2KNDA

Psb27 structure from synechocystis
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
110
structure length
110
Chain Sequence
CDSGTGLTGNYSQDTLTVIATLREAIDLPQDAPNRQEVQDTARGQINDYISRYRRKGDAGGLKSFTTMQTALNSLAGYYTSYGARPIPEKLKKRLQLEFTQAERSIERGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photosystem II 11 kDa protein
publication title Structure of Psb27 in solution: implications for transient binding to photosystem II during biogenesis and repair
pubmed doi rcsb
source organism Synechocystis sp.
molecule tags Photosynthesis
total genus 27
structure length 110
sequence length 110
ec nomenclature
pdb deposition date 2009-08-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.810 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2kndA00
2KNDA 2KMFA 2Y6XA
chains in the Genus database with same CATH superfamily
2W0GA 3A8YC 4IIJE 2AXDS 3N9OA 1YXRA 3ZKRA 2MAWA 1IJ6A 3L09A 5IHYA 3ANWA 4FI5A 2XY8B 3PTRB 3C4XA 4HFBA 5C2TA 4JI6T 2YDQA 2JRKA 5DABA 2CM0A 2XASB 5AQSB 2D5UA 3CPZA 3FXEB 3UU6A 2DWKA 2A2FX 4LMKA 3OYXA 4PFOA 5LHGB 1KK7A 3LG7A 3LJCA 2VVNA 2L9QA 4DVDA 4DIDB 4F6RC 2VQET 3Q9DA 3UFGA 4UXNB 4AKRB 4WZXA 3AEAA 3C50A 4LF7T 4AKIA 2XSAA 4UF0B 2WMOA 3FZLB 2VKDA 5HCMA 2OV9A 5ABGA 2HHHT 1MNDA 1D1CA 3EI0A 3VKGA 3SS1A 3LBXB 4LMLA 3LDQB 3IHRA 2WZIA 4X1KE 4DMVA 2Y8DA 2JIWA 1SA0E 4YSZA 5CGMA 2V8SV 3O1HA 3CK6A 3T8OA 4L5GA 1T8BA 2WB5A 2VL8A 3OYZA 3TKLB 2JJ9A 1G8XA 5JDHA 4DBQA 3CKDA 4ANJA 4DV0T 5AQNB 5AQRB 4NXNT 2J1DG 4HFIA 2X68A 1MMAA 3UQ7A 5HWYA 3AEEA 3VR9A 3O4XE 2JQHA 3ZT5A 3L39A 2LRKA 2N2NA 2WU2A 4GKJT 2EHOA 1W9RA 4OFZA 1FMVA 2ACXA 5HEHA 1KF6A 4YTNA 1MIVA 5FXZA 5LGNB 2X9YA 2VL0A 2W66A 1B7TA 3AXJA 4JV5T 2XQ6A 5LB7B 1HG2A 5L3DB 3K3NA 3RIUA 1MIWA 3UQ4A 2H88A 2W4XA 2BVMA 5LGTB 5CB4E 3RRCA 5L3GB 1BR4A 5AQFB 1SHZC 3QNUA 4K0KT 3N2OA 4IT4A 4AI6A 4ZHQE 3FXDB 2CMRA 4JI1T 2ODVA 2YU1A 4X62T 5L3BB 2A72A 3C51A 3LK42 5M4YA 2NTYA 4UELA 2NR4A 4U7IA 4DV4T 1HNWT 4KUMB 5L4EA 3P4PA 4TN7B 2VKOA 3FBZA 1G73A 1H7CA 3P50A 1CHUA 5JDMA 3ZT6A 5FYMA 2NW9A 2LKHA 3PV0F 3RPUA 3K3OA 2V5CA 2BVLA 3F2EA 4YJ3E 4AIUA 2WCAA 2OLTA 4IGUA 4YTPA 3ZYMA 2VKJA 1KNRA 3UU4A 4OK0A 4HFCA 4GKKT 5HWXA 2ES0A 5FY1A 1UUSA 4JI7T 3W15B 2YEVC 4YTMA 5LGUB 3KVBA 5AQHB 3HI2A 1Z8UA 5HXSA 4IDPA 5ABFA 2H89A 4OYKA 2JPFA 4GIWA 4UVAB 3TLVA 4I55E 3K3QC 4HGAA 2LHNA 3PUQA 1S94A 2IW5B 1KEYA 1J1JA 2BS4A 3RIAA 2Q9QC 3I0OA 4DV7T 2WMNA 3N5LA 4ILAA 3LSVA 5LXTE 3VU7H 3FZKB 5A1LA 2IC9A 4G2AA 4FJOA 2MTQA 3AAAB 5ABHA 5FXWA 3ZLIA 4O8SA 3NBXX 3AE3A 2BG9C 4EZ4A 5LHIB 2VURA 4H9OC 2CLYC 5LA6E 1XDPA 1D1BA 4OYJA 4KI0F 2D9DA 3KV4A 2N1GA 1LVFA 3LK2B 4O4LE 4ZXLA 4AQGA 3HKCE 3JC6C 4LF9T 4JI4T 3N2GE 4DR5T 5JR9B 5AQMB 4IREA 3MZKB 4QHOA 5LMNT 1ZKEA 2C5IT 3PUWF 4H63H 4E7SA 3EVYA 4ILUA 2XAJB 4DNDA 4O2BE 3UUXB 2QA7A 3T1HT 2DWGA 2I59A 3RH3A 2UXDT 4GK5E 3E08A 2XZEA 5EK2A 3VRAA 2H7OA 5LBQB 4PK5A 3CQGB 1OWAA 2YKSA 5AQVB 4TZ4C 3UFEA 2H7VC 2RA1A 3ZMVB 4X1YE 4CXXA 4LFCT 2W61A 3G06A 3PU3A 4NPPA 2V6XA 3PUXF 4YJ2E 2E8IA 4GYRA 3FZFB 2WZHA 3FZMB 2Y6XA 4DR7T 4DUZT 5HEGA 2WDQA 2K3WA 2XSBA 4BA9A 3J9X1 4O4JE 2CPTA 2DI4A 4JI8T 2ZMAA 4EYUA 4PJMA 1T72A 2B1EA 5AQJB 4ZZBA 4QWNB 5LHHB 1IAPA 4XAXB 3JAEA 4YT0A 2SPCA 4LF5T 2LLYA 3VKHA 5C3JA 1NWMX 1AJ3A 2JMKA 2W67A 1W0AA 5JH7E 4ZI2C 1IBKT 1D0YA 3L3PA 2XPKA 2K48A 2CEAA 2WS3A 3C98B 3AEGA 1ZHCA 5JVDE 2I6HA 4IE6A 3ONXA 4ZS2A 1VRBA 4Z90A 1MMNA 2R6GF 3RC3A 5LG3A 3UT5E 1XZYA 4IHJE 4XZCA 4I50E 3KBTA 4JYAT 4U33A 3RQWA 4P0AA 2M6BA 3I9WA 4PJLA 4HWCA 2DNXA 4UV8B 5IYZE 1U5PA 4I4TE 3TLSA 1MIYA 4Z8XA 4TV9E 2UXNB 4HEAA 3TLWA 4QX8B 4ZOLE 4O2AE 1N34T 3RC8A 2ODUA 3SOLA 4H63V 2QGSA 1W0BA 3QC9A 4NXMT 2A9UA 5LNKA 3ZCJA 2BS3A 3ZPOA 5JDFA 3EDVA 3X1DA 5IUXA 1L0VA 2W00A 4QH4A 3E0ZA 2DL1A 2LHRA 3DJBA 1T98A 3HKBE 3P7IA 2BKPA 4PJJA 4X65T 2XM1A 5JR9A 5HXHA 1W09A 3UUNA 2P9BA 4NIQA 3ETVA 4P09A 1HNZT 1ZOYA 3AA0B 1WYCA 1T7SA 1ZP0A 4IDNA 3KV6A 2XQ3A 2K5BB 3MJXA 3ONJA 3ZYKA 4TWHA 2Q9QB 1X9BA 5FP3A 3NRYA 3KVAA 2NTXA 4U72A 4WNKA 4JBWF 2WWUA 2WSSV 2C0SA 3CX8B 4AISA 2WDRA 3DP7A 4I0UA 4DV5T 5LCYA 4EZHA 4Q25A 2D2SA 5J2UE 1WLXA 5J1GA 1LRZA 4B3TT 2Q9QD 3AE6A 2E9XA 3AEDA 2BG9B 5C8YE 2CXLA 2CLYB 1JNRA 5LJNA 4WBOA 3P4WA 2KLQA 1WRDA 2FBWA 3DTOA 4H9RC 4EV6A 5JRCA 4QH5A 3R6NA 4KP3C 4HTEA 2D0TA 3GWHA 4JLEA 2H3RA 4P1NA 2M6IA 3ZC1A 5HEOA 4E7ZA 2ZM6T 2PG8A 2YDSA 3B5MA 3T1YT 1ZEEA 2RP4A 3ONLC 2N9DA 2XAHB 2IMLA 1VCTA 2XQAA 4NUUA 2E9XC 4IE4A 1FIOA 4EXTA 4L9IA 3BQLA 3JC6D 4U2ZA 5KXJA 4OX9T 3F57A 4QX7B 2C5JA 2FJEA 3KINB 3NZPA 3AE9A 3OTOT 2D0UA 4PK4A 3U78A 3QOFA 3N9QA 3HKDE 2EHOC 3ETUA 1X79A 3Q2MA 1GQEA 1BR0A 3NRXA 4EAHA 1HFAA 3TLTA 4UEMA 5AQKB 4MHCA 4X1IE 3EUHA 2MYSA 2V6YB 1U4QA 1D1AA 3HA4A 2UXCT 2XJ7A 3K8PC 2IIUA 3AE4A 1NENA 2V5DA 3ABVA 4LFBT 1OXZA 2A3DA 1OEDA 3RIUC 2MOZA 3CWZB 1D0XA 1IJ5A 2UXBT 2RPAA 3OBVE 1YKEB 3RQUA 1WCRA 3AVSA 4B3MT 2CHNA 3OPCA 1MNEA 2NOXA 4HKAA 4CN6A 2V7LA 3QB5K 2WAUA 3MACA 3N9NA 2GK9A 4A5XA 4MFRA 1NAFA 4CI2B 1EZ3A 2FUPA 2X66A 3GN5B 4UIGA 2B76A 2LRLA 2KXPB 2LEHA 2XTLA 4PK6A 5JTGA 2X67A 1E2AA 3VRBA 1YQ4A 3NKZA 1NEKA 1UX5A 4YHJA 2JMHA 5F8PA 4G63A 2KNDA 4UF0A 4WBNE 1WR6A 5AQUB 4IL9A 4HE8A 5JDNA 3WI3A 3AA6B 4OHFA 2YN6A 1M62A 4ZI2D 2XQ5A 3PUGA 5AQGB 4ILCA 3UU3A 2J47A 1Y01A 4NUVA 3LBXA 1YQ3A 4LF4T 2YINA 4PJNA 2XQ4A 3RGLA 1XMQT 2DHRA 2PBIA 2IAKA 1OEDE 5FL0A 4J2CA 2BDEA 4YFSA 1WFDA 2VK9A 3CMLA 4H9NC 2UUAT 5HXRA 4JUYA 3MKDA 3ZSTA 1XNQT 4I43B 5KMGP 2QYWA 3IF8B 4EB6E 4UVCB 4C91A 2M67A 3N9MA 5GONE 3ZJ1A 3CIRA 1QUUA 4PFPA 1DU2A 4JI2T 3O1JA 2LSGA 4AXPA 3AAIA 4JEHB 2CHOA 4ZEYA 1UCUA 2LSIA 2VKHA 3AECA 2X51A 2V7MA 5FMNA 3L8RA 3ANWB 1KNPA 3CQXC 2LOPA 5LP6E 4MBQA 5HEJA 4HN9A 5ETWA 2L8KA 5HYAA 5LG4A 1V9DA 3V5UA 3K1SA 3AEBA 3M3ZB 3VR8A 4JI3T 3KV5A 5AQIB 4DR2T 5LYJE 1YW0A 2NWBA 2IDOB 4MLKA 4DO0A 1US7B 5IWAT 2L3LA 2FJBA 1XDOA 3SWHA 1KFYA 3EDUA 4EGWA 4BJMA 4L0RA 3IBPA 2V6YA 3CVRA 3AE1A 1LVKA 5FXXA 4XBFB 4DV6T 2VQFT 3VHLA 4V1Av 2CE7A 4ZS3A 2IC6A 5TAOA 4HWIB 2XUEA 1IZNB 2QRXA 5EZYE 4PNIA 5H6RB 1QSDA 5AQOB 2CWYA 2UXXB 4AQFA 4YXDA 2HN1A 5LBMA 3P4QA 2VB6A 4QXBB 3KFWX 2NW7A 1N36T 4KHZF 3RYFE 5FNVE 2KINB 4KX6A 2EHOB 2JQKA 4ILBA 3I1AA 2LSJA 2XQ8A 2W63A 2K9AA 4DR6T 3P4RA 2E9XD 2FJDA 3NZQA 1HF8A 3FZHB 3PUSA 1XWMA 3RYIE 2X0LB 4AQFC 2QVAA 2VWAA 4DR4T 4ASKA 3AXJB 4DR1T 4IE5A 5DQVA 2VVSA 3PUZF 1UURA 2EHOD 3GA8A 5HEUA 2ACZA 5JREA 3P4SA 3RF1A 4QH1A 4ISSA 2YDRA 4LF8T 2XQYA 2CBIA 5HXCA 1FMWA 2HPJA 1HX8A 3AEFA 3ZC0A 3OJAA 2KMFA 5CFBA 4CI1B 1YD8G 1VCSA 2LT3A 3BK9A 3SFEA 2V7KA 4HFHA 3A5XA 1IBLT 2HPLA 2JQ9A 2XM2A 3PUYF 5BR8T 3RKGA 4IE7A 2X9HA 4EYYR 3ZSSA 4KBMB 4U3CA 5JQGE 4JEUB 4ZI3C 5FVKA 2Z6EA 1JNZA 3B57A 4HFVA 1HNXT 4EEBA 3PDYA 2BKOA 2BBHA 2IUBA 3BQIA 2WQYA 3M65A 2FJAA 2E2AA 5HAXA 4B3ST 3WAKA 3HKEE 4YLHA 4DMWA 3RRWA 3I0QA 3AA1B 4IDQA 3H3AA 4CI3B 4LF6T 3AE2A 3B13A 4C90A 4KHPT 3NWIA 2AE9A 3AE5A 5J0ZA 4N78D 4CXWA 1R8IA 2NW8A 2K24A 3PU8A 4X64T 3A7MA 3KBUA 5ABFB 2CA5A 3IA3A 4QXHB 2ZLYA 3ZMSB 5CA0E 4CZZB 4DUYT 1FEWA 2W2UA 5LOVE 5JR9C 4H9SE 4TWDA 1J5WA 2LSKA 5BMVE 4DV2T 1E7PA 3BQKA 1VOMA 4HFDA 5L3EB 5AQLB 2CCQA 3QUJA 2XAQB 3PURA 4F8HA 1UX4A 3H3MA 4M1PA 3FHNA 4COFA 1CUNA 5CJ5A 2CXFA 3MK7C 4GK0E 4TWFA 4DBRA 3RI5A 4IE0A 3ZN1B 3AE7A 2BKNA 5KDMC 3RYCE 4U7YA 3WAJA 2V26A 3C4WA 4HWFA 2BZBA 4DR3T 3RLFF 4TX5A 1SE7A 1HX1B 4ZZCA 5FL1A 2XQ7A 2LM2A 2UUCT 4O4HE 4X5TA 1SUMB 2LM9A 3N9PA 3EHZA 2W62A 1Z0PA 1M7KA 3UUBA 2WBLA 5FXVA 1WR0A 1E1HB 4BAYB 4YSYA 5LJMA 4Z91A 5AQPB 1KNZA 3RYHE 1MMDA 1FJGT 4HWDA 4HWHA 1S35A 3F31A 3ZEFB 3OVUA 3C64A 3GMIA 3CQCB 3ZMTB 4U2YA 2IHR1 1MMGA 3ZN0B 5FY7A 4K0UA 1HS7A 3ESLA 3RHWA 4ADZA 4CQIA 3PUVF 3H37A 1LKXA 5H6QB 4IDZA 3D0TA 3E22E 1YKHB 3MA9A 4H9PC 5AQQB 2WM9A 3R84B 3TLUA 4LMJA 2HN2A 3Q5EA 2C5KT 3QK6A 3UUMA 4LFAT 1HTJF 5L2LA 4H9QC 3S4UA 3O1IA 1OEDC 3IEEA 2BS2A 2PTFA 3PUAA 5E0OA 4GOUA 1XNRT 4A97A 2MPKA 4B3RT 4CN4A 4CXYA 4TV8E 3HR0A 5F5WA 3ZJ2A 2ZM2A 3KDSE 2Q9QA 4MALA 3SRZA 4YHHT 2E5VA 3O9XA 3RIFA 2YK0A 3OKQA 2XQ9A 4ERRA 4AKLA 2DCFA 3AAEB 3LFMA 2UU9T 3AB3B 3NVOA 3J7Yq 1ZV4X 3KV9A 2BG9A 2Y48B 3EABA 1WYBA 3I9YA 4YY3T 3Q5DA 3P8CD 1N33T 5EK3A 3C4ZA 3ZCIA 2DLRA 5FY0A 5FVLA 5KX5E 4PW8A 2KWHA 4ISTA 2WY2A 3N9LA 3SFDA 1N32T 5FKYA 2X0HA 4ZI3D 4U31A 2V1DB 4X66T 5ADXL 1XMOT 4JI0T 2PJQA 3FBLA 4EOZB 3UTKA 1I6ZA 4UR9A 3UU8A 4GYSA 5AQTB 2LE8A 3PJAJ 3FB2A 3MXZA 3N2KE 1I94T 2F4VT 2V7JA 3Q5WA 4A56A 3ZMUB 4TUYE 2E5LT 2CBJA 5DQWA 5HXEA 5J2TE 2VASA 3ZT7A 3UULA 5L47A 2J62A 4B6XA 1IBMT 4O4IE 2CWOA 3JCFA 4U74A 4AKGA 2YOEA 2XHEB 2X9WA 4UV9B 2BG9E 4QXCB 2LOSA 1UK5A 4JI5T 3ZMZB 2NP9A 4TNWA 4PAGA 1QLBA 5F3JA 5CA1E 2CRBA 4CN1A 3PJAA 4QKNA 5JDGA 2KSRA 2JQQA 5HCJA 2V7IA 4DV1T 1O3XA 4WW0A 5EK4A 2I0MA 3AVRA 5L4HA 3CX7B 4AKHA 3AA7B 2E9XB 4P0BA 3JADA 4KMCA 2X0YA 2ZM8A 5JDQA 2MBGA 4IL4A 4BJNA 2KWIB 3PE0A 4X20E 5ABEA 3GN5A 2XAGB 1HG5A 5JRCB 3RKOA 2UUBT 3Q5XA 4WYVA 2KT9A 2HH7A 2J4GA 2CXDA 2BBJA 4IDOA 3ZYLA 1D0ZA 5JDLA 2LSYA 1HR0T 2OA5A 3UU5A 1HCIA 5AFUL 2G0UA 4HFEA 4ZI7E 2X9XA 2LJLA 3U3IA 2WWVA 5L3FB 4EIWA 5LMUT 1BR2A 4YSXA 1BR1A 2PFVA 3JAFA 5DJQC 3HL6A 2YU2A 3QB5A 1UGOA 4DV3T 2LKGA 4EEDA 1Y64B 2KZ7B 3LK3B 3V5SA 2WU5A 3EAMA 5L3CB 2ZM0A 4A98A 3CX6B 4AQYT 3AE8A 4UVBB 1J5ET 2WDVA 3RX6A 4TNVA 2XAFB 2WP9A 1OEDB
chains in the Genus database with same CATH topology
2W0GA 2I59A 3RH3A 4HE8A 5JDNA 3WI3A 3AA6B 4IIJE 4OHFA 3RYCE 5KDMC 3N9OA 4GK5E 4ZI2D 3WAJA 2V26A 3PUGA 3C4WA 3E08A 2BZBA 1IJ6A 3L09A 5EK2A 5IHYA 3ANWA 4FI5A 2H7OA 5LBQB 4PK5A 3CQGB 1OWAA 3PTRB 4NUVA 3C4XA 4TX5A 4TZ4C 3LBXA 3UFEA 2H7VC 2YINA 4PJNA 2RA1A 3ZMVB 2DHRA 2JRKA 4X1YE 2PBIA 2IAKA 5DABA 2CM0A 4J2CA 4CXXA 4O4HE 2W61A 2BDEA 3PU3A 2LM9A 4YFSA 2XASB 2VK9A 2D5UA 3CPZA 3CMLA 3FXEB 4H9NC 3N9PA 2DWKA 5HXRA 4YJ2E 2W62A 2A2FX 1Z0PA 2E8IA 4JUYA 4GYRA 3MKDA 3OYXA 2WBLA 4I43B 5FXVA 5KMGP 4PFOA 1E1HB 5LHGB 4BAYB 1KK7A 3IF8B 3LG7A 5LJMA 3LJCA 4EB6E 2L9QA 4UVCB 4C91A 1KNZA 2Y6XA 4DVDA 3RYHE 2M67A 4F6RC 3N9MA 1MMDA 3Q9DA 5GONE 3ZJ1A 1S35A 1QUUA 4PFPA 3J9X1 4BA9A 4O4JE 3F31A 3O1JA 4UXNB 3ZEFB 4AKRB 2DI4A 2LSGA 4AXPA 3AAIA 3C50A 4JEHB 4AKIA 3C64A 3GMIA 2ZMAA 4UF0B 3CQCB 4EYUA 3ZMTB 1UCUA 2WMOA 4PJMA 2LSIA 2VKDA 2VKHA 2B1EA 4QWNB 5LHHB 2X51A 1IAPA 4XAXB 2V7MA 1MMGA 3ZN0B 2SPCA 5FMNA 5FY7A 3ANWB 3CQXC 3VKHA 4K0UA 1MNDA 1HS7A 1NWMX 1AJ3A 1D1CA 3ESLA 2LOPA 5LP6E 3VKGA 4ADZA 4MBQA 4CQIA 3SS1A 4HN9A 3ZN1B 2JMKA 3LBXB 3H37A 3IHRA 5JH7E 5ETWA 1LKXA 4X1KE 4DMVA 2L8KA 5H6QB 4IDZA 4ZI2C 5HYAA 5LG4A 1D0YA 3L3PA 3D0TA 1V9DA 3V5UA 2K48A 3E22E 2Y8DA 1SA0E 1YKHB 3MA9A 4H9PC 3O1HA 2CEAA 2WM9A 3R84B 3T8OA 3C98B 4L5GA 3KV5A 5LYJE 1YW0A 2NWBA 1ZHCA 2VL8A 5JVDE 3OYZA 4IE6A 3TKLB 2JJ9A 1G8XA 4MLKA 2C5KT 3QK6A 3UUMA 3ONXA 4DO0A 4DBQA 5JDHA 3CKDA 4ZS2A 1HTJF 1US7B 1VRBA 4ANJA 5L2LA 4H9QC 3S4UA 1MMNA 2L3LA 3O1IA 2J1DG 3RC3A 3IEEA 3UT5E 4IHJE 3PUAA 2X68A 5E0OA 1MMAA 4XZCA 4I50E 5HWYA 4GOUA 3SWHA 3KBTA 3EDUA 4CXYA 3O4XE 4BJMA 4TV8E 4L0RA 3HR0A 2N2NA 3IBPA 3CVRA 4P0AA 2EHOA 1LVKA 5FXXA 3ZJ2A 4XBFB 3I9WA 4OFZA 4PJLA 1FMVA 2ACXA 2DNXA 4UV8B 3VHLA 4V1Av 2ZM2A 5IYZE 3KDSE 2CE7A 2Q9QA 1U5PA 4MALA 4I4TE 3SRZA 4ZS3A 1MIVA 1MIYA 4Z8XA 2IC6A 4TV9E 2UXNB 4HEAA 5TAOA 3O9XA 2XUEA 1IZNB 4QX8B 5EZYE 4ZOLE 4O2AE 5FXZA 3RC8A 2YK0A 3OKQA 5LGNB 2X9YA 2ODUA 1B7TA 4PNIA 3SOLA 5H6RB 4H63V 4ERRA 2QGSA 1QSDA 3QC9A 2DCFA 4AKLA 2CWYA 1HG2A 5LNKA 5L3DB 3K3NA 3AAEB 1MIWA 3ZCJA 2UXXB 3ZPOA 4AQFA 5JDFA 3EDVA 3LFMA 2BVMA 5LGTB 5CB4E 3AB3B 3RRCA 5L3GB 1BR4A 1ZV4X 2W00A 5LBMA 3J7Yq 3KV9A 1SHZC 3E0ZA 2Y48B 2LHRA 3DJBA 1T98A 3N2OA 1WYBA 3HKBE 2VB6A 4AI6A 3I9YA 3P7IA 4ZHQE 4QXBB 4PJJA 3FXDB 3KFWX 3P8CD 5JR9A 5HXHA 5EK3A 2NW7A 2CMRA 3C4ZA 3UUNA 2P9BA 3ETVA 4P09A 2DLRA 5FY0A 3ZCIA 2ODVA 2YU1A 5L3BB 3RYFE 2A72A 3AA0B 3C51A 5FNVE 3LK42 2KINB 1WYCA 5M4YA 5KX5E 2NTYA 4PW8A 2EHOB 4UELA 2KWHA 4ISTA 3KV6A 3N9LA 3I1AA 2LSJA 2K5BB 3MJXA 2W63A 3ZYKA 2K9AA 4ZI3D 2E9XD 4KUMB 2Q9QB 2V1DB 3NZQA 1HF8A 5FP3A 3NRYA 3KVAA 5ADXL 3PUSA 4TN7B 2NTXA 3RYIE 4U72A 2VKOA 4WNKA 2X0LB 4AQFC 3FBZA 2PJQA 1G73A 3FBLA 4EOZB 2WWUA 2VWAA 1H7CA 5JDMA 5FYMA 2NW9A 3UTKA 2WSSV 2C0SA 4ASKA 3CX8B 3RPUA 3DP7A 3K3OA 4IE5A 5DQVA 2BVLA 2EHOD 5LCYA 4EZHA 3GA8A 3F2EA 2D2SA 4GYSA 5J2UE 4YJ3E 5JREA 1WLXA 4IGUA 5J1GA 1LRZA 3ZYMA 2LE8A 2Q9QD 3FB2A 3MXZA 2E9XA 3N2KE 4ISSA 2VKJA 2V7JA 3Q5WA 4A56A 3ZMUB 4TUYE 5DQWA 5HXEA 5C8YE 5J2TE 2VASA 2XQYA 2CXLA 2CLYB 4OK0A 3UULA 5LJNA 4WBOA 5HXCA 1FMWA 2HPJA 1HX8A 4B6XA 4O4IE 2KLQA 5HWXA 1WRDA 2ES0A 2CWOA 3OJAA 4U74A 3ZC0A 4AKGA 2KMFA 4CI1B 2XHEB 1YD8G 3DTOA 4H9RC 2X9WA 2LT3A 4UV9B 5JRCA 3BK9A 2V7KA 5FY1A 3A5XA 2HPLA 3R6NA 4QXCB 4KP3C 4HTEA 3W15B 2D0TA 3GWHA 4JLEA 2LOSA 2YEVC 2H3RA 3ZC1A 4IE7A 2X9HA 4EYYR 3ZMZB 2NP9A 3KVBA 4PAGA 4E7ZA 2PG8A 5F3JA 5LGUB 5CA1E 4KBMB 1ZEEA 3HI2A 2RP4A 5HXSA 4WBNE 4QKNA 5JQGE 5JDGA 4JEUB 2N9DA 2XAHB 2JQQA 4ZI3C 2Z6EA 4NUUA 2E9XC 2V7IA 4IE4A 1FIOA 4EXTA 4OYKA 4L9IA 3B57A 2JPFA 3BQLA 3JC6D 4HFVA 1O3XA 4GIWA 4UVAB 3PDYA 3F57A 4WW0A 5EK4A 4I55E 4QX7B 2C5JA 3K3QC 4HGAA 2LHNA 3AVRA 3BQIA 3KINB 3CX7B 4AKHA 3NZPA 3PUQA 3AA7B 2E9XB 1S94A 2D0UA 4PK4A 4P0BA 3U78A 3M65A 4KMCA 2IW5B 3N9QA 3HKDE 2EHOC 2ZM8A 3ETUA 5JDQA 2MBGA 4BJNA 5HAXA 1X79A 3WAKA 3Q2MA 3HKEE 1BR0A 2KWIB 3NRXA 4YLHA 4EAHA 3PE0A 1HFAA 4X20E 2Q9QC 4UEMA 3RRWA 3I0OA 4DMWA 4MHCA 3I0QA 3AA1B 2WMNA 4X1IE 3GN5A 3N5LA 3H3AA 2XAGB 5LXTE 3EUHA 4CI3B 2MYSA 3VU7H 1HG5A 3B13A 1U4QA 4C90A 5A1LA 5JRCB 3RKOA 2IC9A 4G2AA 1D1AA 3HA4A 3Q5XA 4FJOA 2MTQA 3AAAB 2KT9A 4N78D 2HH7A 4CXWA 3K8PC 5FXWA 2CXDA 2NW8A 2K24A 3ZLIA 3PU8A 3ZYLA 1D0ZA 5JDLA 2LSYA 1OXZA 2A3DA 3KBUA 4O8SA 3NBXX 2MOZA 3CWZB 1D0XA 2CA5A 1IJ5A 2OA5A 1HCIA 5AFUL 2G0UA 3OBVE 1YKEB 4ZI7E 3AVSA 4EZ4A 5LHIB 4QXHB 2X9XA 2LJLA 2ZLYA 3U3IA 4H9OC 3ZMSB 5CA0E 5L3FB 1MNEA 4EIWA 2NOXA 2CLYC 4CZZB 1FEWA 5LA6E 4HKAA 1D1BA 1BR2A 5LOVE 5JR9C 4OYJA 4H9SE 3KV4A 2V7LA 2N1GA 1BR1A 1LVFA 2PFVA 3LK2B 4O4LE 2LSKA 5DJQC 4AQGA 3HKCE 2WAUA 3MACA 5BMVE 3JC6C 3N2GE 3N9NA 2GK9A 3BQKA 1VOMA 4MFRA 1NAFA 4CI2B 5JR9B 3HL6A 3MZKB 4QHOA 2YU2A 1EZ3A 1ZKEA 2C5IT 5L3EB 2X66A 3GN5B 1Y64B 4H63H 4E7SA 2CCQA 4UIGA 2KZ7B 3LK3B 3V5SA 5L3CB 3QUJA 2XAQB 3PURA 3EVYA 2ZM0A 2KXPB 2LEHA 2XTLA 1UX4A 4ILUA 4PK6A 4M1PA 3FHNA 1CUNA 2CXFA 3MK7C 4GK0E 3CX6B 2X67A 2XAJB 4DNDA 4O2BE 4UVBB 3UUXB 2QA7A 3RX6A 1UX5A 4YHJA 4DBRA 2JMHA 2DWGA 2XAFB 4IE0A 5F8PA 4G63A 2KNDA 4UF0A 1WR6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KND A;  2KMF A;  2Y6X A; 
#chains in the Genus database with same CATH topology
 2W0G A;  3A8Y C;  4IIJ E;  2AXD S;  3N9O A;  1YXR A;  3ZKR A;  2MAW A;  1IJ6 A;  3L09 A;  5IHY A;  3ANW A;  4FI5 A;  2XY8 B;  3PTR B;  3C4X A;  4HFB A;  5C2T A;  4JI6 T;  2YDQ A;  2JRK A;  5DAB A;  2CM0 A;  2XAS B;  5AQS B;  2D5U A;  3CPZ A;  3FXE B;  3UU6 A;  2DWK A;  2A2F X;  4LMK A;  3OYX A;  4PFO A;  5LHG B;  1KK7 A;  3LG7 A;  3LJC A;  2VVN A;  2L9Q A;  4DVD A;  4DID B;  4F6R C;  2VQE T;  3Q9D A;  3UFG A;  4UXN B;  4AKR B;  4WZX A;  3AEA A;  3C50 A;  4LF7 T;  4AKI A;  2XSA A;  4UF0 B;  2WMO A;  3FZL B;  2VKD A;  5HCM A;  2OV9 A;  5ABG A;  2HHH T;  1MND A;  1D1C A;  3EI0 A;  3VKG A;  3SS1 A;  3LBX B;  4LML A;  3LDQ B;  3IHR A;  2WZI A;  4X1K E;  4DMV A;  2Y8D A;  2JIW A;  1SA0 E;  4YSZ A;  5CGM A;  2V8S V;  3O1H A;  3CK6 A;  3T8O A;  4L5G A;  1T8B A;  2WB5 A;  2VL8 A;  3OYZ A;  3TKL B;  2JJ9 A;  1G8X A;  5JDH A;  4DBQ A;  3CKD A;  4ANJ A;  4DV0 T;  5AQN B;  5AQR B;  4NXN T;  2J1D G;  4HFI A;  2X68 A;  1MMA A;  3UQ7 A;  5HWY A;  3AEE A;  3VR9 A;  3O4X E;  2JQH A;  3ZT5 A;  3L39 A;  2LRK A;  2N2N A;  2WU2 A;  4GKJ T;  2EHO A;  1W9R A;  4OFZ A;  1FMV A;  2ACX A;  5HEH A;  1KF6 A;  4YTN A;  1MIV A;  5FXZ A;  5LGN B;  2X9Y A;  2VL0 A;  2W66 A;  1B7T A;  3AXJ A;  4JV5 T;  2XQ6 A;  5LB7 B;  1HG2 A;  5L3D B;  3K3N A;  3RIU A;  1MIW A;  3UQ4 A;  2H88 A;  2W4X A;  2BVM A;  5LGT B;  5CB4 E;  3RRC A;  5L3G B;  1BR4 A;  5AQF B;  1SHZ C;  3QNU A;  4K0K T;  3N2O A;  4IT4 A;  4AI6 A;  4ZHQ E;  3FXD B;  2CMR A;  4JI1 T;  2ODV A;  2YU1 A;  4X62 T;  5L3B B;  2A72 A;  3C51 A;  3LK4 2;  5M4Y A;  2NTY A;  4UEL A;  2NR4 A;  4U7I A;  4DV4 T;  1HNW T;  4KUM B;  5L4E A;  3P4P A;  4TN7 B;  2VKO A;  3FBZ A;  1G73 A;  1H7C A;  3P50 A;  1CHU A;  5JDM A;  3ZT6 A;  5FYM A;  2NW9 A;  2LKH A;  3PV0 F;  3RPU A;  3K3O A;  2V5C A;  2BVL A;  3F2E A;  4YJ3 E;  4AIU A;  2WCA A;  2OLT A;  4IGU A;  4YTP A;  3ZYM A;  2VKJ A;  1KNR A;  3UU4 A;  4OK0 A;  4HFC A;  4GKK T;  5HWX A;  2ES0 A;  5FY1 A;  1UUS A;  4JI7 T;  3W15 B;  2YEV C;  4YTM A;  5LGU B;  3KVB A;  5AQH B;  3HI2 A;  1Z8U A;  5HXS A;  4IDP A;  5ABF A;  2H89 A;  4OYK A;  2JPF A;  4GIW A;  4UVA B;  3TLV A;  4I55 E;  3K3Q C;  4HGA A;  2LHN A;  3PUQ A;  1S94 A;  2IW5 B;  1KEY A;  1J1J A;  2BS4 A;  3RIA A;  2Q9Q C;  3I0O A;  4DV7 T;  2WMN A;  3N5L A;  4ILA A;  3LSV A;  5LXT E;  3VU7 H;  3FZK B;  5A1L A;  2IC9 A;  4G2A A;  4FJO A;  2MTQ A;  3AAA B;  5ABH A;  5FXW A;  3ZLI A;  4O8S A;  3NBX X;  3AE3 A;  2BG9 C;  4EZ4 A;  5LHI B;  2VUR A;  4H9O C;  2CLY C;  5LA6 E;  1XDP A;  1D1B A;  4OYJ A;  4KI0 F;  2D9D A;  3KV4 A;  2N1G A;  1LVF A;  3LK2 B;  4O4L E;  4ZXL A;  4AQG A;  3HKC E;  3JC6 C;  4LF9 T;  4JI4 T;  3N2G E;  4DR5 T;  5JR9 B;  5AQM B;  4IRE A;  3MZK B;  4QHO A;  5LMN T;  1ZKE A;  2C5I T;  3PUW F;  4H63 H;  4E7S A;  3EVY A;  4ILU A;  2XAJ B;  4DND A;  4O2B E;  3UUX B;  2QA7 A;  3T1H T;  2DWG A;  2I59 A;  3RH3 A;  2UXD T;  4GK5 E;  3E08 A;  2XZE A;  5EK2 A;  3VRA A;  2H7O A;  5LBQ B;  4PK5 A;  3CQG B;  1OWA A;  2YKS A;  5AQV B;  4TZ4 C;  3UFE A;  2H7V C;  2RA1 A;  3ZMV B;  4X1Y E;  4CXX A;  4LFC T;  2W61 A;  3G06 A;  3PU3 A;  4NPP A;  2V6X A;  3PUX F;  4YJ2 E;  2E8I A;  4GYR A;  3FZF B;  2WZH A;  3FZM B;  2Y6X A;  4DR7 T;  4DUZ T;  5HEG A;  2WDQ A;  2K3W A;  2XSB A;  4BA9 A;  3J9X 1;  4O4J E;  2CPT A;  2DI4 A;  4JI8 T;  2ZMA A;  4EYU A;  4PJM A;  1T72 A;  2B1E A;  5AQJ B;  4ZZB A;  4QWN B;  5LHH B;  1IAP A;  4XAX B;  3JAE A;  4YT0 A;  2SPC A;  4LF5 T;  2LLY A;  3VKH A;  5C3J A;  1NWM X;  1AJ3 A;  2JMK A;  2W67 A;  1W0A A;  5JH7 E;  4ZI2 C;  1IBK T;  1D0Y A;  3L3P A;  2XPK A;  2K48 A;  2CEA A;  2WS3 A;  3C98 B;  3AEG A;  1ZHC A;  5JVD E;  2I6H A;  4IE6 A;  3ONX A;  4ZS2 A;  1VRB A;  4Z90 A;  1MMN A;  2R6G F;  3RC3 A;  5LG3 A;  3UT5 E;  1XZY A;  4IHJ E;  4XZC A;  4I50 E;  3KBT A;  4JYA T;  4U33 A;  3RQW A;  4P0A A;  2M6B A;  3I9W A;  4PJL A;  4HWC A;  2DNX A;  4UV8 B;  5IYZ E;  1U5P A;  4I4T E;  3TLS A;  1MIY A;  4Z8X A;  4TV9 E;  2UXN B;  4HEA A;  3TLW A;  4QX8 B;  4ZOL E;  4O2A E;  1N34 T;  3RC8 A;  2ODU A;  3SOL A;  4H63 V;  2QGS A;  1W0B A;  3QC9 A;  4NXM T;  2A9U A;  5LNK A;  3ZCJ A;  2BS3 A;  3ZPO A;  5JDF A;  3EDV A;  3X1D A;  5IUX A;  1L0V A;  2W00 A;  4QH4 A;  3E0Z A;  2DL1 A;  2LHR A;  3DJB A;  1T98 A;  3HKB E;  3P7I A;  2BKP A;  4PJJ A;  4X65 T;  2XM1 A;  5JR9 A;  5HXH A;  1W09 A;  3UUN A;  2P9B A;  4NIQ A;  3ETV A;  4P09 A;  1HNZ T;  1ZOY A;  3AA0 B;  1WYC A;  1T7S A;  1ZP0 A;  4IDN A;  3KV6 A;  2XQ3 A;  2K5B B;  3MJX A;  3ONJ A;  3ZYK A;  4TWH A;  2Q9Q B;  1X9B A;  5FP3 A;  3NRY A;  3KVA A;  2NTX A;  4U72 A;  4WNK A;  4JBW F;  2WWU A;  2WSS V;  2C0S A;  3CX8 B;  4AIS A;  2WDR A;  3DP7 A;  4I0U A;  4DV5 T;  5LCY A;  4EZH A;  4Q25 A;  2D2S A;  5J2U E;  1WLX A;  5J1G A;  1LRZ A;  4B3T T;  2Q9Q D;  3AE6 A;  2E9X A;  3AED A;  2BG9 B;  5C8Y E;  2CXL A;  2CLY B;  1JNR A;  5LJN A;  4WBO A;  3P4W A;  2KLQ A;  1WRD A;  2FBW A;  3DTO A;  4H9R C;  4EV6 A;  5JRC A;  4QH5 A;  3R6N A;  4KP3 C;  4HTE A;  2D0T A;  3GWH A;  4JLE A;  2H3R A;  4P1N A;  2M6I A;  3ZC1 A;  5HEO A;  4E7Z A;  2ZM6 T;  2PG8 A;  2YDS A;  3B5M A;  3T1Y T;  1ZEE A;  2RP4 A;  3ONL C;  2N9D A;  2XAH B;  2IML A;  1VCT A;  2XQA A;  4NUU A;  2E9X C;  4IE4 A;  1FIO A;  4EXT A;  4L9I A;  3BQL A;  3JC6 D;  4U2Z A;  5KXJ A;  4OX9 T;  3F57 A;  4QX7 B;  2C5J A;  2FJE A;  3KIN B;  3NZP A;  3AE9 A;  3OTO T;  2D0U A;  4PK4 A;  3U78 A;  3QOF A;  3N9Q A;  3HKD E;  2EHO C;  3ETU A;  1X79 A;  3Q2M A;  1GQE A;  1BR0 A;  3NRX A;  4EAH A;  1HFA A;  3TLT A;  4UEM A;  5AQK B;  4MHC A;  4X1I E;  3EUH A;  2MYS A;  2V6Y B;  1U4Q A;  1D1A A;  3HA4 A;  2UXC T;  2XJ7 A;  3K8P C;  2IIU A;  3AE4 A;  1NEN A;  2V5D A;  3ABV A;  4LFB T;  1OXZ A;  2A3D A;  1OED A;  3RIU C;  2MOZ A;  3CWZ B;  1D0X A;  1IJ5 A;  2UXB T;  2RPA A;  3OBV E;  1YKE B;  3RQU A;  1WCR A;  3AVS A;  4B3M T;  2CHN A;  3OPC A;  1MNE A;  2NOX A;  4HKA A;  4CN6 A;  2V7L A;  3QB5 K;  2WAU A;  3MAC A;  3N9N A;  2GK9 A;  4A5X A;  4MFR A;  1NAF A;  4CI2 B;  1EZ3 A;  2FUP A;  2X66 A;  3GN5 B;  4UIG A;  2B76 A;  2LRL A;  2KXP B;  2LEH A;  2XTL A;  4PK6 A;  5JTG A;  2X67 A;  1E2A A;  3VRB A;  1YQ4 A;  3NKZ A;  1NEK A;  1UX5 A;  4YHJ A;  2JMH A;  5F8P A;  4G63 A;  2KND A;  4UF0 A;  4WBN E;  1WR6 A;  5AQU B;  4IL9 A;  4HE8 A;  5JDN A;  3WI3 A;  3AA6 B;  4OHF A;  2YN6 A;  1M62 A;  4ZI2 D;  2XQ5 A;  3PUG A;  5AQG B;  4ILC A;  3UU3 A;  2J47 A;  1Y01 A;  4NUV A;  3LBX A;  1YQ3 A;  4LF4 T;  2YIN A;  4PJN A;  2XQ4 A;  3RGL A;  1XMQ T;  2DHR A;  2PBI A;  2IAK A;  1OED E;  5FL0 A;  4J2C A;  2BDE A;  4YFS A;  1WFD A;  2VK9 A;  3CML A;  4H9N C;  2UUA T;  5HXR A;  4JUY A;  3MKD A;  3ZST A;  1XNQ T;  4I43 B;  5KMG P;  2QYW A;  3IF8 B;  4EB6 E;  4UVC B;  4C91 A;  2M67 A;  3N9M A;  5GON E;  3ZJ1 A;  3CIR A;  1QUU A;  4PFP A;  1DU2 A;  4JI2 T;  3O1J A;  2LSG A;  4AXP A;  3AAI A;  4JEH B;  2CHO A;  4ZEY A;  1UCU A;  2LSI A;  2VKH A;  3AEC A;  2X51 A;  2V7M A;  5FMN A;  3L8R A;  3ANW B;  1KNP A;  3CQX C;  2LOP A;  5LP6 E;  4MBQ A;  5HEJ A;  4HN9 A;  5ETW A;  2L8K A;  5HYA A;  5LG4 A;  1V9D A;  3V5U A;  3K1S A;  3AEB A;  3M3Z B;  3VR8 A;  4JI3 T;  3KV5 A;  5AQI B;  4DR2 T;  5LYJ E;  1YW0 A;  2NWB A;  2IDO B;  4MLK A;  4DO0 A;  1US7 B;  5IWA T;  2L3L A;  2FJB A;  1XDO A;  3SWH A;  1KFY A;  3EDU A;  4EGW A;  4BJM A;  4L0R A;  3IBP A;  2V6Y A;  3CVR A;  3AE1 A;  1LVK A;  5FXX A;  4XBF B;  4DV6 T;  2VQF T;  3VHL A;  4V1A v;  2CE7 A;  4ZS3 A;  2IC6 A;  5TAO A;  4HWI B;  2XUE A;  1IZN B;  2QRX A;  5EZY E;  4PNI A;  5H6R B;  1QSD A;  5AQO B;  2CWY A;  2UXX B;  4AQF A;  4YXD A;  2HN1 A;  5LBM A;  3P4Q A;  2VB6 A;  4QXB B;  3KFW X;  2NW7 A;  1N36 T;  4KHZ F;  3RYF E;  5FNV E;  2KIN B;  4KX6 A;  2EHO B;  2JQK A;  4ILB A;  3I1A A;  2LSJ A;  2XQ8 A;  2W63 A;  2K9A A;  4DR6 T;  3P4R A;  2E9X D;  2FJD A;  3NZQ A;  1HF8 A;  3FZH B;  3PUS A;  1XWM A;  3RYI E;  2X0L B;  4AQF C;  2QVA A;  2VWA A;  4DR4 T;  4ASK A;  3AXJ B;  4DR1 T;  4IE5 A;  5DQV A;  2VVS A;  3PUZ F;  1UUR A;  2EHO D;  3GA8 A;  5HEU A;  2ACZ A;  5JRE A;  3P4S A;  3RF1 A;  4QH1 A;  4ISS A;  2YDR A;  4LF8 T;  2XQY A;  2CBI A;  5HXC A;  1FMW A;  2HPJ A;  1HX8 A;  3AEF A;  3ZC0 A;  3OJA A;  2KMF A;  5CFB A;  4CI1 B;  1YD8 G;  1VCS A;  2LT3 A;  3BK9 A;  3SFE A;  2V7K A;  4HFH A;  3A5X A;  1IBL T;  2HPL A;  2JQ9 A;  2XM2 A;  3PUY F;  5BR8 T;  3RKG A;  4IE7 A;  2X9H A;  4EYY R;  3ZSS A;  4KBM B;  4U3C A;  5JQG E;  4JEU B;  4ZI3 C;  5FVK A;  2Z6E A;  1JNZ A;  3B57 A;  4HFV A;  1HNX T;  4EEB A;  3PDY A;  2BKO A;  2BBH A;  2IUB A;  3BQI A;  2WQY A;  3M65 A;  2FJA A;  2E2A A;  5HAX A;  4B3S T;  3WAK A;  3HKE E;  4YLH A;  4DMW A;  3RRW A;  3I0Q A;  3AA1 B;  4IDQ A;  3H3A A;  4CI3 B;  4LF6 T;  3AE2 A;  3B13 A;  4C90 A;  4KHP T;  3NWI A;  2AE9 A;  3AE5 A;  5J0Z A;  4N78 D;  4CXW A;  1R8I A;  2NW8 A;  2K24 A;  3PU8 A;  4X64 T;  3A7M A;  3KBU A;  5ABF B;  2CA5 A;  3IA3 A;  4QXH B;  2ZLY A;  3ZMS B;  5CA0 E;  4CZZ B;  4DUY T;  1FEW A;  2W2U A;  5LOV E;  5JR9 C;  4H9S E;  4TWD A;  1J5W A;  2LSK A;  5BMV E;  4DV2 T;  1E7P A;  3BQK A;  1VOM A;  4HFD A;  5L3E B;  5AQL B;  2CCQ A;  3QUJ A;  2XAQ B;  3PUR A;  4F8H A;  1UX4 A;  3H3M A;  4M1P A;  3FHN A;  4COF A;  1CUN A;  5CJ5 A;  2CXF A;  3MK7 C;  4GK0 E;  4TWF A;  4DBR A;  3RI5 A;  4IE0 A;  3ZN1 B;  3AE7 A;  2BKN A;  5KDM C;  3RYC E;  4U7Y A;  3WAJ A;  2V26 A;  3C4W A;  4HWF A;  2BZB A;  4DR3 T;  3RLF F;  4TX5 A;  1SE7 A;  1HX1 B;  4ZZC A;  5FL1 A;  2XQ7 A;  2LM2 A;  2UUC T;  4O4H E;  4X5T A;  1SUM B;  2LM9 A;  3N9P A;  3EHZ A;  2W62 A;  1Z0P A;  1M7K A;  3UUB A;  2WBL A;  5FXV A;  1WR0 A;  1E1H B;  4BAY B;  4YSY A;  5LJM A;  4Z91 A;  5AQP B;  1KNZ A;  3RYH E;  1MMD A;  1FJG T;  4HWD A;  4HWH A;  1S35 A;  3F31 A;  3ZEF B;  3OVU A;  3C64 A;  3GMI A;  3CQC B;  3ZMT B;  4U2Y A;  2IHR 1;  1MMG A;  3ZN0 B;  5FY7 A;  4K0U A;  1HS7 A;  3ESL A;  3RHW A;  4ADZ A;  4CQI A;  3PUV F;  3H37 A;  1LKX A;  5H6Q B;  4IDZ A;  3D0T A;  3E22 E;  1YKH B;  3MA9 A;  4H9P C;  5AQQ B;  2WM9 A;  3R84 B;  3TLU A;  4LMJ A;  2HN2 A;  3Q5E A;  2C5K T;  3QK6 A;  3UUM A;  4LFA T;  1HTJ F;  5L2L A;  4H9Q C;  3S4U A;  3O1I A;  1OED C;  3IEE A;  2BS2 A;  2PTF A;  3PUA A;  5E0O A;  4GOU A;  1XNR T;  4A97 A;  2MPK A;  4B3R T;  4CN4 A;  4CXY A;  4TV8 E;  3HR0 A;  5F5W A;  3ZJ2 A;  2ZM2 A;  3KDS E;  2Q9Q A;  4MAL A;  3SRZ A;  4YHH T;  2E5V A;  3O9X A;  3RIF A;  2YK0 A;  3OKQ A;  2XQ9 A;  4ERR A;  4AKL A;  2DCF A;  3AAE B;  3LFM A;  2UU9 T;  3AB3 B;  3NVO A;  3J7Y q;  1ZV4 X;  3KV9 A;  2BG9 A;  2Y48 B;  3EAB A;  1WYB A;  3I9Y A;  4YY3 T;  3Q5D A;  3P8C D;  1N33 T;  5EK3 A;  3C4Z A;  3ZCI A;  2DLR A;  5FY0 A;  5FVL A;  5KX5 E;  4PW8 A;  2KWH A;  4IST A;  2WY2 A;  3N9L A;  3SFD A;  1N32 T;  5FKY A;  2X0H A;  4ZI3 D;  4U31 A;  2V1D B;  4X66 T;  5ADX L;  1XMO T;  4JI0 T;  2PJQ A;  3FBL A;  4EOZ B;  3UTK A;  1I6Z A;  4UR9 A;  3UU8 A;  4GYS A;  5AQT B;  2LE8 A;  3PJA J;  3FB2 A;  3MXZ A;  3N2K E;  1I94 T;  2F4V T;  2V7J A;  3Q5W A;  4A56 A;  3ZMU B;  4TUY E;  2E5L T;  2CBJ A;  5DQW A;  5HXE A;  5J2T E;  2VAS A;  3ZT7 A;  3UUL A;  5L47 A;  2J62 A;  4B6X A;  1IBM T;  4O4I E;  2CWO A;  3JCF A;  4U74 A;  4AKG A;  2YOE A;  2XHE B;  2X9W A;  4UV9 B;  2BG9 E;  4QXC B;  2LOS A;  1UK5 A;  4JI5 T;  3ZMZ B;  2NP9 A;  4TNW A;  4PAG A;  1QLB A;  5F3J A;  5CA1 E;  2CRB A;  4CN1 A;  3PJA A;  4QKN A;  5JDG A;  2KSR A;  2JQQ A;  5HCJ A;  2V7I A;  4DV1 T;  1O3X A;  4WW0 A;  5EK4 A;  2I0M A;  3AVR A;  5L4H A;  3CX7 B;  4AKH A;  3AA7 B;  2E9X B;  4P0B A;  3JAD A;  4KMC A;  2X0Y A;  2ZM8 A;  5JDQ A;  2MBG A;  4IL4 A;  4BJN A;  2KWI B;  3PE0 A;  4X20 E;  5ABE A;  3GN5 A;  2XAG B;  1HG5 A;  5JRC B;  3RKO A;  2UUB T;  3Q5X A;  4WYV A;  2KT9 A;  2HH7 A;  2J4G A;  2CXD A;  2BBJ A;  4IDO A;  3ZYL A;  1D0Z A;  5JDL A;  2LSY A;  1HR0 T;  2OA5 A;  3UU5 A;  1HCI A;  5AFU L;  2G0U A;  4HFE A;  4ZI7 E;  2X9X A;  2LJL A;  3U3I A;  2WWV A;  5L3F B;  4EIW A;  5LMU T;  1BR2 A;  4YSX A;  1BR1 A;  2PFV A;  3JAF A;  5DJQ C;  3HL6 A;  2YU2 A;  3QB5 A;  1UGO A;  4DV3 T;  2LKG A;  4EED A;  1Y64 B;  2KZ7 B;  3LK3 B;  3V5S A;  2WU5 A;  3EAM A;  5L3C B;  2ZM0 A;  4A98 A;  3CX6 B;  4AQY T;  3AE8 A;  4UVB B;  1J5E T;  2WDV A;  3RX6 A;  4TNV A;  2XAF B;  2WP9 A;  1OED B; 
#chains in the Genus database with same CATH homology
 2W0G A;  2I59 A;  3RH3 A;  4HE8 A;  5JDN A;  3WI3 A;  3AA6 B;  4IIJ E;  4OHF A;  3RYC E;  5KDM C;  3N9O A;  4GK5 E;  4ZI2 D;  3WAJ A;  2V26 A;  3PUG A;  3C4W A;  3E08 A;  2BZB A;  1IJ6 A;  3L09 A;  5EK2 A;  5IHY A;  3ANW A;  4FI5 A;  2H7O A;  5LBQ B;  4PK5 A;  3CQG B;  1OWA A;  3PTR B;  4NUV A;  3C4X A;  4TX5 A;  4TZ4 C;  3LBX A;  3UFE A;  2H7V C;  2YIN A;  4PJN A;  2RA1 A;  3ZMV B;  2DHR A;  2JRK A;  4X1Y E;  2PBI A;  2IAK A;  5DAB A;  2CM0 A;  4J2C A;  4CXX A;  4O4H E;  2W61 A;  2BDE A;  3PU3 A;  2LM9 A;  4YFS A;  2XAS B;  2VK9 A;  2D5U A;  3CPZ A;  3CML A;  3FXE B;  4H9N C;  3N9P A;  2DWK A;  5HXR A;  4YJ2 E;  2W62 A;  2A2F X;  1Z0P A;  2E8I A;  4JUY A;  4GYR A;  3MKD A;  3OYX A;  2WBL A;  4I43 B;  5FXV A;  5KMG P;  4PFO A;  1E1H B;  5LHG B;  4BAY B;  1KK7 A;  3IF8 B;  3LG7 A;  5LJM A;  3LJC A;  4EB6 E;  2L9Q A;  4UVC B;  4C91 A;  1KNZ A;  2Y6X A;  4DVD A;  3RYH E;  2M67 A;  4F6R C;  3N9M A;  1MMD A;  3Q9D A;  5GON E;  3ZJ1 A;  1S35 A;  1QUU A;  4PFP A;  3J9X 1;  4BA9 A;  4O4J E;  3F31 A;  3O1J A;  4UXN B;  3ZEF B;  4AKR B;  2DI4 A;  2LSG A;  4AXP A;  3AAI A;  3C50 A;  4JEH B;  4AKI A;  3C64 A;  3GMI A;  2ZMA A;  4UF0 B;  3CQC B;  4EYU A;  3ZMT B;  1UCU A;  2WMO A;  4PJM A;  2LSI A;  2VKD A;  2VKH A;  2B1E A;  4QWN B;  5LHH B;  2X51 A;  1IAP A;  4XAX B;  2V7M A;  1MMG A;  3ZN0 B;  2SPC A;  5FMN A;  5FY7 A;  3ANW B;  3CQX C;  3VKH A;  4K0U A;  1MND A;  1HS7 A;  1NWM X;  1AJ3 A;  1D1C A;  3ESL A;  2LOP A;  5LP6 E;  3VKG A;  4ADZ A;  4MBQ A;  4CQI A;  3SS1 A;  4HN9 A;  3ZN1 B;  2JMK A;  3LBX B;  3H37 A;  3IHR A;  5JH7 E;  5ETW A;  1LKX A;  4X1K E;  4DMV A;  2L8K A;  5H6Q B;  4IDZ A;  4ZI2 C;  5HYA A;  5LG4 A;  1D0Y A;  3L3P A;  3D0T A;  1V9D A;  3V5U A;  2K48 A;  3E22 E;  2Y8D A;  1SA0 E;  1YKH B;  3MA9 A;  4H9P C;  3O1H A;  2CEA A;  2WM9 A;  3R84 B;  3T8O A;  3C98 B;  4L5G A;  3KV5 A;  5LYJ E;  1YW0 A;  2NWB A;  1ZHC A;  2VL8 A;  5JVD E;  3OYZ A;  4IE6 A;  3TKL B;  2JJ9 A;  1G8X A;  4MLK A;  2C5K T;  3QK6 A;  3UUM A;  3ONX A;  4DO0 A;  4DBQ A;  5JDH A;  3CKD A;  4ZS2 A;  1HTJ F;  1US7 B;  1VRB A;  4ANJ A;  5L2L A;  4H9Q C;  3S4U A;  1MMN A;  2L3L A;  3O1I A;  2J1D G;  3RC3 A;  3IEE A;  3UT5 E;  4IHJ E;  3PUA A;  2X68 A;  5E0O A;  1MMA A;  4XZC A;  4I50 E;  5HWY A;  4GOU A;  3SWH A;  3KBT A;  3EDU A;  4CXY A;  3O4X E;  4BJM A;  4TV8 E;  4L0R A;  3HR0 A;  2N2N A;  3IBP A;  3CVR A;  4P0A A;  2EHO A;  1LVK A;  5FXX A;  3ZJ2 A;  4XBF B;  3I9W A;  4OFZ A;  4PJL A;  1FMV A;  2ACX A;  2DNX A;  4UV8 B;  3VHL A;  4V1A v;  2ZM2 A;  5IYZ E;  3KDS E;  2CE7 A;  2Q9Q A;  1U5P A;  4MAL A;  4I4T E;  3SRZ A;  4ZS3 A;  1MIV A;  1MIY A;  4Z8X A;  2IC6 A;  4TV9 E;  2UXN B;  4HEA A;  5TAO A;  3O9X A;  2XUE A;  1IZN B;  4QX8 B;  5EZY E;  4ZOL E;  4O2A E;  5FXZ A;  3RC8 A;  2YK0 A;  3OKQ A;  5LGN B;  2X9Y A;  2ODU A;  1B7T A;  4PNI A;  3SOL A;  5H6R B;  4H63 V;  4ERR A;  2QGS A;  1QSD A;  3QC9 A;  2DCF A;  4AKL A;  2CWY A;  1HG2 A;  5LNK A;  5L3D B;  3K3N A;  3AAE B;  1MIW A;  3ZCJ A;  2UXX B;  3ZPO A;  4AQF A;  5JDF A;  3EDV A;  3LFM A;  2BVM A;  5LGT B;  5CB4 E;  3AB3 B;  3RRC A;  5L3G B;  1BR4 A;  1ZV4 X;  2W00 A;  5LBM A;  3J7Y q;  3KV9 A;  1SHZ C;  3E0Z A;  2Y48 B;  2LHR A;  3DJB A;  1T98 A;  3N2O A;  1WYB A;  3HKB E;  2VB6 A;  4AI6 A;  3I9Y A;  3P7I A;  4ZHQ E;  4QXB B;  4PJJ A;  3FXD B;  3KFW X;  3P8C D;  5JR9 A;  5HXH A;  5EK3 A;  2NW7 A;  2CMR A;  3C4Z A;  3UUN A;  2P9B A;  3ETV A;  4P09 A;  2DLR A;  5FY0 A;  3ZCI A;  2ODV A;  2YU1 A;  5L3B B;  3RYF E;  2A72 A;  3AA0 B;  3C51 A;  5FNV E;  3LK4 2;  2KIN B;  1WYC A;  5M4Y A;  5KX5 E;  2NTY A;  4PW8 A;  2EHO B;  4UEL A;  2KWH A;  4IST A;  3KV6 A;  3N9L A;  3I1A A;  2LSJ A;  2K5B B;  3MJX A;  2W63 A;  3ZYK A;  2K9A A;  4ZI3 D;  2E9X D;  4KUM B;  2Q9Q B;  2V1D B;  3NZQ A;  1HF8 A;  5FP3 A;  3NRY A;  3KVA A;  5ADX L;  3PUS A;  4TN7 B;  2NTX A;  3RYI E;  4U72 A;  2VKO A;  4WNK A;  2X0L B;  4AQF C;  3FBZ A;  2PJQ A;  1G73 A;  3FBL A;  4EOZ B;  2WWU A;  2VWA A;  1H7C A;  5JDM A;  5FYM A;  2NW9 A;  3UTK A;  2WSS V;  2C0S A;  4ASK A;  3CX8 B;  3RPU A;  3DP7 A;  3K3O A;  4IE5 A;  5DQV A;  2BVL A;  2EHO D;  5LCY A;  4EZH A;  3GA8 A;  3F2E A;  2D2S A;  4GYS A;  5J2U E;  4YJ3 E;  5JRE A;  1WLX A;  4IGU A;  5J1G A;  1LRZ A;  3ZYM A;  2LE8 A;  2Q9Q D;  3FB2 A;  3MXZ A;  2E9X A;  3N2K E;  4ISS A;  2VKJ A;  2V7J A;  3Q5W A;  4A56 A;  3ZMU B;  4TUY E;  5DQW A;  5HXE A;  5C8Y E;  5J2T E;  2VAS A;  2XQY A;  2CXL A;  2CLY B;  4OK0 A;  3UUL A;  5LJN A;  4WBO A;  5HXC A;  1FMW A;  2HPJ A;  1HX8 A;  4B6X A;  4O4I E;  2KLQ A;  5HWX A;  1WRD A;  2ES0 A;  2CWO A;  3OJA A;  4U74 A;  3ZC0 A;  4AKG A;  2KMF A;  4CI1 B;  2XHE B;  1YD8 G;  3DTO A;  4H9R C;  2X9W A;  2LT3 A;  4UV9 B;  5JRC A;  3BK9 A;  2V7K A;  5FY1 A;  3A5X A;  2HPL A;  3R6N A;  4QXC B;  4KP3 C;  4HTE A;  3W15 B;  2D0T A;  3GWH A;  4JLE A;  2LOS A;  2YEV C;  2H3R A;  3ZC1 A;  4IE7 A;  2X9H A;  4EYY R;  3ZMZ B;  2NP9 A;  3KVB A;  4PAG A;  4E7Z A;  2PG8 A;  5F3J A;  5LGU B;  5CA1 E;  4KBM B;  1ZEE A;  3HI2 A;  2RP4 A;  5HXS A;  4WBN E;  4QKN A;  5JQG E;  5JDG A;  4JEU B;  2N9D A;  2XAH B;  2JQQ A;  4ZI3 C;  2Z6E A;  4NUU A;  2E9X C;  2V7I A;  4IE4 A;  1FIO A;  4EXT A;  4OYK A;  4L9I A;  3B57 A;  2JPF A;  3BQL A;  3JC6 D;  4HFV A;  1O3X A;  4GIW A;  4UVA B;  3PDY A;  3F57 A;  4WW0 A;  5EK4 A;  4I55 E;  4QX7 B;  2C5J A;  3K3Q C;  4HGA A;  2LHN A;  3AVR A;  3BQI A;  3KIN B;  3CX7 B;  4AKH A;  3NZP A;  3PUQ A;  3AA7 B;  2E9X B;  1S94 A;  2D0U A;  4PK4 A;  4P0B A;  3U78 A;  3M65 A;  4KMC A;  2IW5 B;  3N9Q A;  3HKD E;  2EHO C;  2ZM8 A;  3ETU A;  5JDQ A;  2MBG A;  4BJN A;  5HAX A;  1X79 A;  3WAK A;  3Q2M A;  3HKE E;  1BR0 A;  2KWI B;  3NRX A;  4YLH A;  4EAH A;  3PE0 A;  1HFA A;  4X20 E;  2Q9Q C;  4UEM A;  3RRW A;  3I0O A;  4DMW A;  4MHC A;  3I0Q A;  3AA1 B;  2WMN A;  4X1I E;  3GN5 A;  3N5L A;  3H3A A;  2XAG B;  5LXT E;  3EUH A;  4CI3 B;  2MYS A;  3VU7 H;  1HG5 A;  3B13 A;  1U4Q A;  4C90 A;  5A1L A;  5JRC B;  3RKO A;  2IC9 A;  4G2A A;  1D1A A;  3HA4 A;  3Q5X A;  4FJO A;  2MTQ A;  3AAA B;  2KT9 A;  4N78 D;  2HH7 A;  4CXW A;  3K8P C;  5FXW A;  2CXD A;  2NW8 A;  2K24 A;  3ZLI A;  3PU8 A;  3ZYL A;  1D0Z A;  5JDL A;  2LSY A;  1OXZ A;  2A3D A;  3KBU A;  4O8S A;  3NBX X;  2MOZ A;  3CWZ B;  1D0X A;  2CA5 A;  1IJ5 A;  2OA5 A;  1HCI A;  5AFU L;  2G0U A;  3OBV E;  1YKE B;  4ZI7 E;  3AVS A;  4EZ4 A;  5LHI B;  4QXH B;  2X9X A;  2LJL A;  2ZLY A;  3U3I A;  4H9O C;  3ZMS B;  5CA0 E;  5L3F B;  1MNE A;  4EIW A;  2NOX A;  2CLY C;  4CZZ B;  1FEW A;  5LA6 E;  4HKA A;  1D1B A;  1BR2 A;  5LOV E;  5JR9 C;  4OYJ A;  4H9S E;  3KV4 A;  2V7L A;  2N1G A;  1BR1 A;  1LVF A;  2PFV A;  3LK2 B;  4O4L E;  2LSK A;  5DJQ C;  4AQG A;  3HKC E;  2WAU A;  3MAC A;  5BMV E;  3JC6 C;  3N2G E;  3N9N A;  2GK9 A;  3BQK A;  1VOM A;  4MFR A;  1NAF A;  4CI2 B;  5JR9 B;  3HL6 A;  3MZK B;  4QHO A;  2YU2 A;  1EZ3 A;  1ZKE A;  2C5I T;  5L3E B;  2X66 A;  3GN5 B;  1Y64 B;  4H63 H;  4E7S A;  2CCQ A;  4UIG A;  2KZ7 B;  3LK3 B;  3V5S A;  5L3C B;  3QUJ A;  2XAQ B;  3PUR A;  3EVY A;  2ZM0 A;  2KXP B;  2LEH A;  2XTL A;  1UX4 A;  4ILU A;  4PK6 A;  4M1P A;  3FHN A;  1CUN A;  2CXF A;  3MK7 C;  4GK0 E;  3CX6 B;  2X67 A;  2XAJ B;  4DND A;  4O2B E;  4UVB B;  3UUX B;  2QA7 A;  3RX6 A;  1UX5 A;  4YHJ A;  4DBR A;  2JMH A;  2DWG A;  2XAF B;  4IE0 A;  5F8P A;  4G63 A;  2KND A;  4UF0 A;  1WR6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...