1HFAA 3AAAB 2KZ7B 4IE5A 3C4WA 4ISTA 2ZMAA 4YHJA 3ZN1B 3TKLB 2CXLA 5IYZE 3GN5A 3LK42 3RYCE 3C64A 2LHNA 3KDSE 4O4IE 4GIWA 3KVAA 1MMAA 4JUYA 2D0UA 5M4YA 2N9DA 4AQGA 1LVKA 3QUJA 1QSDA 4TN7B 4EIWA 5AFUL 4YFSA 3VU7H 2LJLA 3N2OA 2X9YA 3O1HA 2V1DB 1HG5A 2MBGA 2HH7A 3ZJ2A 3ANWA 3CX7B 5KX5E 4ZOLE 5JVDE 2PG8A 5LCYA 2X9WA 4OK0A 4E7ZA 2WMNA 5HYAA 4Z8XA 4EXTA 1WLXA 3UFEA 2LOSA 2DWGA 3KINB 4PJMA 4G63A 1KK7A 5EK4A 3LBXA 4X1IE 4MHCA 5DJQC 4XZCA 5HWXA 3C51A 4PNIA 4DVDA 3E22E 5HXEA 2VB6A 3RKOA 3CPZA 1G73A 5LBQB 3CX6B 2D5UA 3I9WA 5FY7A 2C5IT 4ANJA 3H3AA 4PFPA 3U3IA 4FI5A 3KV5A 5L3GB 4IE4A 4KP3C 1VOMA 4PJJA 2YU1A 1EZ3A 2WAUA 3RRCA 1UX5A 3ZPOA 4YJ3E 3OYXA 1WYCA 2CLYB 3RH3A 5LGUB 2UXXB 4QX8B 2K5BB 2CE7A 2X0LB 3ETVA 1BR4A 1U4QA 4H63H 5EK2A 2LSJA 2VKOA 5JDMA 5FP3A 5J2UE 2E9XA 2YK0A 4QHOA 3K8PC 1LVFA 5F8PA 4HGAA 5HXHA 4HEAA 1E1HB 5JRCB 4WNKA 4AKRB 2XASB 2IAKA 1MIYA 2CMRA 3MK7C 4ASKA 1YKHB 3IF8B 2C5JA 1HX8A 2A2FX 2VASA 3K3NA 2LT3A 4O2BE 3ZYLA 3A5XA 4IGUA 3R6NA 2LM9A 5CA0E 5JR9C 2UXNB 3AA6B 3Q5XA 4MLKA 2CM0A 5FNVE 2ZM2A 2VKDA 1HCIA 2X67A 3PTRB 4EOZB 5LYJE 2Q9QC 2EHOD 2W0GA 4P0BA 4ZI3D 2KINB 2BZBA 2NTYA 4NUVA 3RPUA 4JLEA 5JR9A 5LHIB 1BR1A 5DQVA 2JJ9A 3HI2A 3KFWX 4N78D 3N9LA 4EB6E 2Q9QA 4CZZB 3AA0B 5LBMA 2NW9A 1Y64B 3P8CD 2V26A 5FXWA 1UX4A 4AXPA 4I50E 3EUHA 2YINA 2PJQA 3JC6D 5CB4E 4ISSA 3OJAA 4IDZA 3O1JA 4M1PA 2NP9A 3ZMSB 1CUNA 4KBMB 2C0SA 3AA1B 3AB3B 3HA4A 4KMCA 1MMGA 3BQIA 3FXEB 5EK3A 2D2SA 4P0AA 5LOVE 1MNEA 3BK9A 4ZS3A 5HWYA 5LGNB 4H9SE 5EZYE 1U5PA 3C4ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K48 A;  3MXZ A;  3S4U A;  3L3P A;  2KWH A;  3N5L A;  2IC9 A;  2X9X A;  4DND A;  3TKL B;  2C5K T;  2C5J A;  4EYY R;  3QK6 A;  4CQI A;  3P7I A;  4L0R A;  2G0U A;  3QUJ A;  1QSD A;  2X9Y A;  2IC6 A;  3CVR A;  1Z0P A;  3FXE B;  2C5I T;  2MBG A;  3CKD A;  4B6X A;  1H7C A;  2CA5 A;  1IJ5 A;  3FXD B;  2KWI B;  1ZKE A;  1LVF A;  4FI5 A;  4J2C A;  1IJ6 A;  2XTL A;  2X9W A;  1LRZ A; 
#chains in the Genus database with same CATH topology
 3L3P A;  4IDO A;  3RRW A;  1ZV4 X;  4UVB B;  4DR2 T;  1IBL T;  5ABE A;  1UCU A;  2BS3 A;  4DBR A;  2N2N A;  3PE0 A;  5GON E;  2BKO A;  1MIV A;  2WCA A;  3ONJ A;  1WYB A;  4ZI2 C;  1XZY A;  1D0X A;  4WBN E;  4B3S T;  2PFV A;  4HE8 A;  5LXT E;  4JYA T;  5C3J A;  2BDE A;  4B6X A;  5J0Z A;  1HG2 A;  4DV1 T;  3ETU A;  4KHP T;  3CQX C;  4JI6 T;  5JRC A;  4LMJ A;  5AQN B;  2A9U A;  4BJM A;  3AEE A;  3MJX A;  5FL0 A;  2FJA A;  3EDU A;  3H37 A;  3KBT A;  4IDN A;  2N1G A;  1Y01 A;  3UUN A;  4KHZ F;  2L8K A;  2FUP A;  3EDV A;  5LJM A;  3VKH A;  3N2G E;  2WU5 A;  3ZMT B;  2I59 A;  4OYK A;  3PUQ A;  2PBI A;  4MBQ A;  1B7T A;  3O4X E;  3NZQ A;  4ZZC A;  3IEE A;  3K3Q C;  1AJ3 A;  3UU5 A;  2UXB T;  3AE1 A;  2JRK A;  4GK5 E;  1N32 T;  4ZI3 C;  1FEW A;  3L8R A;  4EEB A;  3CWZ B;  4WW0 A;  3RYI E;  2KT9 A;  4CN6 A;  3U78 A;  2CXF A;  3J7Y q;  2D0T A;  2WSS V;  4CXY A;  4DV6 T;  2LHR A;  3UUM A;  5HEU A;  3AE6 A;  1HF8 A;  4O2A E;  4UF0 B;  2XM2 A;  4I43 B;  3O1I A;  5JDL A;  2H7V C;  4YHH T;  4B3M T;  2JQH A;  4F8H A;  2QA7 A;  2LE8 A;  2X9X A;  2QVA A;  1X9B A;  2K9A A;  2DNX A;  2CWY A;  4H63 V;  3OTO T;  3VRB A;  4YJ2 E;  2L3L A;  4U72 A;  1GQE A;  1Z0P A;  2YDR A;  4L5G A;  3TLV A;  3CKD A;  1D0Y A;  2H89 A;  4TZ4 C;  2JMK A;  4ADZ A;  4ZHQ E;  4IDP A;  1J5W A;  3B13 A;  2PTF A;  3W15 B;  1XWM A;  5KMG P;  2VQE T;  2ZM8 A;  4U7I A;  5HEH A;  2XQY A;  1OED C;  3MKD A;  2E5L T;  4B3T T;  1H7C A;  1KNZ A;  2JQ9 A;  4BA9 A;  5KDM C;  3QNU A;  4NXN T;  1VRB A;  2K3W A;  4EGW A;  3LBX B;  3K1S A;  4DR5 T;  4AIU A;  2X9H A;  5J2T E;  2NTX A;  2SPC A;  4KX6 A;  3QOF A;  2CBJ A;  4EYU A;  2XAQ B;  3Q9D A;  1FIO A;  4HWH A;  2V5C A;  2XTL A;  4UEL A;  2CWO A;  4PFO A;  5BMV E;  5ABH A;  4EAH A;  3SOL A;  3SRZ A;  1MMN A;  3UTK A;  3ZLI A;  2E9X B;  4AI6 A;  4O4J E;  3N2K E;  1IZN B;  3EVY A;  3RGL A;  3T8O A;  4AKH A;  4KI0 F;  2EHO A;  4AQF C;  4TNW A;  5ABF B;  4YSY A;  2IW5 B;  2XQ5 A;  4LFC T;  1HS7 A;  3DTO A;  4LF6 T;  5F3J A;  1WR6 A;  1XDP A;  2WDR A;  4HFV A;  1BR2 A;  2YEV C;  2YDQ A;  2JQQ A;  5JR9 B;  2WMO A;  3AEB A;  3ONX A;  2WBL A;  4IST A;  5IYZ E;  3GN5 A;  2OV9 A;  2VVN A;  4CN4 A;  2LRK A;  4O4I E;  3KVA A;  1MMA A;  4Z91 A;  3UU3 A;  1QLB A;  3VU7 H;  3N2O A;  2V1D B;  1HG5 A;  2V6Y A;  3ZJ2 A;  3CX7 B;  3G06 A;  2MAW A;  4LFA T;  5LCY A;  2X9W A;  3AE7 A;  3RQW A;  4U33 A;  4Z8X A;  4EXT A;  1XDO A;  3L39 A;  4G63 A;  4AIS A;  3C51 A;  2VB6 A;  5FL1 A;  3ZKR A;  1ZOY A;  4YSZ A;  1YQ4 A;  1XMQ T;  1VOM A;  1OED A;  1EZ3 A;  1UX5 A;  4IL4 A;  4QX8 B;  2JQK A;  5HEO A;  5LGU B;  2BBH A;  2K5B B;  3TLU A;  1U4Q A;  4H63 H;  5EK2 A;  2LSJ A;  4U2Y A;  4HGA A;  2X0H A;  5AQM B;  5HXH A;  2BS4 A;  2FJE A;  3VR8 A;  3FZL B;  4LF7 T;  4MLK A;  4WZX A;  1HCI A;  2X67 A;  3PTR B;  2KIN B;  2NTY A;  5DQV A;  3HI2 A;  2AXD S;  3FZK B;  2Q9Q A;  4CZZ B;  1FJG T;  3P8C D;  2V26 A;  5FXW A;  1UX4 A;  2UUB T;  2PJQ A;  2BBJ A;  5CB4 E;  4M1P A;  2NP9 A;  2C0S A;  3AEF A;  4YSX A;  5EK3 A;  4NXM T;  3AE9 A;  3P4R A;  1MNE A;  2WWV A;  3TLS A;  5EZY E;  2LEH A;  4K0U A;  2C5K T;  1OWA A;  2WWU A;  4PK5 A;  1T7S A;  4HWI B;  5AQI B;  3UU6 A;  5FKY A;  2K24 A;  3PJA A;  5L3F B;  3FBZ A;  3CVR A;  4HN9 A;  4ZXL A;  4UIG A;  5FXX A;  5JH7 E;  1QUU A;  3AEA A;  3UQ7 A;  3WAK A;  5IWA T;  4L9I A;  5F5W A;  1D1A A;  3KV6 A;  2A72 A;  3QK6 A;  5L2L A;  4ILC A;  3ZST A;  1JNR A;  2XUE A;  2IHR 1;  2BVM A;  5HXC A;  4JI4 T;  1IBM T;  2X66 A;  4JI2 T;  3M65 A;  3HL6 A;  5LB7 B;  3V5U A;  2BG9 B;  4YT0 A;  2ES0 A;  5FYM A;  2A3D A;  2DL1 A;  2UXD T;  3ZMU B;  4X65 T;  1R8I A;  3RLF F;  2ODU A;  1KF6 A;  4ILB A;  2E9X D;  5ABG A;  4EV6 A;  1ZKE A;  2H3R A;  3KV9 A;  3UU8 A;  5AQO B;  4LF4 T;  3X1D A;  2J47 A;  3ZYK A;  5FXV A;  1ZEE A;  5LMU T;  2MYS A;  4NIQ A;  5L4H A;  2DCF A;  1FMW A;  3HKB E;  3I1A A;  2IDO B;  1MIW A;  3RC8 A;  3FBL A;  2W67 A;  5LHH B;  5LP6 E;  5CGM A;  1YD8 G;  2B1E A;  3MZK B;  4QXB B;  5DAB A;  4CXW A;  3VHL A;  3A8Y C;  5KXJ A;  2JPF A;  2Y6X A;  3PU3 A;  3T1Y T;  4EYY R;  4HFE A;  4DID B;  2V7L A;  3Q5W A;  2KSR A;  3ZMZ B;  3KV4 A;  5FY1 A;  1W0B A;  4O4L E;  2X68 A;  4ZI7 E;  2HN2 A;  4GK0 E;  3P50 A;  3NKZ A;  5JDF A;  3SFE A;  3CK6 A;  2IUB A;  4ZS2 A;  4MAL A;  2YN6 A;  1UK5 A;  4HFH A;  4UVC B;  1ZP0 A;  2J4G A;  4QH4 A;  4YTP A;  4PAG A;  3HKE E;  3WAJ A;  4HKA A;  4ZI2 D;  4DUZ T;  4A56 A;  3I0O A;  3RC3 A;  1YXR A;  3C50 A;  4IE6 A;  4QWN B;  2W66 A;  5DQW A;  2XQ8 A;  2XHE B;  4XBF B;  3CIR A;  3ZJ1 A;  2K48 A;  3AE5 A;  1E2A A;  1MMD A;  4P09 A;  3N5L A;  3NRX A;  3AAI A;  2HPL A;  3VKG A;  2JMH A;  2Y48 B;  3MAC A;  2IML A;  3RYF E;  3JCF A;  2XAJ B;  3PJA J;  4NUU A;  2E5V A;  5FMN A;  4ZEY A;  3Q2M A;  3QB5 A;  4DR3 T;  1D0Z A;  3N9Q A;  3P4Q A;  2HPJ A;  4U7Y A;  4DBQ A;  3NBX X;  1X79 A;  4C90 A;  2M67 A;  4V1A v;  4AKI A;  2Y8D A;  1J1J A;  2X51 A;  1D1B A;  2E2A A;  3UUL A;  2LKG A;  4QH5 A;  2LSK A;  2KND A;  4IIJ E;  4JEU B;  4KUM B;  2V7K A;  3KBU A;  2EHO C;  4H9R C;  2YDS A;  5ADX L;  3EAM A;  1T8B A;  1T72 A;  3RIU C;  2FBW A;  3PUY F;  5BR8 T;  3ZCI A;  5TAO A;  4IRE A;  3PUW F;  3JC6 C;  2KXP B;  2XQA A;  5LA6 E;  4CI3 B;  5HEG A;  1SA0 E;  5L3E B;  1NEN A;  2CRB A;  2E8I A;  2YKS A;  5FXZ A;  2ACX A;  3UUB A;  5AQL B;  4L0R A;  4XAX B;  4A97 A;  2XM1 A;  1LKX A;  5JDQ A;  3VRA A;  4JEH B;  3PU8 A;  3AAA B;  4HFB A;  4IE5 A;  4U2Z A;  2M6I A;  2CXL A;  3RYC E;  3C64 A;  2LHN A;  3SFD A;  5AFU L;  2X9Y A;  3O1H A;  2MBG A;  2HH7 A;  3ANW A;  5KX5 E;  2IIU A;  4ZOL E;  5JVD E;  1I6Z A;  2HN1 A;  2WMN A;  5HYA A;  3ZT7 A;  2DWG A;  3KIN B;  4PJM A;  1HR0 T;  4U31 A;  5DJQ C;  3PV0 F;  5HWX A;  4DVD A;  3H3M A;  4DV3 T;  5HXE A;  3RKO A;  3CPZ A;  4HFI A;  3AEC A;  5LBQ B;  3CX6 B;  5AQV B;  4JI7 T;  3H3A A;  4KP3 C;  2CBI A;  2YU1 A;  2WAU A;  3ZPO A;  3B5M A;  3RH3 A;  2CHN A;  2FJB A;  1UUR A;  5FP3 A;  4UR9 A;  3PUX F;  2YK0 A;  2XPK A;  2W4X A;  4HEA A;  5JRC B;  4WNK A;  2XAS B;  2IAK A;  4ASK A;  3IF8 B;  3P4S A;  3ZYL A;  5AQF B;  3R6N A;  5CA0 E;  2UXN B;  3AA6 B;  5LG3 A;  4DV4 T;  2ZM2 A;  1N34 T;  2Q9Q C;  2BZB A;  4NUV A;  1BR1 A;  4TNV A;  3KFW X;  4N78 D;  3N9L A;  3RIU A;  5LBM A;  2WU2 A;  2QRX A;  2I0M A;  2YIN A;  4DR6 T;  3OJA A;  3AE8 A;  4IDZ A;  3ZMS B;  4KBM B;  3AA1 B;  3AB3 B;  3HA4 A;  1MMG A;  1W9R A;  2ODV A;  3M3Z B;  1HNW T;  3ZC0 A;  2VK9 A;  3F2E A;  2J62 A;  3MA9 A;  3EAB A;  4O4H E;  5C8Y E;  2CHO A;  5AQP B;  3N9M A;  1US7 B;  2CLY C;  4DMV A;  2NWB A;  3QC9 A;  3NZP A;  4IE0 A;  4F6R C;  5AQQ B;  4GYS A;  4G2A A;  2W61 A;  2YU2 A;  2WZH A;  4LF5 T;  2VQF T;  3UU4 A;  1FMV A;  3LFM A;  3ESL A;  3F31 A;  2KLQ A;  5L3C B;  3O9X A;  4WYV A;  2UUA T;  3AXJ A;  2DLR A;  2B76 A;  2OLT A;  3SS1 A;  4X20 E;  2V8S V;  2LSY A;  4EZH A;  5HAX A;  2KMF A;  4QXH B;  4J2C A;  1L0V A;  5ETW A;  2L9Q A;  4TV9 E;  2H88 A;  2YOE A;  4JI0 T;  1UGO A;  3B57 A;  2GK9 A;  5JQG E;  3P7I A;  1YW0 A;  4FJO A;  2NOX A;  2D9D A;  2KWH A;  2J1D G;  1M7K A;  4LFB T;  4QX7 B;  5FVL A;  5H6Q B;  4GKJ T;  3F57 A;  1UUS A;  3UUX B;  3J9X 1;  5CFB A;  3HKC E;  2VVS A;  3ZMV B;  3JAF A;  5LNK A;  2MPK A;  1W0A A;  2WS3 A;  1D1C A;  2VKJ A;  4Q25 A;  2ACZ A;  2EHO B;  2FJD A;  3EI0 A;  4TV8 E;  2LSI A;  3CML A;  4CI2 B;  1MND A;  5J1G A;  2XQ3 A;  4H9O C;  2BKN A;  4BAY B;  4LML A;  4UV8 B;  2BVL A;  4LMK A;  5AQJ B;  4CN1 A;  3CQG B;  3HR0 A;  4I0U A;  1HTJ F;  2LRL A;  3BQL A;  2WDV A;  3LSV A;  4I55 E;  2V5D A;  2WM9 A;  2DI4 A;  4O8S A;  3ZN0 B;  4DV0 T;  3GN5 B;  1IJ6 A;  4EED A;  1LRZ A;  5E0O A;  3P4W A;  2VL0 A;  3T1H T;  2V7M A;  2CXD A;  1NWM X;  3PUV F;  3CX8 B;  3D0T A;  2BG9 E;  2V6Y B;  2XQ7 A;  2LM2 A;  3OKQ A;  3ZC1 A;  4H9P C;  1VCT A;  2OA5 A;  3RF1 A;  4PK6 A;  2UU9 T;  3R84 B;  3BQK A;  5AQU B;  3FHN A;  2E9X C;  4DV2 T;  4DMW A;  2LKH A;  3RKG A;  3WI3 A;  2G0U A;  3C4X A;  3I9Y A;  5IUX A;  3TLW A;  1OED B;  2XAF B;  3K3O A;  1XNQ T;  3LK3 B;  3SWH A;  3NRY A;  4TWD A;  1S94 A;  1T98 A;  2VWA A;  2CPT A;  1S35 A;  2Z6E A;  5H6R B;  4QH1 A;  1XNR T;  3NVO A;  1WFD A;  3Q5E A;  4UF0 A;  5AQS B;  4CXX A;  4A5X A;  5JDN A;  4AKL A;  3N9N A;  5C2T A;  3DJB A;  4CI1 B;  2QGS A;  4DND A;  3KVB A;  4AQY T;  2RP4 A;  3PUR A;  3ZEF B;  3RIA A;  3N9O A;  5AQH B;  2H7O A;  5L4E A;  4PJL A;  2CA5 A;  2Q9Q B;  4ILU A;  1HFA A;  2KZ7 B;  3C4W A;  2XQ6 A;  2ZMA A;  1WR0 A;  4YHJ A;  2WZI A;  3LK4 2;  3KDS E;  4JUY A;  3AED A;  5M4Y A;  2N9D A;  3RQU A;  4AQG A;  1LVK A;  1JNZ A;  3QUJ A;  4TN7 B;  4EIW A;  2LJL A;  4JI5 T;  2QYW A;  4OK0 A;  4E7Z A;  2WB5 A;  1WLX A;  2R6G F;  3LBX A;  1Z8U A;  4MHC A;  4XZC A;  4YTN A;  3E22 E;  3JAE A;  2D5U A;  5FY7 A;  4PFP A;  3KV5 A;  3RRC A;  4YJ3 E;  2CLY B;  2UXX B;  2CE7 A;  5JDM A;  5J2U E;  2E9X A;  4QHO A;  1LVF A;  2BS2 A;  5F8P A;  5ABF A;  1I94 T;  4IT4 A;  1MIY A;  2CMR A;  2W2U A;  3MK7 C;  1YKH B;  4HWD A;  2C5J A;  1HX8 A;  2VAS A;  1HNZ T;  2JIW A;  3RI5 A;  4O2B E;  3A5X A;  5FVK A;  4X5T A;  2CM0 A;  4ZI3 D;  2EHO D;  5JR9 A;  2JJ9 A;  4EB6 E;  4IDQ A;  3AA0 B;  3JC6 D;  1M62 A;  4ISS A;  2HHH T;  3O1J A;  3ZSS A;  3FZH B;  4KMC A;  3BQI A;  5AQG B;  5LOV E;  3BK9 A;  5HWY A;  4U3C A;  5LGN B;  1U5P A;  5JRE A;  2DHR A;  1N36 T;  4IE7 A;  3ZT5 A;  4GKK T;  3C98 B;  5LMN T;  2RA1 A;  3IBP A;  1ZHC A;  4ERR A;  3UFG A;  3AE2 A;  1CHU A;  3AEG A;  3QB5 K;  4OFZ A;  2BG9 C;  2XZE A;  4IHJ E;  1IAP A;  4IL9 A;  4UXN B;  5CA1 E;  4X1K E;  3FZF B;  1OXZ A;  4GOU A;  3GA8 A;  5LGT B;  5AQK B;  2BKP A;  4TX5 A;  3DP7 A;  2MTQ A;  3IHR A;  1NAF A;  2LLY A;  3S4U A;  4E7S A;  4UVA B;  3GMI A;  3PUG A;  5HXR A;  3N9P A;  4TWF A;  1SUM B;  2W63 A;  4Z90 A;  1WRD A;  1HNX T;  4OHF A;  4C91 A;  3RYH E;  4MFR A;  3LK2 B;  2W62 A;  3PDY A;  5L3D B;  3FB2 A;  4QXC B;  4PJN A;  1SE7 A;  2CCQ A;  4TUY E;  2VL8 A;  1BR0 A;  4DR4 T;  3AA7 B;  3GWH A;  2WY2 A;  1YQ3 A;  5LJN A;  2X0Y A;  4PW8 A;  2NR4 A;  3IA3 A;  2XQ9 A;  4DO0 A;  1SHZ C;  3RX6 A;  2XSB A;  1HX1 B;  3AVR A;  1O3X A;  2VKH A;  5CJ5 A;  3VR9 A;  2Q9Q D;  4K0K T;  1DU2 A;  3Q5D A;  3E0Z A;  2MOZ A;  2DWK A;  5HCM A;  3AAE B;  3HKD E;  2XAG B;  3OYZ A;  5IHY A;  4HWC A;  2V7I A;  1W09 A;  1YKE B;  4JI8 T;  5LG4 A;  3FZM B;  5AQT B;  2ZM6 T;  3PUZ F;  4EZ4 A;  2XAH B;  4H9N C;  5A1L A;  4HFD A;  2IC6 A;  1N33 T;  2W00 A;  2V7J A;  4GYR A;  4QKN A;  3PUS A;  2V6X A;  2CEA A;  4OYJ A;  3ONL C;  4I4T E;  2XQ4 A;  4X64 T;  2BG9 A;  4YY3 T;  2VUR A;  1J5E T;  3UT5 E;  4UV9 B;  4YLH A;  4TWH A;  5L3B B;  2LOP A;  3TLT A;  4HTE A;  4ZZB A;  5JTG A;  3LG7 A;  3PUA A;  3UQ4 A;  3LJC A;  3ANW B;  3OBV E;  4YTM A;  4ILA A;  4H9Q C;  3LDQ B;  4AKG A;  2NW7 A;  3MXZ A;  3V5S A;  2LSG A;  5HCJ A;  2ZLY A;  1G8X A;  3ZCJ A;  5HXS A;  4X66 T;  4CQI A;  4BJN A;  5JDG A;  2ZM0 A;  5FY0 A;  2NW8 A;  3I0Q A;  4DR1 T;  3FXD B;  2KWI B;  3AE3 A;  4X62 T;  2P9B A;  4JI1 T;  2XJ7 A;  3AVS A;  1IBK T;  2XY8 B;  4HFC A;  3E08 A;  4UEM A;  2UXC T;  1V9D A;  4U74 A;  3L09 A;  4PK4 A;  4DV5 T;  3CQC B;  4DV7 T;  1KNP A;  1IJ5 A;  1VCS A;  4WBO A;  4AQF A;  2IC9 A;  3ABV A;  1WCR A;  5LHG B;  4X1Y E;  4LF9 T;  5JDH A;  4A98 A;  1NEK A;  3ZYM A;  2AE9 A;  4JBW F;  1XMO T;  3ZN1 B;  3TKL B;  4GIW A;  2D0U A;  4B3R T;  1QSD A;  4YFS A;  5HEJ A;  2PG8 A;  1E7P A;  3UFE A;  2LOS A;  4JI3 T;  3RIF A;  1KK7 A;  4LF8 T;  2WQY A;  5EK4 A;  4X1I E;  4P1N A;  4DUY T;  3OVU A;  4YXD A;  4PNI A;  1G73 A;  3I9W A;  2C5I T;  3EHZ A;  4ANJ A;  4COF A;  3U3I A;  4FI5 A;  2WDQ A;  5L3G B;  4IE4 A;  3AE4 A;  4PJJ A;  2WP9 A;  3OYX A;  1WYC A;  1KEY A;  1KFY A;  2X0L B;  2RPA A;  3ETV A;  1BR4 A;  2VKO A;  5AQR B;  4HWF A;  2M6B A;  3K8P C;  4OX9 T;  1OED E;  1E1H B;  4NPP A;  4AKR B;  3AXJ B;  2I6H A;  2A2F X;  3K3N A;  2LT3 A;  3A7M A;  4IGU A;  2LM9 A;  5JR9 C;  3Q5X A;  5L47 A;  5FNV E;  4EOZ B;  2VKD A;  3NWI A;  5LYJ E;  1KNR A;  2W0G A;  4P0B A;  3RPU A;  4JLE A;  5LHI B;  4JV5 T;  3RHW A;  2XSA A;  3JAD A;  2NW9 A;  1Y64 B;  3P4P A;  2UUC T;  4AXP A;  4I50 E;  3EUH A;  3ZT6 A;  2F4V T;  1CUN A;  3FXE B;  4DR7 T;  2D2S A;  3OPC A;  4P0A A;  4ZS3 A;  4H9S E;  3C4Z A; 
#chains in the Genus database with same CATH homology
 2DHR A;  3L3P A;  3RRW A;  2ODV A;  4IE7 A;  1ZV4 X;  2LEH A;  3C98 B;  4K0U A;  4UVB B;  2C5K T;  1OWA A;  2WWU A;  2RA1 A;  4PK5 A;  3IBP A;  1UCU A;  1ZHC A;  3ZC0 A;  4ERR A;  2K24 A;  2VK9 A;  4DBR A;  2N2N A;  3F2E A;  5L3F B;  3PE0 A;  3FBZ A;  3MA9 A;  5GON E;  3CVR A;  4HN9 A;  1MIV A;  4UIG A;  4O4H E;  5C8Y E;  5FXX A;  4OFZ A;  5JH7 E;  1QUU A;  1WYB A;  4ZI2 C;  3N9M A;  1US7 B;  3WAK A;  4L9I A;  2CLY C;  4DMV A;  1D0X A;  4IHJ E;  2NWB A;  1IAP A;  4WBN E;  3QC9 A;  4UXN B;  1D1A A;  3NZP A;  4X1K E;  3KV6 A;  2A72 A;  5CA1 E;  1OXZ A;  3QK6 A;  4IE0 A;  2PFV A;  4HE8 A;  5L2L A;  4F6R C;  4GOU A;  5LXT E;  3GA8 A;  4GYS A;  4G2A A;  2W61 A;  2XUE A;  5LGT B;  2YU2 A;  2BDE A;  2BVM A;  4B6X A;  4TX5 A;  5HXC A;  3DP7 A;  1HG2 A;  2MTQ A;  2X66 A;  3IHR A;  1NAF A;  1FMV A;  3LFM A;  3S4U A;  3ESL A;  4E7S A;  4UVA B;  3F31 A;  3M65 A;  2KLQ A;  3GMI A;  3PUG A;  3HL6 A;  3ETU A;  3V5U A;  5HXR A;  3N9P A;  5L3C B;  3O9X A;  3CQX C;  2ES0 A;  5FYM A;  2A3D A;  2W63 A;  1WRD A;  5JRC A;  3ZMU B;  4OHF A;  2DLR A;  4BJM A;  2ODU A;  4C91 A;  3RYH E;  3MJX A;  3EDU A;  3SS1 A;  4X20 E;  3H37 A;  2E9X D;  2LSY A;  3KBT A;  4MFR A;  4EZH A;  2N1G A;  3LK2 B;  5HAX A;  2KMF A;  2W62 A;  4QXH B;  3UUN A;  1ZKE A;  2H3R A;  3KV9 A;  3PDY A;  4J2C A;  3FB2 A;  5L3D B;  4QXC B;  5ETW A;  2L9Q A;  4PJN A;  4TV9 E;  3ZYK A;  5FXV A;  2L8K A;  3EDV A;  1ZEE A;  2CCQ A;  2MYS A;  2DCF A;  4TUY E;  1FMW A;  5LJM A;  2VL8 A;  3HKB E;  3B57 A;  3I1A A;  1BR0 A;  3AA7 B;  3VKH A;  2GK9 A;  3GWH A;  1MIW A;  5JQG E;  3N2G E;  3P7I A;  5LJN A;  4PW8 A;  3FBL A;  3ZMT B;  3RC8 A;  2I59 A;  5LHH B;  5LP6 E;  4OYK A;  3PUQ A;  2PBI A;  4MBQ A;  4DO0 A;  1SHZ C;  3RX6 A;  1B7T A;  3O4X E;  1YD8 G;  1YW0 A;  2B1E A;  3AVR A;  3MZK B;  3NZQ A;  2VKH A;  1O3X A;  4QXB B;  5DAB A;  4FJO A;  2NOX A;  3IEE A;  2Q9Q D;  2KWH A;  3K3Q C;  4CXW A;  1AJ3 A;  2J1D G;  4QX7 B;  3VHL A;  5H6Q B;  2JRK A;  4GK5 E;  3F57 A;  2JPF A;  2Y6X A;  4ZI3 C;  1FEW A;  3PU3 A;  3UUX B;  4EYY R;  3J9X 1;  3E0Z A;  2MOZ A;  3CWZ B;  4WW0 A;  3RYI E;  2KT9 A;  2DWK A;  3HKC E;  3U78 A;  3AAE B;  3HKD E;  2V7L A;  2XAG B;  2CXF A;  3Q5W A;  3J7Y q;  3ZMZ B;  3KV4 A;  3ZMV B;  3OYZ A;  5FY1 A;  5IHY A;  2D0T A;  4O4L E;  5LNK A;  2V7I A;  2X68 A;  4ZI7 E;  2WSS V;  4GK0 E;  4CXY A;  2LHR A;  1YKE B;  3UUM A;  5LG4 A;  1D1C A;  1HF8 A;  4O2A E;  2VKJ A;  4UF0 B;  5JDF A;  4ZS2 A;  4EZ4 A;  2EHO B;  4I43 B;  3O1I A;  4TV8 E;  2XAH B;  5JDL A;  2H7V C;  4H9N C;  4MAL A;  2LSI A;  3CML A;  5A1L A;  2IC6 A;  2W00 A;  4CI2 B;  1MND A;  2QA7 A;  5J1G A;  2V7J A;  4H9O C;  4GYR A;  4UVC B;  4QKN A;  2LE8 A;  3PUS A;  4BAY B;  4UV8 B;  2BVL A;  3CQG B;  4PAG A;  2X9X A;  2CEA A;  4OYJ A;  3HKE E;  3WAJ A;  4HKA A;  4I4T E;  3HR0 A;  2K9A A;  1HTJ F;  2DNX A;  4ZI2 D;  2CWY A;  4A56 A;  4H63 V;  4YJ2 E;  3BQL A;  3I0O A;  3RC3 A;  4IE6 A;  3C50 A;  2L3L A;  4I55 E;  4QWN B;  4U72 A;  5DQW A;  4L5G A;  1Z0P A;  2XHE B;  2WM9 A;  3CKD A;  1D0Y A;  3UT5 E;  4XBF B;  4UV9 B;  4YLH A;  2DI4 A;  4O8S A;  2JMK A;  4TZ4 C;  3ZN0 B;  4ADZ A;  3GN5 B;  1IJ6 A;  3ZJ1 A;  4ZHQ E;  1LRZ A;  5E0O A;  2K48 A;  5L3B B;  2LOP A;  2V7M A;  4P09 A;  1MMD A;  3N5L A;  2CXD A;  3B13 A;  3NRX A;  4HTE A;  3AAI A;  3W15 B;  2HPL A;  3VKG A;  2JMH A;  1NWM X;  3LG7 A;  3PUA A;  3CX8 B;  3D0T A;  5KMG P;  2Y48 B;  2ZM8 A;  3MAC A;  3LJC A;  3ANW B;  3OBV E;  2XQY A;  3RYF E;  3MKD A;  4H9Q C;  2XAJ B;  3OKQ A;  3ZC1 A;  4H9P C;  4NUU A;  1H7C A;  1KNZ A;  4BA9 A;  5KDM C;  4AKG A;  5FMN A;  2OA5 A;  1VRB A;  2NW7 A;  4PK6 A;  3MXZ A;  3Q2M A;  3V5S A;  2LSG A;  3LBX B;  1D0Z A;  3N9Q A;  2HPJ A;  2ZLY A;  1G8X A;  3ZCJ A;  3R84 B;  2X9H A;  3BQK A;  4DBQ A;  5HXS A;  3FHN A;  3NBX X;  2E9X C;  1X79 A;  5J2T E;  4C90 A;  2M67 A;  4V1A v;  4CQI A;  4DMW A;  4AKI A;  3WI3 A;  2Y8D A;  2G0U A;  2X51 A;  4BJN A;  5JDG A;  1D1B A;  2NTX A;  2SPC A;  3C4X A;  2ZM0 A;  3I9Y A;  5FY0 A;  2NW8 A;  3I0Q A;  3UUL A;  4EYU A;  2XAQ B;  2XAF B;  3K3O A;  3Q9D A;  3LK3 B;  3FXD B;  1FIO A;  2KWI B;  3SWH A;  2XTL A;  3NRY A;  1S94 A;  1T98 A;  2CWO A;  2VWA A;  4PFO A;  4UEL A;  2P9B A;  5BMV E;  1S35 A;  2LSK A;  2Z6E A;  2KND A;  4IIJ E;  4JEU B;  4EAH A;  3SOL A;  4KUM B;  2V7K A;  3KBU A;  3AVS A;  3SRZ A;  5H6R B;  1MMN A;  3E08 A;  2EHO C;  3UTK A;  4H9R C;  3ZLI A;  4UEM A;  5JRE A;  2E9X B;  5ADX L;  4O4J E;  4AI6 A;  3N2K E;  1IZN B;  1V9D A;  3EVY A;  3L09 A;  4U74 A;  4UF0 A;  4PK4 A;  3T8O A;  4AKH A;  2EHO A;  3CQC B;  4AQF C;  2IW5 B;  4CXX A;  5JDN A;  4AKL A;  1IJ5 A;  1HS7 A;  3ZCI A;  3N9N A;  5TAO A;  3DTO A;  3JC6 C;  2KXP B;  5F3J A;  1WR6 A;  5LA6 E;  4WBO A;  3DJB A;  2IC9 A;  4AQF A;  4CI3 B;  4CI1 B;  2QGS A;  4DND A;  1SA0 E;  5L3E B;  5FXZ A;  2E8I A;  4HFV A;  1BR2 A;  2YEV C;  2ACX A;  3KVB A;  4L0R A;  4XAX B;  5LHG B;  2JQQ A;  5JR9 B;  2RP4 A;  3PUR A;  3ZEF B;  1LKX A;  2WMO A;  3N9O A;  4X1Y E;  2H7O A;  5JDQ A;  4PJL A;  5JDH A;  4JEH B;  2CA5 A;  2Q9Q B;  4ILU A;  3ONX A;  3ZYM A;  3PU8 A;  2WBL A;  1HFA A;  3AAA B;  2KZ7 B;  4IE5 A;  3C4W A;  4IST A;  2ZMA A;  4YHJ A;  3ZN1 B;  3TKL B;  2CXL A;  5IYZ E;  3GN5 A;  3LK4 2;  3RYC E;  3C64 A;  2LHN A;  3KDS E;  4O4I E;  4GIW A;  3KVA A;  1MMA A;  4JUY A;  2D0U A;  5M4Y A;  2N9D A;  4AQG A;  1LVK A;  3QUJ A;  1QSD A;  4TN7 B;  4EIW A;  5AFU L;  4YFS A;  3VU7 H;  2LJL A;  3N2O A;  2X9Y A;  3O1H A;  2V1D B;  1HG5 A;  2MBG A;  2HH7 A;  3ZJ2 A;  3ANW A;  3CX7 B;  5KX5 E;  4ZOL E;  5JVD E;  2PG8 A;  5LCY A;  2X9W A;  4OK0 A;  4E7Z A;  2WMN A;  5HYA A;  4Z8X A;  4EXT A;  1WLX A;  3UFE A;  2LOS A;  2DWG A;  3KIN B;  4PJM A;  4G63 A;  1KK7 A;  5EK4 A;  3LBX A;  4X1I E;  4MHC A;  5DJQ C;  4XZC A;  5HWX A;  3C51 A;  4PNI A;  4DVD A;  3E22 E;  5HXE A;  2VB6 A;  3RKO A;  3CPZ A;  1G73 A;  5LBQ B;  3CX6 B;  2D5U A;  3I9W A;  5FY7 A;  2C5I T;  4ANJ A;  3H3A A;  4PFP A;  3U3I A;  4FI5 A;  3KV5 A;  5L3G B;  4IE4 A;  4KP3 C;  1VOM A;  4PJJ A;  2YU1 A;  1EZ3 A;  2WAU A;  3RRC A;  1UX5 A;  3ZPO A;  4YJ3 E;  3OYX A;  1WYC A;  2CLY B;  3RH3 A;  5LGU B;  2UXX B;  4QX8 B;  2K5B B;  2CE7 A;  2X0L B;  3ETV A;  1BR4 A;  1U4Q A;  4H63 H;  5EK2 A;  2LSJ A;  2VKO A;  5JDM A;  5FP3 A;  5J2U E;  2E9X A;  2YK0 A;  4QHO A;  3K8P C;  1LVF A;  5F8P A;  4HGA A;  5HXH A;  4HEA A;  1E1H B;  5JRC B;  4WNK A;  4AKR B;  2XAS B;  2IAK A;  1MIY A;  2CMR A;  3MK7 C;  4ASK A;  1YKH B;  3IF8 B;  2C5J A;  1HX8 A;  2A2F X;  2VAS A;  3K3N A;  2LT3 A;  4O2B E;  3ZYL A;  3A5X A;  4IGU A;  3R6N A;  2LM9 A;  5CA0 E;  5JR9 C;  2UXN B;  3AA6 B;  3Q5X A;  4MLK A;  2CM0 A;  5FNV E;  2ZM2 A;  2VKD A;  1HCI A;  2X67 A;  3PTR B;  4EOZ B;  5LYJ E;  2Q9Q C;  2EHO D;  2W0G A;  4P0B A;  4ZI3 D;  2KIN B;  2BZB A;  2NTY A;  4NUV A;  3RPU A;  4JLE A;  5JR9 A;  5LHI B;  1BR1 A;  5DQV A;  2JJ9 A;  3HI2 A;  3KFW X;  4N78 D;  3N9L A;  4EB6 E;  2Q9Q A;  4CZZ B;  3AA0 B;  5LBM A;  2NW9 A;  1Y64 B;  3P8C D;  2V26 A;  5FXW A;  1UX4 A;  4AXP A;  4I50 E;  3EUH A;  2YIN A;  2PJQ A;  3JC6 D;  5CB4 E;  4ISS A;  3OJA A;  4IDZ A;  3O1J A;  4M1P A;  2NP9 A;  3ZMS B;  1CUN A;  4KBM B;  2C0S A;  3AA1 B;  3AB3 B;  3HA4 A;  4KMC A;  1MMG A;  3BQI A;  3FXE B;  5EK3 A;  2D2S A;  4P0A A;  5LOV E;  1MNE A;  3BK9 A;  4ZS3 A;  5HWY A;  5LGN B;  4H9S E;  5EZY E;  1U5P A;  3C4Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...