2C5JA

N-terminal domain of tlg1, domain-swapped dimer
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
87
structure length
82
Chain Sequence
DPFQQVVKDTKEQLNRINNYITRHNTAEEEIQDILKDVEETIVDLDRSIIVMKRDENEDVSGREAQVKNIKQQLDALKLRFD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Analysis of the Interaction between the Snare Tlg1 and Vps51.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein transport
molecule keywords T-SNARE AFFECTING A LATE GOLGI COMPARTMENT PROTEIN 1
total genus 39
structure length 82
sequence length 87
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-10-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.90 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2c5jA00
1QSDA 2CA5A 3CKDA 2XTLA 2C5JA 4J2CA 3FXDB 3S4UA 2MBGA 2C5IT 1LRZA 4FI5A 2C5KT 3FXEB 3QK6A 2KWHA 4EYYR 2X9WA 4DNDA 4B6XA 2G0UA 2IC6A 2X9YA 3L3PA 1IJ6A 2X9XA 1IJ5A 1ZKEA 1H7CA 4L0RA 3CVRA 3P7IA 2IC9A 2KWIB 3QUJA 1LVFA 2K48A 3N5LA 3TKLB 1Z0PA 3MXZA 4CQIA
chains in the Genus database with same CATH superfamily
4ADZA 1KNZA 3UUMA 2XAGB 5L2LA 1FIOA 3PDYA 4HWDA 2X66A 4P1NA 1HX1B 3CKDA 5JDHA 4CXYA 2C5JA 4U2ZA 2A72A 2H7VC 2CE7A 4MBQA 4EEDA 3ONLC 2LLYA 2XQ4A 3C4XA 4YTNA 3HA4A 1M7KA 2Q9QA 4ANJA 1OXZA 1XNRT 2IAKA 1D0ZA 4EYUA 2LHRA 3AE9A 2V26A 5FY1A 3RIUA 3RQWA 3ZJ2A 3ZPOA 3J7Yq 2X9WA 2QRXA 3G06A 4B3ST 3N2OA 2M6BA 2MYSA 3AE8A 3I1AA 4PJLA 4BJNA 3L3PA 2VL8A 3O1HA 5M4YA 5AQRB 4CXWA 2UXBT 2X9XA 1UURA 5JREA 3OJAA 3GWHA 4K0UA 4AQGA 4L0RA 1XWMA 4GYRA 1M62A 3FZLB 2EHOC 3LK2B 1Z0PA 3CQCB 3LBXA 4HFBA 3MKDA 4TWDA 4UR9A 2PFVA 2XAQB 2JMHA 2KINB 2WWVA 4QH5A 4JLEA 2NR4A 3AAAB 5C3JA 2DCFA 2JQ9A 5EZYE 4Z91A 4H9OC 5FKYA 2VK9A 5HAXA 3O1IA 2D0UA 4COFA 4FI5A 1IZNB 4DMWA 2AE9A 3FXEB 1WR0A 3AEAA 4MFRA 3QC9A 3OYZA 5FVLA 1MNEA 3LDQB 3AVRA 4LFAT 5HXHA 4WYVA 1J5ET 2H88A 5JVDE 4ZS3A 3ZJ1A 2CWYA 2I0MA 1QLBA 3UU4A 2ZMAA 3Q5WA 2LOSA 3RYIE 4EZ4A 2CCQA 1UX4A 2I6HA 2IUBA 5KMGP 1IAPA 2VKJA 4GKJT 3KV9A 4PK6A 4K0KT 2IC9A 2D5UA 3AAEB 3GA8A 5BMVE 1I94T 2FBWA 4IDOA 2OA5A 5HCMA 4DV5T 2K24A 3FZMB 2IHR1 1VCSA 5ABGA 3RKGA 2BG9E 4UVCB 3UQ4A 4YXDA 2F4VT 4A56A 2WWUA 1ZEEA 3N2GE 4IDPA 2IW5B 4TX5A 5LP6E 3RYHE 3ZYLA 2WMNA 3ONJA 4X62T 2UUCT 2MAWA 5AQMB 4JI2T 4LF4T 2LOPA 3QB5A 1KFYA 4MLKA 4OYKA 4YTPA 5LG3A 4HFHA 3E0ZA 1D1BA 3JCFA 3K3QC 3QK6A 3SRZA 3AE3A 3AVSA 1HNWT 3UULA 5HYAA 3AA6B 3E22E 4GK0E 2E8IA 2UXXB 2V8SV 3IF8B 2XQ6A 2VWAA 3AEBA 3C4ZA 4HFCA 4YSXA 2UXCT 4L9IA 3CX6B 2XAHB 2XQ9A 5ABEA 3PTRB 5AQJB 3Q5XA 1L0VA 2XQ5A 4YT0A 5LYJE 3SWHA 1Z8UA 4LFBT 4PW8A 5L3DB 5L3GB 5JRCA 4ZI2D 3OPCA 1X9BA 4H9QC 3K8PC 2CRBA 4TUYE 5LGNB 4B3MT 4KX6A 4GKKT 2IDOB 2LSYA 4O4LE 2X67A 4O8SA 5HEOA 5ADXL 3GN5B 3EAMA 5AQQB 1MMGA 2VURA 1OWAA 2HPJA 1EZ3A 5EK3A 4F8HA 5JRCB 2XQYA 3F2EA 3P50A 4G2AA 2WBLA 5GONE 5L3FB 4H9RC 2WSSV 3HKBE 2BS4A 1HG2A 3IA3A 3PUGA 2N9DA 3CX8B 4ZI3D 4HN9A 5J2UE 3NKZA 3TLSA 2G0UA 5JQGE 2XJ7A 5LJNA 3HL6A 1N32T 3NZPA 1IJ6A 2K5BB 2WP9A 1UUSA 3HR0A 1KNRA 4X1KE 3ZLIA 3RC3A 3VKHA 4X1IE 1YQ4A 3TKLB 1SUMB 4ZXLA 1X79A 2JQKA 4AQYT 3KV6A 4WZXA 3ZC0A 3F57A 3CQXC 4G63A 3L8RA 4PFPA 4TN7B 1XDOA 5FL1A 5DQWA 3PUXF 4EGWA 1VCTA 1UGOA 1HF8A 1NEKA 1WR6A 4P0BA 5LBMA 1U4QA 1J1JA 3FZHB 3K3OA 4ILCA 3RH3A 3IEEA 3PUYF 5ABFA 5JDQA 1SE7A 5HWYA 4IIJE 3NRXA 4AISA 4QKNA 3SFEA 4X20E 4DUZT 4AQFC 2NWBA 3MACA 2CHOA 4HFDA 3AE1A 5E0OA 4JI1T 1FEWA 2IC6A 2X9YA 5AQVB 4X65T 2N2NA 5FXWA 5LHIB 1BR0A 2A2FX 4I43B 5ABHA 2W00A 4JI6T 3QUJA 1FJGT 1XZYA 3A7MA 3KV5A 4QXCB 3SOLA 1BR1A 2X9HA 3EI0A 2EHOD 4E7SA 5C2TA 2CLYC 2WQYA 3N9PA 4U31A 4DR1T 5EK4A 4CN1A 5JH7E 2YU2A 5LGTB 4YHHT 4OK0A 2C5IT 2V5DA 3UU3A 4CN6A 3C4WA 2LRKA 4OX9T 3ZT7A 2XAJB 2LM2A 3GN5A 2BDEA 1E7PA 2OLTA 3B5MA 1MIYA 3D0TA 4O2AE 2X0HA 3CPZA 5LMNT 1AJ3A 2H89A 4WBNE 4ZI7E 3HI2A 4DR3T 2R6GF 5CA1E 2BBJA 4TV8E 1WCRA 3FHNA 3KFWX 5FXZA 3LSVA 3EVYA 2A3DA 5EK2A 5JDGA 2LSGA 3VRBA 4OFZA 2GK9A 3CVRA 1D1CA 4DR2T 1I6ZA 2LE8A 3RRWA 3P4RA 4U74A 1ZHCA 2DHRA 3AXJA 3ETVA 2NTYA 4YFSA 1T7SA 3VHLA 2E2AA 3KV4A 4DV6T 4JI4T 1KNPA 2CA5A 5AQTB 4HFIA 5HXCA 5J1GA 4I50E 1U5PA 1OEDB 4PK5A 1G8XA 3AE4A 4GIWA 3WAKA 1YXRA 3CMLA 2UXNB 5AQGB 3ZMVB 3ZSTA 5L3EB 4O2BE 4UF0B 4X66T 2CXDA 3VR9A 1S94A 3N9MA 1NAFA 4IE6A 4IL9A 5FXVA 1LKXA 4CN4A 2C5KT 4WW0A 4DO0A 5AQFB 3N9OA 3O4XE 3L09A 2BZBA 2WU2A 2X0YA 2Y6XA 3ZMSB 1JNRA 2JMKA 2LEHA 3KDSE 2VB6A 3PU3A 4F6RC 1HNXT 1OEDA 3PJAA 4PJMA 2CHNA 5FNVE 4LMJA 1HFAA 2V7KA 4TWHA 2JQQA 1OEDC 2AXDS 2BKOA 2QYWA 3KBTA 3NBXX 3C64A 4KI0F 4PJJA 2WDRA 2D2SA 3NWIA 2NW9A 2M6IA 1US7B 2CBIA 5BR8T 2HH7A 2XPKA 2IMLA 4JEUB 4CI2B 2B1EA 5L3CB 4DV2T 2NW7A 3ABVA 3P4PA 4WNKA 4YTMA 1LVFA 4ZI3C 4IL4A 5FVKA 4N78D 2W61A 2W4XA 3M3ZB 4DV4T 3T1YT 4HFEA 1WYCA 2LKGA 4H9NC 4HWHA 3PUWF 3LJCA 5DABA 5CFBA 4ILBA 5F3JA 5LGUB 4KUMB 3WI3A 4TZ4C 3FXDB 4YSZA 2LSJA 3PURA 4PFOA 4UV9B 2MBGA 2HN2A 4AI6A 1W9RA 2W63A 3N2KE 2VKHA 4EOZB 4BA9A 4DV7T 3OYXA 1YW0A 2E9XA 2XM1A 5ETWA 1IBKT 2E5LT 5LMUT 4DR4T 3C98B 3DJBA 2XSBA 3H3AA 4IREA 4DV1T 2LSIA 4V1Av 3BQIA 1SA0E 2CXFA 5CJ5A 3O9XA 4JI7T 3AECA 4DNDA 3P4QA 4HGAA 4TNVA 5HEHA 3AE2A 4EZHA 5LB7B 2ES0A 3IHRA 2UUBT 1SHZC 2J47A 2YDQA 3LBXB 3PJAJ 3KVAA 3I0OA 4Q25A 1VOMA 2BG9B 2WS3A 2PBIA 3ANWA 1Y64B 1ZP0A 2NW8A 3ZMTB 4ERRA 3PUQA 5HXSA 2ACZA 3EABA 2YOEA 5JR9A 2WCAA 5FY7A 4CZZB 4XAXB 5HEUA 3VU7H 3CWZB 2BVLA 5JDFA 2UXDT 3FZKB 4JYAT 5FP3A 2P9BA 2QVAA 3AE7A 4IGUA 3AXJB 4JI0T 4LMLA 4KHPT 4DBQA 3OVUA 5AQIB 4YHJA 1HTJF 1T98A 2WMOA 2ZM8A 1HX8A 2BKNA 3AEDA 3RKOA 4DR6T 4A97A 5AQSB 4ZOLE 4Z90A 3AEEA 5IYZE 5HEJA 4UEMA 2W67A 4MALA 2FJEA 4NIQA 3ZEFB 2Y8DA 4CI3B 4FJOA 4YSYA 2J4GA 2FJAA 2CEAA 2DI4A 4DV3T 4JEHB 2VKDA 4E7ZA 3KINB 3QOFA 3A8YC 5LCYA 3AA7B 4LF5T 2RA1A 4O4JE 4IE0A 2BG9A 4ILAA 2BBHA 5F8PA 4AQFA 1JNZA 2CMRA 2FJDA 2L9QA 1QSDA 1W09A 2EHOA 5JTGA 1E1HB 1MMNA 3AA0B 3MA9A 4AKIA 4HKAA 3PUVF 4J2CA 3RLFF 2LJLA 5AQLB 4X64T 3S4UA 2KXPB 3BK9A 4H63H 2K9AA 4GOUA 4IE4A 4B3RT 2BKPA 2XAFB 3AA1B 3KVBA 2ZM0A 4AKGA 4UELA 5CGMA 2CM0A 5F5WA 4P09A 1YKEB 2X68A 3LFMA 5AQUB 2V7MA 3FB2A 3RIFA 1VRBA 4X1YE 4H63V 4TWFA 3RYCE 1KK7A 2J1DG 5H6QB 2HPLA 4MHCA 3GMIA 4QHOA 1R8IA 3BQLA 2B76A 2OV9A 3AE5A 3CX7B 1B7TA 4JUYA 5JDLA 5J0ZA 4IE5A 2Q9QD 2XQ8A 3LG7A 3N9NA 3Q9DA 2RPAA 4OHFA 4UXNB 3UFEA 3UUNA 2ACXA 3VKGA 4IHJE 2XQAA 4QXBB 3SS1A 4P0AA 2KLQA 2PG8A 2MOZA 3EDVA 1MNDA 3M65A 4UV8B 3ZMUB 1XDPA 4U3CA 4AKLA 1WLXA 3RRCA 2NTXA 3TLUA 4U2YA 2X51A 3PUAA 5LNKA 3TLVA 1N33T 3UU8A 1BR4A 2JJ9A 4LF7T 4LF8T 1MMDA 2Q9QC 5ABFB 4WBOA 3MZKB 2W62A 2LSKA 2YDSA 4LMKA 5FMNA 1NWMX 5LA6E 4YJ2E 2DWKA 5AQPB 4O4IE 3RIAA 5LJMA 2XQ3A 3PE0A 4LF6T 4PNIA 3BQKA 3T1HT 1IJ5A 3PUZF 4ZEYA 5L3BB 3I0QA 4UIGA 3PUSA 2WZIA 4Z8XA 1KEYA 2XSAA 4BJMA 2XASB 2V5CA 1Y01A 4KP3C 2V7IA 3B57A 4IE7A 3UTKA 2JQHA 1HNZT 4ZI2C 2J62A 2ZM6T 4HE8A 3EHZA 3TLTA 2E9XB 3K1SA 3ZKRA 3RQUA 1W0AA 3JADA 1E2AA 3ESLA 3QNUA 3UT5E 2KT9A 4ASKA 5LG4A 1IBLT 2EHOB 5LHHB 4UVBB 1MIWA 2W66A 3F31A 4A5XA 4HWIB 3RYFE 5LXTE 3EDUA 3DTOA 2PTFA 3I9WA 3N9LA 3CQGB 1CHUA 3AEFA 2FJBA 2ZLYA 5JDNA 4H9SE 2X0LB 3N9QA 3NZQA 3R84B 4U7IA 3W15B 5KX5E 2VQET 3JC6C 3FZFB 5FYMA 4JI8T 4IDNA 1S35A 1HS7A 4QWNB 3I9YA 2CWOA 3LK42 4PAGA 1O3XA 1WRDA 3RHWA 2CBJA 4DMVA 4AIUA 2PJQA 4JBWF 3VRAA 3N5LA 4QX7B 2E9XC 2D0TA 4YJ3E 2L8KA 1D1AA 2VL0A 5LOVE 3UFGA 2WY2A 4AKRB 4C90A 2VQFT 3V5UA 3ZYMA 1N36T 2V7LA 5AQNB 4EB6E 3KBUA 4ZZBA 4DR5T 3NRYA 4TNWA 4EV6A 5JDMA 5CB4E 4EIWA 5J2TE 5IWAT 1XMQT 2V6YA 2Y48B 2XY8B 2Q9QB 4ZZCA 2JRKA 4NXNT 3Q5EA 3JAEA 2VKOA 3ETUA 4DBRA 3DP7A 4HEAA 4I55E 2VASA 4EYYR 2LT3A 1WYBA 1HG5A 2ODUA 5TAOA 3X1DA 1KF6A 1ZOYA 2KSRA 1NENA 3E08A 2MTQA 3RGLA 3RX6A 1G73A 4B6XA 2LM9A 2YINA 4AXPA 4QXHB 5AQOB 3RF1A 4GYSA 1IBMT 3J9X1 3ZN1B 5A1LA 4H9PC 5LHGB 1H7CA 2W2UA 3OKQA 2BS2A 2QGSA 4IDQA 5FY0A 3T8OA 3QB5K 2WDVA 3RPUA 5LBQB 4L5GA 2KWIB 5AQHB 4IT4A 5CA0E 2LKHA 1XNQT 2WZHA 4U72A 3A5XA 2I59A 2QA7A 5DQVA 3Q2MA 3Q5DA 3EUHA 4QH4A 4YLHA 3ZCIA 2XZEA 4PJNA 3VR8A 4CI1B 2D9DA 2WAUA 2XM2A 3AB3B 3ANWB 2CLYB 4GK5E 4U33A 4JI5T 1V9DA 3V5SA 5FL0A 3MK7C 2WU5A 3UU6A 2H3RA 2N1GA 3ZT6A 3PU8A 4DVDA 1LRZA 4LFCT 3L39A 4QX8B 3HKDE 5HXRA 2K3WA 4DIDB 2ODVA 1OEDE 5C8YE 4QH1A 3IBPA 2LHNA 4JV5T 2KWHA 2XUEA 4LF9T 2E9XD 3C51A 4KHZF 4BAYB 2UU9T 2XHEB 3C50A 3H3MA 2A9UA 1FMVA 3U3IA 3AEGA 4TV9E 4UVAB 2V7JA 5L4EA 2JIWA 4NUVA 2YKSA 1W0BA 3UUBA 5KDMC 2LRLA 1HR0T 1D0XA 2VVNA 5L47A 2CPTA 2IIUA 4PK4A 5IHYA 4HTEA 5H6RB 3TLWA 3P8CD 3NVOA 3MXZA 3ZT5A 1UX5A 4NUUA 4CQIA 3WAJA 2WDQA 2V1DB 3ZYKA 4CXXA 3CIRA 3CK6A 5JR9C 2HHHT 3ZMZB 1GQEA 2Z6EA 5AFUL 5JR9B 4ZS2A 4YY3T 2RP4A 4DV0T 5HCJA 2DNXA 4U7YA 3FBZA 1HCIA 2C0SA 1J5WA 5L4HA 5FXXA 3RIUC 2KMFA 1XMOT 2DWGA 4NPPA 4B3TT 3FBLA 2KNDA 3O1JA 3OBVE 4DUYT 3ONXA 2YEVC 3RI5A 1YD8G 2V6XA 5IUXA 4UF0A 2VVSA 2V6YB 3HKCE 4A98A 3UQ7A 2SPCA 2L3LA 4XBFB 4IDZA 4KMCA 3ZCJA 3UUXB 1LVKA 1ZKEA 2YN6A 2XQ7A 2YK0A 3JC6D 1UCUA 1CUNA 1DU2A 2HN1A 3P7IA 1YKHB 1T72A 4XZCA 4EEBA 2E5VA 2BS3A 4OYJA 4I0UA 5DJQC 2YDRA 1ZV4X 3OTOT 3JAFA 2MPKA 3HKEE 2CXLA 2DL1A 3LK3B 3P4WA 5AQKB 2DLRA 2NP9A 2XTLA 2JPFA 2NOXA 3K3NA 4HWFA 4DR7T 1D0YA 4HWCA 4KBMB 3U78A 2WM9A 1UK5A 3UU5A 2W0GA 5HWXA 2UUAT 4EAHA 2BG9C 4ISSA 4NXMT 3AAIA 2M67A 3B13A 1MMAA 1BR2A 2YU1A 3AE6A 4C91A 2ZM2A 4JI3T 1QUUA 4AKHA 2H7OA 4EXTA 3ZN0B 4ZHQE 2WB5A 4ISTA 4O4HE 1MIVA 2KZ7B 3PV0F 3R6NA 4I4TE 3H37A 5HEGA 1T8BA 4M1PA 3ZSSA 3SFDA 2BVMA 5HXEA 5KXJA 3MJXA 1YQ3A 1WFDA 3P4SA 4ILUA 1N34T 3RC8A 2FUPA 2K48A 4X5TA 3ZC1A 4HFVA 1FMWA
chains in the Genus database with same CATH topology
4ADZA 1KNZA 3UUMA 2XAGB 5L2LA 1FIOA 3PDYA 5JDHA 2X66A 3CKDA 4CXYA 2C5JA 2A72A 2H7VC 2CE7A 4MBQA 3C4XA 3HA4A 2Q9QA 1FMWA 1OXZA 4ANJA 2IAKA 1D0ZA 4EYUA 2LHRA 2V26A 5FY1A 3ZJ2A 3ZPOA 3J7Yq 2X9WA 3N2OA 2MYSA 3I1AA 4PJLA 4BJNA 3L3PA 2VL8A 3O1HA 5M4YA 4CXWA 2X9XA 5JREA 3OJAA 3GWHA 4K0UA 4AQGA 4L0RA 4GYRA 2EHOC 3LK2B 1Z0PA 3CQCB 3LBXA 3MKDA 2PFVA 2XAQB 2JMHA 2KINB 4JLEA 3AAAB 2DCFA 5EZYE 4H9OC 2VK9A 5HAXA 3O1IA 2D0UA 4FI5A 1IZNB 4DMWA 3FXEB 4MFRA 3QC9A 3OYZA 1MNEA 3AVRA 5HXHA 5JVDE 4ZS3A 2CWYA 4EZ4A 2ZMAA 3Q5WA 2LOSA 3RYIE 2CCQA 1UX4A 1IAPA 2VKJA 3KV9A 4PK6A 2IC9A 2D5UA 3AAEB 3GA8A 5BMVE 2OA5A 2K24A 4UVCB 2WWUA 1ZEEA 3N2GE 5LP6E 2IW5B 4TX5A 3RYHE 3ZYLA 2WMNA 2LOPA 4MLKA 4OYKA 3E0ZA 1D1BA 3K3QC 3QK6A 3SRZA 3AVSA 3UULA 5HYAA 3AA6B 3E22E 4GK0E 2E8IA 2UXXB 3IF8B 3C4ZA 2VWAA 4L9IA 3CX6B 2XAHB 3PTRB 3Q5XA 5LYJE 3SWHA 4PW8A 5L3DB 5L3GB 5JRCA 4ZI2D 4TUYE 4H9QC 3K8PC 5LGNB 2LSYA 4O4LE 2X67A 4O8SA 5ADXL 3GN5B 1MMGA 1OWAA 2HPJA 1EZ3A 5EK3A 5JRCB 2XQYA 3F2EA 4G2AA 2WBLA 5GONE 5L3FB 4H9RC 2WSSV 3HKBE 5LG4A 1HG2A 4ZI3D 3PUGA 2N9DA 3CX8B 5J2UE 4HN9A 5LJNA 2G0UA 5JQGE 3HL6A 3NZPA 1IJ6A 2K5BB 3ZLIA 3HR0A 4X1KE 3RC3A 3VKHA 4X1IE 3TKLB 1X79A 3ZC0A 3KV6A 3F57A 3CQXC 4G63A 4PFPA 4TN7B 1HF8A 1WR6A 4P0BA 5LBMA 1U4QA 3K3OA 3RH3A 3IEEA 5JDQA 5HWYA 4IIJE 3NRXA 4QKNA 4X20E 4AQFC 2NWBA 3MACA 5E0OA 1FEWA 2IC6A 2X9YA 2N2NA 5FXWA 5LHIB 1BR0A 2A2FX 4I43B 2W00A 3QUJA 3SOLA 3KV5A 4QXCB 1BR1A 2X9HA 4E7SA 2EHOD 2CLYC 3N9PA 5JH7E 2YU2A 5LGTB 4OK0A 2C5IT 3C4WA 2XAJB 3GN5A 2BDEA 3D0TA 1MIYA 4O2AE 3CPZA 1AJ3A 4WBNE 4ZI7E 3HI2A 5CA1E 4TV8E 3FHNA 3KFWX 5FXZA 3EVYA 2A3DA 5EK2A 5JDGA 2LSGA 4OFZA 2GK9A 3CVRA 1D1CA 2LE8A 3RRWA 4U74A 1ZHCA 2DHRA 4YFSA 3ETVA 2NTYA 3VHLA 3KV4A 2CA5A 5J1GA 5HXCA 4I50E 1U5PA 4PK5A 3WAKA 1G8XA 4GIWA 3CMLA 2UXNB 3ZMVB 5L3EB 4O2BE 4UF0B 2CXDA 1S94A 3N9MA 1NAFA 4IE6A 5FXVA 1LKXA 2C5KT 4DO0A 3N9OA 3O4XE 3L09A 2BZBA 3ZMSB 4F6RC 2Y6XA 5KMGP 2JMKA 2LEHA 3KDSE 2VB6A 3PU3A 4PJMA 5FNVE 1HFAA 2V7KA 2JQQA 3NBXX 3KBTA 3ZJ1A 2NW9A 3C64A 4PJJA 2D2SA 1US7B 2HH7A 4JEUB 4CI2B 2B1EA 5L3CB 2NW7A 4WNKA 4ZI3C 4A56A 1LVFA 4N78D 2W61A 1WYCA 4H9NC 3LJCA 5DABA 5F3JA 5LGUB 4KUMB 3WI3A 4TZ4C 3FXDB 2LSJA 3PURA 4PFOA 4UV9B 2MBGA 4AI6A 2W63A 3N2KE 2VKHA 4EOZB 4BA9A 3OYXA 1YW0A 2E9XA 5ETWA 3C98B 3DJBA 3H3AA 2LSIA 4V1Av 3BQIA 1SA0E 2CXFA 3O9XA 4DNDA 4HGAA 4EZHA 2ES0A 3IHRA 1SHZC 5DQWA 3LBXB 5EK4A 3KVAA 3I0OA 4WW0A 1VOMA 3ANWA 5FXXA 2PBIA 3ZMTB 1Y64B 4ERRA 2NW8A 5HXSA 3PUQA 5JR9A 5FY7A 4CZZB 4XAXB 3VU7H 3CWZB 2BVLA 5JDFA 5FP3A 2P9BA 4IGUA 4DBQA 4YHJA 1HTJF 1T98A 2WMOA 1HX8A 3RKOA 4ZOLE 5IYZE 4UEMA 4MALA 3ZEFB 2Y8DA 4CI3B 4FJOA 2CEAA 2DI4A 4JEHB 2VKDA 4E7ZA 3KINB 5LCYA 3AA7B 2RA1A 4O4JE 4IE0A 5F8PA 4AQFA 2CMRA 2L9QA 1QSDA 2EHOA 1E1HB 1MMNA 3AA0B 3MA9A 4AKIA 4HKAA 4J2CA 2LJLA 3S4UA 2KXPB 3BK9A 4H63H 2K9AA 4GOUA 4IE4A 2XAFB 3KVBA 3AA1B 2ZM0A 4AKGA 4UELA 2CM0A 4P09A 1YKEB 2X68A 3LFMA 2V7MA 3FB2A 1VRBA 4X1YE 4H63V 3RYCE 1KK7A 2J1DG 5H6QB 2HPLA 4MHCA 3GMIA 4QHOA 3BQLA 3CX7B 1B7TA 4JUYA 5JDLA 4IE5A 2Q9QD 3LG7A 3N9NA 3Q9DA 4OHFA 3UFEA 3UUNA 4UXNB 3VKGA 2ACXA 4IHJE 4P0AA 4QXBB 3SS1A 2KLQA 2PG8A 2MOZA 3EDVA 1MNDA 3M65A 4UV8B 3ZMUB 4AKLA 1WLXA 3RRCA 2NTXA 2X51A 3PUAA 5LNKA 1BR4A 2JJ9A 1MMDA 2Q9QC 4WBOA 3MZKB 2W62A 2LSKA 4YJ2E 5FMNA 5LA6E 1NWMX 5LJMA 2DWKA 4O4IE 3PE0A 4PNIA 3BQKA 1IJ5A 5L3BB 3I0QA 4UIGA 3PUSA 4Z8XA 4BJMA 2XASB 4KP3C 2V7IA 3B57A 4IE7A 3UTKA 4ZI2C 4HE8A 2E9XB 3UT5E 3ESLA 4ASKA 2KT9A 2EHOB 5LHHB 4UVBB 3F31A 1MIWA 3RYFE 5LXTE 3EDUA 3DTOA 3I9WA 3N9LA 3CQGB 2ZLYA 5JDNA 4H9SE 2X0LB 3N9QA 3NZQA 3R84B 3W15B 5KX5E 3JC6C 5FYMA 1S35A 1HS7A 4QWNB 3I9YA 2CWOA 3LK42 4PAGA 1O3XA 1WRDA 4DMVA 2PJQA 3N5LA 4QX7B 2E9XC 2D0TA 4YJ3E 2L8KA 1D1AA 5LOVE 4AKRB 4C90A 3V5UA 3ZYMA 2V7LA 4EB6E 3KBUA 3NRYA 5JDMA 5CB4E 4EIWA 5J2TE 2Y48B 2Q9QB 2JRKA 2VKOA 3ETUA 4DBRA 3DP7A 4HEAA 4I55E 2VASA 4EYYR 2LT3A 1WYBA 1HG5A 2ODUA 5TAOA 3RX6A 3E08A 2MTQA 4B6XA 1G73A 2LM9A 2YINA 4AXPA 4QXHB 4GYSA 3J9X1 3ZN1B 5A1LA 4H9PC 5LHGB 1H7CA 3OKQA 2QGSA 5FY0A 3T8OA 3RPUA 5LBQB 4L5GA 2KWIB 5CA0E 4U72A 3A5XA 2I59A 2QA7A 5DQVA 3Q2MA 3ZCIA 3EUHA 4YLHA 4PJNA 4CI1B 2WAUA 3AB3B 4GK5E 3ANWB 2CLYB 1V9DA 3V5SA 3MK7C 2H3RA 2N1GA 3PU8A 4DVDA 1LRZA 4QX8B 3HKDE 5HXRA 2ODVA 5C8YE 3IBPA 2LHNA 2KWHA 2XUEA 2E9XD 3C51A 4BAYB 2XHEB 3C50A 1FMVA 3U3IA 4UVAB 4TV9E 2V7JA 4NUVA 5KDMC 1D0XA 4PK4A 5IHYA 4HTEA 5H6RB 3P8CD 3MXZA 3WAJA 1UX5A 4NUUA 4CQIA 4CXXA 2V1DB 3ZYKA 5JR9C 3ZMZB 2Z6EA 5AFUL 5JR9B 4ZS2A 2RP4A 2DNXA 3FBZA 1HCIA 2C0SA 2KMFA 2DWGA 3FBLA 2KNDA 3O1JA 3OBVE 3ONXA 2YEVC 1YD8G 4UF0A 3HKCE 2SPCA 2L3LA 4XBFB 4IDZA 4KMCA 3ZCJA 3UUXB 1LVKA 1ZKEA 2YK0A 3JC6D 1UCUA 1CUNA 3P7IA 1YKHB 4XZCA 4OYJA 5DJQC 1ZV4X 3HKEE 2CXLA 3LK3B 2DLRA 2NP9A 2XTLA 2JPFA 2NOXA 3K3NA 1D0YA 4KBMB 3U78A 2WM9A 2W0GA 5HWXA 4EAHA 4ISSA 3AAIA 2M67A 3B13A 1MMAA 1BR2A 2YU1A 4C91A 2ZM2A 1QUUA 4AKHA 2H7OA 4EXTA 3ZN0B 4ZHQE 4ISTA 4O4HE 1MIVA 2KZ7B 3R6NA 4I4TE 3H37A 4M1PA 2BVMA 5HXEA 3MJXA 4ILUA 3RC8A 2K48A 3ZC1A 4HFVA 2ZM8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QSD A;  2CA5 A;  3CKD A;  2XTL A;  2C5J A;  4J2C A;  3FXD B;  3S4U A;  2MBG A;  2C5I T;  1LRZ A;  4FI5 A;  2C5K T;  3FXE B;  3QK6 A;  2KWH A;  4EYY R;  2X9W A;  4DND A;  4B6X A;  2G0U A;  2IC6 A;  2X9Y A;  3L3P A;  1IJ6 A;  2X9X A;  1IJ5 A;  1ZKE A;  1H7C A;  4L0R A;  3CVR A;  3P7I A;  2IC9 A;  2KWI B;  3QUJ A;  1LVF A;  2K48 A;  3N5L A;  3TKL B;  1Z0P A;  3MXZ A;  4CQI A; 
#chains in the Genus database with same CATH topology
 4ADZ A;  1KNZ A;  3UUM A;  2XAG B;  5L2L A;  1FIO A;  3PDY A;  4HWD A;  2X66 A;  4P1N A;  1HX1 B;  3CKD A;  5JDH A;  4CXY A;  2C5J A;  4U2Z A;  2A72 A;  2H7V C;  2CE7 A;  4MBQ A;  4EED A;  3ONL C;  2LLY A;  2XQ4 A;  3C4X A;  4YTN A;  3HA4 A;  1M7K A;  2Q9Q A;  4ANJ A;  1OXZ A;  1XNR T;  2IAK A;  1D0Z A;  4EYU A;  2LHR A;  3AE9 A;  2V26 A;  5FY1 A;  3RIU A;  3RQW A;  3ZJ2 A;  3ZPO A;  3J7Y q;  2X9W A;  2QRX A;  3G06 A;  4B3S T;  3N2O A;  2M6B A;  2MYS A;  3AE8 A;  3I1A A;  4PJL A;  4BJN A;  3L3P A;  2VL8 A;  3O1H A;  5M4Y A;  5AQR B;  4CXW A;  2UXB T;  2X9X A;  1UUR A;  5JRE A;  3OJA A;  3GWH A;  4K0U A;  4AQG A;  4L0R A;  1XWM A;  4GYR A;  1M62 A;  3FZL B;  2EHO C;  3LK2 B;  1Z0P A;  3CQC B;  3LBX A;  4HFB A;  3MKD A;  4TWD A;  4UR9 A;  2PFV A;  2XAQ B;  2JMH A;  2KIN B;  2WWV A;  4QH5 A;  4JLE A;  2NR4 A;  3AAA B;  5C3J A;  2DCF A;  2JQ9 A;  5EZY E;  4Z91 A;  4H9O C;  5FKY A;  2VK9 A;  5HAX A;  3O1I A;  2D0U A;  4COF A;  4FI5 A;  1IZN B;  4DMW A;  2AE9 A;  3FXE B;  1WR0 A;  3AEA A;  4MFR A;  3QC9 A;  3OYZ A;  5FVL A;  1MNE A;  3LDQ B;  3AVR A;  4LFA T;  5HXH A;  4WYV A;  1J5E T;  2H88 A;  5JVD E;  4ZS3 A;  3ZJ1 A;  2CWY A;  2I0M A;  1QLB A;  3UU4 A;  2ZMA A;  3Q5W A;  2LOS A;  3RYI E;  4EZ4 A;  2CCQ A;  1UX4 A;  2I6H A;  2IUB A;  5KMG P;  1IAP A;  2VKJ A;  4GKJ T;  3KV9 A;  4PK6 A;  4K0K T;  2IC9 A;  2D5U A;  3AAE B;  3GA8 A;  5BMV E;  1I94 T;  2FBW A;  4IDO A;  2OA5 A;  5HCM A;  4DV5 T;  2K24 A;  3FZM B;  2IHR 1;  1VCS A;  5ABG A;  3RKG A;  2BG9 E;  4UVC B;  3UQ4 A;  4YXD A;  2F4V T;  4A56 A;  2WWU A;  1ZEE A;  3N2G E;  4IDP A;  2IW5 B;  4TX5 A;  5LP6 E;  3RYH E;  3ZYL A;  2WMN A;  3ONJ A;  4X62 T;  2UUC T;  2MAW A;  5AQM B;  4JI2 T;  4LF4 T;  2LOP A;  3QB5 A;  1KFY A;  4MLK A;  4OYK A;  4YTP A;  5LG3 A;  4HFH A;  3E0Z A;  1D1B A;  3JCF A;  3K3Q C;  3QK6 A;  3SRZ A;  3AE3 A;  3AVS A;  1HNW T;  3UUL A;  5HYA A;  3AA6 B;  3E22 E;  4GK0 E;  2E8I A;  2UXX B;  2V8S V;  3IF8 B;  2XQ6 A;  2VWA A;  3AEB A;  3C4Z A;  4HFC A;  4YSX A;  2UXC T;  4L9I A;  3CX6 B;  2XAH B;  2XQ9 A;  5ABE A;  3PTR B;  5AQJ B;  3Q5X A;  1L0V A;  2XQ5 A;  4YT0 A;  5LYJ E;  3SWH A;  1Z8U A;  4LFB T;  4PW8 A;  5L3D B;  5L3G B;  5JRC A;  4ZI2 D;  3OPC A;  1X9B A;  4H9Q C;  3K8P C;  2CRB A;  4TUY E;  5LGN B;  4B3M T;  4KX6 A;  4GKK T;  2IDO B;  2LSY A;  4O4L E;  2X67 A;  4O8S A;  5HEO A;  5ADX L;  3GN5 B;  3EAM A;  5AQQ B;  1MMG A;  2VUR A;  1OWA A;  2HPJ A;  1EZ3 A;  5EK3 A;  4F8H A;  5JRC B;  2XQY A;  3F2E A;  3P50 A;  4G2A A;  2WBL A;  5GON E;  5L3F B;  4H9R C;  2WSS V;  3HKB E;  2BS4 A;  1HG2 A;  3IA3 A;  3PUG A;  2N9D A;  3CX8 B;  4ZI3 D;  4HN9 A;  5J2U E;  3NKZ A;  3TLS A;  2G0U A;  5JQG E;  2XJ7 A;  5LJN A;  3HL6 A;  1N32 T;  3NZP A;  1IJ6 A;  2K5B B;  2WP9 A;  1UUS A;  3HR0 A;  1KNR A;  4X1K E;  3ZLI A;  3RC3 A;  3VKH A;  4X1I E;  1YQ4 A;  3TKL B;  1SUM B;  4ZXL A;  1X79 A;  2JQK A;  4AQY T;  3KV6 A;  4WZX A;  3ZC0 A;  3F57 A;  3CQX C;  4G63 A;  3L8R A;  4PFP A;  4TN7 B;  1XDO A;  5FL1 A;  5DQW A;  3PUX F;  4EGW A;  1VCT A;  1UGO A;  1HF8 A;  1NEK A;  1WR6 A;  4P0B A;  5LBM A;  1U4Q A;  1J1J A;  3FZH B;  3K3O A;  4ILC A;  3RH3 A;  3IEE A;  3PUY F;  5ABF A;  5JDQ A;  1SE7 A;  5HWY A;  4IIJ E;  3NRX A;  4AIS A;  4QKN A;  3SFE A;  4X20 E;  4DUZ T;  4AQF C;  2NWB A;  3MAC A;  2CHO A;  4HFD A;  3AE1 A;  5E0O A;  4JI1 T;  1FEW A;  2IC6 A;  2X9Y A;  5AQV B;  4X65 T;  2N2N A;  5FXW A;  5LHI B;  1BR0 A;  2A2F X;  4I43 B;  5ABH A;  2W00 A;  4JI6 T;  3QUJ A;  1FJG T;  1XZY A;  3A7M A;  3KV5 A;  4QXC B;  3SOL A;  1BR1 A;  2X9H A;  3EI0 A;  2EHO D;  4E7S A;  5C2T A;  2CLY C;  2WQY A;  3N9P A;  4U31 A;  4DR1 T;  5EK4 A;  4CN1 A;  5JH7 E;  2YU2 A;  5LGT B;  4YHH T;  4OK0 A;  2C5I T;  2V5D A;  3UU3 A;  4CN6 A;  3C4W A;  2LRK A;  4OX9 T;  3ZT7 A;  2XAJ B;  2LM2 A;  3GN5 A;  2BDE A;  1E7P A;  2OLT A;  3B5M A;  1MIY A;  3D0T A;  4O2A E;  2X0H A;  3CPZ A;  5LMN T;  1AJ3 A;  2H89 A;  4WBN E;  4ZI7 E;  3HI2 A;  4DR3 T;  2R6G F;  5CA1 E;  2BBJ A;  4TV8 E;  1WCR A;  3FHN A;  3KFW X;  5FXZ A;  3LSV A;  3EVY A;  2A3D A;  5EK2 A;  5JDG A;  2LSG A;  3VRB A;  4OFZ A;  2GK9 A;  3CVR A;  1D1C A;  4DR2 T;  1I6Z A;  2LE8 A;  3RRW A;  3P4R A;  4U74 A;  1ZHC A;  2DHR A;  3AXJ A;  3ETV A;  2NTY A;  4YFS A;  1T7S A;  3VHL A;  2E2A A;  3KV4 A;  4DV6 T;  4JI4 T;  1KNP A;  2CA5 A;  5AQT B;  4HFI A;  5HXC A;  5J1G A;  4I50 E;  1U5P A;  1OED B;  4PK5 A;  1G8X A;  3AE4 A;  4GIW A;  3WAK A;  1YXR A;  3CML A;  2UXN B;  5AQG B;  3ZMV B;  3ZST A;  5L3E B;  4O2B E;  4UF0 B;  4X66 T;  2CXD A;  3VR9 A;  1S94 A;  3N9M A;  1NAF A;  4IE6 A;  4IL9 A;  5FXV A;  1LKX A;  4CN4 A;  2C5K T;  4WW0 A;  4DO0 A;  5AQF B;  3N9O A;  3O4X E;  3L09 A;  2BZB A;  2WU2 A;  2X0Y A;  2Y6X A;  3ZMS B;  1JNR A;  2JMK A;  2LEH A;  3KDS E;  2VB6 A;  3PU3 A;  4F6R C;  1HNX T;  1OED A;  3PJA A;  4PJM A;  2CHN A;  5FNV E;  4LMJ A;  1HFA A;  2V7K A;  4TWH A;  2JQQ A;  1OED C;  2AXD S;  2BKO A;  2QYW A;  3KBT A;  3NBX X;  3C64 A;  4KI0 F;  4PJJ A;  2WDR A;  2D2S A;  3NWI A;  2NW9 A;  2M6I A;  1US7 B;  2CBI A;  5BR8 T;  2HH7 A;  2XPK A;  2IML A;  4JEU B;  4CI2 B;  2B1E A;  5L3C B;  4DV2 T;  2NW7 A;  3ABV A;  3P4P A;  4WNK A;  4YTM A;  1LVF A;  4ZI3 C;  4IL4 A;  5FVK A;  4N78 D;  2W61 A;  2W4X A;  3M3Z B;  4DV4 T;  3T1Y T;  4HFE A;  1WYC A;  2LKG A;  4H9N C;  4HWH A;  3PUW F;  3LJC A;  5DAB A;  5CFB A;  4ILB A;  5F3J A;  5LGU B;  4KUM B;  3WI3 A;  4TZ4 C;  3FXD B;  4YSZ A;  2LSJ A;  3PUR A;  4PFO A;  4UV9 B;  2MBG A;  2HN2 A;  4AI6 A;  1W9R A;  2W63 A;  3N2K E;  2VKH A;  4EOZ B;  4BA9 A;  4DV7 T;  3OYX A;  1YW0 A;  2E9X A;  2XM1 A;  5ETW A;  1IBK T;  2E5L T;  5LMU T;  4DR4 T;  3C98 B;  3DJB A;  2XSB A;  3H3A A;  4IRE A;  4DV1 T;  2LSI A;  4V1A v;  3BQI A;  1SA0 E;  2CXF A;  5CJ5 A;  3O9X A;  4JI7 T;  3AEC A;  4DND A;  3P4Q A;  4HGA A;  4TNV A;  5HEH A;  3AE2 A;  4EZH A;  5LB7 B;  2ES0 A;  3IHR A;  2UUB T;  1SHZ C;  2J47 A;  2YDQ A;  3LBX B;  3PJA J;  3KVA A;  3I0O A;  4Q25 A;  1VOM A;  2BG9 B;  2WS3 A;  2PBI A;  3ANW A;  1Y64 B;  1ZP0 A;  2NW8 A;  3ZMT B;  4ERR A;  3PUQ A;  5HXS A;  2ACZ A;  3EAB A;  2YOE A;  5JR9 A;  2WCA A;  5FY7 A;  4CZZ B;  4XAX B;  5HEU A;  3VU7 H;  3CWZ B;  2BVL A;  5JDF A;  2UXD T;  3FZK B;  4JYA T;  5FP3 A;  2P9B A;  2QVA A;  3AE7 A;  4IGU A;  3AXJ B;  4JI0 T;  4LML A;  4KHP T;  4DBQ A;  3OVU A;  5AQI B;  4YHJ A;  1HTJ F;  1T98 A;  2WMO A;  2ZM8 A;  1HX8 A;  2BKN A;  3AED A;  3RKO A;  4DR6 T;  4A97 A;  5AQS B;  4ZOL E;  4Z90 A;  3AEE A;  5IYZ E;  5HEJ A;  4UEM A;  2W67 A;  4MAL A;  2FJE A;  4NIQ A;  3ZEF B;  2Y8D A;  4CI3 B;  4FJO A;  4YSY A;  2J4G A;  2FJA A;  2CEA A;  2DI4 A;  4DV3 T;  4JEH B;  2VKD A;  4E7Z A;  3KIN B;  3QOF A;  3A8Y C;  5LCY A;  3AA7 B;  4LF5 T;  2RA1 A;  4O4J E;  4IE0 A;  2BG9 A;  4ILA A;  2BBH A;  5F8P A;  4AQF A;  1JNZ A;  2CMR A;  2FJD A;  2L9Q A;  1QSD A;  1W09 A;  2EHO A;  5JTG A;  1E1H B;  1MMN A;  3AA0 B;  3MA9 A;  4AKI A;  4HKA A;  3PUV F;  4J2C A;  3RLF F;  2LJL A;  5AQL B;  4X64 T;  3S4U A;  2KXP B;  3BK9 A;  4H63 H;  2K9A A;  4GOU A;  4IE4 A;  4B3R T;  2BKP A;  2XAF B;  3AA1 B;  3KVB A;  2ZM0 A;  4AKG A;  4UEL A;  5CGM A;  2CM0 A;  5F5W A;  4P09 A;  1YKE B;  2X68 A;  3LFM A;  5AQU B;  2V7M A;  3FB2 A;  3RIF A;  1VRB A;  4X1Y E;  4H63 V;  4TWF A;  3RYC E;  1KK7 A;  2J1D G;  5H6Q B;  2HPL A;  4MHC A;  3GMI A;  4QHO A;  1R8I A;  3BQL A;  2B76 A;  2OV9 A;  3AE5 A;  3CX7 B;  1B7T A;  4JUY A;  5JDL A;  5J0Z A;  4IE5 A;  2Q9Q D;  2XQ8 A;  3LG7 A;  3N9N A;  3Q9D A;  2RPA A;  4OHF A;  4UXN B;  3UFE A;  3UUN A;  2ACX A;  3VKG A;  4IHJ E;  2XQA A;  4QXB B;  3SS1 A;  4P0A A;  2KLQ A;  2PG8 A;  2MOZ A;  3EDV A;  1MND A;  3M65 A;  4UV8 B;  3ZMU B;  1XDP A;  4U3C A;  4AKL A;  1WLX A;  3RRC A;  2NTX A;  3TLU A;  4U2Y A;  2X51 A;  3PUA A;  5LNK A;  3TLV A;  1N33 T;  3UU8 A;  1BR4 A;  2JJ9 A;  4LF7 T;  4LF8 T;  1MMD A;  2Q9Q C;  5ABF B;  4WBO A;  3MZK B;  2W62 A;  2LSK A;  2YDS A;  4LMK A;  5FMN A;  1NWM X;  5LA6 E;  4YJ2 E;  2DWK A;  5AQP B;  4O4I E;  3RIA A;  5LJM A;  2XQ3 A;  3PE0 A;  4LF6 T;  4PNI A;  3BQK A;  3T1H T;  1IJ5 A;  3PUZ F;  4ZEY A;  5L3B B;  3I0Q A;  4UIG A;  3PUS A;  2WZI A;  4Z8X A;  1KEY A;  2XSA A;  4BJM A;  2XAS B;  2V5C A;  1Y01 A;  4KP3 C;  2V7I A;  3B57 A;  4IE7 A;  3UTK A;  2JQH A;  1HNZ T;  4ZI2 C;  2J62 A;  2ZM6 T;  4HE8 A;  3EHZ A;  3TLT A;  2E9X B;  3K1S A;  3ZKR A;  3RQU A;  1W0A A;  3JAD A;  1E2A A;  3ESL A;  3QNU A;  3UT5 E;  2KT9 A;  4ASK A;  5LG4 A;  1IBL T;  2EHO B;  5LHH B;  4UVB B;  1MIW A;  2W66 A;  3F31 A;  4A5X A;  4HWI B;  3RYF E;  5LXT E;  3EDU A;  3DTO A;  2PTF A;  3I9W A;  3N9L A;  3CQG B;  1CHU A;  3AEF A;  2FJB A;  2ZLY A;  5JDN A;  4H9S E;  2X0L B;  3N9Q A;  3NZQ A;  3R84 B;  4U7I A;  3W15 B;  5KX5 E;  2VQE T;  3JC6 C;  3FZF B;  5FYM A;  4JI8 T;  4IDN A;  1S35 A;  1HS7 A;  4QWN B;  3I9Y A;  2CWO A;  3LK4 2;  4PAG A;  1O3X A;  1WRD A;  3RHW A;  2CBJ A;  4DMV A;  4AIU A;  2PJQ A;  4JBW F;  3VRA A;  3N5L A;  4QX7 B;  2E9X C;  2D0T A;  4YJ3 E;  2L8K A;  1D1A A;  2VL0 A;  5LOV E;  3UFG A;  2WY2 A;  4AKR B;  4C90 A;  2VQF T;  3V5U A;  3ZYM A;  1N36 T;  2V7L A;  5AQN B;  4EB6 E;  3KBU A;  4ZZB A;  4DR5 T;  3NRY A;  4TNW A;  4EV6 A;  5JDM A;  5CB4 E;  4EIW A;  5J2T E;  5IWA T;  1XMQ T;  2V6Y A;  2Y48 B;  2XY8 B;  2Q9Q B;  4ZZC A;  2JRK A;  4NXN T;  3Q5E A;  3JAE A;  2VKO A;  3ETU A;  4DBR A;  3DP7 A;  4HEA A;  4I55 E;  2VAS A;  4EYY R;  2LT3 A;  1WYB A;  1HG5 A;  2ODU A;  5TAO A;  3X1D A;  1KF6 A;  1ZOY A;  2KSR A;  1NEN A;  3E08 A;  2MTQ A;  3RGL A;  3RX6 A;  1G73 A;  4B6X A;  2LM9 A;  2YIN A;  4AXP A;  4QXH B;  5AQO B;  3RF1 A;  4GYS A;  1IBM T;  3J9X 1;  3ZN1 B;  5A1L A;  4H9P C;  5LHG B;  1H7C A;  2W2U A;  3OKQ A;  2BS2 A;  2QGS A;  4IDQ A;  5FY0 A;  3T8O A;  3QB5 K;  2WDV A;  3RPU A;  5LBQ B;  4L5G A;  2KWI B;  5AQH B;  4IT4 A;  5CA0 E;  2LKH A;  1XNQ T;  2WZH A;  4U72 A;  3A5X A;  2I59 A;  2QA7 A;  5DQV A;  3Q2M A;  3Q5D A;  3EUH A;  4QH4 A;  4YLH A;  3ZCI A;  2XZE A;  4PJN A;  3VR8 A;  4CI1 B;  2D9D A;  2WAU A;  2XM2 A;  3AB3 B;  3ANW B;  2CLY B;  4GK5 E;  4U33 A;  4JI5 T;  1V9D A;  3V5S A;  5FL0 A;  3MK7 C;  2WU5 A;  3UU6 A;  2H3R A;  2N1G A;  3ZT6 A;  3PU8 A;  4DVD A;  1LRZ A;  4LFC T;  3L39 A;  4QX8 B;  3HKD E;  5HXR A;  2K3W A;  4DID B;  2ODV A;  1OED E;  5C8Y E;  4QH1 A;  3IBP A;  2LHN A;  4JV5 T;  2KWH A;  2XUE A;  4LF9 T;  2E9X D;  3C51 A;  4KHZ F;  4BAY B;  2UU9 T;  2XHE B;  3C50 A;  3H3M A;  2A9U A;  1FMV A;  3U3I A;  3AEG A;  4TV9 E;  4UVA B;  2V7J A;  5L4E A;  2JIW A;  4NUV A;  2YKS A;  1W0B A;  3UUB A;  5KDM C;  2LRL A;  1HR0 T;  1D0X A;  2VVN A;  5L47 A;  2CPT A;  2IIU A;  4PK4 A;  5IHY A;  4HTE A;  5H6R B;  3TLW A;  3P8C D;  3NVO A;  3MXZ A;  3ZT5 A;  1UX5 A;  4NUU A;  4CQI A;  3WAJ A;  2WDQ A;  2V1D B;  3ZYK A;  4CXX A;  3CIR A;  3CK6 A;  5JR9 C;  2HHH T;  3ZMZ B;  1GQE A;  2Z6E A;  5AFU L;  5JR9 B;  4ZS2 A;  4YY3 T;  2RP4 A;  4DV0 T;  5HCJ A;  2DNX A;  4U7Y A;  3FBZ A;  1HCI A;  2C0S A;  1J5W A;  5L4H A;  5FXX A;  3RIU C;  2KMF A;  1XMO T;  2DWG A;  4NPP A;  4B3T T;  3FBL A;  2KND A;  3O1J A;  3OBV E;  4DUY T;  3ONX A;  2YEV C;  3RI5 A;  1YD8 G;  2V6X A;  5IUX A;  4UF0 A;  2VVS A;  2V6Y B;  3HKC E;  4A98 A;  3UQ7 A;  2SPC A;  2L3L A;  4XBF B;  4IDZ A;  4KMC A;  3ZCJ A;  3UUX B;  1LVK A;  1ZKE A;  2YN6 A;  2XQ7 A;  2YK0 A;  3JC6 D;  1UCU A;  1CUN A;  1DU2 A;  2HN1 A;  3P7I A;  1YKH B;  1T72 A;  4XZC A;  4EEB A;  2E5V A;  2BS3 A;  4OYJ A;  4I0U A;  5DJQ C;  2YDR A;  1ZV4 X;  3OTO T;  3JAF A;  2MPK A;  3HKE E;  2CXL A;  2DL1 A;  3LK3 B;  3P4W A;  5AQK B;  2DLR A;  2NP9 A;  2XTL A;  2JPF A;  2NOX A;  3K3N A;  4HWF A;  4DR7 T;  1D0Y A;  4HWC A;  4KBM B;  3U78 A;  2WM9 A;  1UK5 A;  3UU5 A;  2W0G A;  5HWX A;  2UUA T;  4EAH A;  2BG9 C;  4ISS A;  4NXM T;  3AAI A;  2M67 A;  3B13 A;  1MMA A;  1BR2 A;  2YU1 A;  3AE6 A;  4C91 A;  2ZM2 A;  4JI3 T;  1QUU A;  4AKH A;  2H7O A;  4EXT A;  3ZN0 B;  4ZHQ E;  2WB5 A;  4IST A;  4O4H E;  1MIV A;  2KZ7 B;  3PV0 F;  3R6N A;  4I4T E;  3H37 A;  5HEG A;  1T8B A;  4M1P A;  3ZSS A;  3SFD A;  2BVM A;  5HXE A;  5KXJ A;  3MJX A;  1YQ3 A;  1WFD A;  3P4S A;  4ILU A;  1N34 T;  3RC8 A;  2FUP A;  2K48 A;  4X5T A;  3ZC1 A;  4HFV A;  1FMW A; 
#chains in the Genus database with same CATH homology
 4ADZ A;  1KNZ A;  3UUM A;  2XAG B;  5L2L A;  1FIO A;  3PDY A;  5JDH A;  2X66 A;  3CKD A;  4CXY A;  2C5J A;  2A72 A;  2H7V C;  2CE7 A;  4MBQ A;  3C4X A;  3HA4 A;  2Q9Q A;  1FMW A;  1OXZ A;  4ANJ A;  2IAK A;  1D0Z A;  4EYU A;  2LHR A;  2V26 A;  5FY1 A;  3ZJ2 A;  3ZPO A;  3J7Y q;  2X9W A;  3N2O A;  2MYS A;  3I1A A;  4PJL A;  4BJN A;  3L3P A;  2VL8 A;  3O1H A;  5M4Y A;  4CXW A;  2X9X A;  5JRE A;  3OJA A;  3GWH A;  4K0U A;  4AQG A;  4L0R A;  4GYR A;  2EHO C;  3LK2 B;  1Z0P A;  3CQC B;  3LBX A;  3MKD A;  2PFV A;  2XAQ B;  2JMH A;  2KIN B;  4JLE A;  3AAA B;  2DCF A;  5EZY E;  4H9O C;  2VK9 A;  5HAX A;  3O1I A;  2D0U A;  4FI5 A;  1IZN B;  4DMW A;  3FXE B;  4MFR A;  3QC9 A;  3OYZ A;  1MNE A;  3AVR A;  5HXH A;  5JVD E;  4ZS3 A;  2CWY A;  4EZ4 A;  2ZMA A;  3Q5W A;  2LOS A;  3RYI E;  2CCQ A;  1UX4 A;  1IAP A;  2VKJ A;  3KV9 A;  4PK6 A;  2IC9 A;  2D5U A;  3AAE B;  3GA8 A;  5BMV E;  2OA5 A;  2K24 A;  4UVC B;  2WWU A;  1ZEE A;  3N2G E;  5LP6 E;  2IW5 B;  4TX5 A;  3RYH E;  3ZYL A;  2WMN A;  2LOP A;  4MLK A;  4OYK A;  3E0Z A;  1D1B A;  3K3Q C;  3QK6 A;  3SRZ A;  3AVS A;  3UUL A;  5HYA A;  3AA6 B;  3E22 E;  4GK0 E;  2E8I A;  2UXX B;  3IF8 B;  3C4Z A;  2VWA A;  4L9I A;  3CX6 B;  2XAH B;  3PTR B;  3Q5X A;  5LYJ E;  3SWH A;  4PW8 A;  5L3D B;  5L3G B;  5JRC A;  4ZI2 D;  4TUY E;  4H9Q C;  3K8P C;  5LGN B;  2LSY A;  4O4L E;  2X67 A;  4O8S A;  5ADX L;  3GN5 B;  1MMG A;  1OWA A;  2HPJ A;  1EZ3 A;  5EK3 A;  5JRC B;  2XQY A;  3F2E A;  4G2A A;  2WBL A;  5GON E;  5L3F B;  4H9R C;  2WSS V;  3HKB E;  5LG4 A;  1HG2 A;  4ZI3 D;  3PUG A;  2N9D A;  3CX8 B;  5J2U E;  4HN9 A;  5LJN A;  2G0U A;  5JQG E;  3HL6 A;  3NZP A;  1IJ6 A;  2K5B B;  3ZLI A;  3HR0 A;  4X1K E;  3RC3 A;  3VKH A;  4X1I E;  3TKL B;  1X79 A;  3ZC0 A;  3KV6 A;  3F57 A;  3CQX C;  4G63 A;  4PFP A;  4TN7 B;  1HF8 A;  1WR6 A;  4P0B A;  5LBM A;  1U4Q A;  3K3O A;  3RH3 A;  3IEE A;  5JDQ A;  5HWY A;  4IIJ E;  3NRX A;  4QKN A;  4X20 E;  4AQF C;  2NWB A;  3MAC A;  5E0O A;  1FEW A;  2IC6 A;  2X9Y A;  2N2N A;  5FXW A;  5LHI B;  1BR0 A;  2A2F X;  4I43 B;  2W00 A;  3QUJ A;  3SOL A;  3KV5 A;  4QXC B;  1BR1 A;  2X9H A;  4E7S A;  2EHO D;  2CLY C;  3N9P A;  5JH7 E;  2YU2 A;  5LGT B;  4OK0 A;  2C5I T;  3C4W A;  2XAJ B;  3GN5 A;  2BDE A;  3D0T A;  1MIY A;  4O2A E;  3CPZ A;  1AJ3 A;  4WBN E;  4ZI7 E;  3HI2 A;  5CA1 E;  4TV8 E;  3FHN A;  3KFW X;  5FXZ A;  3EVY A;  2A3D A;  5EK2 A;  5JDG A;  2LSG A;  4OFZ A;  2GK9 A;  3CVR A;  1D1C A;  2LE8 A;  3RRW A;  4U74 A;  1ZHC A;  2DHR A;  4YFS A;  3ETV A;  2NTY A;  3VHL A;  3KV4 A;  2CA5 A;  5J1G A;  5HXC A;  4I50 E;  1U5P A;  4PK5 A;  3WAK A;  1G8X A;  4GIW A;  3CML A;  2UXN B;  3ZMV B;  5L3E B;  4O2B E;  4UF0 B;  2CXD A;  1S94 A;  3N9M A;  1NAF A;  4IE6 A;  5FXV A;  1LKX A;  2C5K T;  4DO0 A;  3N9O A;  3O4X E;  3L09 A;  2BZB A;  3ZMS B;  4F6R C;  2Y6X A;  5KMG P;  2JMK A;  2LEH A;  3KDS E;  2VB6 A;  3PU3 A;  4PJM A;  5FNV E;  1HFA A;  2V7K A;  2JQQ A;  3NBX X;  3KBT A;  3ZJ1 A;  2NW9 A;  3C64 A;  4PJJ A;  2D2S A;  1US7 B;  2HH7 A;  4JEU B;  4CI2 B;  2B1E A;  5L3C B;  2NW7 A;  4WNK A;  4ZI3 C;  4A56 A;  1LVF A;  4N78 D;  2W61 A;  1WYC A;  4H9N C;  3LJC A;  5DAB A;  5F3J A;  5LGU B;  4KUM B;  3WI3 A;  4TZ4 C;  3FXD B;  2LSJ A;  3PUR A;  4PFO A;  4UV9 B;  2MBG A;  4AI6 A;  2W63 A;  3N2K E;  2VKH A;  4EOZ B;  4BA9 A;  3OYX A;  1YW0 A;  2E9X A;  5ETW A;  3C98 B;  3DJB A;  3H3A A;  2LSI A;  4V1A v;  3BQI A;  1SA0 E;  2CXF A;  3O9X A;  4DND A;  4HGA A;  4EZH A;  2ES0 A;  3IHR A;  1SHZ C;  5DQW A;  3LBX B;  5EK4 A;  3KVA A;  3I0O A;  4WW0 A;  1VOM A;  3ANW A;  5FXX A;  2PBI A;  3ZMT B;  1Y64 B;  4ERR A;  2NW8 A;  5HXS A;  3PUQ A;  5JR9 A;  5FY7 A;  4CZZ B;  4XAX B;  3VU7 H;  3CWZ B;  2BVL A;  5JDF A;  5FP3 A;  2P9B A;  4IGU A;  4DBQ A;  4YHJ A;  1HTJ F;  1T98 A;  2WMO A;  1HX8 A;  3RKO A;  4ZOL E;  5IYZ E;  4UEM A;  4MAL A;  3ZEF B;  2Y8D A;  4CI3 B;  4FJO A;  2CEA A;  2DI4 A;  4JEH B;  2VKD A;  4E7Z A;  3KIN B;  5LCY A;  3AA7 B;  2RA1 A;  4O4J E;  4IE0 A;  5F8P A;  4AQF A;  2CMR A;  2L9Q A;  1QSD A;  2EHO A;  1E1H B;  1MMN A;  3AA0 B;  3MA9 A;  4AKI A;  4HKA A;  4J2C A;  2LJL A;  3S4U A;  2KXP B;  3BK9 A;  4H63 H;  2K9A A;  4GOU A;  4IE4 A;  2XAF B;  3KVB A;  3AA1 B;  2ZM0 A;  4AKG A;  4UEL A;  2CM0 A;  4P09 A;  1YKE B;  2X68 A;  3LFM A;  2V7M A;  3FB2 A;  1VRB A;  4X1Y E;  4H63 V;  3RYC E;  1KK7 A;  2J1D G;  5H6Q B;  2HPL A;  4MHC A;  3GMI A;  4QHO A;  3BQL A;  3CX7 B;  1B7T A;  4JUY A;  5JDL A;  4IE5 A;  2Q9Q D;  3LG7 A;  3N9N A;  3Q9D A;  4OHF A;  3UFE A;  3UUN A;  4UXN B;  3VKG A;  2ACX A;  4IHJ E;  4P0A A;  4QXB B;  3SS1 A;  2KLQ A;  2PG8 A;  2MOZ A;  3EDV A;  1MND A;  3M65 A;  4UV8 B;  3ZMU B;  4AKL A;  1WLX A;  3RRC A;  2NTX A;  2X51 A;  3PUA A;  5LNK A;  1BR4 A;  2JJ9 A;  1MMD A;  2Q9Q C;  4WBO A;  3MZK B;  2W62 A;  2LSK A;  4YJ2 E;  5FMN A;  5LA6 E;  1NWM X;  5LJM A;  2DWK A;  4O4I E;  3PE0 A;  4PNI A;  3BQK A;  1IJ5 A;  5L3B B;  3I0Q A;  4UIG A;  3PUS A;  4Z8X A;  4BJM A;  2XAS B;  4KP3 C;  2V7I A;  3B57 A;  4IE7 A;  3UTK A;  4ZI2 C;  4HE8 A;  2E9X B;  3UT5 E;  3ESL A;  4ASK A;  2KT9 A;  2EHO B;  5LHH B;  4UVB B;  3F31 A;  1MIW A;  3RYF E;  5LXT E;  3EDU A;  3DTO A;  3I9W A;  3N9L A;  3CQG B;  2ZLY A;  5JDN A;  4H9S E;  2X0L B;  3N9Q A;  3NZQ A;  3R84 B;  3W15 B;  5KX5 E;  3JC6 C;  5FYM A;  1S35 A;  1HS7 A;  4QWN B;  3I9Y A;  2CWO A;  3LK4 2;  4PAG A;  1O3X A;  1WRD A;  4DMV A;  2PJQ A;  3N5L A;  4QX7 B;  2E9X C;  2D0T A;  4YJ3 E;  2L8K A;  1D1A A;  5LOV E;  4AKR B;  4C90 A;  3V5U A;  3ZYM A;  2V7L A;  4EB6 E;  3KBU A;  3NRY A;  5JDM A;  5CB4 E;  4EIW A;  5J2T E;  2Y48 B;  2Q9Q B;  2JRK A;  2VKO A;  3ETU A;  4DBR A;  3DP7 A;  4HEA A;  4I55 E;  2VAS A;  4EYY R;  2LT3 A;  1WYB A;  1HG5 A;  2ODU A;  5TAO A;  3RX6 A;  3E08 A;  2MTQ A;  4B6X A;  1G73 A;  2LM9 A;  2YIN A;  4AXP A;  4QXH B;  4GYS A;  3J9X 1;  3ZN1 B;  5A1L A;  4H9P C;  5LHG B;  1H7C A;  3OKQ A;  2QGS A;  5FY0 A;  3T8O A;  3RPU A;  5LBQ B;  4L5G A;  2KWI B;  5CA0 E;  4U72 A;  3A5X A;  2I59 A;  2QA7 A;  5DQV A;  3Q2M A;  3ZCI A;  3EUH A;  4YLH A;  4PJN A;  4CI1 B;  2WAU A;  3AB3 B;  4GK5 E;  3ANW B;  2CLY B;  1V9D A;  3V5S A;  3MK7 C;  2H3R A;  2N1G A;  3PU8 A;  4DVD A;  1LRZ A;  4QX8 B;  3HKD E;  5HXR A;  2ODV A;  5C8Y E;  3IBP A;  2LHN A;  2KWH A;  2XUE A;  2E9X D;  3C51 A;  4BAY B;  2XHE B;  3C50 A;  1FMV A;  3U3I A;  4UVA B;  4TV9 E;  2V7J A;  4NUV A;  5KDM C;  1D0X A;  4PK4 A;  5IHY A;  4HTE A;  5H6R B;  3P8C D;  3MXZ A;  3WAJ A;  1UX5 A;  4NUU A;  4CQI A;  4CXX A;  2V1D B;  3ZYK A;  5JR9 C;  3ZMZ B;  2Z6E A;  5AFU L;  5JR9 B;  4ZS2 A;  2RP4 A;  2DNX A;  3FBZ A;  1HCI A;  2C0S A;  2KMF A;  2DWG A;  3FBL A;  2KND A;  3O1J A;  3OBV E;  3ONX A;  2YEV C;  1YD8 G;  4UF0 A;  3HKC E;  2SPC A;  2L3L A;  4XBF B;  4IDZ A;  4KMC A;  3ZCJ A;  3UUX B;  1LVK A;  1ZKE A;  2YK0 A;  3JC6 D;  1UCU A;  1CUN A;  3P7I A;  1YKH B;  4XZC A;  4OYJ A;  5DJQ C;  1ZV4 X;  3HKE E;  2CXL A;  3LK3 B;  2DLR A;  2NP9 A;  2XTL A;  2JPF A;  2NOX A;  3K3N A;  1D0Y A;  4KBM B;  3U78 A;  2WM9 A;  2W0G A;  5HWX A;  4EAH A;  4ISS A;  3AAI A;  2M67 A;  3B13 A;  1MMA A;  1BR2 A;  2YU1 A;  4C91 A;  2ZM2 A;  1QUU A;  4AKH A;  2H7O A;  4EXT A;  3ZN0 B;  4ZHQ E;  4IST A;  4O4H E;  1MIV A;  2KZ7 B;  3R6N A;  4I4T E;  3H37 A;  4M1P A;  2BVM A;  5HXE A;  3MJX A;  4ILU A;  3RC8 A;  2K48 A;  3ZC1 A;  4HFV A;  2ZM8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...