3WI3A

Crystal structure of the sld3/treslin domain from yeast sld3
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
268
structure length
215
Chain Sequence
YSDPKEYIESKYYDALFSIHTPLAYFVKSNLVRLKNTCRTKYGSDSYKIAYQAMLQKFLLSIVQFKDRHDNRLLLEPFSSPIADEKRKNCLTKFVIQDENKNSSTIADLCVVLKSREIKLQILLLLEIIGLNDLDWNFRDFDYCEQLDLYLDRACILDILLSSETGTIQEHKKNILDKSKEASLVGFINYVLIPYFNKKVPHAVEFIIQKLKGPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA replication regulator SLD3
publication title Crystal structure of the homology domain of the eukaryotic DNA replication proteins sld3/treslin.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Replication regulator
total genus 83
structure length 215
sequence length 268
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2013-09-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.2130 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3wi3A00
3WI3A
chains in the Genus database with same CATH superfamily
3N9MA 2NTYA 4UXNB 3G06A 3MXZA 2X9WA 1N34T 1BR0A 2UUBT 3N9PA 2XTLA 2EHOA 3AVSA 4DV7T 4EXTA 3JADA 4KUMB 2E2AA 3GA8A 1MIVA 4U2YA 2DI4A 2L9QA 3T1HT 4I50E 3I1AA 1ZP0A 1UK5A 2SPCA 4A5XA 3TLWA 5AQRB 3FHNA 2LLYA 4HWIB 3UUXB 2QGSA 5IWAT 2JQQA 4NUUA 4IREA 4YT0A 1NWMX 5AQHB 3LK42 2W00A 4GOUA 4OYKA 1WLXA 3AXJB 4P1NA 4YTNA 1UX5A 3SRZA 1D1AA 5AQIB 4C90A 1KEYA 2V7LA 2H89A 1UUSA 2I0MA 3E0ZA 2IC6A 3P4PA 1ZOYA 1XWMA 4LMJA 3RYIE 4AKIA 4U7YA 3CVRA 2DNXA 3KVBA 2FJEA 1N32T 1FJGT 5HEHA 2NW8A 2LRLA 4ZS2A 2X9HA 4PJMA 5LHIB 3NWIA 4ZS3A 1S94A 4EV6A 2H3RA 2RPAA 4AQFA 2Y6XA 3NKZA 1MMAA 2NOXA 4OX9T 3Q2MA 5AQSB 4O2AE 2Q9QC 4X1KE 2KWIB 2BS4A 3N9LA 5HEOA 2X67A 4CZZB 5KXJA 1OEDA 3AAAB 1CHUA 3ZT5A 3H3AA 4ADZA 4DVDA 5FXVA 2LM9A 1KFYA 5FXXA 3D0TA 5CGMA 3LBXB 4IL9A 2XY8B 4CQIA 3RYFE 2QYWA 3QOFA 3KBTA 3F57A 4IE6A 4Q25A 2YDSA 3L8RA 5LHGB 1NENA 3C51A 2WY2A 3BQLA 4DR3T 5AQVB 3MZKB 4DMVA 3Q5EA 3RYHE 2I6HA 3KFWX 5AQJB 4O8SA 4PJLA 4X20E 3MA9A 4PK5A 3CQXC 4HWHA 1SHZC 3RC8A 5LP6E 4YSYA 3EVYA 2KWHA 4UV8B 2P9BA 3ZT6A 4HWFA 3AEAA 3KV9A 4UV9B 2LHRA 4NUVA 1G73A 3HKBE 1WYBA 3UULA 3ZSTA 4EIWA 1NEKA 4YJ3E 2J1DG 1D0XA 4O4LE 3C64A 1UURA 2NW7A 3VU7H 1D0ZA 2KMFA 1WYCA 1T98A 3UU8A 4UF0A 4EEBA 4DR4T 4UVBB 4WZXA 3AE4A 3K3QC 4TNVA 4JI5T 5JREA 4BJNA 3P7IA 5JDMA 1W09A 5EK3A 3WAJA 5EK4A 1ZKEA 2KT9A 2BS3A 3C4ZA 5H6RB 5JR9C 2OA5A 4QH1A 2BKNA 3EDVA 2C5KT 4HTEA 2H7VC 1FEWA 1HFAA 4P09A 4X1IE 5JDQA 3Q5WA 2QRXA 2DCFA 3K8PC 4MHCA 4IE4A 4WNKA 2XQ6A 3ZMZB 3ZKRA 4HGAA 4PJJA 4ILUA 3ANWB 4OHFA 2XQ8A 3VRAA 5AQOB 3KV6A 3I9WA 3Q5DA 2YOEA 3AE6A 3LFMA 4IL4A 4O2BE 3U3IA 4PK6A 3LSVA 1V9DA 1BR2A 5FKYA 3KINB 3P4RA 3NZQA 1AJ3A 2VURA 2YEVC 2JMKA 1IZNB 5HXRA 1DU2A 4U2ZA 1YKHB 3FZHB 2FBWA 2MPKA 1LKXA 4LF8T 2IIUA 2A3DA 1S35A 1WRDA 2PJQA 5HAXA 4ILAA 5J2UE 4JLEA 3AEBA 4B3MT 4NXNT 2XHEB 2RP4A 2ACZA 4OK0A 2KLQA 3UUNA 5L3BB 5LMNT 3GN5A 2Y48B 5ABHA 4JI8T 2J47A 2WM9A 1W0BA 2IMLA 5EZYE 3FZLB 3QB5A 5KMGP 4Z90A 3PURA 2B76A 2LSGA 2W62A 3EABA 1M7KA 5LHHB 2LJLA 3RQWA 2WP9A 2KNDA 1JNZA 5ABGA 2XQ7A 3N2GE 4ILCA 2VVSA 3C4WA 3JCFA 5DQWA 5TAOA 1YKEB 4MBQA 4JV5T 3ZC1A 3FXEB 2WZHA 1IAPA 1MMGA 3C4XA 3RIFA 4QXBB 3ETUA 3N2OA 4AXPA 5CJ5A 5JTGA 4HWDA 4HFEA 2D2SA 2LE8A 5F8PA 1R8IA 1UGOA 1OEDB 2JQ9A 4KHZF 4DBRA 4PFOA 1NAFA 5C3JA 2YKSA 4CN4A 4QKNA 3FB2A 1IBMT 3AAEB 2JQKA 5FY1A 3RH3A 2MYSA 2W0GA 4JI4T 4JI6T 5L3EB 2WWVA 2CLYC 2DWKA 4JEHB 5GONE 1WFDA 5LJMA 4HFIA 1WCRA 2W2UA 4YHJA 3OVUA 5L2LA 2HPLA 1BR4A 4K0KT 3U78A 4TV9E 2BG9E 4FJOA 3HKDE 4U74A 4EYYR 2R6GF 3K1SA 2ZM6T 4TX5A 2JJ9A 4LFCT 4BJMA 3T8OA 2JIWA 3FZFB 4F8HA 2XQAA 4IDNA 4DR5T 4GK0E 2LSJA 2CE7A 4WBNE 4MFRA 3BQIA 2XAFB 4DV3T 4OFZA 3TLVA 2V6XA 1KK7A 1LRZA 3ZJ1A 3MK7C 4QH4A 1B7TA 2M67A 4TWHA 5BMVE 3RIUA 3TLSA 1MMDA 2V7MA 4ZZBA 4QWNB 4UF0B 4IDZA 3ZMTB 2XSAA 1QUUA 3N2KE 2PFVA 2N2NA 4IGUA 2BG9B 3ZT7A 3N9NA 5LG3A 4QX8B 2YK0A 2CPTA 3QUJA 2MAWA 2WSSV 1H7CA 5C2TA 3CQGB 5FVKA 4GK5E 4LF6T 5IHYA 3MJXA 4H9SE 4PK4A 4UVAB 3GMIA 2W63A 4CXWA 5HEUA 4AKGA 2E8IA 3CIRA 1HG2A 1IBLT 3ZLIA 4QH5A 2J4GA 2RA1A 4QXHB 2UU9T 2K5BB 2XQ4A 3AE8A 3JAEA 2WDRA 4QHOA 3IBPA 5KDMC 2CWYA 4IDQA 3JC6D 4ASKA 1MNEA 3ZYLA 2KZ7B 4LF4T 2UXCT 4DR7T 2VVNA 2EHOD 2XAHB 3P4WA 2JMHA 3HI2A 3UU3A 4G63A 4CI1B 2NW9A 2CM0A 2PBIA 1XNQT 2XPKA 2I59A 2YN6A 4CN6A 3R6NA 2WMOA 4WYVA 4BAYB 4DR2T 3VKHA 2HH7A 5HXCA 1EZ3A 4GYSA 2E9XA 3C98B 2GK9A 5HXHA 3AB3B 4AKRB 3O4XE 4YSXA 2IW5B 4TWDA 4YJ2E 4TZ4C 5M4YA 3H37A 3AA0B 4YLHA 5AQUB 5KX5E 1SA0E 4LMKA 3ONJA 2M6BA 2X9YA 4JI0T 4TNWA 1XMOT 3S4UA 2V5CA 3KV4A 2JPFA 4H9OC 3PJAJ 2XM1A 3CK6A 2V7JA 4DNDA 3N9QA 3PJAA 4ZOLE 2AE9A 3RIAA 3ONXA 5EK2A 5E0OA 3TLUA 3AA7B 3L09A 4ZHQE 2ODUA 4YY3T 1VRBA 2E9XD 2BG9C 2AXDS 2IDOB 5LJNA 3FZKB 2D5UA 2ZM8A 4ZI3D 2XQ3A 3FXDB 3L3PA 3AE5A 1CUNA 4L0RA 3OBVE 3P4QA 4IE0A 4TN7B 3NVOA 5ABFA 4ILBA 4K0UA 2B1EA 3O1JA 5BR8T 5HXSA 4HN9A 4JI1T 4E7ZA 5AQNB 3PUQA 3BQKA 3C50A 3X1DA 2QA7A 1N33T 1U5PA 3RGLA 4X66T 4XBFB 4DMWA 3RX6A 2IHR1 3Q5XA 1YW0A 2ZM0A 4EGWA 4UVCB 3WI3A 4DV6T 1FMVA 3FZMB 2LRKA 1XZYA 4HE8A 3ZC0A 4X62T 2JRKA 2KSRA 1W9RA 3UU6A 4LFBT 2Q9QA 4KI0F 3PE0A 4A97A 1L0VA 1VOMA 2BKOA 5LCYA 3UQ4A 5DQVA 5FVLA 4O4HE 3QNUA 2CWOA 4DV5T 3UUMA 4FI5A 3M3ZB 2BBJA 1Z0PA 2HN2A 4IHJE 5CA1E 3RYCE 2XQ9A 4YTMA 3PUXF 3A5XA 2YU1A 4AKLA 4A56A 2WBLA 5DJQC 2VKHA 2V7IA 1YXRA 5IUXA 4CI3B 2XQ5A 2LT3A 4IE5A 3T1YT 3DTOA 5F3JA 2D0UA 1MNDA 3LJCA 3AA1B 2LSKA 3QB5K 3OJAA 3UT5E 4ANJA 3V5SA 1HS7A 4J2CA 2CCQA 2MTQA 5AQQB 1M62A 2X68A 3P50A 2C5IT 4IDPA 5J2TE 3B57A 2EHOB 3VR8A 1D0YA 3PUYF 1HNWT 3N9OA 3RQUA 4EB6E 1E2AA 2UUAT 4HFCA 5L3DB 3AEFA 5AQTB 2PTFA 3UTKA 1IJ6A 3RRCA 3OYXA 4KHPT 4NPPA 1HNXT 3EUHA 4JI2T 3O1IA 2BBHA 2WDVA 3EI0A 2WWUA 2YDRA 5ADXL 3IF8B 5JR9A 2XAGB 3OYZA 1LVKA 3PV0F 1OEDE 3PUGA 4H9PC 4H9QC 2BDEA 2OLTA 3FBZA 4G2AA 3KBUA 4KP3C 5CA0E 3ZMVB 5LG4A 5LBQB 1KNRA 2KXPB 3ZSSA 4YTPA 1I6ZA 3LK3B 2CA5A 3M65A 1VCTA 3V5UA 5JDHA 4JI3T 1IJ5A 3FBLA 3CKDA 3ZCJA 3LBXA 1O3XA 5CB4E 3AE9A 3IHRA 2BZBA 2E9XB 5JRCA 5HCMA 4DIDB 2G0UA 4MLKA 3PUVF 2UXBT 2X51A 5LGUB 1HTJF 4X1YE 2KINB 2MBGA 5JVDE 3W15B 3ZJ2A 2HHHT 2LSIA 1LVFA 3RF1A 3MKDA 2ACXA 2DLRA 3KV5A 3AA6B 2XJ7A 5FNVE 2E5VA 2HPJA 3A8YC 5AQFB 4P0BA 2XAQB 3UU4A 3JC6C 1ZEEA 4DR6T 3O1HA 2EHOC 1WR0A 4OYJA 4DV4T 3OPCA 2C5JA 3PUAA 2FJBA 3OTOT 3AEDA 3LG7A 4L9IA 2V1DB 4QX7B 5JDGA 3HKEE 2X66A 4E7SA 3ZPOA 3LK2B 4U3CA 2WB5A 4XZCA 3AECA 1MMNA 1WR6A 2XSBA 4X64T 4DO0A 4U72A 3I0QA 4PAGA 3AE7A 4ERRA 1J5ET 3PU8A 3WAKA 3CWZB 2XUEA 5ETWA 2QVAA 1ZV4X 4U31A 2VL8A 5LGNB 2CBJA 3AE1A 2Q9QB 4I43B 1QSDA 5HXEA 1YD8G 3JAFA 4AQGA 1HR0T 3ZYMA 5L3GB 4TWFA 3SWHA 5JDFA 4COFA 1W0AA 4B3TT 4DV2T 2K9AA 1T72A 4O4IE 2WU5A 1UCUA 3ANWA 2Z6EA 4GKJT 2VK9A 3CPZA 1QLBA 2E9XC 2OV9A 4AQFC 4ZI3C 2LKGA 2WU2A 1MIWA 1G8XA 3RI5A 1IBKT 4ZI2D 3I0OA 4GKKT 1XDOA 2NP9A 4KMCA 1OEDC 1US7B 2UUCT 2W61A 3NRYA 1X79A 2DWGA 2VL0A 1T8BA 2H7OA 5FY7A 4NXMT 3RRWA 4AQYT 1Y64B 2BVLA 3UFGA 2UXDT 3E22E 4EOZB 4V1Av 5DABA 4Z8XA 2ZLYA 4EZ4A 4X65T 3ZYKA 5F5WA 1HX1B 2ES0A 2K24A 3ONLC 3RC3A 4HEAA 2ZM2A 4GYRA 4BA9A 4I55E 3RKGA 3AE3A 1XNRT 4ZI7E 1HNZT 1YQ3A 2WQYA 3ZCIA 4IDOA 5HEGA 3HA4A 2IUBA 3IEEA 4ZZCA 4HFHA 2BVMA 4PW8A 1U4QA 1E1HB 5L4HA 3GN5B 5JR9B 1Z8UA 5C8YE 5LBMA 1T7SA 2D0TA 4X5TA 3L39A 3NZPA 5LOVE 2PG8A 3UQ7A 3GWHA 4EAHA 2M6IA 5HCJA 4PJNA 2V5DA 3DP7A 3RKOA 3PUSA 4I4TE 4DUYT 5LGTB 3KVAA 4HFVA 4TV8E 2CHNA 5IYZE 1GQEA 4B3ST 4N78D 4LF9T 2X0HA 4YXDA 1VCSA 3F2EA 5JDLA 5FP3A 5JRCB 1XDPA 3ESLA 4H63H 4IE7A 4HWCA 3NRXA 4WW0A 3SOLA 3EAMA 3ZEFB 5LXTE 4EYUA 3HL6A 3DJBA 4TUYE 5JH7E 2VKOA 4WBOA 4H9NC 1MIYA 3ZN1B 5ABEA 2F4VT 2UXNB 1YQ4A 3PDYA 4B3RT 1D1BA 2CBIA 2CXFA 1SE7A 2VWAA 3CX7B 3CQCB 5LB7B 5AQPB 2XASB 5L3CB 4CN1A 1N36T 2J62A 4P0AA 4U33A 2CXDA 3F31A 3RPUA 3PUWF 2A2FX 1HF8A 5L3FB 3H3MA 3ZMSB 1FMWA 4AI6A 2JQHA 2UXXB 2XAJB 4YHHT 1Y01A 5FMNA 5HWYA 5J1GA 2K3WA 4DBQA 2NTXA 4DR1T 3SFEA 2V6YA 2LSYA 1FIOA 2VKJA 5A1LA 5FY0A 5AQMB 2CEAA 4U7IA 2WMNA 5AQLB 5HEJA 2BG9A 3O9XA 3SS1A 3UUBA 3B5MA 4IT4A 2WAUA 1OWAA 3A7MA 2W67A 2Q9QD 3E08A 1HX8A 1HCIA 2D9DA 2Y8DA 1KF6A 4JEUB 3J9X1 3TLTA 1UX4A 3VHLA 4B6XA 4ZXLA 3CX8B 2XQYA 1OXZA 5FXWA 4CI2B 4UR9A 1J1JA 4ISSA 4YFSA 4NIQA 3ETVA 5HWXA 2W66A 3I9YA 3RLFF 3ZMUB 4ZEYA 2MOZA 2LEHA 2BS2A 1I94T 2VASA 2XM2A 3N5LA 4H9RC 4DUZT 3K3OA 2LM2A 3AXJA 2CLYB 3UU5A 2LHNA 2NR4A 2W4XA 4HFBA 2WS3A 1KNPA 5AQGB 4JYAT 3QC9A 2WZIA 4AKHA 2FJAA 4QXCB 3B13A 3MACA 2LOPA 1ZHCA 1HG5A 3QK6A 4AISA 4YSZA 3BK9A 3K3NA 3J7Yq 1JNRA 3KDSE 4KBMB 3AVRA 4F6RC 3P8CD 4PNIA 2YINA 2FUPA 4H63V 2WCAA 5L47A 2CXLA 1BR1A 2XZEA 4MALA 3VKGA 2YDQA 3Q9DA 5LNKA 4LFAT 4JUYA 4IIJE 2NWBA 1SUMB 3AEEA 2L3LA 1XMQT 4L5GA 5JDNA 4O4JE 3AE2A 4XAXB 2V8SV 3ABVA 5HYAA 4LF5T 3EHZA 2IAKA 4CXYA 2DL1A 4EEDA 2LKHA 2LOSA 3RIUC 3SFDA 2A72A 2L8KA 1J5WA 4GIWA 1X9BA 2VQET 1D1CA 4ISTA 4ZI2C 4A98A 2N1GA 3RHWA 2X0LB 3P4SA 4LMLA 2C0SA 2VB6A 4JI7T 2X0YA 4DV1T 3CMLA 3LDQB 4CXXA 2CMRA 2E5LT 3VR9A 5L4EA 4UIGA 4AIUA 4Z91A 3EDUA 2V26A 3CX6B 5LA6E 3NBXX 3ZN0B 1E7PA 2A9UA 3VRBA 5LMUT 4EZHA 5ABFB 5H6QB 4C91A 2IC9A 5FXZA 5AFUL 4HKAA 3TKLB 5LYJE 2DHRA 3PU3A 2BKPA 2ZMAA 5CFBA 3AAIA 4LF7T 2N9DA 2K48A 4JBWF 4UELA 4HFDA 5AQKB 2CHOA 4UEMA 5FYMA 4M1PA 3R84B 2V7KA 2H88A 1KNZA 3PUZF 4DV0T 2CRBA 4PFPA 3HKCE 3HR0A 3PTRB 5FL0A 2ODVA 4KX6A 2X9XA 5J0ZA 3UFEA 4I0UA 2VKDA 2YU2A 2HN1A 5JQGE 2WDQA 2VQFT 5FL1A 3IA3A 3OKQA 3AEGA 2FJDA 2V6YB
chains in the Genus database with same CATH topology
3N9MA 1MNDA 2NTYA 4UXNB 1IAPA 3DP7A 3RKOA 1MMGA 3PUSA 3C4XA 3MXZA 4I4TE 2X9WA 4QXBB 3ETUA 3N2OA 1BR0A 3LJCA 3N9PA 5LGTB 2XTLA 3AA1B 3KVAA 4AXPA 2LSKA 2EHOA 3AVSA 3OJAA 4HFVA 4TV8E 5IYZE 4EXTA 4N78D 3UT5E 4ANJA 2D2SA 2LE8A 3V5SA 4KUMB 3GA8A 1HS7A 1MIVA 3F2EA 5JDLA 5F8PA 5FP3A 5JRCB 4J2CA 2CCQA 3ESLA 4H63H 4IE7A 2DI4A 2MTQA 2L9QA 4DBRA 3NRXA 4I50E 4PFOA 3I1AA 1NAFA 2X68A 4WW0A 2C5IT 3SOLA 3ZEFB 5LXTE 5J2TE 4QKNA 3FB2A 2SPCA 3B57A 3AAEB 2EHOB 4EYUA 1D0YA 5FY1A 3RH3A 3HL6A 3FHNA 3DJBA 2MYSA 4TUYE 2W0GA 5JH7E 2VKOA 4WBOA 4H9NC 3UUXB 3N9OA 5L3EB 1MIYA 2CLYC 2DWKA 2QGSA 4JEHB 4EB6E 3ZN1B 5GONE 5L3DB 2JQQA 5LJMA 4NUUA 2UXNB 4YHJA 3PDYA 1NWMX 5L2LA 3LK42 2HPLA 2W00A 1BR4A 3U78A 3UTKA 1IJ6A 4GOUA 4TV9E 1D1BA 4OYKA 4FJOA 1WLXA 3HKDE 4U74A 3RRCA 2CXFA 3OYXA 1UX5A 4EYYR 3SRZA 2VWAA 1D1AA 3CX7B 3CQCB 5L3CB 3EUHA 2XASB 4C90A 3O1IA 4P0AA 4TX5A 2V7LA 2CXDA 2JJ9A 4BJMA 3T8OA 3F31A 3E0ZA 2WWUA 2IC6A 3RPUA 5ADXL 3IF8B 5JR9A 2A2FX 1HF8A 5L3FB 2XAGB 3OYZA 3ZMSB 1FMWA 1LVKA 4AI6A 3PUGA 4H9PC 4H9QC 4GK0E 2LSJA 2BDEA 3FBZA 2CE7A 3RYIE 4AKIA 4G2AA 4WBNE 3KBUA 4KP3C 3CVRA 5CA0E 4MFRA 3ZMVB 5LG4A 2DNXA 3KVBA 2UXXB 5LBQB 2XAJB 2KXPB 3BQIA 2NW8A 2XAFB 5FMNA 5HWYA 4OFZA 5J1GA 4ZS2A 4DBQA 2X9HA 2NTXA 3LK3B 1KK7A 1LRZA 4PJMA 5LHIB 3ZJ1A 2CA5A 2LSYA 3MK7C 1B7TA 1FIOA 2M67A 1S94A 2VKJA 4ZS3A 2H3RA 3M65A 5A1LA 5FY0A 5BMVE 2CEAA 3V5UA 4AQFA 5JDHA 2WMNA 2Y6XA 1MMAA 2NOXA 3O9XA 3SS1A 1IJ5A 3Q2MA 1MMDA 2V7MA 2WAUA 3FBLA 1OWAA 4O2AE 3CKDA 3ZCJA 2Q9QC 4X1KE 2KWIB 4QWNB 3LBXA 4UF0B 4IDZA 3ZMTB 1O3XA 3N9LA 2Q9QD 5CB4E 3E08A 1HX8A 2X67A 3IHRA 1HCIA 2BZBA 2Y8DA 1QUUA 4JEUB 4CZZB 3J9X1 3N2KE 2E9XB 5JRCA 1UX4A 2PFVA 3VHLA 4B6XA 3AAAB 2N2NA 2G0UA 3CX8B 3H3AA 2XQYA 4IGUA 3N9NA 4MLKA 4ADZA 4DVDA 1OXZA 4QX8B 5FXVA 2LM9A 5FXWA 4CI2B 2X51A 2YK0A 5FXXA 3D0TA 3QUJA 3LBXB 5LGUB 2WSSV 1H7CA 1HTJF 4ISSA 4X1YE 3CQGB 4YFSA 2KINB 2MBGA 3ETVA 4CQIA 5JVDE 3W15B 5HWXA 3I9YA 3RYFE 3ZJ2A 3ZMUB 4GK5E 2MOZA 5IHYA 2LEHA 3MJXA 4H9SE 2LSIA 1LVFA 3KBTA 4PK4A 3F57A 4UVAB 3GMIA 4IE6A 3MKDA 2W63A 4CXWA 2ACXA 2DLRA 3KV5A 2VASA 5LHGB 3N5LA 4H9RC 4AKGA 2E8IA 3C51A 1HG2A 3AA6B 3BQLA 3K3OA 3MZKB 5FNVE 3ZLIA 4DMVA 2HPJA 3RYHE 2RA1A 3KFWX 4QXHB 2CLYB 2K5BB 2LHNA 4O8SA 4P0BA 4PJLA 4X20E 3MA9A 2XAQB 4QHOA 4PK5A 3CQXC 3IBPA 5KDMC 2CWYA 1SHZC 3JC6C 1ZEEA 3O1HA 3RC8A 2EHOC 5LP6E 3EVYA 2KWHA 1MNEA 3JC6D 2KZ7B 3ZYLA 4ASKA 4UV8B 2P9BA 2EHOD 4OYJA 2C5JA 3PUAA 2XAHB 3QC9A 3LG7A 4AKHA 4L9IA 4QXCB 2JMHA 2V1DB 3HI2A 3KV9A 4QX7B 5JDGA 3B13A 3MACA 4G63A 3HKEE 2X66A 2LOPA 4UV9B 2LHRA 4NUVA 4CI1B 1G73A 2NW9A 1ZHCA 1HG5A 3ZPOA 4E7SA 3HKBE 2CM0A 2PBIA 3QK6A 1WYBA 3UULA 4EIWA 3LK2B 2I59A 4YJ3E 2J1DG 1D0XA 4O4LE 3BK9A 4XZCA 3K3NA 3J7Yq 1MMNA 3C64A 3R6NA 1WR6A 2WMOA 2NW7A 3VU7H 1D0ZA 2KMFA 4U72A 4DO0A 1WYCA 3KDSE 3I0QA 4KBMB 4PAGA 4BAYB 3AVRA 1T98A 4F6RC 4ERRA 3P8CD 4UF0A 4PNIA 2YINA 3VKHA 2HH7A 5HXCA 3PU8A 4UVBB 3WAKA 3CWZB 1EZ3A 2XUEA 3K3QC 4GYSA 4H63V 2E9XA 3C98B 5ETWA 2GK9A 5JREA 2CXLA 4BJNA 1ZV4X 3P7IA 5HXHA 3AB3B 4AKRB 5JDMA 1BR1A 3O4XE 4MALA 3VKGA 2VL8A 2IW5B 3Q9DA 5LGNB 5LNKA 5EK3A 2Q9QB 3WAJA 4I43B 4YJ2E 4TZ4C 5M4YA 1QSDA 3H37A 5EK4A 3AA0B 4YLHA 5HXEA 1ZKEA 4JUYA 1YD8G 4IIJE 4AQGA 2KT9A 2NWBA 5KX5E 3C4ZA 1SA0E 3ZYMA 5H6RB 2X9YA 5L3GB 2L3LA 5JR9C 2OA5A 3S4UA 4L5GA 3SWHA 5JDNA 5JDFA 3EDVA 3KV4A 2C5KT 2K9AA 4O4JE 4HTEA 4O4IE 2JPFA 4XAXB 2H7VC 1FEWA 4H9OC 1UCUA 1HFAA 3ANWA 5HYAA 4P09A 2Z6EA 4X1IE 2V7JA 2IAKA 3Q5WA 5JDQA 2DCFA 4DNDA 3K8PC 3N9QA 4MHCA 4ZOLE 4IE4A 2VK9A 3ONXA 5EK2A 5E0OA 4WNKA 3CPZA 4CXYA 3ZMZB 2E9XC 2LOSA 3AA7B 2A72A 3L09A 2L8KA 4GIWA 2ODUA 4ZHQE 1VRBA 4AQFC 4HGAA 2E9XD 4ZI3C 1D1CA 4PJJA 4ISTA 5LJNA 1MIWA 4ZI2C 1G8XA 2D5UA 2ZM8A 4ILUA 4ZI3D 3ANWB 3FXDB 3L3PA 2N1GA 4OHFA 2X0LB 1CUNA 4L0RA 4ZI2D 3I0OA 3OBVE 2C0SA 4IE0A 3KV6A 4TN7B 2VB6A 3I9WA 2NP9A 4KMCA 3CMLA 3LFMA 4O2BE 1US7B 3U3IA 2W61A 4PK6A 3NRYA 4CXXA 1X79A 2CMRA 2DWGA 4K0UA 2B1EA 3O1JA 1V9DA 5HXSA 1BR2A 4UIGA 2H7OA 5FY7A 3RRWA 4HN9A 3KINB 4E7ZA 3EDUA 3PUQA 2V26A 1Y64B 3BQKA 3CX6B 3C50A 2QA7A 3NZQA 5LA6E 1U5PA 1AJ3A 3NBXX 2BVLA 4XBFB 3ZN0B 4DMWA 3RX6A 4EZHA 2YEVC 3E22E 3Q5XA 1YW0A 2ZM0A 2JMKA 4V1Av 5H6QB 4C91A 4EOZB 1IZNB 2IC9A 5HXRA 5FXZA 5AFUL 4UVCB 5DABA 4Z8XA 2ZLYA 4HKAA 4EZ4A 3ZYKA 3TKLB 3WI3A 5LYJE 1YKHB 2DHRA 2ES0A 2K24A 3PU3A 2ZMAA 1LKXA 1FMVA 2A3DA 3AAIA 1S35A 1WRDA 4HE8A 2N9DA 3ZC0A 2K48A 2JRKA 2PJQA 5HAXA 5J2UE 2Q9QA 4JLEA 4UELA 3RC3A 2XHEB 4HEAA 2RP4A 2ZM2A 4UEMA 4GYRA 4OK0A 3PE0A 2KLQA 1VOMA 3UUNA 5L3BB 5FYMA 4BA9A 4M1PA 3GN5A 4I55E 2Y48B 5LCYA 4ZI7E 3R84B 2V7KA 5DQVA 3ZCIA 2WM9A 4O4HE 3HA4A 3IEEA 2CWOA 1KNZA 5EZYE 2BVMA 4PW8A 3UUMA 4FI5A 1U4QA 1E1HB 5KMGP 3PURA 1Z0PA 2LSGA 2W62A 4IHJE 4PFPA 3HKCE 5CA1E 3RYCE 3HR0A 3GN5B 3PTRB 5LHHB 2LJLA 2ODVA 5JR9B 3A5XA 5C8YE 5LBMA 2YU1A 2X9XA 4AKLA 3UFEA 4A56A 2D0TA 2WBLA 5DJQC 2VKHA 2KNDA 2VKDA 2V7IA 2YU2A 5JQGE 4CI3B 3NZPA 5LOVE 2PG8A 3N2GE 3C4WA 5DQWA 2LT3A 4IE5A 3OKQA 5TAOA 1YKEB 3DTOA 3GWHA 4MBQA 5F3JA 4EAHA 3ZC1A 3FXEB 2D0UA 4PJNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WI3 A; 
#chains in the Genus database with same CATH topology
 3N9M A;  2NTY A;  4UXN B;  3G06 A;  3MXZ A;  2X9W A;  1N34 T;  1BR0 A;  2UUB T;  3N9P A;  2XTL A;  2EHO A;  3AVS A;  4DV7 T;  4EXT A;  3JAD A;  4KUM B;  2E2A A;  3GA8 A;  1MIV A;  4U2Y A;  2DI4 A;  2L9Q A;  3T1H T;  4I50 E;  3I1A A;  1ZP0 A;  1UK5 A;  2SPC A;  4A5X A;  3TLW A;  5AQR B;  3FHN A;  2LLY A;  4HWI B;  3UUX B;  2QGS A;  5IWA T;  2JQQ A;  4NUU A;  4IRE A;  4YT0 A;  1NWM X;  5AQH B;  3LK4 2;  2W00 A;  4GOU A;  4OYK A;  1WLX A;  3AXJ B;  4P1N A;  4YTN A;  1UX5 A;  3SRZ A;  1D1A A;  5AQI B;  4C90 A;  1KEY A;  2V7L A;  2H89 A;  1UUS A;  2I0M A;  3E0Z A;  2IC6 A;  3P4P A;  1ZOY A;  1XWM A;  4LMJ A;  3RYI E;  4AKI A;  4U7Y A;  3CVR A;  2DNX A;  3KVB A;  2FJE A;  1N32 T;  1FJG T;  5HEH A;  2NW8 A;  2LRL A;  4ZS2 A;  2X9H A;  4PJM A;  5LHI B;  3NWI A;  4ZS3 A;  1S94 A;  4EV6 A;  2H3R A;  2RPA A;  4AQF A;  2Y6X A;  3NKZ A;  1MMA A;  2NOX A;  4OX9 T;  3Q2M A;  5AQS B;  4O2A E;  2Q9Q C;  4X1K E;  2KWI B;  2BS4 A;  3N9L A;  5HEO A;  2X67 A;  4CZZ B;  5KXJ A;  1OED A;  3AAA B;  1CHU A;  3ZT5 A;  3H3A A;  4ADZ A;  4DVD A;  5FXV A;  2LM9 A;  1KFY A;  5FXX A;  3D0T A;  5CGM A;  3LBX B;  4IL9 A;  2XY8 B;  4CQI A;  3RYF E;  2QYW A;  3QOF A;  3KBT A;  3F57 A;  4IE6 A;  4Q25 A;  2YDS A;  3L8R A;  5LHG B;  1NEN A;  3C51 A;  2WY2 A;  3BQL A;  4DR3 T;  5AQV B;  3MZK B;  4DMV A;  3Q5E A;  3RYH E;  2I6H A;  3KFW X;  5AQJ B;  4O8S A;  4PJL A;  4X20 E;  3MA9 A;  4PK5 A;  3CQX C;  4HWH A;  1SHZ C;  3RC8 A;  5LP6 E;  4YSY A;  3EVY A;  2KWH A;  4UV8 B;  2P9B A;  3ZT6 A;  4HWF A;  3AEA A;  3KV9 A;  4UV9 B;  2LHR A;  4NUV A;  1G73 A;  3HKB E;  1WYB A;  3UUL A;  3ZST A;  4EIW A;  1NEK A;  4YJ3 E;  2J1D G;  1D0X A;  4O4L E;  3C64 A;  1UUR A;  2NW7 A;  3VU7 H;  1D0Z A;  2KMF A;  1WYC A;  1T98 A;  3UU8 A;  4UF0 A;  4EEB A;  4DR4 T;  4UVB B;  4WZX A;  3AE4 A;  3K3Q C;  4TNV A;  4JI5 T;  5JRE A;  4BJN A;  3P7I A;  5JDM A;  1W09 A;  5EK3 A;  3WAJ A;  5EK4 A;  1ZKE A;  2KT9 A;  2BS3 A;  3C4Z A;  5H6R B;  5JR9 C;  2OA5 A;  4QH1 A;  2BKN A;  3EDV A;  2C5K T;  4HTE A;  2H7V C;  1FEW A;  1HFA A;  4P09 A;  4X1I E;  5JDQ A;  3Q5W A;  2QRX A;  2DCF A;  3K8P C;  4MHC A;  4IE4 A;  4WNK A;  2XQ6 A;  3ZMZ B;  3ZKR A;  4HGA A;  4PJJ A;  4ILU A;  3ANW B;  4OHF A;  2XQ8 A;  3VRA A;  5AQO B;  3KV6 A;  3I9W A;  3Q5D A;  2YOE A;  3AE6 A;  3LFM A;  4IL4 A;  4O2B E;  3U3I A;  4PK6 A;  3LSV A;  1V9D A;  1BR2 A;  5FKY A;  3KIN B;  3P4R A;  3NZQ A;  1AJ3 A;  2VUR A;  2YEV C;  2JMK A;  1IZN B;  5HXR A;  1DU2 A;  4U2Z A;  1YKH B;  3FZH B;  2FBW A;  2MPK A;  1LKX A;  4LF8 T;  2IIU A;  2A3D A;  1S35 A;  1WRD A;  2PJQ A;  5HAX A;  4ILA A;  5J2U E;  4JLE A;  3AEB A;  4B3M T;  4NXN T;  2XHE B;  2RP4 A;  2ACZ A;  4OK0 A;  2KLQ A;  3UUN A;  5L3B B;  5LMN T;  3GN5 A;  2Y48 B;  5ABH A;  4JI8 T;  2J47 A;  2WM9 A;  1W0B A;  2IML A;  5EZY E;  3FZL B;  3QB5 A;  5KMG P;  4Z90 A;  3PUR A;  2B76 A;  2LSG A;  2W62 A;  3EAB A;  1M7K A;  5LHH B;  2LJL A;  3RQW A;  2WP9 A;  2KND A;  1JNZ A;  5ABG A;  2XQ7 A;  3N2G E;  4ILC A;  2VVS A;  3C4W A;  3JCF A;  5DQW A;  5TAO A;  1YKE B;  4MBQ A;  4JV5 T;  3ZC1 A;  3FXE B;  2WZH A;  1IAP A;  1MMG A;  3C4X A;  3RIF A;  4QXB B;  3ETU A;  3N2O A;  4AXP A;  5CJ5 A;  5JTG A;  4HWD A;  4HFE A;  2D2S A;  2LE8 A;  5F8P A;  1R8I A;  1UGO A;  1OED B;  2JQ9 A;  4KHZ F;  4DBR A;  4PFO A;  1NAF A;  5C3J A;  2YKS A;  4CN4 A;  4QKN A;  3FB2 A;  1IBM T;  3AAE B;  2JQK A;  5FY1 A;  3RH3 A;  2MYS A;  2W0G A;  4JI4 T;  4JI6 T;  5L3E B;  2WWV A;  2CLY C;  2DWK A;  4JEH B;  5GON E;  1WFD A;  5LJM A;  4HFI A;  1WCR A;  2W2U A;  4YHJ A;  3OVU A;  5L2L A;  2HPL A;  1BR4 A;  4K0K T;  3U78 A;  4TV9 E;  2BG9 E;  4FJO A;  3HKD E;  4U74 A;  4EYY R;  2R6G F;  3K1S A;  2ZM6 T;  4TX5 A;  2JJ9 A;  4LFC T;  4BJM A;  3T8O A;  2JIW A;  3FZF B;  4F8H A;  2XQA A;  4IDN A;  4DR5 T;  4GK0 E;  2LSJ A;  2CE7 A;  4WBN E;  4MFR A;  3BQI A;  2XAF B;  4DV3 T;  4OFZ A;  3TLV A;  2V6X A;  1KK7 A;  1LRZ A;  3ZJ1 A;  3MK7 C;  4QH4 A;  1B7T A;  2M67 A;  4TWH A;  5BMV E;  3RIU A;  3TLS A;  1MMD A;  2V7M A;  4ZZB A;  4QWN B;  4UF0 B;  4IDZ A;  3ZMT B;  2XSA A;  1QUU A;  3N2K E;  2PFV A;  2N2N A;  4IGU A;  2BG9 B;  3ZT7 A;  3N9N A;  5LG3 A;  4QX8 B;  2YK0 A;  2CPT A;  3QUJ A;  2MAW A;  2WSS V;  1H7C A;  5C2T A;  3CQG B;  5FVK A;  4GK5 E;  4LF6 T;  5IHY A;  3MJX A;  4H9S E;  4PK4 A;  4UVA B;  3GMI A;  2W63 A;  4CXW A;  5HEU A;  4AKG A;  2E8I A;  3CIR A;  1HG2 A;  1IBL T;  3ZLI A;  4QH5 A;  2J4G A;  2RA1 A;  4QXH B;  2UU9 T;  2K5B B;  2XQ4 A;  3AE8 A;  3JAE A;  2WDR A;  4QHO A;  3IBP A;  5KDM C;  2CWY A;  4IDQ A;  3JC6 D;  4ASK A;  1MNE A;  3ZYL A;  2KZ7 B;  4LF4 T;  2UXC T;  4DR7 T;  2VVN A;  2EHO D;  2XAH B;  3P4W A;  2JMH A;  3HI2 A;  3UU3 A;  4G63 A;  4CI1 B;  2NW9 A;  2CM0 A;  2PBI A;  1XNQ T;  2XPK A;  2I59 A;  2YN6 A;  4CN6 A;  3R6N A;  2WMO A;  4WYV A;  4BAY B;  4DR2 T;  3VKH A;  2HH7 A;  5HXC A;  1EZ3 A;  4GYS A;  2E9X A;  3C98 B;  2GK9 A;  5HXH A;  3AB3 B;  4AKR B;  3O4X E;  4YSX A;  2IW5 B;  4TWD A;  4YJ2 E;  4TZ4 C;  5M4Y A;  3H37 A;  3AA0 B;  4YLH A;  5AQU B;  5KX5 E;  1SA0 E;  4LMK A;  3ONJ A;  2M6B A;  2X9Y A;  4JI0 T;  4TNW A;  1XMO T;  3S4U A;  2V5C A;  3KV4 A;  2JPF A;  4H9O C;  3PJA J;  2XM1 A;  3CK6 A;  2V7J A;  4DND A;  3N9Q A;  3PJA A;  4ZOL E;  2AE9 A;  3RIA A;  3ONX A;  5EK2 A;  5E0O A;  3TLU A;  3AA7 B;  3L09 A;  4ZHQ E;  2ODU A;  4YY3 T;  1VRB A;  2E9X D;  2BG9 C;  2AXD S;  2IDO B;  5LJN A;  3FZK B;  2D5U A;  2ZM8 A;  4ZI3 D;  2XQ3 A;  3FXD B;  3L3P A;  3AE5 A;  1CUN A;  4L0R A;  3OBV E;  3P4Q A;  4IE0 A;  4TN7 B;  3NVO A;  5ABF A;  4ILB A;  4K0U A;  2B1E A;  3O1J A;  5BR8 T;  5HXS A;  4HN9 A;  4JI1 T;  4E7Z A;  5AQN B;  3PUQ A;  3BQK A;  3C50 A;  3X1D A;  2QA7 A;  1N33 T;  1U5P A;  3RGL A;  4X66 T;  4XBF B;  4DMW A;  3RX6 A;  2IHR 1;  3Q5X A;  1YW0 A;  2ZM0 A;  4EGW A;  4UVC B;  3WI3 A;  4DV6 T;  1FMV A;  3FZM B;  2LRK A;  1XZY A;  4HE8 A;  3ZC0 A;  4X62 T;  2JRK A;  2KSR A;  1W9R A;  3UU6 A;  4LFB T;  2Q9Q A;  4KI0 F;  3PE0 A;  4A97 A;  1L0V A;  1VOM A;  2BKO A;  5LCY A;  3UQ4 A;  5DQV A;  5FVL A;  4O4H E;  3QNU A;  2CWO A;  4DV5 T;  3UUM A;  4FI5 A;  3M3Z B;  2BBJ A;  1Z0P A;  2HN2 A;  4IHJ E;  5CA1 E;  3RYC E;  2XQ9 A;  4YTM A;  3PUX F;  3A5X A;  2YU1 A;  4AKL A;  4A56 A;  2WBL A;  5DJQ C;  2VKH A;  2V7I A;  1YXR A;  5IUX A;  4CI3 B;  2XQ5 A;  2LT3 A;  4IE5 A;  3T1Y T;  3DTO A;  5F3J A;  2D0U A;  1MND A;  3LJC A;  3AA1 B;  2LSK A;  3QB5 K;  3OJA A;  3UT5 E;  4ANJ A;  3V5S A;  1HS7 A;  4J2C A;  2CCQ A;  2MTQ A;  5AQQ B;  1M62 A;  2X68 A;  3P50 A;  2C5I T;  4IDP A;  5J2T E;  3B57 A;  2EHO B;  3VR8 A;  1D0Y A;  3PUY F;  1HNW T;  3N9O A;  3RQU A;  4EB6 E;  1E2A A;  2UUA T;  4HFC A;  5L3D B;  3AEF A;  5AQT B;  2PTF A;  3UTK A;  1IJ6 A;  3RRC A;  3OYX A;  4KHP T;  4NPP A;  1HNX T;  3EUH A;  4JI2 T;  3O1I A;  2BBH A;  2WDV A;  3EI0 A;  2WWU A;  2YDR A;  5ADX L;  3IF8 B;  5JR9 A;  2XAG B;  3OYZ A;  1LVK A;  3PV0 F;  1OED E;  3PUG A;  4H9P C;  4H9Q C;  2BDE A;  2OLT A;  3FBZ A;  4G2A A;  3KBU A;  4KP3 C;  5CA0 E;  3ZMV B;  5LG4 A;  5LBQ B;  1KNR A;  2KXP B;  3ZSS A;  4YTP A;  1I6Z A;  3LK3 B;  2CA5 A;  3M65 A;  1VCT A;  3V5U A;  5JDH A;  4JI3 T;  1IJ5 A;  3FBL A;  3CKD A;  3ZCJ A;  3LBX A;  1O3X A;  5CB4 E;  3AE9 A;  3IHR A;  2BZB A;  2E9X B;  5JRC A;  5HCM A;  4DID B;  2G0U A;  4MLK A;  3PUV F;  2UXB T;  2X51 A;  5LGU B;  1HTJ F;  4X1Y E;  2KIN B;  2MBG A;  5JVD E;  3W15 B;  3ZJ2 A;  2HHH T;  2LSI A;  1LVF A;  3RF1 A;  3MKD A;  2ACX A;  2DLR A;  3KV5 A;  3AA6 B;  2XJ7 A;  5FNV E;  2E5V A;  2HPJ A;  3A8Y C;  5AQF B;  4P0B A;  2XAQ B;  3UU4 A;  3JC6 C;  1ZEE A;  4DR6 T;  3O1H A;  2EHO C;  1WR0 A;  4OYJ A;  4DV4 T;  3OPC A;  2C5J A;  3PUA A;  2FJB A;  3OTO T;  3AED A;  3LG7 A;  4L9I A;  2V1D B;  4QX7 B;  5JDG A;  3HKE E;  2X66 A;  4E7S A;  3ZPO A;  3LK2 B;  4U3C A;  2WB5 A;  4XZC A;  3AEC A;  1MMN A;  1WR6 A;  2XSB A;  4X64 T;  4DO0 A;  4U72 A;  3I0Q A;  4PAG A;  3AE7 A;  4ERR A;  1J5E T;  3PU8 A;  3WAK A;  3CWZ B;  2XUE A;  5ETW A;  2QVA A;  1ZV4 X;  4U31 A;  2VL8 A;  5LGN B;  2CBJ A;  3AE1 A;  2Q9Q B;  4I43 B;  1QSD A;  5HXE A;  1YD8 G;  3JAF A;  4AQG A;  1HR0 T;  3ZYM A;  5L3G B;  4TWF A;  3SWH A;  5JDF A;  4COF A;  1W0A A;  4B3T T;  4DV2 T;  2K9A A;  1T72 A;  4O4I E;  2WU5 A;  1UCU A;  3ANW A;  2Z6E A;  4GKJ T;  2VK9 A;  3CPZ A;  1QLB A;  2E9X C;  2OV9 A;  4AQF C;  4ZI3 C;  2LKG A;  2WU2 A;  1MIW A;  1G8X A;  3RI5 A;  1IBK T;  4ZI2 D;  3I0O A;  4GKK T;  1XDO A;  2NP9 A;  4KMC A;  1OED C;  1US7 B;  2UUC T;  2W61 A;  3NRY A;  1X79 A;  2DWG A;  2VL0 A;  1T8B A;  2H7O A;  5FY7 A;  4NXM T;  3RRW A;  4AQY T;  1Y64 B;  2BVL A;  3UFG A;  2UXD T;  3E22 E;  4EOZ B;  4V1A v;  5DAB A;  4Z8X A;  2ZLY A;  4EZ4 A;  4X65 T;  3ZYK A;  5F5W A;  1HX1 B;  2ES0 A;  2K24 A;  3ONL C;  3RC3 A;  4HEA A;  2ZM2 A;  4GYR A;  4BA9 A;  4I55 E;  3RKG A;  3AE3 A;  1XNR T;  4ZI7 E;  1HNZ T;  1YQ3 A;  2WQY A;  3ZCI A;  4IDO A;  5HEG A;  3HA4 A;  2IUB A;  3IEE A;  4ZZC A;  4HFH A;  2BVM A;  4PW8 A;  1U4Q A;  1E1H B;  5L4H A;  3GN5 B;  5JR9 B;  1Z8U A;  5C8Y E;  5LBM A;  1T7S A;  2D0T A;  4X5T A;  3L39 A;  3NZP A;  5LOV E;  2PG8 A;  3UQ7 A;  3GWH A;  4EAH A;  2M6I A;  5HCJ A;  4PJN A;  2V5D A;  3DP7 A;  3RKO A;  3PUS A;  4I4T E;  4DUY T;  5LGT B;  3KVA A;  4HFV A;  4TV8 E;  2CHN A;  5IYZ E;  1GQE A;  4B3S T;  4N78 D;  4LF9 T;  2X0H A;  4YXD A;  1VCS A;  3F2E A;  5JDL A;  5FP3 A;  5JRC B;  1XDP A;  3ESL A;  4H63 H;  4IE7 A;  4HWC A;  3NRX A;  4WW0 A;  3SOL A;  3EAM A;  3ZEF B;  5LXT E;  4EYU A;  3HL6 A;  3DJB A;  4TUY E;  5JH7 E;  2VKO A;  4WBO A;  4H9N C;  1MIY A;  3ZN1 B;  5ABE A;  2F4V T;  2UXN B;  1YQ4 A;  3PDY A;  4B3R T;  1D1B A;  2CBI A;  2CXF A;  1SE7 A;  2VWA A;  3CX7 B;  3CQC B;  5LB7 B;  5AQP B;  2XAS B;  5L3C B;  4CN1 A;  1N36 T;  2J62 A;  4P0A A;  4U33 A;  2CXD A;  3F31 A;  3RPU A;  3PUW F;  2A2F X;  1HF8 A;  5L3F B;  3H3M A;  3ZMS B;  1FMW A;  4AI6 A;  2JQH A;  2UXX B;  2XAJ B;  4YHH T;  1Y01 A;  5FMN A;  5HWY A;  5J1G A;  2K3W A;  4DBQ A;  2NTX A;  4DR1 T;  3SFE A;  2V6Y A;  2LSY A;  1FIO A;  2VKJ A;  5A1L A;  5FY0 A;  5AQM B;  2CEA A;  4U7I A;  2WMN A;  5AQL B;  5HEJ A;  2BG9 A;  3O9X A;  3SS1 A;  3UUB A;  3B5M A;  4IT4 A;  2WAU A;  1OWA A;  3A7M A;  2W67 A;  2Q9Q D;  3E08 A;  1HX8 A;  1HCI A;  2D9D A;  2Y8D A;  1KF6 A;  4JEU B;  3J9X 1;  3TLT A;  1UX4 A;  3VHL A;  4B6X A;  4ZXL A;  3CX8 B;  2XQY A;  1OXZ A;  5FXW A;  4CI2 B;  4UR9 A;  1J1J A;  4ISS A;  4YFS A;  4NIQ A;  3ETV A;  5HWX A;  2W66 A;  3I9Y A;  3RLF F;  3ZMU B;  4ZEY A;  2MOZ A;  2LEH A;  2BS2 A;  1I94 T;  2VAS A;  2XM2 A;  3N5L A;  4H9R C;  4DUZ T;  3K3O A;  2LM2 A;  3AXJ A;  2CLY B;  3UU5 A;  2LHN A;  2NR4 A;  2W4X A;  4HFB A;  2WS3 A;  1KNP A;  5AQG B;  4JYA T;  3QC9 A;  2WZI A;  4AKH A;  2FJA A;  4QXC B;  3B13 A;  3MAC A;  2LOP A;  1ZHC A;  1HG5 A;  3QK6 A;  4AIS A;  4YSZ A;  3BK9 A;  3K3N A;  3J7Y q;  1JNR A;  3KDS E;  4KBM B;  3AVR A;  4F6R C;  3P8C D;  4PNI A;  2YIN A;  2FUP A;  4H63 V;  2WCA A;  5L47 A;  2CXL A;  1BR1 A;  2XZE A;  4MAL A;  3VKG A;  2YDQ A;  3Q9D A;  5LNK A;  4LFA T;  4JUY A;  4IIJ E;  2NWB A;  1SUM B;  3AEE A;  2L3L A;  1XMQ T;  4L5G A;  5JDN A;  4O4J E;  3AE2 A;  4XAX B;  2V8S V;  3ABV A;  5HYA A;  4LF5 T;  3EHZ A;  2IAK A;  4CXY A;  2DL1 A;  4EED A;  2LKH A;  2LOS A;  3RIU C;  3SFD A;  2A72 A;  2L8K A;  1J5W A;  4GIW A;  1X9B A;  2VQE T;  1D1C A;  4IST A;  4ZI2 C;  4A98 A;  2N1G A;  3RHW A;  2X0L B;  3P4S A;  4LML A;  2C0S A;  2VB6 A;  4JI7 T;  2X0Y A;  4DV1 T;  3CML A;  3LDQ B;  4CXX A;  2CMR A;  2E5L T;  3VR9 A;  5L4E A;  4UIG A;  4AIU A;  4Z91 A;  3EDU A;  2V26 A;  3CX6 B;  5LA6 E;  3NBX X;  3ZN0 B;  1E7P A;  2A9U A;  3VRB A;  5LMU T;  4EZH A;  5ABF B;  5H6Q B;  4C91 A;  2IC9 A;  5FXZ A;  5AFU L;  4HKA A;  3TKL B;  5LYJ E;  2DHR A;  3PU3 A;  2BKP A;  2ZMA A;  5CFB A;  3AAI A;  4LF7 T;  2N9D A;  2K48 A;  4JBW F;  4UEL A;  4HFD A;  5AQK B;  2CHO A;  4UEM A;  5FYM A;  4M1P A;  3R84 B;  2V7K A;  2H88 A;  1KNZ A;  3PUZ F;  4DV0 T;  2CRB A;  4PFP A;  3HKC E;  3HR0 A;  3PTR B;  5FL0 A;  2ODV A;  4KX6 A;  2X9X A;  5J0Z A;  3UFE A;  4I0U A;  2VKD A;  2YU2 A;  2HN1 A;  5JQG E;  2WDQ A;  2VQF T;  5FL1 A;  3IA3 A;  3OKQ A;  3AEG A;  2FJD A;  2V6Y B; 
#chains in the Genus database with same CATH homology
 3N9M A;  1MND A;  2NTY A;  4UXN B;  1IAP A;  3DP7 A;  3RKO A;  1MMG A;  3PUS A;  3C4X A;  3MXZ A;  4I4T E;  2X9W A;  4QXB B;  3ETU A;  3N2O A;  1BR0 A;  3LJC A;  3N9P A;  5LGT B;  2XTL A;  3AA1 B;  3KVA A;  4AXP A;  2LSK A;  2EHO A;  3AVS A;  3OJA A;  4HFV A;  4TV8 E;  5IYZ E;  4EXT A;  4N78 D;  3UT5 E;  4ANJ A;  2D2S A;  2LE8 A;  3V5S A;  4KUM B;  3GA8 A;  1HS7 A;  1MIV A;  3F2E A;  5JDL A;  5F8P A;  5FP3 A;  5JRC B;  4J2C A;  2CCQ A;  3ESL A;  4H63 H;  4IE7 A;  2DI4 A;  2MTQ A;  2L9Q A;  4DBR A;  3NRX A;  4I50 E;  4PFO A;  3I1A A;  1NAF A;  2X68 A;  4WW0 A;  2C5I T;  3SOL A;  3ZEF B;  5LXT E;  5J2T E;  4QKN A;  3FB2 A;  2SPC A;  3B57 A;  3AAE B;  2EHO B;  4EYU A;  1D0Y A;  5FY1 A;  3RH3 A;  3HL6 A;  3FHN A;  3DJB A;  2MYS A;  4TUY E;  2W0G A;  5JH7 E;  2VKO A;  4WBO A;  4H9N C;  3UUX B;  3N9O A;  5L3E B;  1MIY A;  2CLY C;  2DWK A;  2QGS A;  4JEH B;  4EB6 E;  3ZN1 B;  5GON E;  5L3D B;  2JQQ A;  5LJM A;  4NUU A;  2UXN B;  4YHJ A;  3PDY A;  1NWM X;  5L2L A;  3LK4 2;  2HPL A;  2W00 A;  1BR4 A;  3U78 A;  3UTK A;  1IJ6 A;  4GOU A;  4TV9 E;  1D1B A;  4OYK A;  4FJO A;  1WLX A;  3HKD E;  4U74 A;  3RRC A;  2CXF A;  3OYX A;  1UX5 A;  4EYY R;  3SRZ A;  2VWA A;  1D1A A;  3CX7 B;  3CQC B;  5L3C B;  3EUH A;  2XAS B;  4C90 A;  3O1I A;  4P0A A;  4TX5 A;  2V7L A;  2CXD A;  2JJ9 A;  4BJM A;  3T8O A;  3F31 A;  3E0Z A;  2WWU A;  2IC6 A;  3RPU A;  5ADX L;  3IF8 B;  5JR9 A;  2A2F X;  1HF8 A;  5L3F B;  2XAG B;  3OYZ A;  3ZMS B;  1FMW A;  1LVK A;  4AI6 A;  3PUG A;  4H9P C;  4H9Q C;  4GK0 E;  2LSJ A;  2BDE A;  3FBZ A;  2CE7 A;  3RYI E;  4AKI A;  4G2A A;  4WBN E;  3KBU A;  4KP3 C;  3CVR A;  5CA0 E;  4MFR A;  3ZMV B;  5LG4 A;  2DNX A;  3KVB A;  2UXX B;  5LBQ B;  2XAJ B;  2KXP B;  3BQI A;  2NW8 A;  2XAF B;  5FMN A;  5HWY A;  4OFZ A;  5J1G A;  4ZS2 A;  4DBQ A;  2X9H A;  2NTX A;  3LK3 B;  1KK7 A;  1LRZ A;  4PJM A;  5LHI B;  3ZJ1 A;  2CA5 A;  2LSY A;  3MK7 C;  1B7T A;  1FIO A;  2M67 A;  1S94 A;  2VKJ A;  4ZS3 A;  2H3R A;  3M65 A;  5A1L A;  5FY0 A;  5BMV E;  2CEA A;  3V5U A;  4AQF A;  5JDH A;  2WMN A;  2Y6X A;  1MMA A;  2NOX A;  3O9X A;  3SS1 A;  1IJ5 A;  3Q2M A;  1MMD A;  2V7M A;  2WAU A;  3FBL A;  1OWA A;  4O2A E;  3CKD A;  3ZCJ A;  2Q9Q C;  4X1K E;  2KWI B;  4QWN B;  3LBX A;  4UF0 B;  4IDZ A;  3ZMT B;  1O3X A;  3N9L A;  2Q9Q D;  5CB4 E;  3E08 A;  1HX8 A;  2X67 A;  3IHR A;  1HCI A;  2BZB A;  2Y8D A;  1QUU A;  4JEU B;  4CZZ B;  3J9X 1;  3N2K E;  2E9X B;  5JRC A;  1UX4 A;  2PFV A;  3VHL A;  4B6X A;  3AAA B;  2N2N A;  2G0U A;  3CX8 B;  3H3A A;  2XQY A;  4IGU A;  3N9N A;  4MLK A;  4ADZ A;  4DVD A;  1OXZ A;  4QX8 B;  5FXV A;  2LM9 A;  5FXW A;  4CI2 B;  2X51 A;  2YK0 A;  5FXX A;  3D0T A;  3QUJ A;  3LBX B;  5LGU B;  2WSS V;  1H7C A;  1HTJ F;  4ISS A;  4X1Y E;  3CQG B;  4YFS A;  2KIN B;  2MBG A;  3ETV A;  4CQI A;  5JVD E;  3W15 B;  5HWX A;  3I9Y A;  3RYF E;  3ZJ2 A;  3ZMU B;  4GK5 E;  2MOZ A;  5IHY A;  2LEH A;  3MJX A;  4H9S E;  2LSI A;  1LVF A;  3KBT A;  4PK4 A;  3F57 A;  4UVA B;  3GMI A;  4IE6 A;  3MKD A;  2W63 A;  4CXW A;  2ACX A;  2DLR A;  3KV5 A;  2VAS A;  5LHG B;  3N5L A;  4H9R C;  4AKG A;  2E8I A;  3C51 A;  1HG2 A;  3AA6 B;  3BQL A;  3K3O A;  3MZK B;  5FNV E;  3ZLI A;  4DMV A;  2HPJ A;  3RYH E;  2RA1 A;  3KFW X;  4QXH B;  2CLY B;  2K5B B;  2LHN A;  4O8S A;  4P0B A;  4PJL A;  4X20 E;  3MA9 A;  2XAQ B;  4QHO A;  4PK5 A;  3CQX C;  3IBP A;  5KDM C;  2CWY A;  1SHZ C;  3JC6 C;  1ZEE A;  3O1H A;  3RC8 A;  2EHO C;  5LP6 E;  3EVY A;  2KWH A;  1MNE A;  3JC6 D;  2KZ7 B;  3ZYL A;  4ASK A;  4UV8 B;  2P9B A;  2EHO D;  4OYJ A;  2C5J A;  3PUA A;  2XAH B;  3QC9 A;  3LG7 A;  4AKH A;  4L9I A;  4QXC B;  2JMH A;  2V1D B;  3HI2 A;  3KV9 A;  4QX7 B;  5JDG A;  3B13 A;  3MAC A;  4G63 A;  3HKE E;  2X66 A;  2LOP A;  4UV9 B;  2LHR A;  4NUV A;  4CI1 B;  1G73 A;  2NW9 A;  1ZHC A;  1HG5 A;  3ZPO A;  4E7S A;  3HKB E;  2CM0 A;  2PBI A;  3QK6 A;  1WYB A;  3UUL A;  4EIW A;  3LK2 B;  2I59 A;  4YJ3 E;  2J1D G;  1D0X A;  4O4L E;  3BK9 A;  4XZC A;  3K3N A;  3J7Y q;  1MMN A;  3C64 A;  3R6N A;  1WR6 A;  2WMO A;  2NW7 A;  3VU7 H;  1D0Z A;  2KMF A;  4U72 A;  4DO0 A;  1WYC A;  3KDS E;  3I0Q A;  4KBM B;  4PAG A;  4BAY B;  3AVR A;  1T98 A;  4F6R C;  4ERR A;  3P8C D;  4UF0 A;  4PNI A;  2YIN A;  3VKH A;  2HH7 A;  5HXC A;  3PU8 A;  4UVB B;  3WAK A;  3CWZ B;  1EZ3 A;  2XUE A;  3K3Q C;  4GYS A;  4H63 V;  2E9X A;  3C98 B;  5ETW A;  2GK9 A;  5JRE A;  2CXL A;  4BJN A;  1ZV4 X;  3P7I A;  5HXH A;  3AB3 B;  4AKR B;  5JDM A;  1BR1 A;  3O4X E;  4MAL A;  3VKG A;  2VL8 A;  2IW5 B;  3Q9D A;  5LGN B;  5LNK A;  5EK3 A;  2Q9Q B;  3WAJ A;  4I43 B;  4YJ2 E;  4TZ4 C;  5M4Y A;  1QSD A;  3H37 A;  5EK4 A;  3AA0 B;  4YLH A;  5HXE A;  1ZKE A;  4JUY A;  1YD8 G;  4IIJ E;  4AQG A;  2KT9 A;  2NWB A;  5KX5 E;  3C4Z A;  1SA0 E;  3ZYM A;  5H6R B;  2X9Y A;  5L3G B;  2L3L A;  5JR9 C;  2OA5 A;  3S4U A;  4L5G A;  3SWH A;  5JDN A;  5JDF A;  3EDV A;  3KV4 A;  2C5K T;  2K9A A;  4O4J E;  4HTE A;  4O4I E;  2JPF A;  4XAX B;  2H7V C;  1FEW A;  4H9O C;  1UCU A;  1HFA A;  3ANW A;  5HYA A;  4P09 A;  2Z6E A;  4X1I E;  2V7J A;  2IAK A;  3Q5W A;  5JDQ A;  2DCF A;  4DND A;  3K8P C;  3N9Q A;  4MHC A;  4ZOL E;  4IE4 A;  2VK9 A;  3ONX A;  5EK2 A;  5E0O A;  4WNK A;  3CPZ A;  4CXY A;  3ZMZ B;  2E9X C;  2LOS A;  3AA7 B;  2A72 A;  3L09 A;  2L8K A;  4GIW A;  2ODU A;  4ZHQ E;  1VRB A;  4AQF C;  4HGA A;  2E9X D;  4ZI3 C;  1D1C A;  4PJJ A;  4IST A;  5LJN A;  1MIW A;  4ZI2 C;  1G8X A;  2D5U A;  2ZM8 A;  4ILU A;  4ZI3 D;  3ANW B;  3FXD B;  3L3P A;  2N1G A;  4OHF A;  2X0L B;  1CUN A;  4L0R A;  4ZI2 D;  3I0O A;  3OBV E;  2C0S A;  4IE0 A;  3KV6 A;  4TN7 B;  2VB6 A;  3I9W A;  2NP9 A;  4KMC A;  3CML A;  3LFM A;  4O2B E;  1US7 B;  3U3I A;  2W61 A;  4PK6 A;  3NRY A;  4CXX A;  1X79 A;  2CMR A;  2DWG A;  4K0U A;  2B1E A;  3O1J A;  1V9D A;  5HXS A;  1BR2 A;  4UIG A;  2H7O A;  5FY7 A;  3RRW A;  4HN9 A;  3KIN B;  4E7Z A;  3EDU A;  3PUQ A;  2V26 A;  1Y64 B;  3BQK A;  3CX6 B;  3C50 A;  2QA7 A;  3NZQ A;  5LA6 E;  1U5P A;  1AJ3 A;  3NBX X;  2BVL A;  4XBF B;  3ZN0 B;  4DMW A;  3RX6 A;  4EZH A;  2YEV C;  3E22 E;  3Q5X A;  1YW0 A;  2ZM0 A;  2JMK A;  4V1A v;  5H6Q B;  4C91 A;  4EOZ B;  1IZN B;  2IC9 A;  5HXR A;  5FXZ A;  5AFU L;  4UVC B;  5DAB A;  4Z8X A;  2ZLY A;  4HKA A;  4EZ4 A;  3ZYK A;  3TKL B;  3WI3 A;  5LYJ E;  1YKH B;  2DHR A;  2ES0 A;  2K24 A;  3PU3 A;  2ZMA A;  1LKX A;  1FMV A;  2A3D A;  3AAI A;  1S35 A;  1WRD A;  4HE8 A;  2N9D A;  3ZC0 A;  2K48 A;  2JRK A;  2PJQ A;  5HAX A;  5J2U E;  2Q9Q A;  4JLE A;  4UEL A;  3RC3 A;  2XHE B;  4HEA A;  2RP4 A;  2ZM2 A;  4UEM A;  4GYR A;  4OK0 A;  3PE0 A;  2KLQ A;  1VOM A;  3UUN A;  5L3B B;  5FYM A;  4BA9 A;  4M1P A;  3GN5 A;  4I55 E;  2Y48 B;  5LCY A;  4ZI7 E;  3R84 B;  2V7K A;  5DQV A;  3ZCI A;  2WM9 A;  4O4H E;  3HA4 A;  3IEE A;  2CWO A;  1KNZ A;  5EZY E;  2BVM A;  4PW8 A;  3UUM A;  4FI5 A;  1U4Q A;  1E1H B;  5KMG P;  3PUR A;  1Z0P A;  2LSG A;  2W62 A;  4IHJ E;  4PFP A;  3HKC E;  5CA1 E;  3RYC E;  3HR0 A;  3GN5 B;  3PTR B;  5LHH B;  2LJL A;  2ODV A;  5JR9 B;  3A5X A;  5C8Y E;  5LBM A;  2YU1 A;  2X9X A;  4AKL A;  3UFE A;  4A56 A;  2D0T A;  2WBL A;  5DJQ C;  2VKH A;  2KND A;  2VKD A;  2V7I A;  2YU2 A;  5JQG E;  4CI3 B;  3NZP A;  5LOV E;  2PG8 A;  3N2G E;  3C4W A;  5DQW A;  2LT3 A;  4IE5 A;  3OKQ A;  5TAO A;  1YKE B;  3DTO A;  3GWH A;  4MBQ A;  5F3J A;  4EAH A;  3ZC1 A;  3FXE B;  2D0U A;  4PJN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...