3WI3A

Crystal structure of the sld3/treslin domain from yeast sld3
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
268
structure length
215
Chain Sequence
b'YSDPKEYIESKYYDALFSIHTPLAYFVKSNLVRLKNTCRTKYGSDSYKIAYQAMLQKFLLSIVQFKDRHDNRLLLEPFSSPIADEKRKNCLTKFVIQDENKNSSTIADLCVVLKSREIKLQILLLLEIIGLNDLDWNFRDFDYCEQLDLYLDRACILDILLSSETGTIQEHKKNILDKSKEASLVGFINYVLIPYFNKKVPHAVEFIIQKLKGPS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA replication regulator SLD3
molecule tags Replication regulator
source organism Saccharomyces cerevisiae
publication title Crystal structure of the homology domain of the eukaryotic DNA replication proteins sld3/treslin.
pubmed doi rcsb
total genus 83
structure length 215
sequence length 268
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2013-09-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.2130 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3wi3A00
3WI3A
chains in the Genus database with same CATH superfamily
5LOVE 4NUUA 4IL9A 3EI0A 4PJMA 5JDFA 2UXDT 4DMVA 2BZBA 2B76A 4YJ3E 4I43B 3ZCJA 1N32T 2M6BA 3HKBE 2WMOA 4P1NA 4B3ST 5C8YE 4L5GA 3CPZA 4QWNB 4QXCB 3CX8B 3P4PA 1KF6A 3KVAA 1QUUA 2YK0A 2JMKA 3AEDA 4V1Av 2WWVA 3UULA 3N2KE 3DJBA 1S94A 3ANWA 4O8SA 5HWYA 4AKLA 2BG9B 2W2UA 3AB3B 3K3NA 4GYSA 4EXTA 3E0ZA 2UU9T 4MFRA 2YU2A 1YQ3A 3QK6A 3DTOA 3C4WA 3EUHA 2X0LB 3L39A 4BA9A 3UFGA 1UGOA 5BR8T 2W67A 3OJAA 3S4UA 3IF8B 1ZP0A 2XSAA 4YHJA 5DQVA 3UU5A 3AEFA 4AXPA 5JDHA 5JR9B 4X64T 3FB2A 2NR4A 4P0AA 4A5XA 2I59A 5FNVE 4ZHQE 3HKDE 1IBLT 2UUCT 3Q5DA 5HEHA 3AE7A 4TNVA 5LMUT 3H3AA 4WW0A 5C2TA 2CWOA 3VKGA 3FHNA 5EK3A 2MBGA 4C91A 3IEEA 2IMLA 5ABHA 1W09A 1YW0A 2YINA 4QH5A 4H9SE 5JQGE 3QB5K 4NPPA 1E1HB 2DNXA 4H9NC 3AEEA 2VB6A 1WLXA 3J7Yq 3P4RA 2IW5B 3I9YA 4UVAB 2KMFA 3KFWX 3AE3A 5AQRB 5HCMA 4EOZB 5HXSA 5LHHB 4AKGA 3RC3A 4ILCA 3AE2A 3SFEA 4CI2B 4DR7T 2M67A 2NW7A 3UU6A 4GKKT 4OYJA 2JQKA 1WR0A 3ZMTB 4HWFA 4O2BE 2FJBA 5CGMA 3A5XA 1FMWA 5JDQA 3IBPA 5AQJB 4TWHA 1WYBA 2AE9A 2L8KA 3RPUA 2WY2A 2CHOA 2WDRA 2OLTA 4WYVA 5FMNA 4A56A 4CI1B 1WRDA 2CMRA 4JBWF 4GYRA 5LJNA 2UXBT 5ABEA 4IDOA 2RPAA 4I50E 2DLRA 4PK6A 5E0OA 5H6QB 3ZT6A 4YJ2E 5AQGB 5HEOA 2VQFT 3UTKA 2VKOA 1J5ET 1MIYA 2EHOB 4GK0E 4IE4A 3AE4A 2C5JA 5CA1E 1GQEA 4O4IE 2E2AA 2E9XC 1FMVA 1Z0PA 2H88A 5FL1A 3RX6A 2JQ9A 2XTLA 3JC6D 4O4LE 3ZEFB 3NWIA 4GIWA 2W61A 1JNRA 3U3IA 4DBQA 3CMLA 3SWHA 5LGTB 4U74A 3OTOT 2XJ7A 5AQFB 4JI8T 2ZLYA 2Q9QA 5FY7A 5KX5E 2E9XB 4LF6T 3MZKB 2MOZA 4Z8XA 4X62T 2V1DB 3NVOA 2FJEA 3PUXF 3ZMZB 2OA5A 3NRXA 2NW9A 2MPKA 4TX5A 3PUYF 4JUYA 1ZEEA 3N9NA 3PUQA 2IC6A 3WI3A 5LHGB 2CPTA 2H3RA 2QRXA 2XM2A 1IJ5A 2PG8A 4KP3C 1O3XA 4H9OC 5HXCA 1Z8UA 1UUSA 1ZV4X 1X79A 2HPJA 4H63V 2XQ5A 2VL0A 5AFUL 1W0AA 2XASB 3AEGA 4EIWA 3ESLA 3N9LA 3N9MA 2XHEB 3I0OA 5AQVB 5LA6E 4O2AE 3GA8A 4IHJE 3RRWA 3ZMVB 1CUNA 2PBIA 5FY0A 2W4XA 4YSYA 2KWHA 2WZHA 5LHIB 3P8CD 4LMLA 2LT3A 3L8RA 4IE5A 1FIOA 1LKXA 4DV1T 2PFVA 2IAKA 5LBMA 2H7VC 4GOUA 3B13A 5M4YA 2CRBA 4AQGA 1B7TA 3AAEB 4HFDA 5LNKA 3RYHE 2YKSA 4TWFA 4CXYA 3HL6A 4YLHA 4YTNA 2HHHT 2A3DA 3NBXX 3ZPOA 1N36T 3RC8A 4PW8A 4U7IA 2DCFA 3JAEA 4WBOA 3ZSSA 3NZQA 2XAJB 4KI0F 1LRZA 4U31A 4BAYB 3BK9A 2OV9A 3N2GE 4PJJA 5C3JA 5JDGA 1BR0A 2VK9A 2V8SV 3Q9DA 4ZI3D 2K3WA 3AAAB 3FXDB 2ZM2A 3MXZA 4QXBB 2D0TA 5A1LA 5JRCA 1KEYA 4TWDA 3MK7C 2XPKA 2KWIB 1YXRA 2D2SA 2E5LT 2H7OA 3O1HA 1LVFA 2XM1A 5AQLB 5HEGA 1HF8A 3P4WA 5HYAA 2NTXA 1HNXT 4EGWA 2UXCT 2KT9A 1W0BA 4LF9T 4X20E 5LP6E 4DV6T 2X0YA 4GK5E 4EZHA 3CK6A 3K3OA 5HEJA 2HPLA 3RLFF 2P9BA 3AA7B 2EHOC 3NKZA 2XQAA 3EVYA 3RQUA 4X5TA 1OWAA 3EDUA 1D0YA 2X51A 4HFCA 2BBJA 3Q5EA 1WYCA 2WB5A 4MLKA 3CQGB 2NOXA 1UK5A 3D0TA 3P4SA 2LRKA 5AQNB 5FVLA 2X9HA 3ONXA 2XAGB 3RF1A 2BG9C 2FUPA 2WQYA 3JADA 4JI4T 4AKIA 4UELA 2PJQA 3RKGA 1WCRA 4JI3T 3SOLA 3KVBA 4BJMA 1HCIA 2NW8A 3ETUA 3QNUA 5L3EB 1N34T 4HKAA 1D0ZA 5LGUB 5JDLA 3M65A 4CXXA 3AXJB 3PV0F 5HWXA 2FBWA 4H9PC 4AI6A 5ABFA 4DV7T 5AQHB 4F6RC 2CCQA 3AEAA 5FXZA 3SS1A 3FBZA 1UX4A 3ZC0A 2WP9A 3TLSA 2V7JA 5AQQB 1HG2A 2RA1A 4H9QC 5CFBA 1N33T 1D0XA 1HX1B 2X67A 3HR0A 4TV8E 5DQWA 3ZCIA 4Z91A 1MIVA 2WU5A 2LHRA 2DL1A 5TAOA 4KHPT 4AQYT 3OYZA 4CZZB 3RI5A 3ZMUB 4Q25A 3LK42 4IGUA 3I0QA 3OYXA 4IDQA 5IHYA 1IBKT 3TKLB 3LG7A 2DI4A 4G63A 5AQIB 2D0UA 2V6YA 2XUEA 4AISA 4AKRB 4E7ZA 3KDSE 5L3FB 2LKHA 3RIFA 3PJAA 1HNZT 4A97A 3G06A 4EYUA 2LSJA 3VR8A 5JDNA 3O1IA 5LYJE 3PJAJ 1XMOT 2V7LA 2CBIA 1NENA 3K8PC 4FJOA 4I4TE 2X9YA 3ZSTA 4DR4T 1IJ6A 2VKJA 3RHWA 2BKNA 2KINB 1S35A 3FZHB 3R6NA 3UQ7A 4JI1T 2DWGA 4DNDA 5FVKA 5HXEA 4YFSA 5L3BB 3P50A 5CJ5A 3UUNA 2BS4A 4U3CA 5L2LA 3AVRA 1VCTA 2WMNA 3I9WA 3N5LA 4IE6A 5AQKB 2CM0A 3TLUA 2WBLA 3UU3A 1U5PA 3PUSA 3KV6A 2V7MA 4MALA 4YY3T 4YHHT 3NZPA 4HGAA 5L47A 2RP4A 3JCFA 3OVUA 3HKEE 2QA7A 4X1YE 4JI2T 4B6XA 1UURA 2ODVA 5F3JA 5L3GB 2VL8A 3E08A 2YOEA 2MTQA 4JI5T 4NXNT 3GN5B 4YTPA 1YD8G 1R8IA 4PJNA 4ZS3A 5L3DB 1V9DA 3LBXA 3BQLA 2LJLA 3BQKA 2V7IA 3MJXA 3NRYA 4ILBA 4JEHB 3TLWA 2Y48B 2IUBA 2Y8DA 4HWCA 1KNZA 4HTEA 4L9IA 5AQUB 3P4QA 1KK7A 3ZC1A 4NUVA 1D1CA 2E8IA 2YDSA 1HR0T 3PUVF 2ACZA 2WU2A 4U2ZA 3N2OA 5H6RB 4LFBT 4N78D 3H3MA 2W66A 2X0HA 1SE7A 2EHOD 2K24A 1QLBA 2KSRA 2J4GA 3ONLC 3PE0A 3PDYA 1MIWA 4G2AA 4O4HE 3F31A 4TNWA 5LG4A 4UVCB 2LLYA 1NEKA 3RGLA 3SFDA 4ANJA 4COFA 4HFVA 5J0ZA 4ZI2D 2V7KA 1H7CA 2VWAA 4PAGA 3WAKA 4X1KE 1IZNB 2WDVA 4X66T 1J5WA 1YKEB 2W63A 2WCAA 5LB7B 5FY1A 4AKHA 2BS3A 1M7KA 3MACA 4HFHA 4J2CA 5AQMB 4E7SA 5LJMA 2WWUA 3GMIA 4KBMB 2XAQB 2XSBA 4EZ4A 5LMNT 4DV5T 3ABVA 1IBMT 1MNDA 2NWBA 3C4ZA 3Q5XA 4EYYR 5F8PA 5JTGA 2A72A 4IREA 4LMKA 4ZZCA 2ZM6T 5JR9A 5FXVA 4B3RT 2NP9A 2MYSA 3OBVE 1OXZA 4IDNA 4U2YA 4ZZBA 2LOPA 4YXDA 4UV8B 4X1IE 3UUMA 3VHLA 4K0KT 2V26A 3HKCE 4IE0A 3AE9A 4BJNA 2XQ7A 3OPCA 1OEDA 2L3LA 3X1DA 4F8HA 2XAHB 1MNEA 2WSSV 2XZEA 3FBLA 4IT4A 3UQ4A 2CXFA 5JR9C 3AXJA 4JLEA 2HN2A 3RYIE 4QH4A 4NXMT 4IL4A 3B5MA 4PK4A 4EV6A 2Y6XA 3ZJ2A 2EHOA 5L4EA 2X9WA 1T8BA 4GKJT 3RIAA 4CN6A 1CHUA 3C64A 4DR2T 2C5KT 2CBJA 4IIJE 3C4XA 1WFDA 4IDPA 2LM9A 3OKQA 4P0BA 1MMNA 1M62A 4TUYE 5ABGA 3TLVA 2JPFA 1W9RA 1MMDA 3CX6B 3O9XA 4OK0A 1JNZA 4QH1A 2QYWA 3TLTA 2YEVC 3PURA 4K0UA 1DU2A 4ZOLE 4HEAA 3ETVA 2AXDS 3LK3B 4OYKA 3N9QA 4DR5T 4ADZA 2LE8A 3FZLB 2XQ6A 4PK5A 2GK9A 4H9RC 4M1PA 4UV9B 3ZT7A 4U7YA 3V5UA 5LGNB 2X66A 2XQ4A 4DIDB 2ZMAA 4EEDA 2BDEA 2L9QA 2Q9QD 2VURA 2XAFB 3AE5A 4TV9E 2CXDA 3GWHA 2KLQA 3QC9A 3PU3A 3ZLIA 5LXTE 4DR1T 3T8OA 2XQ8A 4DBRA 4H63H 1T72A 4AQFA 3AECA 3AVSA 4KMCA 5JDMA 3VU7H 3FZMB 2J62A 2YDRA 3FZFB 4DR3T 2LSYA 3AE8A 3BQIA 5IUXA 4LFCT 4YSXA 1T7SA 3B57A 4X65T 3VR9A 5AQPB 5IYZE 3UT5E 3UUXB 5IWAT 5ETWA 4DV4T 1HFAA 3UU4A 1HNWT 3L3PA 4ZI7E 5JH7E 2CE7A 1VCSA 2FJDA 4ISSA 3N9OA 1XWMA 3J9X1 4EAHA 4DV0T 2KNDA 2DWKA 2XQ9A 1QSDA 3LFMA 4TZ4C 2J1DG 4ASKA 4CN1A 4CI3B 5LG3A 3RYFE 2N2NA 5GONE 2X9XA 4QKNA 1NAFA 3EABA 1EZ3A 4JI7T 4YTMA 5FL0A 4EEBA 3AEBA 5AQOB 4XAXB 2BVLA 2N1GA 4ILUA 4JV5T 2LSKA 3LDQB 2X68A 3HI2A 4NIQA 3PUZF 2B1EA 1SA0E 4DO0A 2BG9E 1I6ZA 4ZI3C 3ZMSB 1ZKEA 2J47A 3EDVA 3PTRB 4PFPA 1SUMB 1Y01A 4OFZA 3PUWF 5HEUA 2BKOA 2IHR1 3KINB 5FP3A 3VKHA 5EZYE 2G0UA 3A8YC 1Y64B 2KZ7B 3UU8A 2WAUA 4PJLA 1AJ3A 2W00A 5JVDE 4KHZF 4P09A 2MAWA 5HXHA 2CXLA 1HS7A 4IDZA 2PTFA 4DVDA 3LSVA 2WM9A 2IIUA 3QB5A 2LRLA 2DHRA 2LOSA 1BR1A 4UF0A 5AQTB 4HWDA 3SRZA 5L4HA 1WR6A 5AQSB 3ZJ1A 4WBNE 1L0VA 5CB4E 4ERRA 1G8XA 4DUYT 4HWHA 3RRCA 2BBHA 4KX6A 3HA4A 2JRKA 2ODUA 4LF7T 4U33A 3AE6A 2VKDA 3ONJA 5FYMA 3H37A 3KBUA 2F4VT 2VVNA 1YKHB 5FXWA 3M3ZB 3C50A 4YSZA 3KBTA 1LVKA 1U4QA 1XZYA 4QXHB 4U72A 2R6GF 1OEDE 2Q9QB 3W15B 4JI0T 2CLYB 1SHZC 3AA0B 5FKYA 4PFOA 3V5SA 2XY8B 4MHCA 1ZOYA 1E7PA 2V6YB 4A98A 2WZIA 1XNRT 2LM2A 3RKOA 2JJ9A 2A9UA 2K5BB 2V5DA 5EK4A 3FZKB 4UIGA 1J1JA 3RYCE 1UCUA 2CEAA 2LHNA 3CQCB 5JREA 2XQ3A 1US7B 2CLYC 1OEDB 1KNRA 2C5IT 4O4JE 4UXNB 1KNPA 4HFBA 3RH3A 1ZHCA 2IDOB 5EK2A 4B3TT 4XZCA 3CWZB 2V6XA 3E22E 3DP7A 1UX5A 2JIWA 4HWIB 4Z90A 3ZYLA 5L3CB 4DV3T 5KXJA 2CHNA 3Q2MA 5LCYA 3C51A 1XDPA 2WDQA 1BR4A 3O1JA 2CA5A 2V5CA 3MA9A 1VOMA 4HFEA 4UEMA 5ABFB 4DUZT 4B3MT 5JRCB 3IA3A 3KV5A 1HTJF 2K9AA 5BMVE 4UR9A 3LJCA 4CQIA 3KV9A 2E9XD 2QVAA 3JC6C 1D1BA 1YQ4A 1X9BA 2LKGA 3QOFA 3QUJA 3N9PA 3PU8A 4JI6T 4ZXLA 3R84B 3ZN1B 3AE1A 2VQET 4DMWA 3F57A 5FXXA 4HFIA 4AQFC 2YU1A 3FXEB 4IE7A 4QX7B 4JYAT 2XQYA 3IHRA 5J2TE 2KXPB 4DV2T 1E2AA 4WNKA 3C98B 3Q5WA 1I94T 2BG9A 3KV4A 1G73A 3K1SA 1HG5A 4I0UA 2BVMA 2D9DA 3P7IA 2ACXA 2UXNB 4I55E 5HCJA 5J1GA 4C90A 3ZN0B 3A7MA 5DABA 5J2UE 2BS2A 2E5VA 3AA6B 2N9DA 4ILAA 3RQWA 5KMGP 4LF4T 2Z6EA 3GN5A 4QHOA 2ZM0A 2D5UA 4EB6E 3WAJA 2FJAA 2H89A 1BR2A 3F2EA 5F5WA 2CWYA 4YT0A 1NWMX 3VRBA 5CA0E 2LEHA 4XBFB 1XDOA 1XMQT 1IAPA 2UXXB 4LF5T 4PNIA 2YDQA 1FEWA 4ZS2A 4OX9T 2VVSA 3UUBA 4HE8A 4LF8T 3ANWB 3RIUC 1D1AA 3U78A 5DJQC 4DR6T 2W0GA 3PUGA 1KFYA 3EAMA 3L09A 3LK2B 1HX8A 3LBXB 2WS3A 4JEUB 3CIRA 4CN4A 3ZT5A 2HH7A 2Q9QC 3CX7B 4CXWA 2VKHA 4L0RA 2W62A 4ZI2C 2ES0A 1MMGA 2JMHA 3CQXC 2LSIA 4FI5A 3AAIA 2HN1A 3EHZA 4WZXA 2BKPA 1OEDC 2IC9A 2JQQA 2ZM8A 3PUAA 5HXRA 2UUAT 2K48A 3ZYMA 5LBQB 3JAFA 3RIUA 1FJGT 4ISTA 2E9XA 3CVRA 4KUMB 4OHFA 4LFAT 4UVBB 3UFEA 4MBQA 1MMAA 2NTYA 3AA1B 4QX8B 3O4XE 3ZKRA 3CKDA 5KDMC 3T1YT 3K3QC 1T98A 5ADXL 4LMJA 2I6HA 4AIUA 2M6IA 4UF0B 4TN7B 4ZEYA 3T1HT 3ZYKA 2I0MA 2LSGA 1VRBA 1XNQT 2UUBT 2VASA 2QGSA 2JQHA 3I1AA 3MKDA 4HN9A 2SPCA 2YN6A 5HAXA 3VRAA 2A2FX 2C0SA
chains in the Genus database with same CATH topology
5LOVE 4NUUA 4PJMA 5JDFA 4DMVA 2BZBA 4YJ3E 4I43B 3ZCJA 3HKBE 2WMOA 5C8YE 4L5GA 3CPZA 4QWNB 4QXCB 3CX8B 3KVAA 1QUUA 2YK0A 2JMKA 4V1Av 3UULA 3N2KE 3DJBA 1S94A 3ANWA 4O8SA 5HWYA 4AKLA 3AB3B 4GYSA 3K3NA 4EXTA 3E0ZA 4MFRA 2YU2A 3QK6A 3DTOA 3C4WA 3EUHA 2X0LB 3OJAA 3S4UA 3IF8B 4YHJA 5DQVA 5JDHA 4AXPA 5JR9B 3FB2A 4P0AA 2I59A 5FNVE 4ZHQE 3HKDE 3H3AA 4WW0A 2CWOA 3VKGA 3FHNA 5EK3A 2MBGA 4C91A 3IEEA 1YW0A 2YINA 4H9SE 1E1HB 2DNXA 4H9NC 2VB6A 1WLXA 3J7Yq 2IW5B 3I9YA 4UVAB 2KMFA 3KFWX 4EOZB 5LHHB 5HXSA 4AKGA 3RC3A 4CI2B 2M67A 2NW7A 4OYJA 3ZMTB 4O2BE 3A5XA 1FMWA 5JDQA 3IBPA 3RPUA 1WYBA 3WAKA 2L8KA 4A56A 5FMNA 4CI1B 1WRDA 2CMRA 4GYRA 5LJNA 4I50E 2DLRA 4PK6A 5E0OA 5H6QB 4YJ2E 3UTKA 2VKOA 1MIYA 2EHOB 4GK0E 4IE4A 2C5JA 5CA1E 4O4IE 2E9XC 1FMVA 1Z0PA 3RX6A 2XTLA 3JC6D 4O4LE 3ZEFB 4GIWA 2W61A 4DBQA 3U3IA 3CMLA 3SWHA 5LGTB 4U74A 2ZLYA 2Q9QA 5FY7A 5KX5E 2E9XB 3MZKB 2MOZA 4Z8XA 2V1DB 3ZMZB 2OA5A 3NRXA 2NW9A 4TX5A 3WI3A 4JUYA 1ZEEA 3N9NA 3PUQA 2IC6A 5LHGB 2H3RA 1IJ5A 2PG8A 4KP3C 1O3XA 4H9OC 5HXCA 1ZV4X 1X79A 2HPJA 4H63V 5AFUL 2XASB 4EIWA 3ESLA 3N9LA 3N9MA 2XHEB 3I0OA 5LA6E 4O2AE 3GA8A 4IHJE 3RRWA 3ZMVB 1CUNA 2PBIA 5FY0A 5LHIB 2KWHA 3P8CD 2LT3A 4IE5A 1FIOA 1LKXA 2PFVA 2IAKA 5LBMA 2H7VC 4GOUA 3B13A 5M4YA 4AQGA 1B7TA 3AAEB 5LNKA 3RYHE 4CXYA 3HL6A 4YLHA 2A3DA 3NBXX 3ZPOA 3RC8A 4PW8A 2DCFA 4WBOA 3NZQA 2XAJB 1LRZA 4BAYB 3BK9A 3N2GE 4PJJA 1BR0A 5JDGA 2VK9A 3Q9DA 4ZI3D 3AAAB 4QXBB 3FXDB 2ZM2A 3MXZA 5A1LA 2D0TA 3MK7C 2KWIB 2D2SA 2H7OA 3O1HA 1LVFA 1HF8A 5HYAA 2NTXA 2KT9A 4X20E 5LP6E 4GK5E 3K3OA 2HPLA 2P9BA 3AA7B 2EHOC 3EVYA 1OWAA 3EDUA 1D0YA 2X51A 1WYCA 4MLKA 3CQGB 2NOXA 3D0TA 2X9HA 3ONXA 2XAGB 4AKIA 4UELA 2PJQA 3SOLA 3KVBA 4BJMA 1HCIA 2NW8A 3ETUA 5L3EB 4HKAA 1D0ZA 5LGUB 5JDLA 3M65A 4CXXA 5HWXA 4AI6A 4H9PC 4F6RC 2CCQA 5FXZA 3SS1A 3FBZA 1UX4A 3ZC0A 2V7JA 1HG2A 2RA1A 4H9QC 1D0XA 3HR0A 2X67A 4TV8E 5DQWA 3ZCIA 1MIVA 2LHRA 5TAOA 3OYZA 4CZZB 3ZMUB 3LK42 4IGUA 3I0QA 3OYXA 5IHYA 3TKLB 3LG7A 2DI4A 4G63A 2D0UA 2XUEA 4E7ZA 4AKRB 3KDSE 5L3FB 4EYUA 2LSJA 5JDNA 3O1IA 5LYJE 2V7LA 4FJOA 3K8PC 4I4TE 2X9YA 1IJ6A 2VKJA 2KINB 1S35A 3R6NA 2DWGA 4DNDA 5HXEA 4YFSA 5L3BB 3UUNA 5L2LA 3AVRA 2WMNA 3I9WA 3N5LA 4IE6A 2CM0A 2WBLA 1U5PA 3PUSA 3KV6A 2V7MA 4MALA 3NZPA 4HGAA 2RP4A 4B6XA 3HKEE 2QA7A 4X1YE 5F3JA 5L3GB 2ODVA 2VL8A 3E08A 2MTQA 3GN5B 1YD8G 4PJNA 4ZS3A 5L3DB 1V9DA 3LBXA 3BQLA 2LJLA 3BQKA 2V7IA 3MJXA 3NRYA 4JEHB 3ZN0B 4EZHA 2Y48B 2Y8DA 5JQGE 1KNZA 4HTEA 4L9IA 3ZC1A 1KK7A 4NUVA 1D1CA 2E8IA 5H6RB 3N2OA 4N78D 2K24A 2EHOD 4BJNA 3PE0A 3PDYA 4G2AA 1MIWA 4O4HE 5LG4A 3F31A 4UVCB 4ANJA 4HFVA 4ZI2D 2V7KA 1H7CA 2VWAA 4PAGA 4X1KE 1IZNB 2W63A 1YKEB 5FY1A 4AKHA 3MACA 4J2CA 4E7SA 5LJMA 2WWUA 3GMIA 4KBMB 2XAQB 4EZ4A 1MNDA 2NWBA 3C4ZA 3Q5XA 4EYYR 5F8PA 2A72A 5JR9A 5FXVA 2NP9A 2MYSA 3OBVE 1OXZA 2LOPA 4UV8B 4X1IE 3UUMA 3VHLA 2V26A 3HKCE 4IE0A 2L3LA 2XAHB 1MNEA 2WSSV 3FBLA 2CXFA 5JR9C 4JLEA 3RYIE 4PK4A 2Y6XA 3ZJ2A 2EHOA 2X9WA 3C64A 2C5KT 4IIJE 3C4XA 4TUYE 2LM9A 3OKQA 4P0BA 1MMNA 2JPFA 3CX6B 1MMDA 3O9XA 4OK0A 2YEVC 3PURA 4K0UA 4ZOLE 4HEAA 3ETVA 3LK3B 4OYKA 3N9QA 4ADZA 2LE8A 4PK5A 2GK9A 4H9RC 4M1PA 4UV9B 3V5UA 5LGNB 2X66A 2ZMAA 2BDEA 2L9QA 2Q9QD 2XAFB 4TV9E 2CXDA 3GWHA 2KLQA 3QC9A 3PU3A 3ZLIA 5LXTE 3T8OA 4DBRA 4H63H 4AQFA 3AVSA 4KMCA 5JDMA 3VU7H 2LSYA 3BQIA 3B57A 5IYZE 3UT5E 3UUXB 5ETWA 1HFAA 3L3PA 4ZI7E 5JH7E 2CE7A 4ISSA 3J9X1 3N9OA 4EAHA 2KNDA 2DWKA 1QSDA 3LFMA 4TZ4C 2J1DG 4ASKA 4CI3B 3RYFE 2N2NA 5GONE 2X9XA 4QKNA 1NAFA 1EZ3A 4XAXB 2BVLA 2N1GA 4ILUA 2LSKA 2X68A 3HI2A 4DO0A 2B1EA 1SA0E 4ZI3C 3ZMSB 1ZKEA 3EDVA 3PTRB 4PFPA 4OFZA 3KINB 5FP3A 3VKHA 5EZYE 2G0UA 1Y64B 2KZ7B 2WAUA 4PJLA 1AJ3A 2W00A 5JVDE 4P09A 5HXHA 2CXLA 1HS7A 4IDZA 4DVDA 2WM9A 2DHRA 2LOSA 1BR1A 4UF0A 3SRZA 3ZJ1A 1WR6A 4WBNE 4ERRA 5CB4E 1G8XA 3RRCA 3HA4A 2JRKA 2ODUA 2VKDA 5FYMA 3H37A 3KBUA 1YKHB 5FXWA 3C50A 3KBTA 1LVKA 1U4QA 4QXHB 4U72A 2Q9QB 3W15B 2CLYB 1SHZC 3AA0B 4PFOA 3V5SA 4MHCA 3RKOA 2JJ9A 2K5BB 5EK4A 5JREA 4UIGA 3RYCE 1UCUA 2CEAA 2LHNA 3CQCB 1US7B 2CLYC 2C5IT 4O4JE 4UXNB 3RH3A 1ZHCA 5EK2A 4XZCA 3CWZB 3E22E 3DP7A 1UX5A 3ZYLA 5L3CB 3Q2MA 5LCYA 3C51A 1BR4A 3O1JA 2CA5A 3MA9A 4UEMA 1VOMA 5JRCB 3KV5A 1HTJF 2K9AA 5BMVE 3LJCA 4CQIA 3KV9A 2E9XD 3JC6C 1D1BA 3QUJA 3N9PA 3PU8A 3R84B 3ZN1B 4DMWA 3F57A 5FXXA 4AQFC 2YU1A 3FXEB 4IE7A 4QX7B 2XQYA 3IHRA 5J2TE 2KXPB 4WNKA 3C98B 3Q5WA 3KV4A 1G73A 1HG5A 5J1GA 2BVMA 3P7IA 2ACXA 2UXNB 4I55E 4C90A 5DABA 5J2UE 3AA6B 5JRCA 2N9DA 5KMGP 2Z6EA 3GN5A 4QHOA 2ZM0A 2D5UA 4EB6E 3WAJA 1BR2A 3F2EA 2CWYA 1NWMX 5CA0E 2LEHA 4XBFB 1IAPA 2UXXB 4PNIA 1FEWA 4ZS2A 4HE8A 3ANWB 3U78A 1D1AA 5DJQC 2W0GA 3PUGA 3LK2B 3L09A 1HX8A 3LBXB 4JEUB 4CXWA 2HH7A 2Q9QC 3CX7B 2VKHA 4L0RA 2W62A 4ZI2C 2ES0A 1MMGA 2JMHA 3CQXC 2LSIA 4FI5A 3AAIA 2ZM8A 2IC9A 2JQQA 3PUAA 5HXRA 2K48A 3ZYMA 5LBQB 4ISTA 2E9XA 3CVRA 4KUMB 4OHFA 4UVBB 3UFEA 4MBQA 1MMAA 2NTYA 3AA1B 4QX8B 3O4XE 3CKDA 5KDMC 3K3QC 1T98A 5ADXL 4UF0B 4TN7B 3ZYKA 2LSGA 1VRBA 2VASA 2QGSA 3I1AA 3MKDA 4HN9A 2SPCA 4BA9A 5HAXA 2A2FX 2C0SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WI3 A; 
#chains in the Genus database with same CATH topology
 5LOV E;  4NUU A;  4IL9 A;  3EI0 A;  4PJM A;  5JDF A;  2UXD T;  4DMV A;  2BZB A;  2B76 A;  4YJ3 E;  4I43 B;  3ZCJ A;  1N32 T;  2M6B A;  3HKB E;  2WMO A;  4P1N A;  4B3S T;  5C8Y E;  4L5G A;  3CPZ A;  4QWN B;  4QXC B;  3CX8 B;  3P4P A;  1KF6 A;  3KVA A;  1QUU A;  2YK0 A;  2JMK A;  3AED A;  4V1A v;  2WWV A;  3UUL A;  3N2K E;  3DJB A;  1S94 A;  3ANW A;  4O8S A;  5HWY A;  4AKL A;  2BG9 B;  2W2U A;  3AB3 B;  3K3N A;  4GYS A;  4EXT A;  3E0Z A;  2UU9 T;  4MFR A;  2YU2 A;  1YQ3 A;  3QK6 A;  3DTO A;  3C4W A;  3EUH A;  2X0L B;  3L39 A;  4BA9 A;  3UFG A;  1UGO A;  5BR8 T;  2W67 A;  3OJA A;  3S4U A;  3IF8 B;  1ZP0 A;  2XSA A;  4YHJ A;  5DQV A;  3UU5 A;  3AEF A;  4AXP A;  5JDH A;  5JR9 B;  4X64 T;  3FB2 A;  2NR4 A;  4P0A A;  4A5X A;  2I59 A;  5FNV E;  4ZHQ E;  3HKD E;  1IBL T;  2UUC T;  3Q5D A;  5HEH A;  3AE7 A;  4TNV A;  5LMU T;  3H3A A;  4WW0 A;  5C2T A;  2CWO A;  3VKG A;  3FHN A;  5EK3 A;  2MBG A;  4C91 A;  3IEE A;  2IML A;  5ABH A;  1W09 A;  1YW0 A;  2YIN A;  4QH5 A;  4H9S E;  5JQG E;  3QB5 K;  4NPP A;  1E1H B;  2DNX A;  4H9N C;  3AEE A;  2VB6 A;  1WLX A;  3J7Y q;  3P4R A;  2IW5 B;  3I9Y A;  4UVA B;  2KMF A;  3KFW X;  3AE3 A;  5AQR B;  5HCM A;  4EOZ B;  5HXS A;  5LHH B;  4AKG A;  3RC3 A;  4ILC A;  3AE2 A;  3SFE A;  4CI2 B;  4DR7 T;  2M67 A;  2NW7 A;  3UU6 A;  4GKK T;  4OYJ A;  2JQK A;  1WR0 A;  3ZMT B;  4HWF A;  4O2B E;  2FJB A;  5CGM A;  3A5X A;  1FMW A;  5JDQ A;  3IBP A;  5AQJ B;  4TWH A;  1WYB A;  2AE9 A;  2L8K A;  3RPU A;  2WY2 A;  2CHO A;  2WDR A;  2OLT A;  4WYV A;  5FMN A;  4A56 A;  4CI1 B;  1WRD A;  2CMR A;  4JBW F;  4GYR A;  5LJN A;  2UXB T;  5ABE A;  4IDO A;  2RPA A;  4I50 E;  2DLR A;  4PK6 A;  5E0O A;  5H6Q B;  3ZT6 A;  4YJ2 E;  5AQG B;  5HEO A;  2VQF T;  3UTK A;  2VKO A;  1J5E T;  1MIY A;  2EHO B;  4GK0 E;  4IE4 A;  3AE4 A;  2C5J A;  5CA1 E;  1GQE A;  4O4I E;  2E2A A;  2E9X C;  1FMV A;  1Z0P A;  2H88 A;  5FL1 A;  3RX6 A;  2JQ9 A;  2XTL A;  3JC6 D;  4O4L E;  3ZEF B;  3NWI A;  4GIW A;  2W61 A;  1JNR A;  3U3I A;  4DBQ A;  3CML A;  3SWH A;  5LGT B;  4U74 A;  3OTO T;  2XJ7 A;  5AQF B;  4JI8 T;  2ZLY A;  2Q9Q A;  5FY7 A;  5KX5 E;  2E9X B;  4LF6 T;  3MZK B;  2MOZ A;  4Z8X A;  4X62 T;  2V1D B;  3NVO A;  2FJE A;  3PUX F;  3ZMZ B;  2OA5 A;  3NRX A;  2NW9 A;  2MPK A;  4TX5 A;  3PUY F;  4JUY A;  1ZEE A;  3N9N A;  3PUQ A;  2IC6 A;  3WI3 A;  5LHG B;  2CPT A;  2H3R A;  2QRX A;  2XM2 A;  1IJ5 A;  2PG8 A;  4KP3 C;  1O3X A;  4H9O C;  5HXC A;  1Z8U A;  1UUS A;  1ZV4 X;  1X79 A;  2HPJ A;  4H63 V;  2XQ5 A;  2VL0 A;  5AFU L;  1W0A A;  2XAS B;  3AEG A;  4EIW A;  3ESL A;  3N9L A;  3N9M A;  2XHE B;  3I0O A;  5AQV B;  5LA6 E;  4O2A E;  3GA8 A;  4IHJ E;  3RRW A;  3ZMV B;  1CUN A;  2PBI A;  5FY0 A;  2W4X A;  4YSY A;  2KWH A;  2WZH A;  5LHI B;  3P8C D;  4LML A;  2LT3 A;  3L8R A;  4IE5 A;  1FIO A;  1LKX A;  4DV1 T;  2PFV A;  2IAK A;  5LBM A;  2H7V C;  4GOU A;  3B13 A;  5M4Y A;  2CRB A;  4AQG A;  1B7T A;  3AAE B;  4HFD A;  5LNK A;  3RYH E;  2YKS A;  4TWF A;  4CXY A;  3HL6 A;  4YLH A;  4YTN A;  2HHH T;  2A3D A;  3NBX X;  3ZPO A;  1N36 T;  3RC8 A;  4PW8 A;  4U7I A;  2DCF A;  3JAE A;  4WBO A;  3ZSS A;  3NZQ A;  2XAJ B;  4KI0 F;  1LRZ A;  4U31 A;  4BAY B;  3BK9 A;  2OV9 A;  3N2G E;  4PJJ A;  5C3J A;  5JDG A;  1BR0 A;  2VK9 A;  2V8S V;  3Q9D A;  4ZI3 D;  2K3W A;  3AAA B;  3FXD B;  2ZM2 A;  3MXZ A;  4QXB B;  2D0T A;  5A1L A;  5JRC A;  1KEY A;  4TWD A;  3MK7 C;  2XPK A;  2KWI B;  1YXR A;  2D2S A;  2E5L T;  2H7O A;  3O1H A;  1LVF A;  2XM1 A;  5AQL B;  5HEG A;  1HF8 A;  3P4W A;  5HYA A;  2NTX A;  1HNX T;  4EGW A;  2UXC T;  2KT9 A;  1W0B A;  4LF9 T;  4X20 E;  5LP6 E;  4DV6 T;  2X0Y A;  4GK5 E;  4EZH A;  3CK6 A;  3K3O A;  5HEJ A;  2HPL A;  3RLF F;  2P9B A;  3AA7 B;  2EHO C;  3NKZ A;  2XQA A;  3EVY A;  3RQU A;  4X5T A;  1OWA A;  3EDU A;  1D0Y A;  2X51 A;  4HFC A;  2BBJ A;  3Q5E A;  1WYC A;  2WB5 A;  4MLK A;  3CQG B;  2NOX A;  1UK5 A;  3D0T A;  3P4S A;  2LRK A;  5AQN B;  5FVL A;  2X9H A;  3ONX A;  2XAG B;  3RF1 A;  2BG9 C;  2FUP A;  2WQY A;  3JAD A;  4JI4 T;  4AKI A;  4UEL A;  2PJQ A;  3RKG A;  1WCR A;  4JI3 T;  3SOL A;  3KVB A;  4BJM A;  1HCI A;  2NW8 A;  3ETU A;  3QNU A;  5L3E B;  1N34 T;  4HKA A;  1D0Z A;  5LGU B;  5JDL A;  3M65 A;  4CXX A;  3AXJ B;  3PV0 F;  5HWX A;  2FBW A;  4H9P C;  4AI6 A;  5ABF A;  4DV7 T;  5AQH B;  4F6R C;  2CCQ A;  3AEA A;  5FXZ A;  3SS1 A;  3FBZ A;  1UX4 A;  3ZC0 A;  2WP9 A;  3TLS A;  2V7J A;  5AQQ B;  1HG2 A;  2RA1 A;  4H9Q C;  5CFB A;  1N33 T;  1D0X A;  1HX1 B;  2X67 A;  3HR0 A;  4TV8 E;  5DQW A;  3ZCI A;  4Z91 A;  1MIV A;  2WU5 A;  2LHR A;  2DL1 A;  5TAO A;  4KHP T;  4AQY T;  3OYZ A;  4CZZ B;  3RI5 A;  3ZMU B;  4Q25 A;  3LK4 2;  4IGU A;  3I0Q A;  3OYX A;  4IDQ A;  5IHY A;  1IBK T;  3TKL B;  3LG7 A;  2DI4 A;  4G63 A;  5AQI B;  2D0U A;  2V6Y A;  2XUE A;  4AIS A;  4AKR B;  4E7Z A;  3KDS E;  5L3F B;  2LKH A;  3RIF A;  3PJA A;  1HNZ T;  4A97 A;  3G06 A;  4EYU A;  2LSJ A;  3VR8 A;  5JDN A;  3O1I A;  5LYJ E;  3PJA J;  1XMO T;  2V7L A;  2CBI A;  1NEN A;  3K8P C;  4FJO A;  4I4T E;  2X9Y A;  3ZST A;  4DR4 T;  1IJ6 A;  2VKJ A;  3RHW A;  2BKN A;  2KIN B;  1S35 A;  3FZH B;  3R6N A;  3UQ7 A;  4JI1 T;  2DWG A;  4DND A;  5FVK A;  5HXE A;  4YFS A;  5L3B B;  3P50 A;  5CJ5 A;  3UUN A;  2BS4 A;  4U3C A;  5L2L A;  3AVR A;  1VCT A;  2WMN A;  3I9W A;  3N5L A;  4IE6 A;  5AQK B;  2CM0 A;  3TLU A;  2WBL A;  3UU3 A;  1U5P A;  3PUS A;  3KV6 A;  2V7M A;  4MAL A;  4YY3 T;  4YHH T;  3NZP A;  4HGA A;  5L47 A;  2RP4 A;  3JCF A;  3OVU A;  3HKE E;  2QA7 A;  4X1Y E;  4JI2 T;  4B6X A;  1UUR A;  2ODV A;  5F3J A;  5L3G B;  2VL8 A;  3E08 A;  2YOE A;  2MTQ A;  4JI5 T;  4NXN T;  3GN5 B;  4YTP A;  1YD8 G;  1R8I A;  4PJN A;  4ZS3 A;  5L3D B;  1V9D A;  3LBX A;  3BQL A;  2LJL A;  3BQK A;  2V7I A;  3MJX A;  3NRY A;  4ILB A;  4JEH B;  3TLW A;  2Y48 B;  2IUB A;  2Y8D A;  4HWC A;  1KNZ A;  4HTE A;  4L9I A;  5AQU B;  3P4Q A;  1KK7 A;  3ZC1 A;  4NUV A;  1D1C A;  2E8I A;  2YDS A;  1HR0 T;  3PUV F;  2ACZ A;  2WU2 A;  4U2Z A;  3N2O A;  5H6R B;  4LFB T;  4N78 D;  3H3M A;  2W66 A;  2X0H A;  1SE7 A;  2EHO D;  2K24 A;  1QLB A;  2KSR A;  2J4G A;  3ONL C;  3PE0 A;  3PDY A;  1MIW A;  4G2A A;  4O4H E;  3F31 A;  4TNW A;  5LG4 A;  4UVC B;  2LLY A;  1NEK A;  3RGL A;  3SFD A;  4ANJ A;  4COF A;  4HFV A;  5J0Z A;  4ZI2 D;  2V7K A;  1H7C A;  2VWA A;  4PAG A;  3WAK A;  4X1K E;  1IZN B;  2WDV A;  4X66 T;  1J5W A;  1YKE B;  2W63 A;  2WCA A;  5LB7 B;  5FY1 A;  4AKH A;  2BS3 A;  1M7K A;  3MAC A;  4HFH A;  4J2C A;  5AQM B;  4E7S A;  5LJM A;  2WWU A;  3GMI A;  4KBM B;  2XAQ B;  2XSB A;  4EZ4 A;  5LMN T;  4DV5 T;  3ABV A;  1IBM T;  1MND A;  2NWB A;  3C4Z A;  3Q5X A;  4EYY R;  5F8P A;  5JTG A;  2A72 A;  4IRE A;  4LMK A;  4ZZC A;  2ZM6 T;  5JR9 A;  5FXV A;  4B3R T;  2NP9 A;  2MYS A;  3OBV E;  1OXZ A;  4IDN A;  4U2Y A;  4ZZB A;  2LOP A;  4YXD A;  4UV8 B;  4X1I E;  3UUM A;  3VHL A;  4K0K T;  2V26 A;  3HKC E;  4IE0 A;  3AE9 A;  4BJN A;  2XQ7 A;  3OPC A;  1OED A;  2L3L A;  3X1D A;  4F8H A;  2XAH B;  1MNE A;  2WSS V;  2XZE A;  3FBL A;  4IT4 A;  3UQ4 A;  2CXF A;  5JR9 C;  3AXJ A;  4JLE A;  2HN2 A;  3RYI E;  4QH4 A;  4NXM T;  4IL4 A;  3B5M A;  4PK4 A;  4EV6 A;  2Y6X A;  3ZJ2 A;  2EHO A;  5L4E A;  2X9W A;  1T8B A;  4GKJ T;  3RIA A;  4CN6 A;  1CHU A;  3C64 A;  4DR2 T;  2C5K T;  2CBJ A;  4IIJ E;  3C4X A;  1WFD A;  4IDP A;  2LM9 A;  3OKQ A;  4P0B A;  1MMN A;  1M62 A;  4TUY E;  5ABG A;  3TLV A;  2JPF A;  1W9R A;  1MMD A;  3CX6 B;  3O9X A;  4OK0 A;  1JNZ A;  4QH1 A;  2QYW A;  3TLT A;  2YEV C;  3PUR A;  4K0U A;  1DU2 A;  4ZOL E;  4HEA A;  3ETV A;  2AXD S;  3LK3 B;  4OYK A;  3N9Q A;  4DR5 T;  4ADZ A;  2LE8 A;  3FZL B;  2XQ6 A;  4PK5 A;  2GK9 A;  4H9R C;  4M1P A;  4UV9 B;  3ZT7 A;  4U7Y A;  3V5U A;  5LGN B;  2X66 A;  2XQ4 A;  4DID B;  2ZMA A;  4EED A;  2BDE A;  2L9Q A;  2Q9Q D;  2VUR A;  2XAF B;  3AE5 A;  4TV9 E;  2CXD A;  3GWH A;  2KLQ A;  3QC9 A;  3PU3 A;  3ZLI A;  5LXT E;  4DR1 T;  3T8O A;  2XQ8 A;  4DBR A;  4H63 H;  1T72 A;  4AQF A;  3AEC A;  3AVS A;  4KMC A;  5JDM A;  3VU7 H;  3FZM B;  2J62 A;  2YDR A;  3FZF B;  4DR3 T;  2LSY A;  3AE8 A;  3BQI A;  5IUX A;  4LFC T;  4YSX A;  1T7S A;  3B57 A;  4X65 T;  3VR9 A;  5AQP B;  5IYZ E;  3UT5 E;  3UUX B;  5IWA T;  5ETW A;  4DV4 T;  1HFA A;  3UU4 A;  1HNW T;  3L3P A;  4ZI7 E;  5JH7 E;  2CE7 A;  1VCS A;  2FJD A;  4ISS A;  3N9O A;  1XWM A;  3J9X 1;  4EAH A;  4DV0 T;  2KND A;  2DWK A;  2XQ9 A;  1QSD A;  3LFM A;  4TZ4 C;  2J1D G;  4ASK A;  4CN1 A;  4CI3 B;  5LG3 A;  3RYF E;  2N2N A;  5GON E;  2X9X A;  4QKN A;  1NAF A;  3EAB A;  1EZ3 A;  4JI7 T;  4YTM A;  5FL0 A;  4EEB A;  3AEB A;  5AQO B;  4XAX B;  2BVL A;  2N1G A;  4ILU A;  4JV5 T;  2LSK A;  3LDQ B;  2X68 A;  3HI2 A;  4NIQ A;  3PUZ F;  2B1E A;  1SA0 E;  4DO0 A;  2BG9 E;  1I6Z A;  4ZI3 C;  3ZMS B;  1ZKE A;  2J47 A;  3EDV A;  3PTR B;  4PFP A;  1SUM B;  1Y01 A;  4OFZ A;  3PUW F;  5HEU A;  2BKO A;  2IHR 1;  3KIN B;  5FP3 A;  3VKH A;  5EZY E;  2G0U A;  3A8Y C;  1Y64 B;  2KZ7 B;  3UU8 A;  2WAU A;  4PJL A;  1AJ3 A;  2W00 A;  5JVD E;  4KHZ F;  4P09 A;  2MAW A;  5HXH A;  2CXL A;  1HS7 A;  4IDZ A;  2PTF A;  4DVD A;  3LSV A;  2WM9 A;  2IIU A;  3QB5 A;  2LRL A;  2DHR A;  2LOS A;  1BR1 A;  4UF0 A;  5AQT B;  4HWD A;  3SRZ A;  5L4H A;  1WR6 A;  5AQS B;  3ZJ1 A;  4WBN E;  1L0V A;  5CB4 E;  4ERR A;  1G8X A;  4DUY T;  4HWH A;  3RRC A;  2BBH A;  4KX6 A;  3HA4 A;  2JRK A;  2ODU A;  4LF7 T;  4U33 A;  3AE6 A;  2VKD A;  3ONJ A;  5FYM A;  3H37 A;  3KBU A;  2F4V T;  2VVN A;  1YKH B;  5FXW A;  3M3Z B;  3C50 A;  4YSZ A;  3KBT A;  1LVK A;  1U4Q A;  1XZY A;  4QXH B;  4U72 A;  2R6G F;  1OED E;  2Q9Q B;  3W15 B;  4JI0 T;  2CLY B;  1SHZ C;  3AA0 B;  5FKY A;  4PFO A;  3V5S A;  2XY8 B;  4MHC A;  1ZOY A;  1E7P A;  2V6Y B;  4A98 A;  2WZI A;  1XNR T;  2LM2 A;  3RKO A;  2JJ9 A;  2A9U A;  2K5B B;  2V5D A;  5EK4 A;  3FZK B;  4UIG A;  1J1J A;  3RYC E;  1UCU A;  2CEA A;  2LHN A;  3CQC B;  5JRE A;  2XQ3 A;  1US7 B;  2CLY C;  1OED B;  1KNR A;  2C5I T;  4O4J E;  4UXN B;  1KNP A;  4HFB A;  3RH3 A;  1ZHC A;  2IDO B;  5EK2 A;  4B3T T;  4XZC A;  3CWZ B;  2V6X A;  3E22 E;  3DP7 A;  1UX5 A;  2JIW A;  4HWI B;  4Z90 A;  3ZYL A;  5L3C B;  4DV3 T;  5KXJ A;  2CHN A;  3Q2M A;  5LCY A;  3C51 A;  1XDP A;  2WDQ A;  1BR4 A;  3O1J A;  2CA5 A;  2V5C A;  3MA9 A;  1VOM A;  4HFE A;  4UEM A;  5ABF B;  4DUZ T;  4B3M T;  5JRC B;  3IA3 A;  3KV5 A;  1HTJ F;  2K9A A;  5BMV E;  4UR9 A;  3LJC A;  4CQI A;  3KV9 A;  2E9X D;  2QVA A;  3JC6 C;  1D1B A;  1YQ4 A;  1X9B A;  2LKG A;  3QOF A;  3QUJ A;  3N9P A;  3PU8 A;  4JI6 T;  4ZXL A;  3R84 B;  3ZN1 B;  3AE1 A;  2VQE T;  4DMW A;  3F57 A;  5FXX A;  4HFI A;  4AQF C;  2YU1 A;  3FXE B;  4IE7 A;  4QX7 B;  4JYA T;  2XQY A;  3IHR A;  5J2T E;  2KXP B;  4DV2 T;  1E2A A;  4WNK A;  3C98 B;  3Q5W A;  1I94 T;  2BG9 A;  3KV4 A;  1G73 A;  3K1S A;  1HG5 A;  4I0U A;  2BVM A;  2D9D A;  3P7I A;  2ACX A;  2UXN B;  4I55 E;  5HCJ A;  5J1G A;  4C90 A;  3ZN0 B;  3A7M A;  5DAB A;  5J2U E;  2BS2 A;  2E5V A;  3AA6 B;  2N9D A;  4ILA A;  3RQW A;  5KMG P;  4LF4 T;  2Z6E A;  3GN5 A;  4QHO A;  2ZM0 A;  2D5U A;  4EB6 E;  3WAJ A;  2FJA A;  2H89 A;  1BR2 A;  3F2E A;  5F5W A;  2CWY A;  4YT0 A;  1NWM X;  3VRB A;  5CA0 E;  2LEH A;  4XBF B;  1XDO A;  1XMQ T;  1IAP A;  2UXX B;  4LF5 T;  4PNI A;  2YDQ A;  1FEW A;  4ZS2 A;  4OX9 T;  2VVS A;  3UUB A;  4HE8 A;  4LF8 T;  3ANW B;  3RIU C;  1D1A A;  3U78 A;  5DJQ C;  4DR6 T;  2W0G A;  3PUG A;  1KFY A;  3EAM A;  3L09 A;  3LK2 B;  1HX8 A;  3LBX B;  2WS3 A;  4JEU B;  3CIR A;  4CN4 A;  3ZT5 A;  2HH7 A;  2Q9Q C;  3CX7 B;  4CXW A;  2VKH A;  4L0R A;  2W62 A;  4ZI2 C;  2ES0 A;  1MMG A;  2JMH A;  3CQX C;  2LSI A;  4FI5 A;  3AAI A;  2HN1 A;  3EHZ A;  4WZX A;  2BKP A;  1OED C;  2IC9 A;  2JQQ A;  2ZM8 A;  3PUA A;  5HXR A;  2UUA T;  2K48 A;  3ZYM A;  5LBQ B;  3JAF A;  3RIU A;  1FJG T;  4IST A;  2E9X A;  3CVR A;  4KUM B;  4OHF A;  4LFA T;  4UVB B;  3UFE A;  4MBQ A;  1MMA A;  2NTY A;  3AA1 B;  4QX8 B;  3O4X E;  3ZKR A;  3CKD A;  5KDM C;  3T1Y T;  3K3Q C;  1T98 A;  5ADX L;  4LMJ A;  2I6H A;  4AIU A;  2M6I A;  4UF0 B;  4TN7 B;  4ZEY A;  3T1H T;  3ZYK A;  2I0M A;  2LSG A;  1VRB A;  1XNQ T;  2UUB T;  2VAS A;  2QGS A;  2JQH A;  3I1A A;  3MKD A;  4HN9 A;  2SPC A;  2YN6 A;  5HAX A;  3VRA A;  2A2F X;  2C0S A; 
#chains in the Genus database with same CATH homology
 5LOV E;  4NUU A;  4PJM A;  5JDF A;  4DMV A;  2BZB A;  4YJ3 E;  4I43 B;  3ZCJ A;  3HKB E;  2WMO A;  5C8Y E;  4L5G A;  3CPZ A;  4QWN B;  4QXC B;  3CX8 B;  3KVA A;  1QUU A;  2YK0 A;  2JMK A;  4V1A v;  3UUL A;  3N2K E;  3DJB A;  1S94 A;  3ANW A;  4O8S A;  5HWY A;  4AKL A;  3AB3 B;  4GYS A;  3K3N A;  4EXT A;  3E0Z A;  4MFR A;  2YU2 A;  3QK6 A;  3DTO A;  3C4W A;  3EUH A;  2X0L B;  3OJA A;  3S4U A;  3IF8 B;  4YHJ A;  5DQV A;  5JDH A;  4AXP A;  5JR9 B;  3FB2 A;  4P0A A;  2I59 A;  5FNV E;  4ZHQ E;  3HKD E;  3H3A A;  4WW0 A;  2CWO A;  3VKG A;  3FHN A;  5EK3 A;  2MBG A;  4C91 A;  3IEE A;  1YW0 A;  2YIN A;  4H9S E;  1E1H B;  2DNX A;  4H9N C;  2VB6 A;  1WLX A;  3J7Y q;  2IW5 B;  3I9Y A;  4UVA B;  2KMF A;  3KFW X;  4EOZ B;  5LHH B;  5HXS A;  4AKG A;  3RC3 A;  4CI2 B;  2M67 A;  2NW7 A;  4OYJ A;  3ZMT B;  4O2B E;  3A5X A;  1FMW A;  5JDQ A;  3IBP A;  3RPU A;  1WYB A;  3WAK A;  2L8K A;  4A56 A;  5FMN A;  4CI1 B;  1WRD A;  2CMR A;  4GYR A;  5LJN A;  4I50 E;  2DLR A;  4PK6 A;  5E0O A;  5H6Q B;  4YJ2 E;  3UTK A;  2VKO A;  1MIY A;  2EHO B;  4GK0 E;  4IE4 A;  2C5J A;  5CA1 E;  4O4I E;  2E9X C;  1FMV A;  1Z0P A;  3RX6 A;  2XTL A;  3JC6 D;  4O4L E;  3ZEF B;  4GIW A;  2W61 A;  4DBQ A;  3U3I A;  3CML A;  3SWH A;  5LGT B;  4U74 A;  2ZLY A;  2Q9Q A;  5FY7 A;  5KX5 E;  2E9X B;  3MZK B;  2MOZ A;  4Z8X A;  2V1D B;  3ZMZ B;  2OA5 A;  3NRX A;  2NW9 A;  4TX5 A;  3WI3 A;  4JUY A;  1ZEE A;  3N9N A;  3PUQ A;  2IC6 A;  5LHG B;  2H3R A;  1IJ5 A;  2PG8 A;  4KP3 C;  1O3X A;  4H9O C;  5HXC A;  1ZV4 X;  1X79 A;  2HPJ A;  4H63 V;  5AFU L;  2XAS B;  4EIW A;  3ESL A;  3N9L A;  3N9M A;  2XHE B;  3I0O A;  5LA6 E;  4O2A E;  3GA8 A;  4IHJ E;  3RRW A;  3ZMV B;  1CUN A;  2PBI A;  5FY0 A;  5LHI B;  2KWH A;  3P8C D;  2LT3 A;  4IE5 A;  1FIO A;  1LKX A;  2PFV A;  2IAK A;  5LBM A;  2H7V C;  4GOU A;  3B13 A;  5M4Y A;  4AQG A;  1B7T A;  3AAE B;  5LNK A;  3RYH E;  4CXY A;  3HL6 A;  4YLH A;  2A3D A;  3NBX X;  3ZPO A;  3RC8 A;  4PW8 A;  2DCF A;  4WBO A;  3NZQ A;  2XAJ B;  1LRZ A;  4BAY B;  3BK9 A;  3N2G E;  4PJJ A;  1BR0 A;  5JDG A;  2VK9 A;  3Q9D A;  4ZI3 D;  3AAA B;  4QXB B;  3FXD B;  2ZM2 A;  3MXZ A;  5A1L A;  2D0T A;  3MK7 C;  2KWI B;  2D2S A;  2H7O A;  3O1H A;  1LVF A;  1HF8 A;  5HYA A;  2NTX A;  2KT9 A;  4X20 E;  5LP6 E;  4GK5 E;  3K3O A;  2HPL A;  2P9B A;  3AA7 B;  2EHO C;  3EVY A;  1OWA A;  3EDU A;  1D0Y A;  2X51 A;  1WYC A;  4MLK A;  3CQG B;  2NOX A;  3D0T A;  2X9H A;  3ONX A;  2XAG B;  4AKI A;  4UEL A;  2PJQ A;  3SOL A;  3KVB A;  4BJM A;  1HCI A;  2NW8 A;  3ETU A;  5L3E B;  4HKA A;  1D0Z A;  5LGU B;  5JDL A;  3M65 A;  4CXX A;  5HWX A;  4AI6 A;  4H9P C;  4F6R C;  2CCQ A;  5FXZ A;  3SS1 A;  3FBZ A;  1UX4 A;  3ZC0 A;  2V7J A;  1HG2 A;  2RA1 A;  4H9Q C;  1D0X A;  3HR0 A;  2X67 A;  4TV8 E;  5DQW A;  3ZCI A;  1MIV A;  2LHR A;  5TAO A;  3OYZ A;  4CZZ B;  3ZMU B;  3LK4 2;  4IGU A;  3I0Q A;  3OYX A;  5IHY A;  3TKL B;  3LG7 A;  2DI4 A;  4G63 A;  2D0U A;  2XUE A;  4E7Z A;  4AKR B;  3KDS E;  5L3F B;  4EYU A;  2LSJ A;  5JDN A;  3O1I A;  5LYJ E;  2V7L A;  4FJO A;  3K8P C;  4I4T E;  2X9Y A;  1IJ6 A;  2VKJ A;  2KIN B;  1S35 A;  3R6N A;  2DWG A;  4DND A;  5HXE A;  4YFS A;  5L3B B;  3UUN A;  5L2L A;  3AVR A;  2WMN A;  3I9W A;  3N5L A;  4IE6 A;  2CM0 A;  2WBL A;  1U5P A;  3PUS A;  3KV6 A;  2V7M A;  4MAL A;  3NZP A;  4HGA A;  2RP4 A;  4B6X A;  3HKE E;  2QA7 A;  4X1Y E;  5F3J A;  5L3G B;  2ODV A;  2VL8 A;  3E08 A;  2MTQ A;  3GN5 B;  1YD8 G;  4PJN A;  4ZS3 A;  5L3D B;  1V9D A;  3LBX A;  3BQL A;  2LJL A;  3BQK A;  2V7I A;  3MJX A;  3NRY A;  4JEH B;  3ZN0 B;  4EZH A;  2Y48 B;  2Y8D A;  5JQG E;  1KNZ A;  4HTE A;  4L9I A;  3ZC1 A;  1KK7 A;  4NUV A;  1D1C A;  2E8I A;  5H6R B;  3N2O A;  4N78 D;  2K24 A;  2EHO D;  4BJN A;  3PE0 A;  3PDY A;  4G2A A;  1MIW A;  4O4H E;  5LG4 A;  3F31 A;  4UVC B;  4ANJ A;  4HFV A;  4ZI2 D;  2V7K A;  1H7C A;  2VWA A;  4PAG A;  4X1K E;  1IZN B;  2W63 A;  1YKE B;  5FY1 A;  4AKH A;  3MAC A;  4J2C A;  4E7S A;  5LJM A;  2WWU A;  3GMI A;  4KBM B;  2XAQ B;  4EZ4 A;  1MND A;  2NWB A;  3C4Z A;  3Q5X A;  4EYY R;  5F8P A;  2A72 A;  5JR9 A;  5FXV A;  2NP9 A;  2MYS A;  3OBV E;  1OXZ A;  2LOP A;  4UV8 B;  4X1I E;  3UUM A;  3VHL A;  2V26 A;  3HKC E;  4IE0 A;  2L3L A;  2XAH B;  1MNE A;  2WSS V;  3FBL A;  2CXF A;  5JR9 C;  4JLE A;  3RYI E;  4PK4 A;  2Y6X A;  3ZJ2 A;  2EHO A;  2X9W A;  3C64 A;  2C5K T;  4IIJ E;  3C4X A;  4TUY E;  2LM9 A;  3OKQ A;  4P0B A;  1MMN A;  2JPF A;  3CX6 B;  1MMD A;  3O9X A;  4OK0 A;  2YEV C;  3PUR A;  4K0U A;  4ZOL E;  4HEA A;  3ETV A;  3LK3 B;  4OYK A;  3N9Q A;  4ADZ A;  2LE8 A;  4PK5 A;  2GK9 A;  4H9R C;  4M1P A;  4UV9 B;  3V5U A;  5LGN B;  2X66 A;  2ZMA A;  2BDE A;  2L9Q A;  2Q9Q D;  2XAF B;  4TV9 E;  2CXD A;  3GWH A;  2KLQ A;  3QC9 A;  3PU3 A;  3ZLI A;  5LXT E;  3T8O A;  4DBR A;  4H63 H;  4AQF A;  3AVS A;  4KMC A;  5JDM A;  3VU7 H;  2LSY A;  3BQI A;  3B57 A;  5IYZ E;  3UT5 E;  3UUX B;  5ETW A;  1HFA A;  3L3P A;  4ZI7 E;  5JH7 E;  2CE7 A;  4ISS A;  3J9X 1;  3N9O A;  4EAH A;  2KND A;  2DWK A;  1QSD A;  3LFM A;  4TZ4 C;  2J1D G;  4ASK A;  4CI3 B;  3RYF E;  2N2N A;  5GON E;  2X9X A;  4QKN A;  1NAF A;  1EZ3 A;  4XAX B;  2BVL A;  2N1G A;  4ILU A;  2LSK A;  2X68 A;  3HI2 A;  4DO0 A;  2B1E A;  1SA0 E;  4ZI3 C;  3ZMS B;  1ZKE A;  3EDV A;  3PTR B;  4PFP A;  4OFZ A;  3KIN B;  5FP3 A;  3VKH A;  5EZY E;  2G0U A;  1Y64 B;  2KZ7 B;  2WAU A;  4PJL A;  1AJ3 A;  2W00 A;  5JVD E;  4P09 A;  5HXH A;  2CXL A;  1HS7 A;  4IDZ A;  4DVD A;  2WM9 A;  2DHR A;  2LOS A;  1BR1 A;  4UF0 A;  3SRZ A;  3ZJ1 A;  1WR6 A;  4WBN E;  4ERR A;  5CB4 E;  1G8X A;  3RRC A;  3HA4 A;  2JRK A;  2ODU A;  2VKD A;  5FYM A;  3H37 A;  3KBU A;  1YKH B;  5FXW A;  3C50 A;  3KBT A;  1LVK A;  1U4Q A;  4QXH B;  4U72 A;  2Q9Q B;  3W15 B;  2CLY B;  1SHZ C;  3AA0 B;  4PFO A;  3V5S A;  4MHC A;  3RKO A;  2JJ9 A;  2K5B B;  5EK4 A;  5JRE A;  4UIG A;  3RYC E;  1UCU A;  2CEA A;  2LHN A;  3CQC B;  1US7 B;  2CLY C;  2C5I T;  4O4J E;  4UXN B;  3RH3 A;  1ZHC A;  5EK2 A;  4XZC A;  3CWZ B;  3E22 E;  3DP7 A;  1UX5 A;  3ZYL A;  5L3C B;  3Q2M A;  5LCY A;  3C51 A;  1BR4 A;  3O1J A;  2CA5 A;  3MA9 A;  4UEM A;  1VOM A;  5JRC B;  3KV5 A;  1HTJ F;  2K9A A;  5BMV E;  3LJC A;  4CQI A;  3KV9 A;  2E9X D;  3JC6 C;  1D1B A;  3QUJ A;  3N9P A;  3PU8 A;  3R84 B;  3ZN1 B;  4DMW A;  3F57 A;  5FXX A;  4AQF C;  2YU1 A;  3FXE B;  4IE7 A;  4QX7 B;  2XQY A;  3IHR A;  5J2T E;  2KXP B;  4WNK A;  3C98 B;  3Q5W A;  3KV4 A;  1G73 A;  1HG5 A;  5J1G A;  2BVM A;  3P7I A;  2ACX A;  2UXN B;  4I55 E;  4C90 A;  5DAB A;  5J2U E;  3AA6 B;  5JRC A;  2N9D A;  5KMG P;  2Z6E A;  3GN5 A;  4QHO A;  2ZM0 A;  2D5U A;  4EB6 E;  3WAJ A;  1BR2 A;  3F2E A;  2CWY A;  1NWM X;  5CA0 E;  2LEH A;  4XBF B;  1IAP A;  2UXX B;  4PNI A;  1FEW A;  4ZS2 A;  4HE8 A;  3ANW B;  3U78 A;  1D1A A;  5DJQ C;  2W0G A;  3PUG A;  3LK2 B;  3L09 A;  1HX8 A;  3LBX B;  4JEU B;  4CXW A;  2HH7 A;  2Q9Q C;  3CX7 B;  2VKH A;  4L0R A;  2W62 A;  4ZI2 C;  2ES0 A;  1MMG A;  2JMH A;  3CQX C;  2LSI A;  4FI5 A;  3AAI A;  2ZM8 A;  2IC9 A;  2JQQ A;  3PUA A;  5HXR A;  2K48 A;  3ZYM A;  5LBQ B;  4IST A;  2E9X A;  3CVR A;  4KUM B;  4OHF A;  4UVB B;  3UFE A;  4MBQ A;  1MMA A;  2NTY A;  3AA1 B;  4QX8 B;  3O4X E;  3CKD A;  5KDM C;  3K3Q C;  1T98 A;  5ADX L;  4UF0 B;  4TN7 B;  3ZYK A;  2LSG A;  1VRB A;  2VAS A;  2QGS A;  3I1A A;  3MKD A;  4HN9 A;  2SPC A;  4BA9 A;  5HAX A;  2A2F X;  2C0S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...