3WI3A

Crystal structure of the sld3/treslin domain from yeast sld3
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
268
structure length
215
Chain Sequence
YSDPKEYIESKYYDALFSIHTPLAYFVKSNLVRLKNTCRTKYGSDSYKIAYQAMLQKFLLSIVQFKDRHDNRLLLEPFSSPIADEKRKNCLTKFVIQDENKNSSTIADLCVVLKSREIKLQILLLLEIIGLNDLDWNFRDFDYCEQLDLYLDRACILDILLSSETGTIQEHKKNILDKSKEASLVGFINYVLIPYFNKKVPHAVEFIIQKLKGPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Replication regulator
molecule keywords DNA replication regulator SLD3
publication title Crystal structure of the homology domain of the eukaryotic DNA replication proteins sld3/treslin.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 83
structure length 215
sequence length 268
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2013-09-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.2130 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3wi3A00
3WI3A
chains in the Genus database with same CATH superfamily
4OFZA 1I94T 4H9SE 5F8PA 4ZI3D 4O4HE 1HG5A 3H3MA 5LHIB 3B13A 2VQFT 3P4SA 4HKAA 3WAKA 5JR9A 3CK6A 2CWOA 2XQ3A 5JRCA 2XJ7A 5EK3A 1WCRA 4YJ2E 5FL1A 3FHNA 4TNVA 2WZIA 5KXJA 2K48A 3N9NA 3PTRB 1FIOA 2K5BB 3FBLA 4ZZCA 4HWFA 3UU6A 2PTFA 3PUXF 3RGLA 2J62A 3KFWX 4UELA 2I59A 2W67A 2EHOD 4M1PA 3S4UA 2FJDA 3Q9DA 1LVKA 2V5CA 4QX8B 4U2ZA 3ONLC 4HE8A 5HXCA 3HL6A 2DCFA 2X9HA 3C4ZA 2Q9QA 4K0KT 2UU9T 4QH1A 3TLVA 2VK9A 2LEHA 4H9PC 2M6IA 3OYZA 1SA0E 2VKOA 2XY8B 2XAHB 2CXFA 1U5PA 5CFBA 2P9BA 3AE6A 4EZ4A 2Z6EA 2VL8A 3SWHA 2XTLA 5IYZE 4LFAT 2L8KA 1OXZA 2CHOA 3IEEA 3RKOA 3H3AA 4IL4A 3UU4A 4UV8B 1YW0A 3RQUA 4CN4A 2BG9A 4O4LE 2BZBA 4U74A 1IBMT 3CWZB 4LMKA 3UUBA 4PK6A 3PUGA 3LK42 2BS4A 3N5LA 1KEYA 3EDUA 1XNQT 1S94A 4KHPT 3ZN0B 2BKNA 1US7B 4H9QC 2UXNB 4IE4A 2MOZA 2UUBT 3RH3A 3KBTA 5JR9B 2CPTA 1BR1A 4P09A 1H7CA 1O3XA 5JRCB 4OK0A 1XDPA 3UFGA 4B3TT 2V7LA 5CJ5A 1D1BA 4NIQA 5HWYA 2YK0A 2E5LT 1LKXA 2NW9A 4JV5T 3AA6B 4I0UA 2YN6A 3I9WA 2KT9A 4E7SA 2LHNA 1BR0A 3PUSA 4DR5T 3ZT7A 2X68A 1UK5A 3JC6C 4B3ST 3F31A 1KNRA 1N33T 3UUNA 3RQWA 3ZEFB 5EZYE 4HWCA 1NEKA 5JVDE 5AQVB 3QUJA 1OWAA 5HXSA 3UT5E 2W63A 3JCFA 3Q5WA 3LDQB 3PUAA 3Q5XA 4OYKA 2Q9QB 5AQMB 3OTOT 3AA1B 1IAPA 4X62T 5AQIB 2DNXA 1E7PA 2KWIB 2N9DA 2NP9A 4G2AA 1YD8G 2ZM0A 4TWHA 2QYWA 2JIWA 2XHEB 2G0UA 4QKNA 4JYAT 2BBHA 2XQ7A 3P4PA 5IUXA 3N9LA 2W2UA 5ABFA 2ZM8A 2H7OA 2D9DA 2WWVA 3ZYKA 5HEOA 3P4QA 2SPCA 4EAHA 2CWYA 3FXDB 2WP9A 2VWAA 1G8XA 3MACA 5LG4A 3AAIA 2N1GA 2F4VT 3V5SA 4TNWA 2V6YA 2IUBA 4DV7T 1E2AA 3RYCE 1W0BA 3N2KE 5ADXL 3FZKB 3AE1A 3ANWB 5HXHA 1SHZC 3C64A 3PJAA 5AQTB 2E8IA 2ZM2A 1Z8UA 5IWAT 3AVSA 1UUSA 3WAJA 4B6XA 3HR0A 3UQ7A 3TKLB 3E08A 2XSAA 1MIVA 5LGNB 4CI2B 5J2TE 3ZJ1A 3AECA 3VRBA 2LKHA 3PURA 4AKRB 4IDZA 4ZS3A 2RA1A 4F6RC 3ZCJA 2Y48B 4AIUA 4AQFA 3RRCA 4IDOA 3ZMUB 4QH5A 2FJEA 4DR2T 4ZI7E 4GYRA 1YKHB 4HFDA 1VCSA 3LBXB 2D5UA 3NKZA 4AISA 5FY1A 5DQWA 2VB6A 4IL9A 1ZKEA 3EI0A 5CA1E 4L9IA 5HCMA 3SOLA 4WNKA 4ZEYA 4ILCA 4ILBA 1KK7A 3N2GE 3FB2A 2ODVA 4ZZBA 1FMWA 2JQKA 3N9MA 1XMQT 5ABHA 4Z90A 3BQKA 2I6HA 2FJBA 1KNZA 4L0RA 2V7KA 2OLTA 3AE7A 1VCTA 4MLKA 2WDQA 5LGUB 3D0TA 5LGTB 3AE4A 4HFBA 4QXHB 4HFVA 4TUYE 2HPJA 5ETWA 3PDYA 2BKOA 3AVRA 2HHHT 3ZLIA 4U7IA 3N9QA 1J5ET 3CKDA 3I9YA 3FZFB 5HWXA 3OJAA 3G06A 4HWIB 3T8OA 4QH4A 3RLFF 2WB5A 4O4JE 5JREA 4NPPA 1B7TA 2LSIA 5LJNA 4AXPA 2YU1A 2YEVC 5F5WA 2V6YB 1XZYA 2UXCT 2IAKA 4Z91A 5JR9C 2A72A 5CB4E 4DUZT 4KP3C 4DR6T 2DHRA 3RPUA 2NTYA 3EDVA 3I0QA 5FL0A 2WU5A 3RC3A 3EUHA 5LBQB 4YSYA 2OA5A 2M6BA 4G63A 4DUYT 4LMLA 1ZP0A 2K24A 2I0MA 3JC6D 4JI7T 4EIWA 2OV9A 3OKQA 3JADA 4MFRA 1MNDA 2BG9E 3O1IA 4JI2T 3AE9A 3AAEB 1NAFA 2VVSA 2XAFB 3ZC1A 4EYYR 3HKEE 2VASA 5AQJB 4ERRA 4YT0A 3RIFA 4NUVA 4UVCB 2H89A 4X20E 2IW5B 4H9OC 2N2NA 4DNDA 5CGMA 3GA8A 2YKSA 1UCUA 1UX5A 1ZEEA 2Q9QC 5FY0A 3SFDA 5JDGA 3AXJA 3SRZA 5JDLA 2XASB 2CHNA 3N2OA 5HEGA 1NENA 4DV1T 3ABVA 4GK0E 2XPKA 4DR3T 4IE5A 1HX8A 3CX7B 4AQGA 4AKIA 3C4XA 2KSRA 2V6XA 4U3CA 4WBNE 4U2YA 2LRKA 2YOEA 2BG9C 2NTXA 5KDMC 2BBJA 4YSZA 2C0SA 1W0AA 3RHWA 3HA4A 5HEHA 5JQGE 5IHYA 3AEEA 3CPZA 4HFEA 3TLTA 1IZNB 2XQYA 3VKHA 2V26A 5BMVE 4JI1T 1XWMA 1EZ3A 4JBWF 3PUVF 4AI6A 4KX6A 3DTOA 4IDNA 4OYJA 1VRBA 1Z0PA 3V5UA 3HI2A 2NW7A 2WQYA 5L3DB 1NWMX 5EK2A 1IBLT 3FBZA 2WAUA 2YINA 3OVUA 5JH7E 4UXNB 5H6RB 1MNEA 4QXCB 4YY3T 4NXMT 2YDRA 4GK5E 3VRAA 3CQGB 2JRKA 4P0AA 2YDQA 3AEFA 1DU2A 3KBUA 2BVMA 1W09A 5HXEA 4DO0A 1HCIA 1D0ZA 2WWUA 2H7VC 4BJMA 4ZOLE 3ZT5A 4IDPA 4X65T 3KV9A 4YSXA 4C91A 3RF1A 3P7IA 2ACXA 5LNKA 3ONXA 4DBRA 4U31A 4LF5T 2XUEA 1XNRT 2ACZA 2QVAA 1HNWT 3NBXX 2DL1A 1WRDA 3ZCIA 2PFVA 4I43B 1N32T 1OEDE 4PJMA 3I1AA 3KV6A 1WFDA 4YLHA 1HR0T 3ZSTA 4C90A 2V7IA 2V7MA 4U33A 1ZOYA 4KUMB 2W66A 2XQ5A 5FXXA 4ILUA 3PUQA 3B57A 2Y6XA 1IJ6A 3OPCA 3CX6B 3O1HA 2KZ7B 5KX5E 4OHFA 3BK9A 3EVYA 3AA0B 1G73A 2XZEA 1VOMA 4YHJA 2WSSV 2MYSA 2XAGB 3B5MA 1M62A 2J4GA 2VVNA 3QC9A 2L9QA 3RIAA 4EOZB 3AE5A 3ONJA 4LFCT 2CMRA 2MPKA 3T1YT 2AE9A 4F8HA 3LK3B 3PU3A 3M65A 1N34T 2XSBA 4AQFC 5L4EA 2Q9QD 4ADZA 4YFSA 2QGSA 4P0BA 4UF0A 2YU2A 4YJ3E 1QUUA 3LG7A 3AA7B 1V9DA 4P1NA 3QB5K 3VR8A 3PV0F 3JAFA 3VKGA 2LSYA 3FXEB 3L8RA 4LF9T 1HF8A 2KINB 1XMOT 3UULA 2A3DA 3UFEA 4A98A 4X1YE 4V1Av 3IHRA 2X66A 5A1LA 4HFIA 4X5TA 1WYCA 3ETUA 4ILAA 4NXNT 2E9XA 4LF6T 2V8SV 2C5JA 2BG9B 4O2AE 1SE7A 5HEJA 1X79A 4ZHQE 3TLSA 2IIUA 2H88A 4FJOA 2XM2A 3ZC0A 4H9RC 4ZI2C 3M3ZB 3OYXA 1HS7A 2X9YA 4UV9B 2HH7A 2K9AA 3CMLA 3KINB 4PK5A 3UU3A 2Y8DA 3NZQA 4PNIA 1GQEA 3AEDA 2JMHA 5L3BB 4O8SA 1OEDA 3R6NA 5LMUT 1ZHCA 3HKDE 1YXRA 4CI3B 3P4RA 1YKEB 4EEBA 2YDSA 3UQ4A 3RI5A 4DIDB 4UVBB 4IHJE 5C3JA 3CVRA 2D0UA 4LFBT 2LJLA 4TZ4C 3ZSSA 2BVLA 3K3QC 4DR1T 3Q5DA 1WR0A 2CLYB 4HTEA 4HGAA 5EK4A 3AE8A 5AQGB 3PUZF 4HWDA 2HN2A 3AB3B 3ZYMA 1LRZA 5BR8T 1R8IA 2JMKA 4UF0B 1D1AA 5J2UE 4HFCA 1T8BA 2VKHA 1WYBA 2X0YA 1BR2A 2C5IT 3GWHA 5FXVA 2VURA 2LSKA 4UIGA 2X9WA 4CI1B 2KNDA 5ABFB 4H63H 3C51A 5AQOB 3N9PA 4YHHT 3A8YC 4DV6T 2A2FX 4EB6E 2RPAA 5LCYA 4B3RT 2CXLA 3QB5A 5AQUB 4WZXA 1HFAA 1FMVA 1D1CA 1LVFA 3UUMA 3UU8A 3CQCB 4FI5A 3ZYLA 4XAXB 2V5DA 2WM9A 2IC9A 5AQRB 3K3OA 4EXTA 2XQ9A 3FZHB 4ISTA 2W00A 3K3NA 4JI0T 2EHOA 3EHZA 2DI4A 4LMJA 4IE7A 5AQNB 1Y64B 4JEHB 5FKYA 1MIWA 4TX5A 1HNZT 1UGOA 3C4WA 3Q2MA 4Q25A 3RYIE 3MA9A 4PJJA 3F57A 4A97A 5ABEA 4YTMA 5HYAA 3O4XE 2HPLA 3ZKRA 1OEDB 2CA5A 2XQ6A 2NW8A 4EGWA 2LOPA 4E7ZA 3CX8B 4ASKA 2FBWA 4TV9E 4DVDA 1ZV4X 2VKJA 2H3RA 1L0VA 5HEUA 4IE6A 1T72A 2X0HA 4QHOA 5AQQB 3ZT6A 4JI6T 4BA9A 4HN9A 4JI4T 1BR4A 2LT3A 3SFEA 2PBIA 4HWHA 5LMNT 1U4QA 4LF4T 1MIYA 4MBQA 3PU8A 2LM9A 2DWGA 2NWBA 3KV5A 2UXBT 2XQAA 4NUUA 3J9X1 4YTPA 3NZPA 5LHGB 5L3FB 2VQET 4TN7B 2W62A 3ZJ2A 4GYSA 4CN1A 2CEAA 1FEWA 3FZLB 2W4XA 4ZI2D 3HKCE 2JQQA 2JQ9A 2WBLA 2MBGA 2XQ4A 3A5XA 3AEAA 4K0UA 2RP4A 4LF8T 1HNXT 3EABA 4ZXLA 3RX6A 3K1SA 4H63V 3NVOA 3AEGA 2R6GF 4KI0F 3KVAA 3VU7H 5LHHB 5AQHB 2W61A 5LP6E 5LG3A 3RIUA 3UTKA 3T1HT 1JNZA 2WMNA 3RYFE 1M7KA 2KWHA 1SUMB 2JPFA 2WZHA 5FP3A 2EHOB 4EV6A 3JAEA 3KVBA 3EAMA 4LF7T 4X64T 4TWDA 5LB7B 3ETVA 5J0ZA 3I0OA 4XBFB 4KHZF 3MXZA 4GIWA 5HAXA 2LSGA 2LRLA 4L5GA 3AAAB 4DV3T 4KBMB 1HX1B 2WCAA 3AE3A 4TV8E 5AQLB 1CUNA 3A7MA 2BS3A 2V1DB 2CLYC 4J2CA 5AQPB 2FUPA 5JDNA 1UX4A 5E0OA 3ZPOA 3KDSE 4PJLA 3AXJB 2WMOA 4YXDA 2DWKA 2CCQA 2FJAA 5FMNA 4Z8XA 4EEDA 2X0LB 4JLEA 1WR6A 5FY7A 4ANJA 3C98B 3MJXA 5J1GA 3LSVA 3ANWA 5DABA 4AKHA 4CN6A 2X67A 5L3CB 2E9XC 3Q5EA 4PFPA 2VL0A 5JDFA 1FJGT 4DV0T 4IIJE 3OBVE 2B1EA 4UVAB 5L2LA 2HN1A 4QWNB 4YTNA 2ODUA 5DQVA 1WLXA 4DV2T 4BAYB 5LBMA 2UUAT 2M67A 2NR4A 4O2BE 4MALA 3QK6A 1KF6A 3L09A 3LK2B 3PE0A 4HEAA 2XM1A 2WS3A 3LBXA 4AKLA 5GONE 1YQ3A 2MTQA 3RYHE 2K3WA 2CBIA 3ZMZB 3MK7C 5M4YA 2IC6A 1YQ4A 3PJAJ 5JDMA 1OEDC 3PUWF 2MAWA 2BDEA 3LFMA 1E1HB 4A56A 2KMFA 4I4TE 3U3IA 2IHR1 3RKGA 2WDRA 4PAGA 2LKGA 1QSDA 3MZKB 4UR9A 1S35A 5L3EB 3DP7A 4IT4A 3MKDA 4JI5T 4DMWA 2JQHA 4DR4T 2XAQB 3ESLA 5L47A 2B76A 4JI3T 4WW0A 4EZHA 4QX7B 3O9XA 4O4IE 3J7Yq 5LOVE 1MMNA 4N78D 2BS2A 4GKJT 4BJNA 2LLYA 1D0YA 5TAOA 4EYUA 2PG8A 1T7SA 2WU2A 3BQLA 4GKKT 2UXXB 4COFA 3DJBA 3UUXB 4DV5T 3H37A 2XQ8A 4H9NC 5FVLA 3RC8A 1D0XA 4ZI3C 2XAJB 1Y01A 3UU5A 3VR9A 4IE0A 3FZMB 1J5WA 4IREA 2CM0A 5H6QB 2WDVA 4PFOA 3NRXA 4IGUA 2ZLYA 2C5KT 2J1DG 1J1JA 3E22E 1N36T 4X1IE 2ZM6T 2CBJA 3U78A 3QNUA 3SS1A 3VHLA 4ISSA 3O1JA 1I6ZA 4A5XA 4CQIA 2L3LA 4AQYT 4ZS2A 5KMGP 3IF8B 3C50A 4I50E 2WY2A 2X9XA 1CHUA 3GN5A 3GMIA 4X66T 2LHRA 4MHCA 3AE2A 4DMVA 5LXTE 4CXXA 2DLRA 2EHOC 3TLUA 3BQIA 3E0ZA 5AFUL 4PK4A 4OX9T 5L3GB 2LOSA 4TWFA 3AEBA 3TLWA 3QOFA 4IDQA 3F2EA 5JDQA 2QRXA 4HFHA 3NRYA 2KLQA 5LJMA 4B3MT 3HKBE 1HG2A 2E5VA 3P50A 2GK9A 5HCJA 2LSJA 2CXDA 4AKGA 2IDOB 2ES0A 5JTGA 5FYMA 3RRWA 3X1DA 4PJNA 4XZCA 3ZMTB 4X1KE 5ABGA 5LA6E 3NWIA 5AQFB 1XDOA 1MMDA 3P4WA 5CA0E 4QXBB 3PUYF 4DBQA 5AQKB 2LE8A 2E9XB 4DR7T 2E9XD 1HTJF 2UUCT 5JDHA 1KNPA 2BKPA 5HXRA 1KFYA 4JEUB 4CXYA 5LYJE 3IA3A 3L3PA 2D0TA 3ZMVB 2V7JA 5F3JA 1UURA 5FNVE 2W0GA 1X9BA 3WI3A 5FVKA 4I55E 2LM2A 2QA7A 3IBPA 4CZZB 3N9OA 2E2AA 5FXWA 4WBOA 4U72A 3CIRA 2D2SA 1MMGA 1JNRA 3LJCA 1T98A 4UEMA 3CQXC 3W15B 5AQSB 5L4HA 2JJ9A 5C8YE 5FXZA 2NOXA 2UXDT 4JUYA 1W9RA 3RIUC 2X51A 1IJ5A 2IMLA 4WYVA 3GN5B 1QLBA 2CE7A 4GOUA 4CXWA 2J47A 5DJQC 1IBKT 3KV4A 2CRBA 2ZMAA 2KXPB 4U7YA 4JI8T 3P8CD 4DV4T 4KMCA 2AXDS 3ZMSB 3L39A 2PJQA 4PW8A 3K8PC 2A9UA 3R84B 5C2TA 1MMAA 1AJ3A 3ZN1B 2VKDA
chains in the Genus database with same CATH topology
4OFZA 1WYCA 2X0LB 3ETUA 3PDYA 3AVRA 3ZLIA 4H9SE 4JLEA 5F8PA 4ZI3D 1WR6A 3N9QA 4O4HE 2E9XA 5FY7A 4ANJA 1HG5A 3C98B 3CKDA 3MJXA 5J1GA 3I9YA 5LHIB 5HWXA 3B13A 3OJAA 2C5JA 4O2AE 3ANWA 5DABA 4HKAA 3WAKA 5JR9A 4AKHA 1X79A 4ZHQE 3T8OA 2CWOA 5JRCA 4FJOA 3ZC0A 5EK3A 4O4JE 5JREA 2X67A 4H9RC 5L3CB 4ZI2C 1B7TA 2LSIA 2E9XC 5LJNA 4PFPA 4AXPA 5JDFA 4YJ2E 2YU1A 2YEVC 3OYXA 3FHNA 4IIJE 1HS7A 3OBVE 2B1EA 2X9YA 4UVAB 4UV9B 5L2LA 4QWNB 2HH7A 2IAKA 2K48A 2K9AA 3CMLA 5JR9C 2ODUA 2A72A 3N9NA 3PTRB 5CB4E 3KINB 4PK5A 5DQVA 1FIOA 1WLXA 2K5BB 3FBLA 4KP3C 2Y8DA 4BAYB 2DHRA 3NZQA 4PNIA 3RPUA 5LBMA 3KFWX 2NTYA 2JMHA 2M67A 3EDVA 5L3BB 3I0QA 4O2BE 4UELA 2I59A 3RC3A 3EUHA 4MALA 3QK6A 5LBQB 2OA5A 3L09A 3LK2B 2EHOD 4O8SA 4G63A 4M1PA 3S4UA 2K24A 3JC6D 3PE0A 4HEAA 4EIWA 3LBXA 3OKQA 4AKLA 5GONE 2MTQA 3Q9DA 1LVKA 4QX8B 3R6NA 1ZHCA 4MFRA 1MNDA 3HKDE 3RYHE 4CI3B 3O1IA 4HE8A 3ZMZB 1YKEB 5HXCA 3AAEB 3MK7C 3HL6A 5M4YA 2DCFA 2IC6A 2X9HA 4UVBB 1NAFA 4IHJE 3C4ZA 2Q9QA 2XAFB 3ZC1A 3CVRA 4EYYR 5JDMA 3HKEE 2VASA 4ERRA 2VK9A 2BDEA 2D0UA 3LFMA 4NUVA 4UVCB 1E1HB 2LEHA 4A56A 2KMFA 2LJLA 4H9PC 4I4TE 4TZ4C 3U3IA 3OYZA 2BVLA 1SA0E 2VKOA 4PAGA 4X20E 3K3QC 2IW5B 1QSDA 4H9OC 3MZKB 2N2NA 1S35A 4DNDA 5L3EB 2XAHB 2CXFA 2CLYB 3GA8A 4HTEA 1U5PA 3DP7A 4HGAA 5EK4A 1UCUA 1UX5A 1ZEEA 2P9BA 2Q9QC 3MKDA 4DMWA 5FY0A 5JDGA 2XAQB 3ESLA 4EZ4A 2Z6EA 2VL8A 3AB3B 3SRZA 3ZYMA 3SWHA 1LRZA 2XTLA 4WW0A 5JDLA 2JMKA 5IYZE 4UF0B 2XASB 1D1AA 4EZHA 4QX7B 3O9XA 2L8KA 5J2UE 3N2OA 1OXZA 4O4IE 3J7Yq 5LOVE 1MMNA 4N78D 2VKHA 3IEEA 1WYBA 1BR2A 2C5IT 4GK0E 3RKOA 3GWHA 5FXVA 3H3AA 4BJNA 4UV8B 1YW0A 1D0YA 5TAOA 4IE5A 2LSKA 4UIGA 1HX8A 2X9WA 2KNDA 4EYUA 4CI1B 2PG8A 3CX7B 4H63H 3C51A 4O4LE 2BZBA 4U74A 3BQLA 3N9PA 4AQGA 4AKIA 2UXXB 3CWZB 3C4XA 3DJBA 3UUXB 2A2FX 3H37A 4EB6E 4PK6A 4H9NC 3PUGA 4WBNE 3RC8A 3LK42 3N5LA 1D0XA 3EDUA 5LCYA 4ZI3C 1S94A 2CXLA 2XAJB 3ZN0B 1US7B 4IE0A 2CM0A 5H6QB 4PFOA 3NRXA 1HFAA 1FMVA 4H9QC 2NTXA 2UXNB 4IGUA 2ZLYA 4IE4A 1D1CA 5KDMC 2C5KT 1LVFA 2MOZA 3UUMA 2C0SA 2J1DG 3RH3A 3CQCB 3HA4A 3E22E 4FI5A 3CPZA 5IHYA 3ZYLA 3KBTA 4X1IE 5JQGE 5JR9B 4XAXB 1BR1A 4P09A 1H7CA 3U78A 1IZNB 1O3XA 2WM9A 3SS1A 2IC9A 2XQYA 3K3OA 5JRCB 3VKHA 4EXTA 4OK0A 4ISTA 2V26A 3VHLA 5BMVE 2W00A 4ISSA 1EZ3A 2V7LA 3K3NA 2EHOA 3O1JA 1D1BA 2DI4A 4IE7A 5HWYA 4AI6A 4CQIA 2YK0A 1Y64B 3DTOA 4JEHB 4OYJA 1LKXA 2NW9A 1VRBA 1Z0PA 2L3LA 3V5UA 4ZS2A 3HI2A 2NW7A 5KMGP 5L3DB 3IF8B 1MIWA 1NWMX 3C50A 4TX5A 3AA6B 4I50E 5EK2A 2X9XA 3FBZA 3GN5A 3C4WA 3GMIA 3I9WA 2LHRA 4MHCA 2KT9A 2WAUA 2YINA 3Q2MA 4DMVA 4UXNB 4E7SA 5JH7E 5H6RB 4CXXA 5LXTE 1MNEA 2LHNA 4QXCB 2DLRA 1BR0A 3PUSA 2EHOC 3RYIE 3MA9A 3BQIA 4GK5E 3E0ZA 4PJJA 5AFUL 2X68A 4PK4A 3F57A 3JC6C 3CQGB 2JRKA 5L3GB 3F31A 2LOSA 5HYAA 4P0AA 3O4XE 2HPLA 2CA5A 3UUNA 2NW8A 3ZEFB 2LOPA 4E7ZA 5EZYE 3CX8B 3F2EA 4ASKA 5JDQA 3KBUA 5JVDE 2BVMA 4TV9E 3QUJA 5HXEA 1OWAA 4DVDA 5HXSA 1ZV4X 1HCIA 4DO0A 3UT5E 3NRYA 2KLQA 5LJMA 2VKJA 1D0ZA 2H3RA 3HKBE 2W63A 2WWUA 2H7VC 3PUAA 3Q5WA 3Q5XA 4OYKA 4BJMA 1HG2A 4ZOLE 2Q9QB 4IE6A 3AA1B 1IAPA 3KV9A 2GK9A 2LSJA 4QHOA 4C91A 3P7IA 2DNXA 2CXDA 2KWIB 2N9DA 2NP9A 4BA9A 4HN9A 4G2AA 1YD8G 4AKGA 1BR4A 2ZM0A 2ES0A 5FYMA 2ACXA 2LT3A 5LNKA 2XHEB 2PBIA 2G0UA 4QKNA 3RRWA 1U4QA 3ONXA 1MIYA 4MBQA 3PU8A 4DBRA 4PJNA 4XZCA 3ZMTB 4X1KE 2LM9A 2XUEA 3N9LA 2DWGA 2NWBA 2ZM8A 3KV5A 2H7OA 5LA6E 4NUUA 3J9X1 3NBXX 3ZYKA 1MMDA 1WRDA 3NZPA 2SPCA 4EAHA 4QXBB 5CA0E 5LHGB 5L3FB 3ZCIA 2PFVA 4TN7B 2W62A 2CWYA 4I43B 4PJMA 4DBQA 3FXDB 3I1AA 3KV6A 3ZJ2A 4GYSA 4YLHA 4C90A 2V7IA 2VWAA 1G8XA 3MACA 2V7MA 5LG4A 2CEAA 3AAIA 2LE8A 2N1GA 3V5SA 1FEWA 4KUMB 5FXXA 2E9XB 3HKCE 4ILUA 4ZI2D 2E9XD 1HTJF 2JQQA 5JDHA 2WBLA 3PUQA 3RYCE 2MBGA 3N2KE 5ADXL 5HXRA 3B57A 3A5XA 3ANWB 2Y6XA 4K0UA 1IJ6A 2RP4A 3CX6B 3O1HA 4JEUB 2KZ7B 5HXHA 4CXYA 5KX5E 3RX6A 1SHZC 5LYJE 3C64A 4H63V 3L3PA 2D0TA 2E8IA 2ZM2A 4OHFA 3ZMVB 2V7JA 3BK9A 3EVYA 3AA0B 5F3JA 1G73A 1VOMA 5FNVE 3KVAA 3AVSA 3VU7H 4YHJA 3WAJA 2W0GA 3WI3A 5LHHB 2WSSV 4B6XA 2W61A 3HR0A 5LP6E 4I55E 3TKLB 3E08A 2MYSA 1MIVA 2QA7A 3IBPA 5LGNB 4CI2B 4CZZB 5J2TE 3N9OA 2XAGB 4WBOA 4U72A 5FXWA 3UTKA 3ZJ1A 2WMNA 2D2SA 1MMGA 3PURA 3LJCA 3RYFE 4AKRB 3QC9A 4IDZA 4ZS3A 2RA1A 4F6RC 3ZCJA 2KWHA 2Y48B 2JPFA 2L9QA 1T98A 5FP3A 4AQFA 3RRCA 4UEMA 2EHOB 4EOZB 3ZMUB 3CQXC 3W15B 3KVBA 2JJ9A 5C8YE 5FXZA 2NOXA 4ZI7E 4JUYA 2CMRA 4GYRA 1YKHB 2X51A 3ETVA 3I0OA 3LBXB 1IJ5A 2D5UA 4XBFB 3GN5B 3MXZA 4GIWA 5HAXA 2LSGA 3LK3B 4L5GA 3AAAB 5FY1A 5DQWA 3PU3A 3M65A 2CE7A 2VB6A 1ZKEA 4GOUA 4KBMB 4AQFC 4CXWA 5CA1E 4L9IA 3SOLA 4WNKA 5DJQC 3KV4A 2Q9QD 4TV8E 4ADZA 4YFSA 2QGSA 1KK7A 4P0BA 4UF0A 2ZMAA 2KXPB 3N2GE 2YU2A 3FB2A 2ODVA 4YJ3E 1CUNA 1FMWA 1QUUA 3P8CD 3N9MA 4KMCA 3BQKA 3LG7A 3AA7B 2V1DB 2CLYC 4J2CA 3ZMSB 1V9DA 1KNZA 2PJQA 5JDNA 1UX4A 4PW8A 4L0RA 2V7KA 5E0OA 3ZPOA 3KDSE 3K8PC 4PJLA 4MLKA 3VKGA 2LSYA 3R84B 5LGUB 3D0TA 3FXEB 5LGTB 1HF8A 2WMOA 2KINB 3UULA 4QXHB 2DWKA 2A3DA 4HFVA 3UFEA 1MMAA 2CCQA 4TUYE 2HPJA 1AJ3A 4X1YE 3ZN1B 4V1Av 5FMNA 4Z8XA 3IHRA 5ETWA 2X66A 2VKDA 5A1LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WI3 A; 
#chains in the Genus database with same CATH topology
 4OFZ A;  1I94 T;  4H9S E;  5F8P A;  4ZI3 D;  4O4H E;  1HG5 A;  3H3M A;  5LHI B;  3B13 A;  2VQF T;  3P4S A;  4HKA A;  3WAK A;  5JR9 A;  3CK6 A;  2CWO A;  2XQ3 A;  5JRC A;  2XJ7 A;  5EK3 A;  1WCR A;  4YJ2 E;  5FL1 A;  3FHN A;  4TNV A;  2WZI A;  5KXJ A;  2K48 A;  3N9N A;  3PTR B;  1FIO A;  2K5B B;  3FBL A;  4ZZC A;  4HWF A;  3UU6 A;  2PTF A;  3PUX F;  3RGL A;  2J62 A;  3KFW X;  4UEL A;  2I59 A;  2W67 A;  2EHO D;  4M1P A;  3S4U A;  2FJD A;  3Q9D A;  1LVK A;  2V5C A;  4QX8 B;  4U2Z A;  3ONL C;  4HE8 A;  5HXC A;  3HL6 A;  2DCF A;  2X9H A;  3C4Z A;  2Q9Q A;  4K0K T;  2UU9 T;  4QH1 A;  3TLV A;  2VK9 A;  2LEH A;  4H9P C;  2M6I A;  3OYZ A;  1SA0 E;  2VKO A;  2XY8 B;  2XAH B;  2CXF A;  1U5P A;  5CFB A;  2P9B A;  3AE6 A;  4EZ4 A;  2Z6E A;  2VL8 A;  3SWH A;  2XTL A;  5IYZ E;  4LFA T;  2L8K A;  1OXZ A;  2CHO A;  3IEE A;  3RKO A;  3H3A A;  4IL4 A;  3UU4 A;  4UV8 B;  1YW0 A;  3RQU A;  4CN4 A;  2BG9 A;  4O4L E;  2BZB A;  4U74 A;  1IBM T;  3CWZ B;  4LMK A;  3UUB A;  4PK6 A;  3PUG A;  3LK4 2;  2BS4 A;  3N5L A;  1KEY A;  3EDU A;  1XNQ T;  1S94 A;  4KHP T;  3ZN0 B;  2BKN A;  1US7 B;  4H9Q C;  2UXN B;  4IE4 A;  2MOZ A;  2UUB T;  3RH3 A;  3KBT A;  5JR9 B;  2CPT A;  1BR1 A;  4P09 A;  1H7C A;  1O3X A;  5JRC B;  4OK0 A;  1XDP A;  3UFG A;  4B3T T;  2V7L A;  5CJ5 A;  1D1B A;  4NIQ A;  5HWY A;  2YK0 A;  2E5L T;  1LKX A;  2NW9 A;  4JV5 T;  3AA6 B;  4I0U A;  2YN6 A;  3I9W A;  2KT9 A;  4E7S A;  2LHN A;  1BR0 A;  3PUS A;  4DR5 T;  3ZT7 A;  2X68 A;  1UK5 A;  3JC6 C;  4B3S T;  3F31 A;  1KNR A;  1N33 T;  3UUN A;  3RQW A;  3ZEF B;  5EZY E;  4HWC A;  1NEK A;  5JVD E;  5AQV B;  3QUJ A;  1OWA A;  5HXS A;  3UT5 E;  2W63 A;  3JCF A;  3Q5W A;  3LDQ B;  3PUA A;  3Q5X A;  4OYK A;  2Q9Q B;  5AQM B;  3OTO T;  3AA1 B;  1IAP A;  4X62 T;  5AQI B;  2DNX A;  1E7P A;  2KWI B;  2N9D A;  2NP9 A;  4G2A A;  1YD8 G;  2ZM0 A;  4TWH A;  2QYW A;  2JIW A;  2XHE B;  2G0U A;  4QKN A;  4JYA T;  2BBH A;  2XQ7 A;  3P4P A;  5IUX A;  3N9L A;  2W2U A;  5ABF A;  2ZM8 A;  2H7O A;  2D9D A;  2WWV A;  3ZYK A;  5HEO A;  3P4Q A;  2SPC A;  4EAH A;  2CWY A;  3FXD B;  2WP9 A;  2VWA A;  1G8X A;  3MAC A;  5LG4 A;  3AAI A;  2N1G A;  2F4V T;  3V5S A;  4TNW A;  2V6Y A;  2IUB A;  4DV7 T;  1E2A A;  3RYC E;  1W0B A;  3N2K E;  5ADX L;  3FZK B;  3AE1 A;  3ANW B;  5HXH A;  1SHZ C;  3C64 A;  3PJA A;  5AQT B;  2E8I A;  2ZM2 A;  1Z8U A;  5IWA T;  3AVS A;  1UUS A;  3WAJ A;  4B6X A;  3HR0 A;  3UQ7 A;  3TKL B;  3E08 A;  2XSA A;  1MIV A;  5LGN B;  4CI2 B;  5J2T E;  3ZJ1 A;  3AEC A;  3VRB A;  2LKH A;  3PUR A;  4AKR B;  4IDZ A;  4ZS3 A;  2RA1 A;  4F6R C;  3ZCJ A;  2Y48 B;  4AIU A;  4AQF A;  3RRC A;  4IDO A;  3ZMU B;  4QH5 A;  2FJE A;  4DR2 T;  4ZI7 E;  4GYR A;  1YKH B;  4HFD A;  1VCS A;  3LBX B;  2D5U A;  3NKZ A;  4AIS A;  5FY1 A;  5DQW A;  2VB6 A;  4IL9 A;  1ZKE A;  3EI0 A;  5CA1 E;  4L9I A;  5HCM A;  3SOL A;  4WNK A;  4ZEY A;  4ILC A;  4ILB A;  1KK7 A;  3N2G E;  3FB2 A;  2ODV A;  4ZZB A;  1FMW A;  2JQK A;  3N9M A;  1XMQ T;  5ABH A;  4Z90 A;  3BQK A;  2I6H A;  2FJB A;  1KNZ A;  4L0R A;  2V7K A;  2OLT A;  3AE7 A;  1VCT A;  4MLK A;  2WDQ A;  5LGU B;  3D0T A;  5LGT B;  3AE4 A;  4HFB A;  4QXH B;  4HFV A;  4TUY E;  2HPJ A;  5ETW A;  3PDY A;  2BKO A;  3AVR A;  2HHH T;  3ZLI A;  4U7I A;  3N9Q A;  1J5E T;  3CKD A;  3I9Y A;  3FZF B;  5HWX A;  3OJA A;  3G06 A;  4HWI B;  3T8O A;  4QH4 A;  3RLF F;  2WB5 A;  4O4J E;  5JRE A;  4NPP A;  1B7T A;  2LSI A;  5LJN A;  4AXP A;  2YU1 A;  2YEV C;  5F5W A;  2V6Y B;  1XZY A;  2UXC T;  2IAK A;  4Z91 A;  5JR9 C;  2A72 A;  5CB4 E;  4DUZ T;  4KP3 C;  4DR6 T;  2DHR A;  3RPU A;  2NTY A;  3EDV A;  3I0Q A;  5FL0 A;  2WU5 A;  3RC3 A;  3EUH A;  5LBQ B;  4YSY A;  2OA5 A;  2M6B A;  4G63 A;  4DUY T;  4LML A;  1ZP0 A;  2K24 A;  2I0M A;  3JC6 D;  4JI7 T;  4EIW A;  2OV9 A;  3OKQ A;  3JAD A;  4MFR A;  1MND A;  2BG9 E;  3O1I A;  4JI2 T;  3AE9 A;  3AAE B;  1NAF A;  2VVS A;  2XAF B;  3ZC1 A;  4EYY R;  3HKE E;  2VAS A;  5AQJ B;  4ERR A;  4YT0 A;  3RIF A;  4NUV A;  4UVC B;  2H89 A;  4X20 E;  2IW5 B;  4H9O C;  2N2N A;  4DND A;  5CGM A;  3GA8 A;  2YKS A;  1UCU A;  1UX5 A;  1ZEE A;  2Q9Q C;  5FY0 A;  3SFD A;  5JDG A;  3AXJ A;  3SRZ A;  5JDL A;  2XAS B;  2CHN A;  3N2O A;  5HEG A;  1NEN A;  4DV1 T;  3ABV A;  4GK0 E;  2XPK A;  4DR3 T;  4IE5 A;  1HX8 A;  3CX7 B;  4AQG A;  4AKI A;  3C4X A;  2KSR A;  2V6X A;  4U3C A;  4WBN E;  4U2Y A;  2LRK A;  2YOE A;  2BG9 C;  2NTX A;  5KDM C;  2BBJ A;  4YSZ A;  2C0S A;  1W0A A;  3RHW A;  3HA4 A;  5HEH A;  5JQG E;  5IHY A;  3AEE A;  3CPZ A;  4HFE A;  3TLT A;  1IZN B;  2XQY A;  3VKH A;  2V26 A;  5BMV E;  4JI1 T;  1XWM A;  1EZ3 A;  4JBW F;  3PUV F;  4AI6 A;  4KX6 A;  3DTO A;  4IDN A;  4OYJ A;  1VRB A;  1Z0P A;  3V5U A;  3HI2 A;  2NW7 A;  2WQY A;  5L3D B;  1NWM X;  5EK2 A;  1IBL T;  3FBZ A;  2WAU A;  2YIN A;  3OVU A;  5JH7 E;  4UXN B;  5H6R B;  1MNE A;  4QXC B;  4YY3 T;  4NXM T;  2YDR A;  4GK5 E;  3VRA A;  3CQG B;  2JRK A;  4P0A A;  2YDQ A;  3AEF A;  1DU2 A;  3KBU A;  2BVM A;  1W09 A;  5HXE A;  4DO0 A;  1HCI A;  1D0Z A;  2WWU A;  2H7V C;  4BJM A;  4ZOL E;  3ZT5 A;  4IDP A;  4X65 T;  3KV9 A;  4YSX A;  4C91 A;  3RF1 A;  3P7I A;  2ACX A;  5LNK A;  3ONX A;  4DBR A;  4U31 A;  4LF5 T;  2XUE A;  1XNR T;  2ACZ A;  2QVA A;  1HNW T;  3NBX X;  2DL1 A;  1WRD A;  3ZCI A;  2PFV A;  4I43 B;  1N32 T;  1OED E;  4PJM A;  3I1A A;  3KV6 A;  1WFD A;  4YLH A;  1HR0 T;  3ZST A;  4C90 A;  2V7I A;  2V7M A;  4U33 A;  1ZOY A;  4KUM B;  2W66 A;  2XQ5 A;  5FXX A;  4ILU A;  3PUQ A;  3B57 A;  2Y6X A;  1IJ6 A;  3OPC A;  3CX6 B;  3O1H A;  2KZ7 B;  5KX5 E;  4OHF A;  3BK9 A;  3EVY A;  3AA0 B;  1G73 A;  2XZE A;  1VOM A;  4YHJ A;  2WSS V;  2MYS A;  2XAG B;  3B5M A;  1M62 A;  2J4G A;  2VVN A;  3QC9 A;  2L9Q A;  3RIA A;  4EOZ B;  3AE5 A;  3ONJ A;  4LFC T;  2CMR A;  2MPK A;  3T1Y T;  2AE9 A;  4F8H A;  3LK3 B;  3PU3 A;  3M65 A;  1N34 T;  2XSB A;  4AQF C;  5L4E A;  2Q9Q D;  4ADZ A;  4YFS A;  2QGS A;  4P0B A;  4UF0 A;  2YU2 A;  4YJ3 E;  1QUU A;  3LG7 A;  3AA7 B;  1V9D A;  4P1N A;  3QB5 K;  3VR8 A;  3PV0 F;  3JAF A;  3VKG A;  2LSY A;  3FXE B;  3L8R A;  4LF9 T;  1HF8 A;  2KIN B;  1XMO T;  3UUL A;  2A3D A;  3UFE A;  4A98 A;  4X1Y E;  4V1A v;  3IHR A;  2X66 A;  5A1L A;  4HFI A;  4X5T A;  1WYC A;  3ETU A;  4ILA A;  4NXN T;  2E9X A;  4LF6 T;  2V8S V;  2C5J A;  2BG9 B;  4O2A E;  1SE7 A;  5HEJ A;  1X79 A;  4ZHQ E;  3TLS A;  2IIU A;  2H88 A;  4FJO A;  2XM2 A;  3ZC0 A;  4H9R C;  4ZI2 C;  3M3Z B;  3OYX A;  1HS7 A;  2X9Y A;  4UV9 B;  2HH7 A;  2K9A A;  3CML A;  3KIN B;  4PK5 A;  3UU3 A;  2Y8D A;  3NZQ A;  4PNI A;  1GQE A;  3AED A;  2JMH A;  5L3B B;  4O8S A;  1OED A;  3R6N A;  5LMU T;  1ZHC A;  3HKD E;  1YXR A;  4CI3 B;  3P4R A;  1YKE B;  4EEB A;  2YDS A;  3UQ4 A;  3RI5 A;  4DID B;  4UVB B;  4IHJ E;  5C3J A;  3CVR A;  2D0U A;  4LFB T;  2LJL A;  4TZ4 C;  3ZSS A;  2BVL A;  3K3Q C;  4DR1 T;  3Q5D A;  1WR0 A;  2CLY B;  4HTE A;  4HGA A;  5EK4 A;  3AE8 A;  5AQG B;  3PUZ F;  4HWD A;  2HN2 A;  3AB3 B;  3ZYM A;  1LRZ A;  5BR8 T;  1R8I A;  2JMK A;  4UF0 B;  1D1A A;  5J2U E;  4HFC A;  1T8B A;  2VKH A;  1WYB A;  2X0Y A;  1BR2 A;  2C5I T;  3GWH A;  5FXV A;  2VUR A;  2LSK A;  4UIG A;  2X9W A;  4CI1 B;  2KND A;  5ABF B;  4H63 H;  3C51 A;  5AQO B;  3N9P A;  4YHH T;  3A8Y C;  4DV6 T;  2A2F X;  4EB6 E;  2RPA A;  5LCY A;  4B3R T;  2CXL A;  3QB5 A;  5AQU B;  4WZX A;  1HFA A;  1FMV A;  1D1C A;  1LVF A;  3UUM A;  3UU8 A;  3CQC B;  4FI5 A;  3ZYL A;  4XAX B;  2V5D A;  2WM9 A;  2IC9 A;  5AQR B;  3K3O A;  4EXT A;  2XQ9 A;  3FZH B;  4IST A;  2W00 A;  3K3N A;  4JI0 T;  2EHO A;  3EHZ A;  2DI4 A;  4LMJ A;  4IE7 A;  5AQN B;  1Y64 B;  4JEH B;  5FKY A;  1MIW A;  4TX5 A;  1HNZ T;  1UGO A;  3C4W A;  3Q2M A;  4Q25 A;  3RYI E;  3MA9 A;  4PJJ A;  3F57 A;  4A97 A;  5ABE A;  4YTM A;  5HYA A;  3O4X E;  2HPL A;  3ZKR A;  1OED B;  2CA5 A;  2XQ6 A;  2NW8 A;  4EGW A;  2LOP A;  4E7Z A;  3CX8 B;  4ASK A;  2FBW A;  4TV9 E;  4DVD A;  1ZV4 X;  2VKJ A;  2H3R A;  1L0V A;  5HEU A;  4IE6 A;  1T72 A;  2X0H A;  4QHO A;  5AQQ B;  3ZT6 A;  4JI6 T;  4BA9 A;  4HN9 A;  4JI4 T;  1BR4 A;  2LT3 A;  3SFE A;  2PBI A;  4HWH A;  5LMN T;  1U4Q A;  4LF4 T;  1MIY A;  4MBQ A;  3PU8 A;  2LM9 A;  2DWG A;  2NWB A;  3KV5 A;  2UXB T;  2XQA A;  4NUU A;  3J9X 1;  4YTP A;  3NZP A;  5LHG B;  5L3F B;  2VQE T;  4TN7 B;  2W62 A;  3ZJ2 A;  4GYS A;  4CN1 A;  2CEA A;  1FEW A;  3FZL B;  2W4X A;  4ZI2 D;  3HKC E;  2JQQ A;  2JQ9 A;  2WBL A;  2MBG A;  2XQ4 A;  3A5X A;  3AEA A;  4K0U A;  2RP4 A;  4LF8 T;  1HNX T;  3EAB A;  4ZXL A;  3RX6 A;  3K1S A;  4H63 V;  3NVO A;  3AEG A;  2R6G F;  4KI0 F;  3KVA A;  3VU7 H;  5LHH B;  5AQH B;  2W61 A;  5LP6 E;  5LG3 A;  3RIU A;  3UTK A;  3T1H T;  1JNZ A;  2WMN A;  3RYF E;  1M7K A;  2KWH A;  1SUM B;  2JPF A;  2WZH A;  5FP3 A;  2EHO B;  4EV6 A;  3JAE A;  3KVB A;  3EAM A;  4LF7 T;  4X64 T;  4TWD A;  5LB7 B;  3ETV A;  5J0Z A;  3I0O A;  4XBF B;  4KHZ F;  3MXZ A;  4GIW A;  5HAX A;  2LSG A;  2LRL A;  4L5G A;  3AAA B;  4DV3 T;  4KBM B;  1HX1 B;  2WCA A;  3AE3 A;  4TV8 E;  5AQL B;  1CUN A;  3A7M A;  2BS3 A;  2V1D B;  2CLY C;  4J2C A;  5AQP B;  2FUP A;  5JDN A;  1UX4 A;  5E0O A;  3ZPO A;  3KDS E;  4PJL A;  3AXJ B;  2WMO A;  4YXD A;  2DWK A;  2CCQ A;  2FJA A;  5FMN A;  4Z8X A;  4EED A;  2X0L B;  4JLE A;  1WR6 A;  5FY7 A;  4ANJ A;  3C98 B;  3MJX A;  5J1G A;  3LSV A;  3ANW A;  5DAB A;  4AKH A;  4CN6 A;  2X67 A;  5L3C B;  2E9X C;  3Q5E A;  4PFP A;  2VL0 A;  5JDF A;  1FJG T;  4DV0 T;  4IIJ E;  3OBV E;  2B1E A;  4UVA B;  5L2L A;  2HN1 A;  4QWN B;  4YTN A;  2ODU A;  5DQV A;  1WLX A;  4DV2 T;  4BAY B;  5LBM A;  2UUA T;  2M67 A;  2NR4 A;  4O2B E;  4MAL A;  3QK6 A;  1KF6 A;  3L09 A;  3LK2 B;  3PE0 A;  4HEA A;  2XM1 A;  2WS3 A;  3LBX A;  4AKL A;  5GON E;  1YQ3 A;  2MTQ A;  3RYH E;  2K3W A;  2CBI A;  3ZMZ B;  3MK7 C;  5M4Y A;  2IC6 A;  1YQ4 A;  3PJA J;  5JDM A;  1OED C;  3PUW F;  2MAW A;  2BDE A;  3LFM A;  1E1H B;  4A56 A;  2KMF A;  4I4T E;  3U3I A;  2IHR 1;  3RKG A;  2WDR A;  4PAG A;  2LKG A;  1QSD A;  3MZK B;  4UR9 A;  1S35 A;  5L3E B;  3DP7 A;  4IT4 A;  3MKD A;  4JI5 T;  4DMW A;  2JQH A;  4DR4 T;  2XAQ B;  3ESL A;  5L47 A;  2B76 A;  4JI3 T;  4WW0 A;  4EZH A;  4QX7 B;  3O9X A;  4O4I E;  3J7Y q;  5LOV E;  1MMN A;  4N78 D;  2BS2 A;  4GKJ T;  4BJN A;  2LLY A;  1D0Y A;  5TAO A;  4EYU A;  2PG8 A;  1T7S A;  2WU2 A;  3BQL A;  4GKK T;  2UXX B;  4COF A;  3DJB A;  3UUX B;  4DV5 T;  3H37 A;  2XQ8 A;  4H9N C;  5FVL A;  3RC8 A;  1D0X A;  4ZI3 C;  2XAJ B;  1Y01 A;  3UU5 A;  3VR9 A;  4IE0 A;  3FZM B;  1J5W A;  4IRE A;  2CM0 A;  5H6Q B;  2WDV A;  4PFO A;  3NRX A;  4IGU A;  2ZLY A;  2C5K T;  2J1D G;  1J1J A;  3E22 E;  1N36 T;  4X1I E;  2ZM6 T;  2CBJ A;  3U78 A;  3QNU A;  3SS1 A;  3VHL A;  4ISS A;  3O1J A;  1I6Z A;  4A5X A;  4CQI A;  2L3L A;  4AQY T;  4ZS2 A;  5KMG P;  3IF8 B;  3C50 A;  4I50 E;  2WY2 A;  2X9X A;  1CHU A;  3GN5 A;  3GMI A;  4X66 T;  2LHR A;  4MHC A;  3AE2 A;  4DMV A;  5LXT E;  4CXX A;  2DLR A;  2EHO C;  3TLU A;  3BQI A;  3E0Z A;  5AFU L;  4PK4 A;  4OX9 T;  5L3G B;  2LOS A;  4TWF A;  3AEB A;  3TLW A;  3QOF A;  4IDQ A;  3F2E A;  5JDQ A;  2QRX A;  4HFH A;  3NRY A;  2KLQ A;  5LJM A;  4B3M T;  3HKB E;  1HG2 A;  2E5V A;  3P50 A;  2GK9 A;  5HCJ A;  2LSJ A;  2CXD A;  4AKG A;  2IDO B;  2ES0 A;  5JTG A;  5FYM A;  3RRW A;  3X1D A;  4PJN A;  4XZC A;  3ZMT B;  4X1K E;  5ABG A;  5LA6 E;  3NWI A;  5AQF B;  1XDO A;  1MMD A;  3P4W A;  5CA0 E;  4QXB B;  3PUY F;  4DBQ A;  5AQK B;  2LE8 A;  2E9X B;  4DR7 T;  2E9X D;  1HTJ F;  2UUC T;  5JDH A;  1KNP A;  2BKP A;  5HXR A;  1KFY A;  4JEU B;  4CXY A;  5LYJ E;  3IA3 A;  3L3P A;  2D0T A;  3ZMV B;  2V7J A;  5F3J A;  1UUR A;  5FNV E;  2W0G A;  1X9B A;  3WI3 A;  5FVK A;  4I55 E;  2LM2 A;  2QA7 A;  3IBP A;  4CZZ B;  3N9O A;  2E2A A;  5FXW A;  4WBO A;  4U72 A;  3CIR A;  2D2S A;  1MMG A;  1JNR A;  3LJC A;  1T98 A;  4UEM A;  3CQX C;  3W15 B;  5AQS B;  5L4H A;  2JJ9 A;  5C8Y E;  5FXZ A;  2NOX A;  2UXD T;  4JUY A;  1W9R A;  3RIU C;  2X51 A;  1IJ5 A;  2IML A;  4WYV A;  3GN5 B;  1QLB A;  2CE7 A;  4GOU A;  4CXW A;  2J47 A;  5DJQ C;  1IBK T;  3KV4 A;  2CRB A;  2ZMA A;  2KXP B;  4U7Y A;  4JI8 T;  3P8C D;  4DV4 T;  4KMC A;  2AXD S;  3ZMS B;  3L39 A;  2PJQ A;  4PW8 A;  3K8P C;  2A9U A;  3R84 B;  5C2T A;  1MMA A;  1AJ3 A;  3ZN1 B;  2VKD A; 
#chains in the Genus database with same CATH homology
 4OFZ A;  1WYC A;  2X0L B;  3ETU A;  3PDY A;  3AVR A;  3ZLI A;  4H9S E;  4JLE A;  5F8P A;  4ZI3 D;  1WR6 A;  3N9Q A;  4O4H E;  2E9X A;  5FY7 A;  4ANJ A;  1HG5 A;  3C98 B;  3CKD A;  3MJX A;  5J1G A;  3I9Y A;  5LHI B;  5HWX A;  3B13 A;  3OJA A;  2C5J A;  4O2A E;  3ANW A;  5DAB A;  4HKA A;  3WAK A;  5JR9 A;  4AKH A;  1X79 A;  4ZHQ E;  3T8O A;  2CWO A;  5JRC A;  4FJO A;  3ZC0 A;  5EK3 A;  4O4J E;  5JRE A;  2X67 A;  4H9R C;  5L3C B;  4ZI2 C;  1B7T A;  2LSI A;  2E9X C;  5LJN A;  4PFP A;  4AXP A;  5JDF A;  4YJ2 E;  2YU1 A;  2YEV C;  3OYX A;  3FHN A;  4IIJ E;  1HS7 A;  3OBV E;  2B1E A;  2X9Y A;  4UVA B;  4UV9 B;  5L2L A;  4QWN B;  2HH7 A;  2IAK A;  2K48 A;  2K9A A;  3CML A;  5JR9 C;  2ODU A;  2A72 A;  3N9N A;  3PTR B;  5CB4 E;  3KIN B;  4PK5 A;  5DQV A;  1FIO A;  1WLX A;  2K5B B;  3FBL A;  4KP3 C;  2Y8D A;  4BAY B;  2DHR A;  3NZQ A;  4PNI A;  3RPU A;  5LBM A;  3KFW X;  2NTY A;  2JMH A;  2M67 A;  3EDV A;  5L3B B;  3I0Q A;  4O2B E;  4UEL A;  2I59 A;  3RC3 A;  3EUH A;  4MAL A;  3QK6 A;  5LBQ B;  2OA5 A;  3L09 A;  3LK2 B;  2EHO D;  4O8S A;  4G63 A;  4M1P A;  3S4U A;  2K24 A;  3JC6 D;  3PE0 A;  4HEA A;  4EIW A;  3LBX A;  3OKQ A;  4AKL A;  5GON E;  2MTQ A;  3Q9D A;  1LVK A;  4QX8 B;  3R6N A;  1ZHC A;  4MFR A;  1MND A;  3HKD E;  3RYH E;  4CI3 B;  3O1I A;  4HE8 A;  3ZMZ B;  1YKE B;  5HXC A;  3AAE B;  3MK7 C;  3HL6 A;  5M4Y A;  2DCF A;  2IC6 A;  2X9H A;  4UVB B;  1NAF A;  4IHJ E;  3C4Z A;  2Q9Q A;  2XAF B;  3ZC1 A;  3CVR A;  4EYY R;  5JDM A;  3HKE E;  2VAS A;  4ERR A;  2VK9 A;  2BDE A;  2D0U A;  3LFM A;  4NUV A;  4UVC B;  1E1H B;  2LEH A;  4A56 A;  2KMF A;  2LJL A;  4H9P C;  4I4T E;  4TZ4 C;  3U3I A;  3OYZ A;  2BVL A;  1SA0 E;  2VKO A;  4PAG A;  4X20 E;  3K3Q C;  2IW5 B;  1QSD A;  4H9O C;  3MZK B;  2N2N A;  1S35 A;  4DND A;  5L3E B;  2XAH B;  2CXF A;  2CLY B;  3GA8 A;  4HTE A;  1U5P A;  3DP7 A;  4HGA A;  5EK4 A;  1UCU A;  1UX5 A;  1ZEE A;  2P9B A;  2Q9Q C;  3MKD A;  4DMW A;  5FY0 A;  5JDG A;  2XAQ B;  3ESL A;  4EZ4 A;  2Z6E A;  2VL8 A;  3AB3 B;  3SRZ A;  3ZYM A;  3SWH A;  1LRZ A;  2XTL A;  4WW0 A;  5JDL A;  2JMK A;  5IYZ E;  4UF0 B;  2XAS B;  1D1A A;  4EZH A;  4QX7 B;  3O9X A;  2L8K A;  5J2U E;  3N2O A;  1OXZ A;  4O4I E;  3J7Y q;  5LOV E;  1MMN A;  4N78 D;  2VKH A;  3IEE A;  1WYB A;  1BR2 A;  2C5I T;  4GK0 E;  3RKO A;  3GWH A;  5FXV A;  3H3A A;  4BJN A;  4UV8 B;  1YW0 A;  1D0Y A;  5TAO A;  4IE5 A;  2LSK A;  4UIG A;  1HX8 A;  2X9W A;  2KND A;  4EYU A;  4CI1 B;  2PG8 A;  3CX7 B;  4H63 H;  3C51 A;  4O4L E;  2BZB A;  4U74 A;  3BQL A;  3N9P A;  4AQG A;  4AKI A;  2UXX B;  3CWZ B;  3C4X A;  3DJB A;  3UUX B;  2A2F X;  3H37 A;  4EB6 E;  4PK6 A;  4H9N C;  3PUG A;  4WBN E;  3RC8 A;  3LK4 2;  3N5L A;  1D0X A;  3EDU A;  5LCY A;  4ZI3 C;  1S94 A;  2CXL A;  2XAJ B;  3ZN0 B;  1US7 B;  4IE0 A;  2CM0 A;  5H6Q B;  4PFO A;  3NRX A;  1HFA A;  1FMV A;  4H9Q C;  2NTX A;  2UXN B;  4IGU A;  2ZLY A;  4IE4 A;  1D1C A;  5KDM C;  2C5K T;  1LVF A;  2MOZ A;  3UUM A;  2C0S A;  2J1D G;  3RH3 A;  3CQC B;  3HA4 A;  3E22 E;  4FI5 A;  3CPZ A;  5IHY A;  3ZYL A;  3KBT A;  4X1I E;  5JQG E;  5JR9 B;  4XAX B;  1BR1 A;  4P09 A;  1H7C A;  3U78 A;  1IZN B;  1O3X A;  2WM9 A;  3SS1 A;  2IC9 A;  2XQY A;  3K3O A;  5JRC B;  3VKH A;  4EXT A;  4OK0 A;  4IST A;  2V26 A;  3VHL A;  5BMV E;  2W00 A;  4ISS A;  1EZ3 A;  2V7L A;  3K3N A;  2EHO A;  3O1J A;  1D1B A;  2DI4 A;  4IE7 A;  5HWY A;  4AI6 A;  4CQI A;  2YK0 A;  1Y64 B;  3DTO A;  4JEH B;  4OYJ A;  1LKX A;  2NW9 A;  1VRB A;  1Z0P A;  2L3L A;  3V5U A;  4ZS2 A;  3HI2 A;  2NW7 A;  5KMG P;  5L3D B;  3IF8 B;  1MIW A;  1NWM X;  3C50 A;  4TX5 A;  3AA6 B;  4I50 E;  5EK2 A;  2X9X A;  3FBZ A;  3GN5 A;  3C4W A;  3GMI A;  3I9W A;  2LHR A;  4MHC A;  2KT9 A;  2WAU A;  2YIN A;  3Q2M A;  4DMV A;  4UXN B;  4E7S A;  5JH7 E;  5H6R B;  4CXX A;  5LXT E;  1MNE A;  2LHN A;  4QXC B;  2DLR A;  1BR0 A;  3PUS A;  2EHO C;  3RYI E;  3MA9 A;  3BQI A;  4GK5 E;  3E0Z A;  4PJJ A;  5AFU L;  2X68 A;  4PK4 A;  3F57 A;  3JC6 C;  3CQG B;  2JRK A;  5L3G B;  3F31 A;  2LOS A;  5HYA A;  4P0A A;  3O4X E;  2HPL A;  2CA5 A;  3UUN A;  2NW8 A;  3ZEF B;  2LOP A;  4E7Z A;  5EZY E;  3CX8 B;  3F2E A;  4ASK A;  5JDQ A;  3KBU A;  5JVD E;  2BVM A;  4TV9 E;  3QUJ A;  5HXE A;  1OWA A;  4DVD A;  5HXS A;  1ZV4 X;  1HCI A;  4DO0 A;  3UT5 E;  3NRY A;  2KLQ A;  5LJM A;  2VKJ A;  1D0Z A;  2H3R A;  3HKB E;  2W63 A;  2WWU A;  2H7V C;  3PUA A;  3Q5W A;  3Q5X A;  4OYK A;  4BJM A;  1HG2 A;  4ZOL E;  2Q9Q B;  4IE6 A;  3AA1 B;  1IAP A;  3KV9 A;  2GK9 A;  2LSJ A;  4QHO A;  4C91 A;  3P7I A;  2DNX A;  2CXD A;  2KWI B;  2N9D A;  2NP9 A;  4BA9 A;  4HN9 A;  4G2A A;  1YD8 G;  4AKG A;  1BR4 A;  2ZM0 A;  2ES0 A;  5FYM A;  2ACX A;  2LT3 A;  5LNK A;  2XHE B;  2PBI A;  2G0U A;  4QKN A;  3RRW A;  1U4Q A;  3ONX A;  1MIY A;  4MBQ A;  3PU8 A;  4DBR A;  4PJN A;  4XZC A;  3ZMT B;  4X1K E;  2LM9 A;  2XUE A;  3N9L A;  2DWG A;  2NWB A;  2ZM8 A;  3KV5 A;  2H7O A;  5LA6 E;  4NUU A;  3J9X 1;  3NBX X;  3ZYK A;  1MMD A;  1WRD A;  3NZP A;  2SPC A;  4EAH A;  4QXB B;  5CA0 E;  5LHG B;  5L3F B;  3ZCI A;  2PFV A;  4TN7 B;  2W62 A;  2CWY A;  4I43 B;  4PJM A;  4DBQ A;  3FXD B;  3I1A A;  3KV6 A;  3ZJ2 A;  4GYS A;  4YLH A;  4C90 A;  2V7I A;  2VWA A;  1G8X A;  3MAC A;  2V7M A;  5LG4 A;  2CEA A;  3AAI A;  2LE8 A;  2N1G A;  3V5S A;  1FEW A;  4KUM B;  5FXX A;  2E9X B;  3HKC E;  4ILU A;  4ZI2 D;  2E9X D;  1HTJ F;  2JQQ A;  5JDH A;  2WBL A;  3PUQ A;  3RYC E;  2MBG A;  3N2K E;  5ADX L;  5HXR A;  3B57 A;  3A5X A;  3ANW B;  2Y6X A;  4K0U A;  1IJ6 A;  2RP4 A;  3CX6 B;  3O1H A;  4JEU B;  2KZ7 B;  5HXH A;  4CXY A;  5KX5 E;  3RX6 A;  1SHZ C;  5LYJ E;  3C64 A;  4H63 V;  3L3P A;  2D0T A;  2E8I A;  2ZM2 A;  4OHF A;  3ZMV B;  2V7J A;  3BK9 A;  3EVY A;  3AA0 B;  5F3J A;  1G73 A;  1VOM A;  5FNV E;  3KVA A;  3AVS A;  3VU7 H;  4YHJ A;  3WAJ A;  2W0G A;  3WI3 A;  5LHH B;  2WSS V;  4B6X A;  2W61 A;  3HR0 A;  5LP6 E;  4I55 E;  3TKL B;  3E08 A;  2MYS A;  1MIV A;  2QA7 A;  3IBP A;  5LGN B;  4CI2 B;  4CZZ B;  5J2T E;  3N9O A;  2XAG B;  4WBO A;  4U72 A;  5FXW A;  3UTK A;  3ZJ1 A;  2WMN A;  2D2S A;  1MMG A;  3PUR A;  3LJC A;  3RYF E;  4AKR B;  3QC9 A;  4IDZ A;  4ZS3 A;  2RA1 A;  4F6R C;  3ZCJ A;  2KWH A;  2Y48 B;  2JPF A;  2L9Q A;  1T98 A;  5FP3 A;  4AQF A;  3RRC A;  4UEM A;  2EHO B;  4EOZ B;  3ZMU B;  3CQX C;  3W15 B;  3KVB A;  2JJ9 A;  5C8Y E;  5FXZ A;  2NOX A;  4ZI7 E;  4JUY A;  2CMR A;  4GYR A;  1YKH B;  2X51 A;  3ETV A;  3I0O A;  3LBX B;  1IJ5 A;  2D5U A;  4XBF B;  3GN5 B;  3MXZ A;  4GIW A;  5HAX A;  2LSG A;  3LK3 B;  4L5G A;  3AAA B;  5FY1 A;  5DQW A;  3PU3 A;  3M65 A;  2CE7 A;  2VB6 A;  1ZKE A;  4GOU A;  4KBM B;  4AQF C;  4CXW A;  5CA1 E;  4L9I A;  3SOL A;  4WNK A;  5DJQ C;  3KV4 A;  2Q9Q D;  4TV8 E;  4ADZ A;  4YFS A;  2QGS A;  1KK7 A;  4P0B A;  4UF0 A;  2ZMA A;  2KXP B;  3N2G E;  2YU2 A;  3FB2 A;  2ODV A;  4YJ3 E;  1CUN A;  1FMW A;  1QUU A;  3P8C D;  3N9M A;  4KMC A;  3BQK A;  3LG7 A;  3AA7 B;  2V1D B;  2CLY C;  4J2C A;  3ZMS B;  1V9D A;  1KNZ A;  2PJQ A;  5JDN A;  1UX4 A;  4PW8 A;  4L0R A;  2V7K A;  5E0O A;  3ZPO A;  3KDS E;  3K8P C;  4PJL A;  4MLK A;  3VKG A;  2LSY A;  3R84 B;  5LGU B;  3D0T A;  3FXE B;  5LGT B;  1HF8 A;  2WMO A;  2KIN B;  3UUL A;  4QXH B;  2DWK A;  2A3D A;  4HFV A;  3UFE A;  1MMA A;  2CCQ A;  4TUY E;  2HPJ A;  1AJ3 A;  4X1Y E;  3ZN1 B;  4V1A v;  5FMN A;  4Z8X A;  3IHR A;  5ETW A;  2X66 A;  2VKD A;  5A1L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...