2C5JA

N-terminal domain of tlg1, domain-swapped dimer
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
87
structure length
82
Chain Sequence
DPFQQVVKDTKEQLNRINNYITRHNTAEEEIQDILKDVEETIVDLDRSIIVMKRDENEDVSGREAQVKNIKQQLDALKLRFD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords T-SNARE AFFECTING A LATE GOLGI COMPARTMENT PROTEIN 1
publication title Structural Analysis of the Interaction between the Snare Tlg1 and Vps51.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein transport
total genus 39
structure length 82
sequence length 87
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-10-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.90 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2c5jA00
1LVFA 1Z0PA 1IJ5A 1QSDA 3CKDA 3MXZA 2X9XA 3S4UA 4DNDA 4CQIA 1LRZA 3CVRA 2KWIB 3QK6A 2X9YA 2C5KT 2C5JA 2KWHA 1IJ6A 4EYYR 3N5LA 2C5IT 2IC9A 2K48A 3FXDB 2G0UA 2MBGA 3P7IA 3TKLB 2XTLA 1ZKEA 4J2CA 2X9WA 1H7CA 3L3PA 2IC6A 3QUJA 4L0RA 3FXEB 4FI5A 4B6XA 2CA5A
chains in the Genus database with same CATH superfamily
5LP6E 4DV5T 1WYBA 3AEDA 2BDEA 3P4SA 2EHOD 3OYXA 3O9XA 4HWDA 2VKOA 2K48A 2YINA 4YTPA 2IUBA 3L3PA 3UQ4A 1E2AA 4JBWF 2BBJA 2L3LA 3IHRA 4ZI2D 3Q5XA 1KNZA 4GK0E 5HYAA 4I43B 2OA5A 3DTOA 3UU5A 4WYVA 3K3QC 4U2YA 4TWHA 2W0GA 3P4WA 4ZS3A 1OXZA 4IGUA 2IIUA 2LRKA 4JYAT 2BG9A 1WYCA 2E8IA 4HTEA 1W9RA 4LF9T 2V6XA 1KEYA 2KXPB 3BQIA 1IBLT 2LE8A 1HNZT 5EK4A 5JR9A 1ZOYA 4DR3T 4LFBT 2X66A 2NP9A 2ZLYA 4ZEYA 3JC6C 2WWUA 5L47A 3R84B 4TV9E 2X51A 1ZEEA 1SA0E 2LM2A 3IF8B 4AQYT 3UU6A 5JRCB 2BBHA 3AA7B 1VCSA 3UUNA 3MJXA 4U7IA 4NUVA 5FY7A 2D5UA 4GIWA 4GYRA 5LG4A 5CGMA 5DQVA 3ZC1A 3ZLIA 3UUMA 1L0VA 3HI2A 5J1GA 3VHLA 2UXBT 1WFDA 3ANWA 1XZYA 3SWHA 3RIAA 2H89A 5HAXA 1ZV4X 4IE6A 2JQKA 5IUXA 5IHYA 2I6HA 4IE7A 3RIUC 2XM1A 2WU2A 3C4ZA 3AAEB 5L2LA 3AA1B 1HF8A 1KFYA 1OEDC 2UUCT 2LHRA 4DV4T 3HKCE 1CHUA 1YKEB 1BR0A 5AQRB 4UV8B 4MFRA 3OBVE 4CN4A 2WB5A 4YXDA 4IHJE 3CX7B 2VVNA 5AQGB 2CWOA 5AQKB 2E5LT 2BKOA 3FZHB 2V7MA 4H9SE 2WWVA 1Y01A 3EABA 2V7IA 5EK2A 4AQGA 2ACXA 3ZN0B 4ZI2C 4QH5A 2W67A 1MIYA 4O8SA 4OYKA 4XAXB 1D1AA 5AQHB 2KT9A 2I59A 3EUHA 3A5XA 4IE5A 2WU5A 4U33A 2KMFA 2ZM0A 5IWAT 3JCFA 1IBKT 2VASA 4U3CA 3E08A 4YLHA 2UXXB 4F6RC 2WS3A 2UUAT 3UFGA 3BQKA 3AA6B 3N9OA 2YU1A 1ZKEA 1UX4A 5HWXA 3C4WA 3OJAA 2FJAA 4X65T 4ERRA 3TLUA 1Z0PA 4IE0A 2YDRA 2XY8B 4QH4A 4E7SA 2OV9A 3FBZA 1G8XA 4HE8A 4IL9A 4DV7T 2J62A 2IAKA 4UIGA 3OVUA 4YY3T 4WBOA 3AB3B 4HFVA 1SUMB 1MMDA 1GQEA 4UV9B 5LBMA 4ILAA 2M6IA 4JI8T 4PJNA 5JRCA 3AXJB 2V6YA 1S94A 4DR4T 2LLYA 4PK6A 3FXEB 5F5WA 2V26A 3RI5A 3CQCB 2Y48B 5FXXA 5LMNT 5FP3A 3GMIA 2WM9A 5FY0A 2HN1A 3O1JA 3AAIA 3CQXC 5FY1A 2P9BA 4XBFB 2LKHA 5FVKA 2DCFA 1U4QA 4O4IE 3RYCE 3W15B 4DMWA 2YN6A 4LMLA 3ZN1B 3PUYF 3FZLB 4PJMA 4TWFA 3UUXB 5J2UE 5AQOB 1HFAA 3OTOT 4UVAB 3TLSA 5JDFA 4HFBA 5C8YE 4DR7T 1I94T 3IBPA 4H63H 4QXHB 4DUZT 3LK3B 5AQSB 1IBMT 3AE3A 2NR4A 1WR6A 2H3RA 2VL0A 1WCRA 3T1HT 5AQFB 1NAFA 4KX6A 3JAEA 2WSSV 4YJ3E 3A8YC 4HFHA 5JDGA 3WAKA 3AEGA 4ANJA 3AECA 3OYZA 2LOSA 3ETUA 2NTYA 4YHHT 1XDPA 4HWFA 5H6QB 3SFEA 4LMJA 2IDOB 3RGLA 2BS4A 3LFMA 4MBQA 2KWHA 4EYUA 1E1HB 2G0UA 5FMNA 2L8KA 3RQUA 3PUGA 3GN5B 3L39A 2YEVC 2BG9C 5JDMA 3ZKRA 2VQFT 4JI5T 1FMVA 1MMNA 2AE9A 5JR9C 2XPKA 3AE4A 5JREA 4HFIA 3PUZF 1BR1A 3P7IA 2XTLA 2MOZA 3U78A 4AKLA 3RX6A 4X1IE 3T1YT 2V5CA 5L3DB 1X9BA 4BJNA 2KZ7B 1HCIA 2A72A 2MPKA 2W2UA 5EK3A 2FJDA 2Q9QC 2LM9A 5CFBA 3P8CD 2HHHT 4EB6E 3SFDA 5AQNB 3KFWX 2XQ3A 2WDQA 4H9NC 3UU4A 3AXJA 3EDUA 3N9LA 5LXTE 4P0AA 4ILCA 3NZQA 3DP7A 2I0MA 3NKZA 3QB5K 4KHPT 2E2AA 4H63V 3ZMZB 1WRDA 2MTQA 1ZHCA 5DQWA 3AE5A 3Q9DA 4TZ4C 4ZS2A 2V1DB 3Q5EA 3VKGA 4DR2T 3M65A 3UULA 5ADXL 4HKAA 2C5JA 4EIWA 4M1PA 3FZFB 4KI0F 2B1EA 4EOZB 1XDOA 4EZHA 3H3MA 1QLBA 3LBXB 4AKHA 5HXRA 4JI0T 4LFCT 1OWAA 3KV4A 2RA1A 3ZEFB 5HEHA 5HXCA 2WZIA 3RLFF 4AKRB 3NVOA 3LG7A 2CXDA 2CPTA 5ABFA 2VQET 2CMRA 4YSXA 4G2AA 4OHFA 1X79A 4J2CA 2KINB 2H7OA 4DUYT 3ZT7A 5JTGA 4UELA 2K9AA 5FL1A 2ACZA 4ZI3D 4YT0A 4NPPA 4B3RT 3VRBA 4JI3T 1IJ6A 3D0TA 3ZCJA 3RYIE 1CUNA 5FXVA 4ILUA 4H9RC 3F31A 3N2KE 1UURA 3AAAB 2K24A 2DNXA 2NWBA 4DR5T 3FBLA 4TNWA 3Q2MA 3GN5A 3RC8A 5CB4E 3PTRB 5L4HA 5F3JA 1M62A 4JEHB 4CI3B 1MNDA 2K5BB 2CM0A 4FI5A 2CEAA 2X68A 5LHGB 2XQ8A 2CHOA 3SOLA 2X9YA 4B3MT 5C3JA 4EGWA 3KVAA 3RYFE 2IW5B 5JDQA 3N2GE 3PUSA 3FZKB 1NEKA 2D9DA 2C0SA 1HTJF 3CIRA 3OKQA 4COFA 4UF0B 3LSVA 2PG8A 2VL8A 4KMCA 5LGNB 4O2AE 5BMVE 4AISA 3UTKA 5ETWA 3EVYA 4X62T 3MACA 2DHRA 5LA6E 3ABVA 4C91A 3GA8A 2ODVA 1W0BA 3P4QA 4U2ZA 3AEFA 3LBXA 1XMQT 3HA4A 1OEDB 2VK9A 3IEEA 3N9MA 4IT4A 1N34T 4A5XA 2R6GF 2EHOC 2XHEB 1NWMX 5HEGA 3QB5A 4PK4A 5J0ZA 2LSJA 5HEJA 5KXJA 4NXNT 5LNKA 1IJ5A 2NW9A 4GKJT 4ZI3C 1HX1B 4BA9A 1HNWT 2YK0A 4FJOA 1KF6A 2CCQA 2XSAA 3O1IA 4AI6A 2X9XA 2PJQA 4CN6A 4JI2T 2NW8A 4EEBA 4DV3T 1MIWA 4HFCA 3PUVF 2BS3A 4I4TE 4AQFC 4BJMA 3FB2A 2MBGA 1J5ET 2B76A 3PJAA 2BKPA 5HEOA 3KBUA 1T8BA 2WDVA 2FUPA 4LF6T 4DV2T 4JI6T 1Z8UA 4C90A 4NIQA 1AJ3A 2UXCT 2V8SV 3KVBA 1N33T 3HKDE 4DNDA 2V7LA 4WZXA 3B57A 3AEEA 5LGTB 4Z91A 1D0ZA 2W66A 5EZYE 3RPUA 4OFZA 4IDOA 3V5UA 4H9PC 4YSYA 1LKXA 4EAHA 2AXDS 4JEUB 3RRWA 4PJLA 4H9OC 2N1GA 1UX5A 4PJJA 4UF0A 4OX9T 2V7JA 1G73A 3UU8A 2W00A 5AQJB 4KHZF 3ZSSA 4E7ZA 2IC6A 2W61A 3C98B 4HFEA 2ZM2A 3I9YA 2V5DA 4AKGA 3F2EA 4IREA 4ILBA 4N78D 3CMLA 3LK42 1BR4A 4CZZB 3OPCA 3TLWA 5L3BB 2VKJA 2JRKA 5LJNA 4YTMA 5LCYA 5HCJA 4LFAT 3EI0A 4QH1A 3UU3A 3U3IA 2DI4A 3QNUA 3RKOA 3P4RA 4CQIA 4KBMB 5E0OA 2LRLA 4IDQA 1OEDA 4K0KT 3V5SA 4YTNA 4DO0A 1KNRA 1HS7A 3HL6A 1OEDE 3KV5A 2XQ5A 4JLEA 4DMVA 5CA0E 5TAOA 2X67A 4KP3C 2VKDA 3KINB 3F57A 4LF8T 2XQ4A 1W09A 3I0OA 3ZT6A 1W0AA 3UFEA 3AVRA 4X20E 3AE7A 2YKSA 1SHZC 3PUXF 4DVDA 3NBXX 2CLYC 1YQ3A 2LJLA 2PBIA 2X0HA 1US7B 4JI1T 5ABEA 2IC9A 3I0QA 3AEAA 4ASKA 4UR9A 2UU9T 4HEAA 2XJ7A 4PK5A 3PURA 2XAHB 3PDYA 2BVLA 3ETVA 2V7KA 4X64T 2LSGA 2M67A 1HG2A 2KNDA 2WP9A 4BAYB 1JNZA 2HH7A 2VWAA 2BG9B 2WY2A 3K3NA 2W4XA 2E9XB 2N2NA 5L4EA 3RIFA 3EAMA 5JR9B 2DLRA 4HN9A 5DJQC 3CX8B 3ONLC 4X66T 3C64A 3CWZB 1I6ZA 3L8RA 4HWHA 3RQWA 2F4VT 2XQ9A 2UXDT 3LJCA 2QYWA 3ONJA 3DJBA 2W63A 2Q9QB 3KDSE 1UUSA 2N9DA 4EXTA 1R8IA 5AQIB 4HFDA 2J1DG 4WBNE 2XZEA 3VKHA 2CHNA 4X1YE 4TV8E 3EHZA 5CA1E 2JMHA 3ZJ1A 1UCUA 3NRXA 5L3CB 2D2SA 4YFSA 3NRYA 3M3ZB 5A1LA 2CBIA 5FVLA 5CJ5A 3ZCIA 2PTFA 4B6XA 5HCMA 2XQYA 3ZPOA 4DIDB 3MK7C 2X9HA 2CBJA 3C4XA 3E22E 3VRAA 4IL4A 3B5MA 4U74A 4Z8XA 1SE7A 2BKNA 3L09A 3N9NA 4V1Av 3C50A 3CPZA 2HPLA 4A97A 4TWDA 5LGUB 1YKHB 3LK2B 3RKGA 3KBTA 1XNQT 4PFPA 2Z6EA 3KV6A 3K8PC 4GYSA 4QXCB 4X1KE 1HR0T 3ZMVB 4WNKA 1FEWA 2X0LB 3K1SA 5GONE 1J1JA 1WLXA 5L3FB 4IDZA 5JDLA 3PUQA 1N32T 4QWNB 4XZCA 4OYJA 4PNIA 3N9QA 2ZMAA 2QGSA 3QC9A 5KDMC 5LJMA 3SS1A 4I0UA 4QX8B 1YD8G 4QX7B 2WMOA 5AQVB 1D0XA 2BS2A 4ZI7E 3VR8A 1VOMA 1M7KA 2CA5A 3BK9A 2E9XA 4EV6A 2BG9E 3CX6B 4DV0T 3I1AA 5LG3A 3VU7H 1T72A 2NOXA 3G06A 2UXNB 2D0UA 2ODUA 2XASB 4IIJE 4DV6T 5FYMA 1VCTA 4AXPA 2WCAA 4YJ2E 4P1NA 3ZYLA 3X1DA 2CXLA 3CQGB 3ZT5A 3QK6A 4UVBB 2DL1A 2Q9QA 2RPAA 2V6YB 1KNPA 4ADZA 3B13A 3MZKB 1B7TA 3N2OA 5F8PA 1JNRA 1HG5A 2OLTA 3FZMB 1NENA 2XQ6A 2XAQB 3PU3A 2XAJB 2J47A 3HKBE 1IZNB 5DABA 3ZMSB 5HEUA 5H6RB 5HXSA 2A9UA 3QUJA 3H3AA 2LSYA 2FJEA 2VURA 4X5TA 4LF7T 4DV1T 1J5WA 2FBWA 1UK5A 3O1HA 2L9QA 2CE7A 3ZMTB 1FIOA 3N5LA 4CXXA 3AVSA 4Z90A 2HPJA 2KLQA 1D1BA 2H7VC 4JUYA 2X9WA 3PU8A 2YDQA 3ZYMA 2UUBT 2KWIB 1E7PA 4UEMA 2EHOB 4TN7B 4LF5T 2FJBA 4A98A 3EDVA 2VB6A 2SPCA 1S35A 4MLKA 3RC3A 4QHOA 5HWYA 3ZMUB 1D1CA 3BQLA 3QOFA 4YSZA 5LMUT 4DBQA 3AE9A 3A7MA 2RP4A 3UUBA 5IYZE 3AE1A 4QKNA 3ONXA 3K3OA 1BR2A 4LF4T 3CK6A 3R6NA 2XUEA 2DWGA 4IE4A 1QSDA 2LSIA 2YDSA 3PUWF 5FNVE 1LRZA 2KSRA 4L5GA 4H9QC 2C5IT 3RYHE 4AKIA 2LOPA 4O4HE 5ABHA 4U7YA 3SRZA 2JQQA 3Q5WA 1D0YA 4CI1B 3NZPA 4KUMB 1YXRA 3CVRA 4JI4T 3C51A 4ISSA 2J4GA 2Y6XA 1FJGT 5FKYA 4DR6T 4NUUA 1WR0A 2ES0A 4NXMT 3AEBA 4EEDA 2E9XD 3AE6A 2WDRA 4DR1T 4EZ4A 4HGAA 2WQYA 3S4UA 5LOVE 2D0TA 3PV0F 4O4LE 5L3GB 2HN2A 4G63A 4HWIB 2XAFB 2Y8DA 3ZYKA 3LDQB 4PFOA 3I9WA 1V9DA 3FXDB 1XWMA 2NTXA 4TNVA 5JQGE 3UQ7A 2CRBA 1XNRT 4ZZCA 5FL0A 4UXNB 5C2TA 3PE0A 5FXWA 3HR0A 2YU2A 2Q9QD 5L3EB 1T98A 3CKDA 3AA0B 1EZ3A 3ZJ2A 3ZSTA 4PAGA 2NW7A 4O4JE 2VVSA 4Q25A 3HKEE 4K0UA 3O4XE 3NWIA 4P0BA 2E5VA 3PUAA 4CN1A 4ZHQE 4YHJA 3RHWA 4ZZBA 3RH3A 3J9X1 3RIUA 4DBRA 5LBQB 4L9IA 3ZC0A 2XM2A 2JIWA 1T7SA 2QRXA 2A2FX 4A56A 4B3TT 2JQ9A 2XQ7A 3MXZA 2CWYA 1O3XA 3WAJA 5JDNA 3PJAJ 1YW0A 1KK7A 4EYYR 1VRBA 3RRCA 4ZXLA 2QVAA 4HWCA 3MKDA 2EHOA 4PW8A 3TLVA 2WZHA 1ZP0A 5AFUL 4IDNA 1MIVA 1U5PA 5LB7B 4L0RA 5JDHA 1HX8A 5LHHB 4CXWA 5ABFB 2CXFA 5J2TE 3AE8A 5BR8T 1IAPA 2C5KT 4I50E 5AQQB 2A3DA 2BVMA 2IMLA 4MALA 2MAWA 1MNEA 1XMOT 4CXYA 2CLYB 5FXZA 2DWKA 4ISTA 4LMKA 1FMWA 2LKGA 2W62A 4CI2B 5AQTB 3GWHA 4UVCB 3Q5DA 2MYSA 4AQFA 2X0YA 3MA9A 4OK0A 3TKLB 3VR9A 3ESLA 2WBLA 3KV9A 1H7CA 1LVFA 2LT3A 1LVKA 1MMAA 2E9XC 1HNXT 2ZM6T 4O2BE 5AQUB 4JV5T 3TLTA 5ABGA 3IA3A 4I55E 2QA7A 4F8HA 4U72A 3JADA 2YOEA 2JPFA 3FHNA 3RF1A 4IDPA 2XAGB 1YQ4A 2ZM8A 1MMGA 4GK5E 2H88A 2WMNA 3JC6D 5M4YA 2VKHA 2GK9A 4JI7T 4GOUA 3AE2A 2XSBA 5KX5E 1DU2A 5JVDE 2LSKA 4GKKT 2JJ9A 4WW0A 3ANWB 2JMKA 4ZOLE 2JQHA 2BZBA 1UGOA 4AIUA 3J7Yq 5AQLB 3UT5E 3E0ZA 3JAFA 2K3WA 5AQPB 2M6BA 3N9PA 2IHR1 4TX5A 5LHIB 3P50A 3H37A 5AQMB 3WI3A 2LHNA 2LEHA 4TUYE 4B3ST 1QUUA 4P09A 3T8OA 5LYJE 5KMGP 4U31A 2WAUA 5JH7E 1Y64B 5HXHA 4QXBB 5HXEA 2PFVA 3P4PA 2XQAA 4MHCA 1N36T
chains in the Genus database with same CATH topology
4H9PC 5LP6E 2LSYA 5JDMA 1LKXA 4EAHA 4JEUB 3RRWA 1FMVA 3O1HA 4PJLA 2L9QA 1WYBA 2BDEA 1MMNA 2CE7A 2EHOD 3ZMTB 4H9OC 2N1GA 3OYXA 3O9XA 1FIOA 1UX5A 4PJJA 3N5LA 5JR9C 4CXXA 3AVSA 2HPJA 4UF0A 5JREA 2VKOA 2KLQA 2K48A 2YINA 1BR1A 1G73A 1D1BA 2V7JA 2W00A 2H7VC 3P7IA 2XTLA 4JUYA 2X9WA 2MOZA 4E7ZA 3L3PA 3PU8A 2IC6A 3U78A 4AKLA 2W61A 3RX6A 3C98B 2L3LA 4X1IE 3IHRA 4ZI2D 3Q5XA 1KNZA 2ZM2A 5L3DB 4GK0E 5HYAA 3I9YA 4I43B 2OA5A 3DTOA 4BJNA 2KZ7B 4AKGA 1HCIA 3ZYMA 3F2EA 2KWIB 2A72A 5EK3A 2Q9QC 4N78D 2LM9A 3CMLA 3LK42 3K3QC 3P8CD 4UEMA 1BR4A 4CZZB 4EB6E 2EHOB 4TN7B 3KFWX 2W0GA 3EDVA 2VB6A 2SPCA 4ZS3A 5L3BB 4H9NC 2VKJA 1S35A 1OXZA 4MLKA 2JRKA 3EDUA 4IGUA 5LJNA 3RC3A 3N9LA 5LCYA 5LXTE 4P0AA 4QHOA 5HWYA 3NZQA 3DP7A 3ZMUB 1WYCA 2E8IA 3U3IA 4HTEA 1D1CA 2DI4A 3BQLA 3RKOA 4CQIA 4KBMB 5E0OA 4DBQA 2KXPB 3BQIA 2LE8A 3V5SA 4H63V 3ZMZB 1WRDA 5EK4A 5JR9A 4DO0A 2RP4A 2MTQA 1ZHCA 1HS7A 3HL6A 5IYZE 3KV5A 5DQWA 2X66A 2NP9A 4QKNA 3ONXA 3K3OA 1BR2A 4JLEA 4DMVA 3Q9DA 2ZLYA 5CA0E 4TZ4C 4ZS2A 3R6NA 2V1DB 5TAOA 3JC6C 2XUEA 2WWUA 2X67A 3R84B 4KP3C 2DWGA 1ZEEA 2VKDA 2X51A 3KINB 4IE4A 4TV9E 1SA0E 1QSDA 2LSIA 3VKGA 5FNVE 1LRZA 3F57A 3M65A 3UULA 5ADXL 3IF8B 4HKAA 4L5GA 2C5JA 4EIWA 5JRCB 4M1PA 3I0OA 3UFEA 2B1EA 2C5IT 3AA7B 4H9QC 3RYHE 3AVRA 4EOZB 4EZHA 4AKIA 2LOPA 4O4HE 3UUNA 4X20E 3MJXA 3LBXB 4AKHA 1SHZC 4NUVA 5FY7A 2D5UA 5HXRA 3SRZA 4GIWA 2JQQA 3Q5WA 4GYRA 5LG4A 4DVDA 5DQVA 3NBXX 2CLYC 2LJLA 1D0YA 2PBIA 3ZC1A 3ZLIA 4CI1B 1OWAA 3NZPA 4KUMB 3CVRA 3UUMA 3KV4A 2RA1A 3C51A 4ISSA 3ZEFB 3HI2A 1US7B 2Y6XA 5J1GA 3VHLA 5HXCA 2IC9A 4NUUA 3ANWA 2ES0A 3SWHA 5HAXA 1ZV4X 3I0QA 4ASKA 4IE6A 2E9XD 4AKRB 4HEAA 4EZ4A 3LG7A 4HGAA 5IHYA 2CXDA 4IE7A 3PURA 4PK5A 3S4UA 2XAHB 5LOVE 2D0TA 4O4LE 5L3GB 3C4ZA 3AAEB 3PDYA 2BVLA 3ETVA 2V7KA 5L2LA 4G63A 2CMRA 2XAFB 1HF8A 3AA1B 2Y8DA 2LSGA 2M67A 3ZYKA 1HG2A 2LHRA 2KNDA 4G2AA 4PFOA 3I9WA 4OHFA 1V9DA 4BAYB 3FXDB 2NTXA 5JQGE 3HKCE 1YKEB 2HH7A 2VWAA 1X79A 4J2CA 2KINB 3K3NA 1BR0A 2H7OA 4UXNB 4UELA 2K9AA 3PE0A 5FXWA 2E9XB 3HR0A 4UV8B 4MFRA 2N2NA 2YU2A 2Q9QD 5L3EB 1T98A 3CKDA 3OBVE 4ZI3D 3AA0B 1EZ3A 3ZJ2A 5JR9B 2DLRA 4HN9A 1IJ6A 3CX7B 4IHJE 3CX8B 3D0TA 2CWOA 4PAGA 2NW7A 5DJQC 3RYIE 3ZCJA 1CUNA 5FXVA 4ILUA 4O4JE 3C64A 2V7MA 3CWZB 4H9RC 3F31A 3HKEE 4H9SE 4K0UA 3N2KE 3O4XE 2V7IA 3AAAB 2K24A 4P0BA 2DNXA 3PUAA 2NWBA 4ZHQE 5EK2A 3LJCA 4YHJA 3FBLA 3Q2MA 3GN5A 3RC8A 5CB4E 4AQGA 2ACXA 3ZN0B 3RH3A 3PTRB 3DJBA 3J9X1 4ZI2C 2W63A 2Q9QB 3KDSE 4DBRA 1MIYA 4O8SA 5F3JA 5LBQB 2N9DA 4EXTA 4OYKA 4JEHB 4XAXB 1D1AA 4CI3B 1MNDA 2J1DG 4WBNE 2KT9A 4L9IA 2I59A 3EUHA 3ZC0A 3VKHA 2K5BB 4X1YE 3A5XA 4IE5A 4TV8E 2CM0A 2A2FX 4FI5A 4A56A 2KMFA 2ZM0A 2CEAA 5CA1E 2X68A 5LHGB 2JMHA 2VASA 3MXZA 2CWYA 1O3XA 3WAJA 3ZJ1A 1UCUA 5JDNA 3E08A 3NRXA 3SOLA 4YLHA 5L3CB 2D2SA 2X9YA 1YW0A 2UXXB 4YFSA 1KK7A 3NRYA 4EYYR 4F6RC 1VRBA 3RRCA 5A1LA 3MKDA 3BQKA 3AA6B 3N9OA 2EHOA 4PW8A 2YU1A 1ZKEA 3ZCIA 1UX4A 5HWXA 3KVAA 5AFUL 3RYFE 2IW5B 3C4WA 3OJAA 1MIVA 1U5PA 4L0RA 5JDQA 5JDHA 3N2GE 4B6XA 3PUSA 2XQYA 4ERRA 1HX8A 3ZPOA 1Z0PA 5LHHB 4CXWA 4IE0A 2C0SA 2CXFA 3MK7C 4E7SA 2X9HA 5J2TE 3FBZA 1G8XA 1HTJF 1IAPA 3C4XA 3OKQA 2C5KT 4UF0B 3E22E 2PG8A 2VL8A 4HE8A 4I50E 2A3DA 2BVMA 4U74A 4KMCA 4Z8XA 4MALA 5LGNB 1MNEA 3L09A 4O2AE 5BMVE 3N9NA 4V1Av 3C50A 2IAKA 4UIGA 4CXYA 2CLYB 3CPZA 3UTKA 2HPLA 5FXZA 4WBOA 2DWKA 4ISTA 5LGUB 5ETWA 3AB3B 1FMWA 1YKHB 4HFVA 3EVYA 2W62A 3LK2B 3MACA 2DHRA 5LA6E 3KBTA 1MMDA 4CI2B 4UV9B 5LBMA 3GWHA 4UVCB 4PFPA 4C91A 3GA8A 2ODVA 2MYSA 4PJNA 4AQFA 4OK0A 3MA9A 5JRCA 3TKLB 2Z6EA 3KV6A 3K8PC 1S94A 3ESLA 2WBLA 4GYSA 4PK6A 3FXEB 3KV9A 4QXCB 1H7CA 4X1KE 1LVFA 2V26A 2LT3A 1LVKA 1MMAA 3LBXA 2E9XC 3ZMVB 3HA4A 3CQCB 2Y48B 4WNKA 4O2BE 5FXXA 1FEWA 2VK9A 2X0LB 3IEEA 5GONE 1WLXA 3N9MA 4IDZA 5L3FB 4I55E 5FP3A 3PUQA 5JDLA 4QWNB 3GMIA 2WM9A 2QA7A 4XZCA 5FY0A 2EHOC 2XHEB 4U72A 1NWMX 3O1JA 4OYJA 3AAIA 3CQXC 2JPFA 4PK4A 4PNIA 5FY1A 2LSJA 2P9BA 4XBFB 3FHNA 3N9QA 2DCFA 5LNKA 1U4QA 1IJ5A 2ZMAA 2QGSA 4O4IE 2NW9A 3QC9A 5KDMC 3RYCE 3W15B 4DMWA 5LJMA 3SS1A 2XAGB 3ZN1B 4QX8B 2ZM8A 4ZI3C 1MMGA 1YD8G 4GK5E 4QX7B 2WMNA 4BA9A 2YK0A 2WMOA 4PJMA 4FJOA 1D0XA 3JC6D 2CCQA 5M4YA 2VKHA 4ZI7E 1VOMA 2GK9A 3UUXB 2CA5A 3BK9A 5J2UE 1HFAA 4UVAB 3O1IA 4GOUA 4AI6A 2E9XA 2X9XA 2PJQA 3CX6B 5KX5E 5JVDE 5JDFA 2LSKA 2NW8A 3I1AA 2JJ9A 4WW0A 5C8YE 3VU7H 3ANWB 1MIWA 3IBPA 2NOXA 4H63H 4I4TE 4QXHB 4AQFC 2UXNB 3FB2A 4BJMA 2D0UA 2MBGA 2ODUA 2JMKA 2XASB 4IIJE 3LK3B 4ZOLE 2BZBA 5FYMA 3J7Yq 3UT5E 3E0ZA 4AXPA 4YJ2E 1WR6A 2H3RA 3ZYLA 2CXLA 3KBUA 3CQGB 3QK6A 4UVBB 2Q9QA 1NAFA 3N9PA 4ADZA 2WSSV 4YJ3E 4C90A 4TX5A 5JDGA 5LHIB 3WAKA 3B13A 4ANJA 3H37A 3MZKB 1AJ3A 3WI3A 3OYZA 2LOSA 3ETUA 2NTYA 1B7TA 3N2OA 5F8PA 2LHNA 3KVBA 2LEHA 4TUYE 1HG5A 3HKDE 1QUUA 5H6QB 2V7LA 4P09A 3T8OA 4DNDA 5LYJE 5KMGP 3B57A 2XAQB 2WAUA 3LFMA 4MBQA 5LGTB 2KWHA 4EYUA 3PU3A 5JH7E 2XAJB 1Y64B 1D0ZA 3HKBE 1IZNB 5HXHA 1E1HB 4QXBB 5HXEA 5DABA 2G0UA 2PFVA 3ZMSB 5FMNA 2L8KA 5EZYE 5H6RB 3RPUA 5HXSA 4OFZA 4MHCA 3QUJA 3PUGA 3V5UA 3GN5B 3H3AA 2YEVC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LVF A;  1Z0P A;  1IJ5 A;  1QSD A;  3CKD A;  3MXZ A;  2X9X A;  3S4U A;  4DND A;  4CQI A;  1LRZ A;  3CVR A;  2KWI B;  3QK6 A;  2X9Y A;  2C5K T;  2C5J A;  2KWH A;  1IJ6 A;  4EYY R;  3N5L A;  2C5I T;  2IC9 A;  2K48 A;  3FXD B;  2G0U A;  2MBG A;  3P7I A;  3TKL B;  2XTL A;  1ZKE A;  4J2C A;  2X9W A;  1H7C A;  3L3P A;  2IC6 A;  3QUJ A;  4L0R A;  3FXE B;  4FI5 A;  4B6X A;  2CA5 A; 
#chains in the Genus database with same CATH topology
 5LP6 E;  4DV5 T;  1WYB A;  3AED A;  2BDE A;  3P4S A;  2EHO D;  3OYX A;  3O9X A;  4HWD A;  2VKO A;  2K48 A;  2YIN A;  4YTP A;  2IUB A;  3L3P A;  3UQ4 A;  1E2A A;  4JBW F;  2BBJ A;  2L3L A;  3IHR A;  4ZI2 D;  3Q5X A;  1KNZ A;  4GK0 E;  5HYA A;  4I43 B;  2OA5 A;  3DTO A;  3UU5 A;  4WYV A;  3K3Q C;  4U2Y A;  4TWH A;  2W0G A;  3P4W A;  4ZS3 A;  1OXZ A;  4IGU A;  2IIU A;  2LRK A;  4JYA T;  2BG9 A;  1WYC A;  2E8I A;  4HTE A;  1W9R A;  4LF9 T;  2V6X A;  1KEY A;  2KXP B;  3BQI A;  1IBL T;  2LE8 A;  1HNZ T;  5EK4 A;  5JR9 A;  1ZOY A;  4DR3 T;  4LFB T;  2X66 A;  2NP9 A;  2ZLY A;  4ZEY A;  3JC6 C;  2WWU A;  5L47 A;  3R84 B;  4TV9 E;  2X51 A;  1ZEE A;  1SA0 E;  2LM2 A;  3IF8 B;  4AQY T;  3UU6 A;  5JRC B;  2BBH A;  3AA7 B;  1VCS A;  3UUN A;  3MJX A;  4U7I A;  4NUV A;  5FY7 A;  2D5U A;  4GIW A;  4GYR A;  5LG4 A;  5CGM A;  5DQV A;  3ZC1 A;  3ZLI A;  3UUM A;  1L0V A;  3HI2 A;  5J1G A;  3VHL A;  2UXB T;  1WFD A;  3ANW A;  1XZY A;  3SWH A;  3RIA A;  2H89 A;  5HAX A;  1ZV4 X;  4IE6 A;  2JQK A;  5IUX A;  5IHY A;  2I6H A;  4IE7 A;  3RIU C;  2XM1 A;  2WU2 A;  3C4Z A;  3AAE B;  5L2L A;  3AA1 B;  1HF8 A;  1KFY A;  1OED C;  2UUC T;  2LHR A;  4DV4 T;  3HKC E;  1CHU A;  1YKE B;  1BR0 A;  5AQR B;  4UV8 B;  4MFR A;  3OBV E;  4CN4 A;  2WB5 A;  4YXD A;  4IHJ E;  3CX7 B;  2VVN A;  5AQG B;  2CWO A;  5AQK B;  2E5L T;  2BKO A;  3FZH B;  2V7M A;  4H9S E;  2WWV A;  1Y01 A;  3EAB A;  2V7I A;  5EK2 A;  4AQG A;  2ACX A;  3ZN0 B;  4ZI2 C;  4QH5 A;  2W67 A;  1MIY A;  4O8S A;  4OYK A;  4XAX B;  1D1A A;  5AQH B;  2KT9 A;  2I59 A;  3EUH A;  3A5X A;  4IE5 A;  2WU5 A;  4U33 A;  2KMF A;  2ZM0 A;  5IWA T;  3JCF A;  1IBK T;  2VAS A;  4U3C A;  3E08 A;  4YLH A;  2UXX B;  4F6R C;  2WS3 A;  2UUA T;  3UFG A;  3BQK A;  3AA6 B;  3N9O A;  2YU1 A;  1ZKE A;  1UX4 A;  5HWX A;  3C4W A;  3OJA A;  2FJA A;  4X65 T;  4ERR A;  3TLU A;  1Z0P A;  4IE0 A;  2YDR A;  2XY8 B;  4QH4 A;  4E7S A;  2OV9 A;  3FBZ A;  1G8X A;  4HE8 A;  4IL9 A;  4DV7 T;  2J62 A;  2IAK A;  4UIG A;  3OVU A;  4YY3 T;  4WBO A;  3AB3 B;  4HFV A;  1SUM B;  1MMD A;  1GQE A;  4UV9 B;  5LBM A;  4ILA A;  2M6I A;  4JI8 T;  4PJN A;  5JRC A;  3AXJ B;  2V6Y A;  1S94 A;  4DR4 T;  2LLY A;  4PK6 A;  3FXE B;  5F5W A;  2V26 A;  3RI5 A;  3CQC B;  2Y48 B;  5FXX A;  5LMN T;  5FP3 A;  3GMI A;  2WM9 A;  5FY0 A;  2HN1 A;  3O1J A;  3AAI A;  3CQX C;  5FY1 A;  2P9B A;  4XBF B;  2LKH A;  5FVK A;  2DCF A;  1U4Q A;  4O4I E;  3RYC E;  3W15 B;  4DMW A;  2YN6 A;  4LML A;  3ZN1 B;  3PUY F;  3FZL B;  4PJM A;  4TWF A;  3UUX B;  5J2U E;  5AQO B;  1HFA A;  3OTO T;  4UVA B;  3TLS A;  5JDF A;  4HFB A;  5C8Y E;  4DR7 T;  1I94 T;  3IBP A;  4H63 H;  4QXH B;  4DUZ T;  3LK3 B;  5AQS B;  1IBM T;  3AE3 A;  2NR4 A;  1WR6 A;  2H3R A;  2VL0 A;  1WCR A;  3T1H T;  5AQF B;  1NAF A;  4KX6 A;  3JAE A;  2WSS V;  4YJ3 E;  3A8Y C;  4HFH A;  5JDG A;  3WAK A;  3AEG A;  4ANJ A;  3AEC A;  3OYZ A;  2LOS A;  3ETU A;  2NTY A;  4YHH T;  1XDP A;  4HWF A;  5H6Q B;  3SFE A;  4LMJ A;  2IDO B;  3RGL A;  2BS4 A;  3LFM A;  4MBQ A;  2KWH A;  4EYU A;  1E1H B;  2G0U A;  5FMN A;  2L8K A;  3RQU A;  3PUG A;  3GN5 B;  3L39 A;  2YEV C;  2BG9 C;  5JDM A;  3ZKR A;  2VQF T;  4JI5 T;  1FMV A;  1MMN A;  2AE9 A;  5JR9 C;  2XPK A;  3AE4 A;  5JRE A;  4HFI A;  3PUZ F;  1BR1 A;  3P7I A;  2XTL A;  2MOZ A;  3U78 A;  4AKL A;  3RX6 A;  4X1I E;  3T1Y T;  2V5C A;  5L3D B;  1X9B A;  4BJN A;  2KZ7 B;  1HCI A;  2A72 A;  2MPK A;  2W2U A;  5EK3 A;  2FJD A;  2Q9Q C;  2LM9 A;  5CFB A;  3P8C D;  2HHH T;  4EB6 E;  3SFD A;  5AQN B;  3KFW X;  2XQ3 A;  2WDQ A;  4H9N C;  3UU4 A;  3AXJ A;  3EDU A;  3N9L A;  5LXT E;  4P0A A;  4ILC A;  3NZQ A;  3DP7 A;  2I0M A;  3NKZ A;  3QB5 K;  4KHP T;  2E2A A;  4H63 V;  3ZMZ B;  1WRD A;  2MTQ A;  1ZHC A;  5DQW A;  3AE5 A;  3Q9D A;  4TZ4 C;  4ZS2 A;  2V1D B;  3Q5E A;  3VKG A;  4DR2 T;  3M65 A;  3UUL A;  5ADX L;  4HKA A;  2C5J A;  4EIW A;  4M1P A;  3FZF B;  4KI0 F;  2B1E A;  4EOZ B;  1XDO A;  4EZH A;  3H3M A;  1QLB A;  3LBX B;  4AKH A;  5HXR A;  4JI0 T;  4LFC T;  1OWA A;  3KV4 A;  2RA1 A;  3ZEF B;  5HEH A;  5HXC A;  2WZI A;  3RLF F;  4AKR B;  3NVO A;  3LG7 A;  2CXD A;  2CPT A;  5ABF A;  2VQE T;  2CMR A;  4YSX A;  4G2A A;  4OHF A;  1X79 A;  4J2C A;  2KIN B;  2H7O A;  4DUY T;  3ZT7 A;  5JTG A;  4UEL A;  2K9A A;  5FL1 A;  2ACZ A;  4ZI3 D;  4YT0 A;  4NPP A;  4B3R T;  3VRB A;  4JI3 T;  1IJ6 A;  3D0T A;  3ZCJ A;  3RYI E;  1CUN A;  5FXV A;  4ILU A;  4H9R C;  3F31 A;  3N2K E;  1UUR A;  3AAA B;  2K24 A;  2DNX A;  2NWB A;  4DR5 T;  3FBL A;  4TNW A;  3Q2M A;  3GN5 A;  3RC8 A;  5CB4 E;  3PTR B;  5L4H A;  5F3J A;  1M62 A;  4JEH B;  4CI3 B;  1MND A;  2K5B B;  2CM0 A;  4FI5 A;  2CEA A;  2X68 A;  5LHG B;  2XQ8 A;  2CHO A;  3SOL A;  2X9Y A;  4B3M T;  5C3J A;  4EGW A;  3KVA A;  3RYF E;  2IW5 B;  5JDQ A;  3N2G E;  3PUS A;  3FZK B;  1NEK A;  2D9D A;  2C0S A;  1HTJ F;  3CIR A;  3OKQ A;  4COF A;  4UF0 B;  3LSV A;  2PG8 A;  2VL8 A;  4KMC A;  5LGN B;  4O2A E;  5BMV E;  4AIS A;  3UTK A;  5ETW A;  3EVY A;  4X62 T;  3MAC A;  2DHR A;  5LA6 E;  3ABV A;  4C91 A;  3GA8 A;  2ODV A;  1W0B A;  3P4Q A;  4U2Z A;  3AEF A;  3LBX A;  1XMQ T;  3HA4 A;  1OED B;  2VK9 A;  3IEE A;  3N9M A;  4IT4 A;  1N34 T;  4A5X A;  2R6G F;  2EHO C;  2XHE B;  1NWM X;  5HEG A;  3QB5 A;  4PK4 A;  5J0Z A;  2LSJ A;  5HEJ A;  5KXJ A;  4NXN T;  5LNK A;  1IJ5 A;  2NW9 A;  4GKJ T;  4ZI3 C;  1HX1 B;  4BA9 A;  1HNW T;  2YK0 A;  4FJO A;  1KF6 A;  2CCQ A;  2XSA A;  3O1I A;  4AI6 A;  2X9X A;  2PJQ A;  4CN6 A;  4JI2 T;  2NW8 A;  4EEB A;  4DV3 T;  1MIW A;  4HFC A;  3PUV F;  2BS3 A;  4I4T E;  4AQF C;  4BJM A;  3FB2 A;  2MBG A;  1J5E T;  2B76 A;  3PJA A;  2BKP A;  5HEO A;  3KBU A;  1T8B A;  2WDV A;  2FUP A;  4LF6 T;  4DV2 T;  4JI6 T;  1Z8U A;  4C90 A;  4NIQ A;  1AJ3 A;  2UXC T;  2V8S V;  3KVB A;  1N33 T;  3HKD E;  4DND A;  2V7L A;  4WZX A;  3B57 A;  3AEE A;  5LGT B;  4Z91 A;  1D0Z A;  2W66 A;  5EZY E;  3RPU A;  4OFZ A;  4IDO A;  3V5U A;  4H9P C;  4YSY A;  1LKX A;  4EAH A;  2AXD S;  4JEU B;  3RRW A;  4PJL A;  4H9O C;  2N1G A;  1UX5 A;  4PJJ A;  4UF0 A;  4OX9 T;  2V7J A;  1G73 A;  3UU8 A;  2W00 A;  5AQJ B;  4KHZ F;  3ZSS A;  4E7Z A;  2IC6 A;  2W61 A;  3C98 B;  4HFE A;  2ZM2 A;  3I9Y A;  2V5D A;  4AKG A;  3F2E A;  4IRE A;  4ILB A;  4N78 D;  3CML A;  3LK4 2;  1BR4 A;  4CZZ B;  3OPC A;  3TLW A;  5L3B B;  2VKJ A;  2JRK A;  5LJN A;  4YTM A;  5LCY A;  5HCJ A;  4LFA T;  3EI0 A;  4QH1 A;  3UU3 A;  3U3I A;  2DI4 A;  3QNU A;  3RKO A;  3P4R A;  4CQI A;  4KBM B;  5E0O A;  2LRL A;  4IDQ A;  1OED A;  4K0K T;  3V5S A;  4YTN A;  4DO0 A;  1KNR A;  1HS7 A;  3HL6 A;  1OED E;  3KV5 A;  2XQ5 A;  4JLE A;  4DMV A;  5CA0 E;  5TAO A;  2X67 A;  4KP3 C;  2VKD A;  3KIN B;  3F57 A;  4LF8 T;  2XQ4 A;  1W09 A;  3I0O A;  3ZT6 A;  1W0A A;  3UFE A;  3AVR A;  4X20 E;  3AE7 A;  2YKS A;  1SHZ C;  3PUX F;  4DVD A;  3NBX X;  2CLY C;  1YQ3 A;  2LJL A;  2PBI A;  2X0H A;  1US7 B;  4JI1 T;  5ABE A;  2IC9 A;  3I0Q A;  3AEA A;  4ASK A;  4UR9 A;  2UU9 T;  4HEA A;  2XJ7 A;  4PK5 A;  3PUR A;  2XAH B;  3PDY A;  2BVL A;  3ETV A;  2V7K A;  4X64 T;  2LSG A;  2M67 A;  1HG2 A;  2KND A;  2WP9 A;  4BAY B;  1JNZ A;  2HH7 A;  2VWA A;  2BG9 B;  2WY2 A;  3K3N A;  2W4X A;  2E9X B;  2N2N A;  5L4E A;  3RIF A;  3EAM A;  5JR9 B;  2DLR A;  4HN9 A;  5DJQ C;  3CX8 B;  3ONL C;  4X66 T;  3C64 A;  3CWZ B;  1I6Z A;  3L8R A;  4HWH A;  3RQW A;  2F4V T;  2XQ9 A;  2UXD T;  3LJC A;  2QYW A;  3ONJ A;  3DJB A;  2W63 A;  2Q9Q B;  3KDS E;  1UUS A;  2N9D A;  4EXT A;  1R8I A;  5AQI B;  4HFD A;  2J1D G;  4WBN E;  2XZE A;  3VKH A;  2CHN A;  4X1Y E;  4TV8 E;  3EHZ A;  5CA1 E;  2JMH A;  3ZJ1 A;  1UCU A;  3NRX A;  5L3C B;  2D2S A;  4YFS A;  3NRY A;  3M3Z B;  5A1L A;  2CBI A;  5FVL A;  5CJ5 A;  3ZCI A;  2PTF A;  4B6X A;  5HCM A;  2XQY A;  3ZPO A;  4DID B;  3MK7 C;  2X9H A;  2CBJ A;  3C4X A;  3E22 E;  3VRA A;  4IL4 A;  3B5M A;  4U74 A;  4Z8X A;  1SE7 A;  2BKN A;  3L09 A;  3N9N A;  4V1A v;  3C50 A;  3CPZ A;  2HPL A;  4A97 A;  4TWD A;  5LGU B;  1YKH B;  3LK2 B;  3RKG A;  3KBT A;  1XNQ T;  4PFP A;  2Z6E A;  3KV6 A;  3K8P C;  4GYS A;  4QXC B;  4X1K E;  1HR0 T;  3ZMV B;  4WNK A;  1FEW A;  2X0L B;  3K1S A;  5GON E;  1J1J A;  1WLX A;  5L3F B;  4IDZ A;  5JDL A;  3PUQ A;  1N32 T;  4QWN B;  4XZC A;  4OYJ A;  4PNI A;  3N9Q A;  2ZMA A;  2QGS A;  3QC9 A;  5KDM C;  5LJM A;  3SS1 A;  4I0U A;  4QX8 B;  1YD8 G;  4QX7 B;  2WMO A;  5AQV B;  1D0X A;  2BS2 A;  4ZI7 E;  3VR8 A;  1VOM A;  1M7K A;  2CA5 A;  3BK9 A;  2E9X A;  4EV6 A;  2BG9 E;  3CX6 B;  4DV0 T;  3I1A A;  5LG3 A;  3VU7 H;  1T72 A;  2NOX A;  3G06 A;  2UXN B;  2D0U A;  2ODU A;  2XAS B;  4IIJ E;  4DV6 T;  5FYM A;  1VCT A;  4AXP A;  2WCA A;  4YJ2 E;  4P1N A;  3ZYL A;  3X1D A;  2CXL A;  3CQG B;  3ZT5 A;  3QK6 A;  4UVB B;  2DL1 A;  2Q9Q A;  2RPA A;  2V6Y B;  1KNP A;  4ADZ A;  3B13 A;  3MZK B;  1B7T A;  3N2O A;  5F8P A;  1JNR A;  1HG5 A;  2OLT A;  3FZM B;  1NEN A;  2XQ6 A;  2XAQ B;  3PU3 A;  2XAJ B;  2J47 A;  3HKB E;  1IZN B;  5DAB A;  3ZMS B;  5HEU A;  5H6R B;  5HXS A;  2A9U A;  3QUJ A;  3H3A A;  2LSY A;  2FJE A;  2VUR A;  4X5T A;  4LF7 T;  4DV1 T;  1J5W A;  2FBW A;  1UK5 A;  3O1H A;  2L9Q A;  2CE7 A;  3ZMT B;  1FIO A;  3N5L A;  4CXX A;  3AVS A;  4Z90 A;  2HPJ A;  2KLQ A;  1D1B A;  2H7V C;  4JUY A;  2X9W A;  3PU8 A;  2YDQ A;  3ZYM A;  2UUB T;  2KWI B;  1E7P A;  4UEM A;  2EHO B;  4TN7 B;  4LF5 T;  2FJB A;  4A98 A;  3EDV A;  2VB6 A;  2SPC A;  1S35 A;  4MLK A;  3RC3 A;  4QHO A;  5HWY A;  3ZMU B;  1D1C A;  3BQL A;  3QOF A;  4YSZ A;  5LMU T;  4DBQ A;  3AE9 A;  3A7M A;  2RP4 A;  3UUB A;  5IYZ E;  3AE1 A;  4QKN A;  3ONX A;  3K3O A;  1BR2 A;  4LF4 T;  3CK6 A;  3R6N A;  2XUE A;  2DWG A;  4IE4 A;  1QSD A;  2LSI A;  2YDS A;  3PUW F;  5FNV E;  1LRZ A;  2KSR A;  4L5G A;  4H9Q C;  2C5I T;  3RYH E;  4AKI A;  2LOP A;  4O4H E;  5ABH A;  4U7Y A;  3SRZ A;  2JQQ A;  3Q5W A;  1D0Y A;  4CI1 B;  3NZP A;  4KUM B;  1YXR A;  3CVR A;  4JI4 T;  3C51 A;  4ISS A;  2J4G A;  2Y6X A;  1FJG T;  5FKY A;  4DR6 T;  4NUU A;  1WR0 A;  2ES0 A;  4NXM T;  3AEB A;  4EED A;  2E9X D;  3AE6 A;  2WDR A;  4DR1 T;  4EZ4 A;  4HGA A;  2WQY A;  3S4U A;  5LOV E;  2D0T A;  3PV0 F;  4O4L E;  5L3G B;  2HN2 A;  4G63 A;  4HWI B;  2XAF B;  2Y8D A;  3ZYK A;  3LDQ B;  4PFO A;  3I9W A;  1V9D A;  3FXD B;  1XWM A;  2NTX A;  4TNV A;  5JQG E;  3UQ7 A;  2CRB A;  1XNR T;  4ZZC A;  5FL0 A;  4UXN B;  5C2T A;  3PE0 A;  5FXW A;  3HR0 A;  2YU2 A;  2Q9Q D;  5L3E B;  1T98 A;  3CKD A;  3AA0 B;  1EZ3 A;  3ZJ2 A;  3ZST A;  4PAG A;  2NW7 A;  4O4J E;  2VVS A;  4Q25 A;  3HKE E;  4K0U A;  3O4X E;  3NWI A;  4P0B A;  2E5V A;  3PUA A;  4CN1 A;  4ZHQ E;  4YHJ A;  3RHW A;  4ZZB A;  3RH3 A;  3J9X 1;  3RIU A;  4DBR A;  5LBQ B;  4L9I A;  3ZC0 A;  2XM2 A;  2JIW A;  1T7S A;  2QRX A;  2A2F X;  4A56 A;  4B3T T;  2JQ9 A;  2XQ7 A;  3MXZ A;  2CWY A;  1O3X A;  3WAJ A;  5JDN A;  3PJA J;  1YW0 A;  1KK7 A;  4EYY R;  1VRB A;  3RRC A;  4ZXL A;  2QVA A;  4HWC A;  3MKD A;  2EHO A;  4PW8 A;  3TLV A;  2WZH A;  1ZP0 A;  5AFU L;  4IDN A;  1MIV A;  1U5P A;  5LB7 B;  4L0R A;  5JDH A;  1HX8 A;  5LHH B;  4CXW A;  5ABF B;  2CXF A;  5J2T E;  3AE8 A;  5BR8 T;  1IAP A;  2C5K T;  4I50 E;  5AQQ B;  2A3D A;  2BVM A;  2IML A;  4MAL A;  2MAW A;  1MNE A;  1XMO T;  4CXY A;  2CLY B;  5FXZ A;  2DWK A;  4IST A;  4LMK A;  1FMW A;  2LKG A;  2W62 A;  4CI2 B;  5AQT B;  3GWH A;  4UVC B;  3Q5D A;  2MYS A;  4AQF A;  2X0Y A;  3MA9 A;  4OK0 A;  3TKL B;  3VR9 A;  3ESL A;  2WBL A;  3KV9 A;  1H7C A;  1LVF A;  2LT3 A;  1LVK A;  1MMA A;  2E9X C;  1HNX T;  2ZM6 T;  4O2B E;  5AQU B;  4JV5 T;  3TLT A;  5ABG A;  3IA3 A;  4I55 E;  2QA7 A;  4F8H A;  4U72 A;  3JAD A;  2YOE A;  2JPF A;  3FHN A;  3RF1 A;  4IDP A;  2XAG B;  1YQ4 A;  2ZM8 A;  1MMG A;  4GK5 E;  2H88 A;  2WMN A;  3JC6 D;  5M4Y A;  2VKH A;  2GK9 A;  4JI7 T;  4GOU A;  3AE2 A;  2XSB A;  5KX5 E;  1DU2 A;  5JVD E;  2LSK A;  4GKK T;  2JJ9 A;  4WW0 A;  3ANW B;  2JMK A;  4ZOL E;  2JQH A;  2BZB A;  1UGO A;  4AIU A;  3J7Y q;  5AQL B;  3UT5 E;  3E0Z A;  3JAF A;  2K3W A;  5AQP B;  2M6B A;  3N9P A;  2IHR 1;  4TX5 A;  5LHI B;  3P50 A;  3H37 A;  5AQM B;  3WI3 A;  2LHN A;  2LEH A;  4TUY E;  4B3S T;  1QUU A;  4P09 A;  3T8O A;  5LYJ E;  5KMG P;  4U31 A;  2WAU A;  5JH7 E;  1Y64 B;  5HXH A;  4QXB B;  5HXE A;  2PFV A;  3P4P A;  2XQA A;  4MHC A;  1N36 T; 
#chains in the Genus database with same CATH homology
 4H9P C;  5LP6 E;  2LSY A;  5JDM A;  1LKX A;  4EAH A;  4JEU B;  3RRW A;  1FMV A;  3O1H A;  4PJL A;  2L9Q A;  1WYB A;  2BDE A;  1MMN A;  2CE7 A;  2EHO D;  3ZMT B;  4H9O C;  2N1G A;  3OYX A;  3O9X A;  1FIO A;  1UX5 A;  4PJJ A;  3N5L A;  5JR9 C;  4CXX A;  3AVS A;  2HPJ A;  4UF0 A;  5JRE A;  2VKO A;  2KLQ A;  2K48 A;  2YIN A;  1BR1 A;  1G73 A;  1D1B A;  2V7J A;  2W00 A;  2H7V C;  3P7I A;  2XTL A;  4JUY A;  2X9W A;  2MOZ A;  4E7Z A;  3L3P A;  3PU8 A;  2IC6 A;  3U78 A;  4AKL A;  2W61 A;  3RX6 A;  3C98 B;  2L3L A;  4X1I E;  3IHR A;  4ZI2 D;  3Q5X A;  1KNZ A;  2ZM2 A;  5L3D B;  4GK0 E;  5HYA A;  3I9Y A;  4I43 B;  2OA5 A;  3DTO A;  4BJN A;  2KZ7 B;  4AKG A;  1HCI A;  3ZYM A;  3F2E A;  2KWI B;  2A72 A;  5EK3 A;  2Q9Q C;  4N78 D;  2LM9 A;  3CML A;  3LK4 2;  3K3Q C;  3P8C D;  4UEM A;  1BR4 A;  4CZZ B;  4EB6 E;  2EHO B;  4TN7 B;  3KFW X;  2W0G A;  3EDV A;  2VB6 A;  2SPC A;  4ZS3 A;  5L3B B;  4H9N C;  2VKJ A;  1S35 A;  1OXZ A;  4MLK A;  2JRK A;  3EDU A;  4IGU A;  5LJN A;  3RC3 A;  3N9L A;  5LCY A;  5LXT E;  4P0A A;  4QHO A;  5HWY A;  3NZQ A;  3DP7 A;  3ZMU B;  1WYC A;  2E8I A;  3U3I A;  4HTE A;  1D1C A;  2DI4 A;  3BQL A;  3RKO A;  4CQI A;  4KBM B;  5E0O A;  4DBQ A;  2KXP B;  3BQI A;  2LE8 A;  3V5S A;  4H63 V;  3ZMZ B;  1WRD A;  5EK4 A;  5JR9 A;  4DO0 A;  2RP4 A;  2MTQ A;  1ZHC A;  1HS7 A;  3HL6 A;  5IYZ E;  3KV5 A;  5DQW A;  2X66 A;  2NP9 A;  4QKN A;  3ONX A;  3K3O A;  1BR2 A;  4JLE A;  4DMV A;  3Q9D A;  2ZLY A;  5CA0 E;  4TZ4 C;  4ZS2 A;  3R6N A;  2V1D B;  5TAO A;  3JC6 C;  2XUE A;  2WWU A;  2X67 A;  3R84 B;  4KP3 C;  2DWG A;  1ZEE A;  2VKD A;  2X51 A;  3KIN B;  4IE4 A;  4TV9 E;  1SA0 E;  1QSD A;  2LSI A;  3VKG A;  5FNV E;  1LRZ A;  3F57 A;  3M65 A;  3UUL A;  5ADX L;  3IF8 B;  4HKA A;  4L5G A;  2C5J A;  4EIW A;  5JRC B;  4M1P A;  3I0O A;  3UFE A;  2B1E A;  2C5I T;  3AA7 B;  4H9Q C;  3RYH E;  3AVR A;  4EOZ B;  4EZH A;  4AKI A;  2LOP A;  4O4H E;  3UUN A;  4X20 E;  3MJX A;  3LBX B;  4AKH A;  1SHZ C;  4NUV A;  5FY7 A;  2D5U A;  5HXR A;  3SRZ A;  4GIW A;  2JQQ A;  3Q5W A;  4GYR A;  5LG4 A;  4DVD A;  5DQV A;  3NBX X;  2CLY C;  2LJL A;  1D0Y A;  2PBI A;  3ZC1 A;  3ZLI A;  4CI1 B;  1OWA A;  3NZP A;  4KUM B;  3CVR A;  3UUM A;  3KV4 A;  2RA1 A;  3C51 A;  4ISS A;  3ZEF B;  3HI2 A;  1US7 B;  2Y6X A;  5J1G A;  3VHL A;  5HXC A;  2IC9 A;  4NUU A;  3ANW A;  2ES0 A;  3SWH A;  5HAX A;  1ZV4 X;  3I0Q A;  4ASK A;  4IE6 A;  2E9X D;  4AKR B;  4HEA A;  4EZ4 A;  3LG7 A;  4HGA A;  5IHY A;  2CXD A;  4IE7 A;  3PUR A;  4PK5 A;  3S4U A;  2XAH B;  5LOV E;  2D0T A;  4O4L E;  5L3G B;  3C4Z A;  3AAE B;  3PDY A;  2BVL A;  3ETV A;  2V7K A;  5L2L A;  4G63 A;  2CMR A;  2XAF B;  1HF8 A;  3AA1 B;  2Y8D A;  2LSG A;  2M67 A;  3ZYK A;  1HG2 A;  2LHR A;  2KND A;  4G2A A;  4PFO A;  3I9W A;  4OHF A;  1V9D A;  4BAY B;  3FXD B;  2NTX A;  5JQG E;  3HKC E;  1YKE B;  2HH7 A;  2VWA A;  1X79 A;  4J2C A;  2KIN B;  3K3N A;  1BR0 A;  2H7O A;  4UXN B;  4UEL A;  2K9A A;  3PE0 A;  5FXW A;  2E9X B;  3HR0 A;  4UV8 B;  4MFR A;  2N2N A;  2YU2 A;  2Q9Q D;  5L3E B;  1T98 A;  3CKD A;  3OBV E;  4ZI3 D;  3AA0 B;  1EZ3 A;  3ZJ2 A;  5JR9 B;  2DLR A;  4HN9 A;  1IJ6 A;  3CX7 B;  4IHJ E;  3CX8 B;  3D0T A;  2CWO A;  4PAG A;  2NW7 A;  5DJQ C;  3RYI E;  3ZCJ A;  1CUN A;  5FXV A;  4ILU A;  4O4J E;  3C64 A;  2V7M A;  3CWZ B;  4H9R C;  3F31 A;  3HKE E;  4H9S E;  4K0U A;  3N2K E;  3O4X E;  2V7I A;  3AAA B;  2K24 A;  4P0B A;  2DNX A;  3PUA A;  2NWB A;  4ZHQ E;  5EK2 A;  3LJC A;  4YHJ A;  3FBL A;  3Q2M A;  3GN5 A;  3RC8 A;  5CB4 E;  4AQG A;  2ACX A;  3ZN0 B;  3RH3 A;  3PTR B;  3DJB A;  3J9X 1;  4ZI2 C;  2W63 A;  2Q9Q B;  3KDS E;  4DBR A;  1MIY A;  4O8S A;  5F3J A;  5LBQ B;  2N9D A;  4EXT A;  4OYK A;  4JEH B;  4XAX B;  1D1A A;  4CI3 B;  1MND A;  2J1D G;  4WBN E;  2KT9 A;  4L9I A;  2I59 A;  3EUH A;  3ZC0 A;  3VKH A;  2K5B B;  4X1Y E;  3A5X A;  4IE5 A;  4TV8 E;  2CM0 A;  2A2F X;  4FI5 A;  4A56 A;  2KMF A;  2ZM0 A;  2CEA A;  5CA1 E;  2X68 A;  5LHG B;  2JMH A;  2VAS A;  3MXZ A;  2CWY A;  1O3X A;  3WAJ A;  3ZJ1 A;  1UCU A;  5JDN A;  3E08 A;  3NRX A;  3SOL A;  4YLH A;  5L3C B;  2D2S A;  2X9Y A;  1YW0 A;  2UXX B;  4YFS A;  1KK7 A;  3NRY A;  4EYY R;  4F6R C;  1VRB A;  3RRC A;  5A1L A;  3MKD A;  3BQK A;  3AA6 B;  3N9O A;  2EHO A;  4PW8 A;  2YU1 A;  1ZKE A;  3ZCI A;  1UX4 A;  5HWX A;  3KVA A;  5AFU L;  3RYF E;  2IW5 B;  3C4W A;  3OJA A;  1MIV A;  1U5P A;  4L0R A;  5JDQ A;  5JDH A;  3N2G E;  4B6X A;  3PUS A;  2XQY A;  4ERR A;  1HX8 A;  3ZPO A;  1Z0P A;  5LHH B;  4CXW A;  4IE0 A;  2C0S A;  2CXF A;  3MK7 C;  4E7S A;  2X9H A;  5J2T E;  3FBZ A;  1G8X A;  1HTJ F;  1IAP A;  3C4X A;  3OKQ A;  2C5K T;  4UF0 B;  3E22 E;  2PG8 A;  2VL8 A;  4HE8 A;  4I50 E;  2A3D A;  2BVM A;  4U74 A;  4KMC A;  4Z8X A;  4MAL A;  5LGN B;  1MNE A;  3L09 A;  4O2A E;  5BMV E;  3N9N A;  4V1A v;  3C50 A;  2IAK A;  4UIG A;  4CXY A;  2CLY B;  3CPZ A;  3UTK A;  2HPL A;  5FXZ A;  4WBO A;  2DWK A;  4IST A;  5LGU B;  5ETW A;  3AB3 B;  1FMW A;  1YKH B;  4HFV A;  3EVY A;  2W62 A;  3LK2 B;  3MAC A;  2DHR A;  5LA6 E;  3KBT A;  1MMD A;  4CI2 B;  4UV9 B;  5LBM A;  3GWH A;  4UVC B;  4PFP A;  4C91 A;  3GA8 A;  2ODV A;  2MYS A;  4PJN A;  4AQF A;  4OK0 A;  3MA9 A;  5JRC A;  3TKL B;  2Z6E A;  3KV6 A;  3K8P C;  1S94 A;  3ESL A;  2WBL A;  4GYS A;  4PK6 A;  3FXE B;  3KV9 A;  4QXC B;  1H7C A;  4X1K E;  1LVF A;  2V26 A;  2LT3 A;  1LVK A;  1MMA A;  3LBX A;  2E9X C;  3ZMV B;  3HA4 A;  3CQC B;  2Y48 B;  4WNK A;  4O2B E;  5FXX A;  1FEW A;  2VK9 A;  2X0L B;  3IEE A;  5GON E;  1WLX A;  3N9M A;  4IDZ A;  5L3F B;  4I55 E;  5FP3 A;  3PUQ A;  5JDL A;  4QWN B;  3GMI A;  2WM9 A;  2QA7 A;  4XZC A;  5FY0 A;  2EHO C;  2XHE B;  4U72 A;  1NWM X;  3O1J A;  4OYJ A;  3AAI A;  3CQX C;  2JPF A;  4PK4 A;  4PNI A;  5FY1 A;  2LSJ A;  2P9B A;  4XBF B;  3FHN A;  3N9Q A;  2DCF A;  5LNK A;  1U4Q A;  1IJ5 A;  2ZMA A;  2QGS A;  4O4I E;  2NW9 A;  3QC9 A;  5KDM C;  3RYC E;  3W15 B;  4DMW A;  5LJM A;  3SS1 A;  2XAG B;  3ZN1 B;  4QX8 B;  2ZM8 A;  4ZI3 C;  1MMG A;  1YD8 G;  4GK5 E;  4QX7 B;  2WMN A;  4BA9 A;  2YK0 A;  2WMO A;  4PJM A;  4FJO A;  1D0X A;  3JC6 D;  2CCQ A;  5M4Y A;  2VKH A;  4ZI7 E;  1VOM A;  2GK9 A;  3UUX B;  2CA5 A;  3BK9 A;  5J2U E;  1HFA A;  4UVA B;  3O1I A;  4GOU A;  4AI6 A;  2E9X A;  2X9X A;  2PJQ A;  3CX6 B;  5KX5 E;  5JVD E;  5JDF A;  2LSK A;  2NW8 A;  3I1A A;  2JJ9 A;  4WW0 A;  5C8Y E;  3VU7 H;  3ANW B;  1MIW A;  3IBP A;  2NOX A;  4H63 H;  4I4T E;  4QXH B;  4AQF C;  2UXN B;  3FB2 A;  4BJM A;  2D0U A;  2MBG A;  2ODU A;  2JMK A;  2XAS B;  4IIJ E;  3LK3 B;  4ZOL E;  2BZB A;  5FYM A;  3J7Y q;  3UT5 E;  3E0Z A;  4AXP A;  4YJ2 E;  1WR6 A;  2H3R A;  3ZYL A;  2CXL A;  3KBU A;  3CQG B;  3QK6 A;  4UVB B;  2Q9Q A;  1NAF A;  3N9P A;  4ADZ A;  2WSS V;  4YJ3 E;  4C90 A;  4TX5 A;  5JDG A;  5LHI B;  3WAK A;  3B13 A;  4ANJ A;  3H37 A;  3MZK B;  1AJ3 A;  3WI3 A;  3OYZ A;  2LOS A;  3ETU A;  2NTY A;  1B7T A;  3N2O A;  5F8P A;  2LHN A;  3KVB A;  2LEH A;  4TUY E;  1HG5 A;  3HKD E;  1QUU A;  5H6Q B;  2V7L A;  4P09 A;  3T8O A;  4DND A;  5LYJ E;  5KMG P;  3B57 A;  2XAQ B;  2WAU A;  3LFM A;  4MBQ A;  5LGT B;  2KWH A;  4EYU A;  3PU3 A;  5JH7 E;  2XAJ B;  1Y64 B;  1D0Z A;  3HKB E;  1IZN B;  5HXH A;  1E1H B;  4QXB B;  5HXE A;  5DAB A;  2G0U A;  2PFV A;  3ZMS B;  5FMN A;  2L8K A;  5EZY E;  5H6R B;  3RPU A;  5HXS A;  4OFZ A;  4MHC A;  3QUJ A;  3PUG A;  3V5U A;  3GN5 B;  3H3A A;  2YEV C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...