2KNDA

Psb27 structure from synechocystis
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
110
structure length
110
Chain Sequence
CDSGTGLTGNYSQDTLTVIATLREAIDLPQDAPNRQEVQDTARGQINDYISRYRRKGDAGGLKSFTTMQTALNSLAGYYTSYGARPIPEKLKKRLQLEFTQAERSIERGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Photosynthesis
molecule keywords Photosystem II 11 kDa protein
publication title Structure of Psb27 in solution: implications for transient binding to photosystem II during biogenesis and repair
pubmed doi rcsb
source organism Synechocystis sp.
total genus 27
structure length 110
sequence length 110
ec nomenclature
pdb deposition date 2009-08-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.810 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2kndA00
2KNDA 2Y6XA 2KMFA
chains in the Genus database with same CATH superfamily
4LF7T 4HFBA 4ILCA 3HKCE 2JMKA 3O9XA 1WCRA 4X5TA 2E5LT 3NBXX 2W63A 4E7ZA 2VASA 5E0OA 2N1GA 3CQCB 5AQJB 5ABFA 1GQEA 4IREA 1T98A 5DABA 3NVOA 2PJQA 2B76A 4UR9A 3WAJA 2DWKA 4GK0E 2K9AA 4OYJA 5JQGE 5ABGA 1HR0T 3T1HT 5AQVB 2DWGA 5DQVA 3AECA 2M67A 4X1YE 4ZI2D 3UFGA 1E7PA 4H9RC 3RIFA 3M3ZB 2FBWA 2MYSA 2IAKA 1G8XA 4HEAA 2WWVA 4DR1T 4O8SA 2V8SV 4AQFC 3AA6B 4HFVA 3Q5XA 4U2YA 3TLWA 4OX9T 3LSVA 3VKHA 2M6BA 5L2LA 3RIUC 4H9QC 2JJ9A 5EZYE 1CHUA 3FHNA 2KMFA 3UQ7A 3PUAA 2XZEA 4CXWA 2ODUA 2SPCA 2CEAA 2J4GA 2BVLA 2YK0A 4ISTA 5JDMA 2CLYB 3CX6B 4YHHT 5HEOA 4IL4A 2NTXA 2VURA 2ZLYA 2DHRA 4ZHQE 3J9X1 2E2AA 5HEUA 2X0LB 5JRCB 1US7B 3UU3A 3FBLA 2QA7A 3A8YC 4TV8E 2XQ4A 2DL1A 4DV3T 3K1SA 3NZPA 1LVFA 3SS1A 1UUSA 5L3EB 2Q9QA 1M62A 3OYXA 3KFWX 2D2SA 2XPKA 2JPFA 2ODVA 4IHJE 4DR2T 5DJQC 3B5MA 4QH1A 4JI4T 4ZI3C 1UX5A 3PU8A 5J0ZA 4LF5T 4HKAA 3ZC0A 4LMKA 3ZCJA 3ZYMA 5LHIB 1XDPA 2M6IA 1KNZA 3P4RA 2MOZA 2W4XA 4OHFA 4TN7B 4KP3C 5JR9B 3RPUA 3SRZA 2QYWA 4H63H 3HA4A 4UELA 3J7Yq 2WWUA 4U2ZA 4YXDA 4KX6A 3AAAB 4ZI7E 5L4HA 3NRXA 4JI8T 4G63A 3RHWA 3MK7C 4NPPA 1XNQT 1UGOA 2JQ9A 1Z8UA 5AQPB 1MNDA 1VOMA 4ADZA 4XBFB 2IUBA 3PUQA 2WZIA 3HKEE 4YY3T 3N9OA 2LSGA 2WSSV 1OEDC 3LK3B 2J62A 4ZI2C 4HFDA 3P4QA 1VCSA 4X62T 3ZEFB 2DLRA 5KX5E 3CKDA 4AQYT 3PU3A 3ZMSB 2UXBT 1J1JA 4F6RC 2VL8A 2V26A 4YFSA 4FI5A 4I4TE 5FYMA 2L9QA 4JI2T 4E7SA 4B3MT 3RQWA 5JRCA 1LVKA 4PK5A 2F4VT 4LF9T 2CBIA 3V5SA 1WYCA 3ZJ1A 2E9XB 2VQFT 3VHLA 1HG2A 4Z91A 2BS2A 3A7MA 4UV9B 4U74A 3ANWB 3ZSTA 1FEWA 3NRYA 3PV0F 2WAUA 2V6YB 4O4LE 1WFDA 4MBQA 1YXRA 2XAFB 2BS4A 3O1JA 3UULA 2ZMAA 4LF6T 3BQKA 2LT3A 2IDOB 5JDNA 5JR9A 5HEJA 4DMVA 2YINA 4L0RA 2KLQA 1X9BA 2VWAA 1WR6A 4O4IE 2X66A 3ZT7A 4ZZCA 1I94T 2LEHA 5GONE 4PJMA 3VU7H 4TX5A 3PE0A 5ABEA 4YTMA 4BAYB 3ONXA 2WZHA 4ZXLA 4AQGA 2IW5B 2MPKA 4DR3T 5AQGB 1YQ4A 4JI0T 4CI3B 2CM0A 4FJOA 2LSJA 2LRLA 4O4JE 4YJ3E 3QUJA 2CWYA 2ES0A 2I6HA 3DTOA 2E5VA 3N2KE 2LHNA 3VRBA 1LKXA 4TZ4C 3QOFA 3ZMVB 3EI0A 5LMNT 3KV9A 2X9XA 5L3DB 4PK4A 4X64T 1IBKT 3VR9A 2XQAA 3K3OA 1QLBA 4F8HA 4IT4A 4A98A 1NAFA 3AA1B 4PK6A 4DR5T 1O3XA 3PUVF 3HI2A 3CK6A 1YW0A 3N2GE 5LA6E 3R6NA 5LP6E 1XMQT 3ABVA 3I9WA 3IBPA 3MACA 5L4EA 1BR0A 3RX6A 4TV9E 4NXNT 3GWHA 2E9XA 3P7IA 5LCYA 3GN5B 1L0VA 4YSYA 2JQQA 3IF8B 5FXZA 4DV4T 5FKYA 5EK2A 5AQMB 3EHZA 3ANWA 1MNEA 2X0HA 3JAEA 5AQFB 2V6YA 2OA5A 1IBLT 2VKOA 3AE1A 4WBNE 4DMWA 2IIUA 4EYYR 3ZN0B 2XAJB 3C4WA 4GKKT 5FMNA 3L3PA 4QXCB 5BR8T 1ZKEA 3FXDB 1XMOT 2BZBA 2D5UA 2WMOA 4EAHA 3CX7B 2XUEA 1WYBA 2LKHA 4L9IA 2LOPA 5FL0A 3AXJB 3ONJA 4CZZB 3Q2MA 4KI0F 3I0OA 2A72A 2NW8A 3CMLA 2J1DG 5KDMC 4NUUA 4NUVA 3UUNA 4H9SE 5AQNB 4O2AE 5J2UE 4IGUA 1YD8G 5CFBA 4UVCB 3HKDE 4UEMA 2XM1A 2BVMA 2UXCT 1NEKA 4B6XA 1ZHCA 4K0KT 2V7MA 3E0ZA 2HN2A 3D0TA 3N2OA 3IHRA 2V7JA 4P0BA 5IHYA 4ISSA 2I0MA 4JEUB 3AEGA 3NWIA 1W0AA 1B7TA 3ZLIA 5HAXA 1MMGA 4QKNA 3RYFE 4XAXB 2MAWA 4I43B 3W15B 5A1LA 3PUSA 4LF4T 2JIWA 4KHZF 2K24A 4X20E 4J2CA 4JI3T 2FJBA 3LFMA 5LBMA 2HPLA 1ZV4X 3ONLC 3K3QC 4CN6A 4HGAA 5L3CB 3ZJ2A 4AIUA 3IA3A 3AE9A 3GN5A 1IBMT 2KINB 5LHGB 4IE0A 2BS3A 4DO0A 4X1IE 3H37A 5LOVE 4A5XA 4JUYA 1QSDA 3AE6A 4MHCA 4ERRA 4AKHA 2LRKA 1T8BA 4BJMA 4H9PC 3AE7A 4KBMB 1HG5A 3FB2A 2JQHA 3EUHA 3LK2B 4QXBB 3KV4A 2V5DA 2IHR1 5F5WA 3QK6A 4K0UA 3AE5A 5FY0A 4QHOA 2XQ7A 3UFEA 3I0QA 5HYAA 3MJXA 3TLUA 2NTYA 2W0GA 1D1BA 4DBRA 2L3LA 5AQKB 3AXJA 4U33A 4V1Av 1UX4A 5JREA 1YKHB 4DV5T 2QRXA 4KUMB 3ZMTB 3PUZF 2LHRA 1X79A 2OV9A 3FZKB 3BQLA 2A9UA 2XSBA 5H6QB 1T72A 1H7CA 2DCFA 5AQSB 1D0YA 4EEDA 4EZHA 4X66T 1IJ5A 3ZT5A 2X67A 2Y48B 4AXPA 4P1NA 4U72A 3RRWA 1D1AA 5HXRA 3MZKB 1JNRA 3QNUA 5FVLA 4U7IA 2PBIA 4DV7T 2EHOD 2Z6EA 2CXFA 5KMGP 1DU2A 5AQOB 4YLHA 2MTQA 1N34T 2CLYC 4QH4A 3X1DA 3KBUA 1N33T 2VB6A 3AVRA 1ZP0A 2WP9A 2K3WA 4HWDA 3RYHE 3AAEB 2FJDA 4ZS3A 5FXWA 1OWAA 5JDHA 2E9XD 2LSYA 4OK0A 2X51A 1UURA 2YKSA 3O4XE 5BMVE 4QH5A 5EK3A 3KV6A 2XJ7A 4IE6A 4IDNA 2WDVA 5CGMA 3ETUA 3RGLA 2XSAA 5LGUB 4N78D 4PJLA 4ZOLE 3UTKA 2VKDA 3E22E 3RYCE 3UQ4A 5C2TA 2XQ6A 4TWFA 3F2EA 2A2FX 2VL0A 3P8CD 1E2AA 2ZM6T 3C4ZA 1VCTA 2IC9A 5FY1A 4BJNA 4M1PA 3QB5A 1D0XA 5JR9C 4LFAT 3CVRA 4MFRA 3ESLA 4PJNA 2LOSA 1VRBA 4DUZT 5FVKA 5LJMA 2KSRA 3Q5DA 1NWMX 1W9RA 3C64A 1HFAA 3AVSA 1I6ZA 2Y6XA 5IUXA 2VKJA 4H9OC 3CQXC 3L09A 1UK5A 1D0ZA 4EYUA 5LG3A 3QB5K 2QGSA 2BG9B 3RH3A 2W62A 4OFZA 2CE7A 5L3BB 2UXXB 4EB6E 2XQ5A 2YDRA 3LJCA 4WNKA 4YSXA 3LBXB 2LSKA 2FJEA 2I59A 4DNDA 3N9LA 5AQQB 5DQWA 3EVYA 2ACZA 4EZ4A 4DV1T 3TLTA 1SHZC 1N36T 3O1IA 2RP4A 3H3AA 2NW7A 3AEDA 4HFEA 4L5GA 3RI5A 3LG7A 2V6XA 2YU1A 4P09A 4Z8XA 4C90A 2NP9A 2N2NA 4QX7B 4QX8B 1J5WA 3PUGA 3I9YA 1HS7A 4I0UA 2K48A 4ILBA 2UXNB 2JMHA 3HR0A 2DNXA 2EHOC 5LYJE 3RRCA 3RKOA 3Q9DA 2UUAT 2CMRA 3TKLB 3VR8A 4IIJE 3FZFB 5LBQB 2BBJA 2LJLA 2XASB 1FMWA 3BQIA 2V7KA 4TWDA 4GK5E 5LNKA 1XWMA 4LMJA 1S35A 3ZT6A 3ZYKA 1T7SA 2E9XC 4ZS2A 3OTOT 3K3NA 2HPJA 3OVUA 1EZ3A 1U5PA 4COFA 2XQ3A 5J1GA 2LM9A 5HEGA 3ZPOA 3OPCA 4I50E 5ADXL 3GMIA 1M7KA 4CI1B 4JI1T 2Q9QD 3CPZA 4YTPA 3N9QA 1HTJF 1IAPA 4LF8T 2LKGA 2C0SA 5CB4E 4NXMT 3P50A 2LE8A 3K8PC 4NIQA 1XNRT 5L47A 1BR1A 3CX8B 4WBOA 2L8KA 4GYRA 1KFYA 4HN9A 2BKPA 3N9PA 1YQ3A 3JCFA 3PJAJ 3BK9A 1S94A 3PUYF 2WU5A 5CA0E 3ZSSA 4U7YA 3OBVE 4B3RT 2ZM2A 3HL6A 5HXSA 5AQTB 3RIAA 5EK4A 1HX1B 3ZKRA 3UU8A 4JI6T 4UF0B 5AFUL 2BG9A 1N32T 2V5CA 5JTGA 4U31A 3E08A 4HFIA 3LBXA 3F57A 4IDOA 1UCUA 4C91A 5HXEA 2XAQB 2GK9A 2W2UA 2A3DA 4MLKA 2NW9A 4YJ2E 2X0YA 2CXLA 4PW8A 3N9NA 4DVDA 3EDUA 4PFOA 3VKGA 4ASKA 4IE5A 1MMAA 3C50A 1AJ3A 5HEHA 1BR4A 2WDRA 3MXZA 2VVSA 5AQLB 4B3TT 4IE7A 2X9HA 3PTRB 4AKRB 2VQET 4XZCA 2AXDS 5CA1E 1G73A 4DV2T 3AEFA 1LRZA 2YDQA 1HNXT 2X9YA 2Y8DA 2C5JA 1ZOYA 3KDSE 4LFCT 1IZNB 4EEBA 2DI4A 2BG9E 1U4QA 3U78A 5TAOA 2WB5A 2K5BB 1WLXA 5HCMA 4X1KE 4IDPA 4HE8A 4DR6T 1XZYA 5JH7E 3JC6D 5F3JA 5HWXA 4ILAA 2LLYA 2VK9A 4UVAB 3AE4A 5C3JA 2Q9QC 1SA0E 4CN4A 1R8IA 3I1AA 3SWHA 3MKDA 4JBWF 4KMCA 2BDEA 3RC8A 4H9NC 5AQUB 3PURA 3FZMB 3M65A 4UV8B 2BKOA 3DP7A 3CQGB 3KVBA 2AE9A 3RQUA 2PTFA 5JDQA 3KVAA 4P0AA 1JNZA 3ZN1B 2YN6A 3NZQA 5LGTB 4DIDB 4IDZA 3UT5E 4IL9A 4JLEA 5JDGA 2X68A 2XHEB 4AKGA 2C5IT 2WMNA 2H88A 1KF6A 2YOEA 2XM2A 4DV0T 2PFVA 5HWYA 5J2TE 4H63V 4O2BE 4X65T 4UF0A 3EAMA 3F31A 4KHPT 3FZHB 2ZM8A 1W0BA 3Q5WA 1E1HB 1MIYA 2ACXA 5FXVA 1OEDB 3L39A 3SFDA 4AQFA 2JQKA 5L3GB 3KV5A 5FY7A 3RIUA 4ANJA 2UU9T 3CWZB 5FL1A 5C8YE 3RYIE 3OYZA 5LB7B 3O1HA 2P9BA 4IE4A 1WR0A 1HF8A 3AA0B 4DBQA 4HWFA 2XQ8A 3UUBA 2CRBA 2W67A 4GYSA 2N9DA 4O4HE 4EIWA 1YKEB 4HFHA 2H89A 1XDOA 4DV6T 5FXXA 4QWNB 2MBGA 3PJAA 2WDQA 2CCQA 2CBJA 2D9DA 3G06A 1OXZA 1QUUA 2YEVC 4OYKA 1MIVA 3L8RA 1ZEEA 3N5LA 3VRAA 3C98B 3TLSA 3SOLA 2J47A 4GOUA 3DJBA 2CHOA 4CXYA 2UUCT 4Q25A 3JC6C 2WCAA 1Y64B 4LFBT 3CIRA 5F8PA 2VVNA 4UIGA 4ZZBA 4JYAT 3U3IA 4TUYE 2G0UA 1HCIA 3B13A 2OLTA 4TNWA 4QXHB 5AQHB 2IC6A 2ZM0A 1FMVA 4CN1A 3TLVA 2VKHA 4PJJA 3PUXF 1MMDA 2LM2A 2WY2A 2YDSA 4G2AA 5ABHA 4JV5T 1V9DA 5H6RB 1SUMB 2UUBT 2EHOB 4BA9A 3B57A 4DUYT 2PG8A 4IDQA 3HKBE 2WQYA 2WS3A 2YU2A 5LHHB 3RKGA 3N9MA 2RPAA 4I55E 2B1EA 1NENA 4HWHA 2E8IA 5M4YA 4PFPA 1OEDA 2UXDT 2NWBA 2QVAA 2FJAA 4UVBB 1HNWT 4AKLA 3P4SA 4EV6A 3AAIA 2HH7A 1WRDA 2LSIA 3C4XA 4ILUA 4YHJA 3AB3B 4HFCA 2RA1A 2W00A 3UU5A 3UUMA 4EXTA 1W09A 3SFEA 3ZCIA 1SE7A 4A56A 3C51A 2V7LA 4LMLA 3P4WA 2V1DB 5HXCA 2JRKA 2W66A 4U3CA 3V5UA 3ZC1A 3FXEB 4CI2B 4PNIA 2BBHA 3MA9A 2KWHA 5IYZE 1OEDE 3ZYLA 3WAKA 4DR7T 3FBZA 3AEEA 4AKIA 1KK7A 5HXHA 5AQIB 1FJGT 1Z0PA 2XAHB 3JAFA 2KNDA 3KINB 2CPTA 3P4PA 4EGWA 1KNRA 4B3ST 3PUWF 3GA8A 3EABA 4JI7T 2BKNA 3RF1A 3AEBA 1BR2A 2CWOA 1MMNA 4YSZA 1CUNA 5LJNA 4JEHB 1D1CA 3AE8A 5IWAT 5ABFB 1KNPA 1HNZT 3EDVA 2H7OA 2X9WA 2KZ7B 3H3MA 3LDQB 4WZXA 4TNVA 5HCJA 2D0UA 3UU4A 3RC3A 4A97A 2BG9C 2H3RA 3UUXB 3LK42 2CA5A 2EHOA 2NR4A 4YTNA 3T1YT 5FNVE 3RLFF 2V7IA 5FP3A 2WU2A 5LGNB 5KXJA 3OKQA 2XY8B 1FIOA 5JVDE 2XQ9A 2KXPB 4WYVA 4UXNB 2XQYA 4GIWA 1MIWA 3ZMZB 3S4UA 1HX8A 2C5KT 5LMUT 2CXDA 4EOZB 4TWHA 2NOXA 3FZLB 3AEAA 2KT9A 3AE2A 3ZMUB 4AISA 3ETVA 5LG4A 5L3FB 5ETWA 4HWCA 2HN1A 4AI6A 2CHNA 5LXTE 3Q5EA 2Q9QB 3OJAA 3WI3A 2D0TA 4CQIA 5JDFA 3A5XA 2KWIB 2HHHT 3AE3A 3AA7B 2WBLA 2W61A 2H7VC 4ZI3D 2XTLA 3PDYA 4ZEYA 4WW0A 1J5ET 3R84B 2FUPA 3UU6A 3T8OA 4YT0A 2IMLA 4CXXA 2R6GF 2WM9A 4GKJT 4MALA 4JI5T 1Y01A 3NKZA 4HWIB 1KEYA 4Z90A 4PAGA 5AQRB 5CJ5A 3IEEA 3QC9A 4HTEA 1IJ6A 5JDLA 3JADA 2XAGB 3KBTA 4DR4T
chains in the Genus database with same CATH topology
3RYIE 4MFRA 3ESLA 1NAFA 3AA1B 3OYZA 3HKCE 4PJNA 2LOSA 2JMKA 4PK6A 3O1HA 1VRBA 3O9XA 2P9BA 4IE4A 5LJMA 1HF8A 1O3XA 3AA0B 4DBQA 1NWMX 3C64A 3NBXX 1HFAA 3HI2A 3AVSA 2W63A 4E7ZA 4GYSA 2N9DA 2VASA 1YW0A 5E0OA 3N2GE 2Y6XA 5LA6E 4O4HE 3R6NA 2N1GA 5LP6E 4EIWA 2VKJA 1YKEB 3CQCB 3CQXC 4H9OC 3L09A 3I9WA 1D0ZA 4EYUA 1T98A 5FXXA 4QWNB 3IBPA 3MACA 2MBGA 5DABA 3RX6A 1BR0A 2PJQA 2CCQA 2QGSA 4TV9E 1OXZA 1QUUA 3RH3A 3GWHA 2YEVC 2W62A 4OFZA 2CE7A 3WAJA 5L3BB 2E9XA 2DWKA 2UXXB 3P7IA 3GN5B 5LCYA 4EB6E 4GK0E 2K9AA 4OYJA 5JQGE 3LJCA 2JQQA 4WNKA 4OYKA 2DWGA 3IF8B 3LBXB 5DQVA 5FXZA 2M67A 1MIVA 3N5LA 1ZEEA 4X1YE 4ZI2D 4H9RC 2LSKA 3C98B 2MYSA 2I59A 2IAKA 4DNDA 5EK2A 1G8XA 3SOLA 4HEAA 3N9LA 4GOUA 3ANWA 4O8SA 4AQFC 3AA6B 3DJBA 1MNEA 4HFVA 5DQWA 3EVYA 3Q5XA 4EZ4A 4CXYA 3VKHA 2OA5A 2VKOA 1SHZC 5L2LA 3O1IA 4H9QC 2JJ9A 2RP4A 4WBNE 5EZYE 3H3AA 3JC6C 2NW7A 4DMWA 1Y64B 4L5GA 3FHNA 4EYYR 2KMFA 3LG7A 3ZN0B 2YU1A 2XAJB 3C4WA 3PUAA 4P09A 4CXWA 5FMNA 2ODUA 2SPCA 4Z8XA 2CEAA 3L3PA 4QXCB 2BVLA 5F8PA 2NP9A 4C90A 1ZKEA 2YK0A 2N2NA 4UIGA 4ISTA 5JDMA 2CLYB 4QX7B 3FXDB 4QX8B 2BZBA 2D5UA 2WMOA 3CX6B 3PUGA 3I9YA 1HS7A 3U3IA 2K48A 4TUYE 4EAHA 3CX7B 2NTXA 2G0UA 2JMHA 2UXNB 3HR0A 1HCIA 2DNXA 2EHOC 2XUEA 2ZLYA 3B13A 5LYJE 2DHRA 3RRCA 3J9X1 4ZHQE 1WYBA 3RKOA 4QXHB 2X0LB 3Q9DA 4L9IA 5JRCB 1US7B 2IC6A 2ZM0A 1FMVA 2LOPA 3FBLA 2QA7A 4TV8E 2CMRA 3TKLB 4IIJE 4CZZB 5LBQB 3Q2MA 2LJLA 2XASB 3NZPA 1LVFA 3SS1A 1FMWA 5L3EB 2VKHA 2Q9QA 3BQIA 2V7KA 3I0OA 2A72A 4PJJA 4GK5E 2NW8A 3CMLA 1MMDA 5LNKA 3OYXA 2J1DG 3KFWX 4NUUA 4G2AA 5KDMC 2D2SA 4NUVA 1S35A 1V9DA 2JPFA 4H9SE 5H6RB 3UUNA 3ZYKA 4O2AE 5J2UE 2E9XC 4IGUA 4ZS2A 2ODVA 4IHJE 1YD8G 2EHOB 3K3NA 5DJQC 2HPJA 4UVCB 4BA9A 3B57A 3HKDE 1EZ3A 1U5PA 2PG8A 4UEMA 3HKBE 5J1GA 2YU2A 4ZI3C 5LHHB 1UX5A 3PU8A 2LM9A 4HKAA 3ZPOA 4I50E 5ADXL 2BVMA 3N9MA 3ZC0A 4I55E 3GMIA 2B1EA 3ZCJA 3ZYMA 4B6XA 4CI1B 5LHIB 2Q9QD 3CPZA 1ZHCA 3N9QA 1HTJF 2E8IA 5M4YA 4PFPA 1IAPA 2C0SA 1KNZA 2V7MA 5CB4E 3E0ZA 2MOZA 2NWBA 3D0TA 3N2OA 4OHFA 4UVBB 3IHRA 2LE8A 2V7JA 3K8PC 4TN7B 4KP3C 5JR9B 3RPUA 3SRZA 4H63H 4P0BA 4AKLA 3HA4A 3AAIA 5IHYA 2HH7A 1WRDA 1BR1A 3CX8B 4ISSA 4UELA 4JEUB 2LSIA 3C4XA 4ILUA 4WBOA 4YHJA 3AB3B 3J7Yq 2L8KA 2WWUA 4GYRA 4HN9A 1B7TA 3ZLIA 3N9PA 2RA1A 2W00A 3UUMA 4EXTA 3ZCIA 3BK9A 1S94A 5CA0E 4A56A 3C51A 2V7LA 5HAXA 1MMGA 3AAAB 4QKNA 4ZI7E 3RYFE 4XAXB 3OBVE 2ZM2A 4I43B 2V1DB 3HL6A 3W15B 5HXSA 5A1LA 3NRXA 5HXCA 3PUSA 2JRKA 5EK4A 2K24A 4X20E 4G63A 4J2CA 3LFMA 3MK7C 5LBMA 2HPLA 1ZV4X 4UF0B 3K3QC 3V5UA 3ZC1A 3FXEB 1MNDA 4HGAA 5L3CB 5AFUL 3ZJ2A 1VOMA 4CI2B 3GN5A 4ADZA 3E08A 4XBFB 4PNIA 2KINB 3PUQA 4IE0A 5LHGB 3MA9A 4DO0A 2KWHA 4X1IE 3LBXA 5IYZE 3F57A 3H37A 5LOVE 3HKEE 3ZYLA 3WAKA 1UCUA 4C91A 3N9OA 5HXEA 2LSGA 2XAQB 2WSSV 3FBZA 2GK9A 4AKIA 3LK3B 4JUYA 1QSDA 4ZI2C 1KK7A 4MHCA 4ERRA 5HXHA 2A3DA 4MLKA 4AKHA 1Z0PA 3ZEFB 2NW9A 2DLRA 4BJMA 4YJ2E 2CXLA 2XAHB 4H9PC 5KX5E 4KBMB 1HG5A 2KNDA 3FB2A 3N9NA 3CKDA 3EDUA 3KINB 4PW8A 4PFOA 4DVDA 3VKGA 3PU3A 4ASKA 3ZMSB 3EUHA 4IE5A 1MMAA 3LK2B 3C50A 4QXBB 3KV4A 1AJ3A 1BR4A 3GA8A 3QK6A 3MXZA 4K0UA 4IE7A 5FY0A 4QHOA 2X9HA 3PTRB 3UFEA 3I0QA 1BR2A 2CWOA 1MMNA 3MJXA 2VL8A 4AKRB 4XZCA 4F6RC 5HYAA 1CUNA 2V26A 4YFSA 2NTYA 2W0GA 5LJNA 4FI5A 4I4TE 4JEHB 1D1BA 4DBRA 5CA1E 5FYMA 2L9QA 1G73A 2L3LA 1D1CA 4E7SA 1LRZA 5JRCA 3EDVA 2X9YA 2H7OA 2Y8DA 1LVKA 4V1Av 1UX4A 5JREA 2X9WA 2KZ7B 2C5JA 3KDSE 4PK5A 1YKHB 1IZNB 4KUMB 2DI4A 2D0UA 3ZMTB 1U4QA 3V5SA 3U78A 1WYCA 2LHRA 1X79A 5TAOA 3ZJ1A 2E9XB 3VHLA 1HG2A 3RC3A 3BQLA 5H6QB 2H3RA 1H7CA 3UUXB 3LK42 2K5BB 2DCFA 1WLXA 1D0YA 2CA5A 2EHOA 4EZHA 4X1KE 4HE8A 4UV9B 5FNVE 4U74A 1IJ5A 3ANWB 2X67A 2Y48B 5JH7E 2V7IA 3JC6D 1FEWA 3NRYA 5F3JA 4AXPA 5HWXA 2WAUA 5FP3A 4O4LE 4U72A 3RRWA 5LGNB 1D1AA 3OKQA 4MBQA 2XAFB 1FIOA 5HXRA 5JVDE 3MZKB 3O1JA 3UULA 2VK9A 2ZMAA 2KXPB 4UVAB 2Q9QC 1SA0E 4UXNB 3BQKA 2LT3A 2XQYA 4GIWA 2PBIA 3I1AA 1MIWA 2EHOD 2Z6EA 2CXFA 3MKDA 3S4UA 3SWHA 1HX8A 4KMCA 3ZMZB 5KMGP 2C5KT 5JDNA 5JR9A 2BDEA 2CXDA 4YLHA 4DMVA 2MTQA 3RC8A 4EOZB 4H9NC 2YINA 4L0RA 3PURA 2CLYC 2KLQA 3M65A 3KBUA 2VWAA 2NOXA 2VB6A 1WR6A 3AVRA 4O4IE 4UV8B 2X66A 2KT9A 3DP7A 3ZMUB 3CQGB 3KVBA 3RYHE 2LEHA 3AAEB 5JDQA 3ETVA 5LG4A 5GONE 5L3FB 3KVAA 5ETWA 4PJMA 3VU7H 4TX5A 4P0AA 4AI6A 4ZS3A 5LXTE 5FXWA 3ZN1B 1OWAA 3PE0A 3NZQA 5JDHA 5LGTB 4IDZA 2Q9QB 3OJAA 2E9XD 2LSYA 3ONXA 3UT5E 4OK0A 4BAYB 2X51A 4JLEA 3WI3A 5JDGA 3O4XE 2D0TA 4AQGA 4CQIA 2X68A 2XHEB 5JDFA 5BMVE 4AKGA 5EK3A 3A5XA 3KV6A 2KWIB 2IW5B 2C5IT 2WMNA 4IE6A 3AA7B 2WBLA 2W61A 2H7VC 4CI3B 4ZI3D 2CM0A 2XTLA 3ETUA 2PFVA 3PDYA 5HWYA 5J2TE 4FJOA 2LSJA 4H63V 4WW0A 4O2BE 3R84B 4UF0A 3T8OA 5LGUB 4N78D 3F31A 4O4JE 4PJLA 4YJ3E 3QUJA 4CXXA 4ZOLE 2WM9A 3UTKA 2VKDA 3E22E 2CWYA 2ZM8A 4MALA 2ES0A 3RYCE 3Q5WA 1E1HB 3DTOA 1MIYA 3F2EA 2ACXA 5FXVA 4AQFA 3N2KE 2LHNA 2A2FX 1LKXA 4TZ4C 4PAGA 3P8CD 3ZMVB 5L3GB 3KV9A 2X9XA 5L3DB 4PK4A 3IEEA 3KV5A 5FY7A 3C4ZA 3QC9A 4HTEA 4ANJA 1IJ6A 2IC9A 3CWZB 5FY1A 5JDLA 4BJNA 3K3OA 2XAGB 4M1PA 1D0XA 3KBTA 5JR9C 5C8YE 3CVRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KND A;  2Y6X A;  2KMF A; 
#chains in the Genus database with same CATH topology
 4LF7 T;  4HFB A;  4ILC A;  3HKC E;  2JMK A;  3O9X A;  1WCR A;  4X5T A;  2E5L T;  3NBX X;  2W63 A;  4E7Z A;  2VAS A;  5E0O A;  2N1G A;  3CQC B;  5AQJ B;  5ABF A;  1GQE A;  4IRE A;  1T98 A;  5DAB A;  3NVO A;  2PJQ A;  2B76 A;  4UR9 A;  3WAJ A;  2DWK A;  4GK0 E;  2K9A A;  4OYJ A;  5JQG E;  5ABG A;  1HR0 T;  3T1H T;  5AQV B;  2DWG A;  5DQV A;  3AEC A;  2M67 A;  4X1Y E;  4ZI2 D;  3UFG A;  1E7P A;  4H9R C;  3RIF A;  3M3Z B;  2FBW A;  2MYS A;  2IAK A;  1G8X A;  4HEA A;  2WWV A;  4DR1 T;  4O8S A;  2V8S V;  4AQF C;  3AA6 B;  4HFV A;  3Q5X A;  4U2Y A;  3TLW A;  4OX9 T;  3LSV A;  3VKH A;  2M6B A;  5L2L A;  3RIU C;  4H9Q C;  2JJ9 A;  5EZY E;  1CHU A;  3FHN A;  2KMF A;  3UQ7 A;  3PUA A;  2XZE A;  4CXW A;  2ODU A;  2SPC A;  2CEA A;  2J4G A;  2BVL A;  2YK0 A;  4IST A;  5JDM A;  2CLY B;  3CX6 B;  4YHH T;  5HEO A;  4IL4 A;  2NTX A;  2VUR A;  2ZLY A;  2DHR A;  4ZHQ E;  3J9X 1;  2E2A A;  5HEU A;  2X0L B;  5JRC B;  1US7 B;  3UU3 A;  3FBL A;  2QA7 A;  3A8Y C;  4TV8 E;  2XQ4 A;  2DL1 A;  4DV3 T;  3K1S A;  3NZP A;  1LVF A;  3SS1 A;  1UUS A;  5L3E B;  2Q9Q A;  1M62 A;  3OYX A;  3KFW X;  2D2S A;  2XPK A;  2JPF A;  2ODV A;  4IHJ E;  4DR2 T;  5DJQ C;  3B5M A;  4QH1 A;  4JI4 T;  4ZI3 C;  1UX5 A;  3PU8 A;  5J0Z A;  4LF5 T;  4HKA A;  3ZC0 A;  4LMK A;  3ZCJ A;  3ZYM A;  5LHI B;  1XDP A;  2M6I A;  1KNZ A;  3P4R A;  2MOZ A;  2W4X A;  4OHF A;  4TN7 B;  4KP3 C;  5JR9 B;  3RPU A;  3SRZ A;  2QYW A;  4H63 H;  3HA4 A;  4UEL A;  3J7Y q;  2WWU A;  4U2Z A;  4YXD A;  4KX6 A;  3AAA B;  4ZI7 E;  5L4H A;  3NRX A;  4JI8 T;  4G63 A;  3RHW A;  3MK7 C;  4NPP A;  1XNQ T;  1UGO A;  2JQ9 A;  1Z8U A;  5AQP B;  1MND A;  1VOM A;  4ADZ A;  4XBF B;  2IUB A;  3PUQ A;  2WZI A;  3HKE E;  4YY3 T;  3N9O A;  2LSG A;  2WSS V;  1OED C;  3LK3 B;  2J62 A;  4ZI2 C;  4HFD A;  3P4Q A;  1VCS A;  4X62 T;  3ZEF B;  2DLR A;  5KX5 E;  3CKD A;  4AQY T;  3PU3 A;  3ZMS B;  2UXB T;  1J1J A;  4F6R C;  2VL8 A;  2V26 A;  4YFS A;  4FI5 A;  4I4T E;  5FYM A;  2L9Q A;  4JI2 T;  4E7S A;  4B3M T;  3RQW A;  5JRC A;  1LVK A;  4PK5 A;  2F4V T;  4LF9 T;  2CBI A;  3V5S A;  1WYC A;  3ZJ1 A;  2E9X B;  2VQF T;  3VHL A;  1HG2 A;  4Z91 A;  2BS2 A;  3A7M A;  4UV9 B;  4U74 A;  3ANW B;  3ZST A;  1FEW A;  3NRY A;  3PV0 F;  2WAU A;  2V6Y B;  4O4L E;  1WFD A;  4MBQ A;  1YXR A;  2XAF B;  2BS4 A;  3O1J A;  3UUL A;  2ZMA A;  4LF6 T;  3BQK A;  2LT3 A;  2IDO B;  5JDN A;  5JR9 A;  5HEJ A;  4DMV A;  2YIN A;  4L0R A;  2KLQ A;  1X9B A;  2VWA A;  1WR6 A;  4O4I E;  2X66 A;  3ZT7 A;  4ZZC A;  1I94 T;  2LEH A;  5GON E;  4PJM A;  3VU7 H;  4TX5 A;  3PE0 A;  5ABE A;  4YTM A;  4BAY B;  3ONX A;  2WZH A;  4ZXL A;  4AQG A;  2IW5 B;  2MPK A;  4DR3 T;  5AQG B;  1YQ4 A;  4JI0 T;  4CI3 B;  2CM0 A;  4FJO A;  2LSJ A;  2LRL A;  4O4J E;  4YJ3 E;  3QUJ A;  2CWY A;  2ES0 A;  2I6H A;  3DTO A;  2E5V A;  3N2K E;  2LHN A;  3VRB A;  1LKX A;  4TZ4 C;  3QOF A;  3ZMV B;  3EI0 A;  5LMN T;  3KV9 A;  2X9X A;  5L3D B;  4PK4 A;  4X64 T;  1IBK T;  3VR9 A;  2XQA A;  3K3O A;  1QLB A;  4F8H A;  4IT4 A;  4A98 A;  1NAF A;  3AA1 B;  4PK6 A;  4DR5 T;  1O3X A;  3PUV F;  3HI2 A;  3CK6 A;  1YW0 A;  3N2G E;  5LA6 E;  3R6N A;  5LP6 E;  1XMQ T;  3ABV A;  3I9W A;  3IBP A;  3MAC A;  5L4E A;  1BR0 A;  3RX6 A;  4TV9 E;  4NXN T;  3GWH A;  2E9X A;  3P7I A;  5LCY A;  3GN5 B;  1L0V A;  4YSY A;  2JQQ A;  3IF8 B;  5FXZ A;  4DV4 T;  5FKY A;  5EK2 A;  5AQM B;  3EHZ A;  3ANW A;  1MNE A;  2X0H A;  3JAE A;  5AQF B;  2V6Y A;  2OA5 A;  1IBL T;  2VKO A;  3AE1 A;  4WBN E;  4DMW A;  2IIU A;  4EYY R;  3ZN0 B;  2XAJ B;  3C4W A;  4GKK T;  5FMN A;  3L3P A;  4QXC B;  5BR8 T;  1ZKE A;  3FXD B;  1XMO T;  2BZB A;  2D5U A;  2WMO A;  4EAH A;  3CX7 B;  2XUE A;  1WYB A;  2LKH A;  4L9I A;  2LOP A;  5FL0 A;  3AXJ B;  3ONJ A;  4CZZ B;  3Q2M A;  4KI0 F;  3I0O A;  2A72 A;  2NW8 A;  3CML A;  2J1D G;  5KDM C;  4NUU A;  4NUV A;  3UUN A;  4H9S E;  5AQN B;  4O2A E;  5J2U E;  4IGU A;  1YD8 G;  5CFB A;  4UVC B;  3HKD E;  4UEM A;  2XM1 A;  2BVM A;  2UXC T;  1NEK A;  4B6X A;  1ZHC A;  4K0K T;  2V7M A;  3E0Z A;  2HN2 A;  3D0T A;  3N2O A;  3IHR A;  2V7J A;  4P0B A;  5IHY A;  4ISS A;  2I0M A;  4JEU B;  3AEG A;  3NWI A;  1W0A A;  1B7T A;  3ZLI A;  5HAX A;  1MMG A;  4QKN A;  3RYF E;  4XAX B;  2MAW A;  4I43 B;  3W15 B;  5A1L A;  3PUS A;  4LF4 T;  2JIW A;  4KHZ F;  2K24 A;  4X20 E;  4J2C A;  4JI3 T;  2FJB A;  3LFM A;  5LBM A;  2HPL A;  1ZV4 X;  3ONL C;  3K3Q C;  4CN6 A;  4HGA A;  5L3C B;  3ZJ2 A;  4AIU A;  3IA3 A;  3AE9 A;  3GN5 A;  1IBM T;  2KIN B;  5LHG B;  4IE0 A;  2BS3 A;  4DO0 A;  4X1I E;  3H37 A;  5LOV E;  4A5X A;  4JUY A;  1QSD A;  3AE6 A;  4MHC A;  4ERR A;  4AKH A;  2LRK A;  1T8B A;  4BJM A;  4H9P C;  3AE7 A;  4KBM B;  1HG5 A;  3FB2 A;  2JQH A;  3EUH A;  3LK2 B;  4QXB B;  3KV4 A;  2V5D A;  2IHR 1;  5F5W A;  3QK6 A;  4K0U A;  3AE5 A;  5FY0 A;  4QHO A;  2XQ7 A;  3UFE A;  3I0Q A;  5HYA A;  3MJX A;  3TLU A;  2NTY A;  2W0G A;  1D1B A;  4DBR A;  2L3L A;  5AQK B;  3AXJ A;  4U33 A;  4V1A v;  1UX4 A;  5JRE A;  1YKH B;  4DV5 T;  2QRX A;  4KUM B;  3ZMT B;  3PUZ F;  2LHR A;  1X79 A;  2OV9 A;  3FZK B;  3BQL A;  2A9U A;  2XSB A;  5H6Q B;  1T72 A;  1H7C A;  2DCF A;  5AQS B;  1D0Y A;  4EED A;  4EZH A;  4X66 T;  1IJ5 A;  3ZT5 A;  2X67 A;  2Y48 B;  4AXP A;  4P1N A;  4U72 A;  3RRW A;  1D1A A;  5HXR A;  3MZK B;  1JNR A;  3QNU A;  5FVL A;  4U7I A;  2PBI A;  4DV7 T;  2EHO D;  2Z6E A;  2CXF A;  5KMG P;  1DU2 A;  5AQO B;  4YLH A;  2MTQ A;  1N34 T;  2CLY C;  4QH4 A;  3X1D A;  3KBU A;  1N33 T;  2VB6 A;  3AVR A;  1ZP0 A;  2WP9 A;  2K3W A;  4HWD A;  3RYH E;  3AAE B;  2FJD A;  4ZS3 A;  5FXW A;  1OWA A;  5JDH A;  2E9X D;  2LSY A;  4OK0 A;  2X51 A;  1UUR A;  2YKS A;  3O4X E;  5BMV E;  4QH5 A;  5EK3 A;  3KV6 A;  2XJ7 A;  4IE6 A;  4IDN A;  2WDV A;  5CGM A;  3ETU A;  3RGL A;  2XSA A;  5LGU B;  4N78 D;  4PJL A;  4ZOL E;  3UTK A;  2VKD A;  3E22 E;  3RYC E;  3UQ4 A;  5C2T A;  2XQ6 A;  4TWF A;  3F2E A;  2A2F X;  2VL0 A;  3P8C D;  1E2A A;  2ZM6 T;  3C4Z A;  1VCT A;  2IC9 A;  5FY1 A;  4BJN A;  4M1P A;  3QB5 A;  1D0X A;  5JR9 C;  4LFA T;  3CVR A;  4MFR A;  3ESL A;  4PJN A;  2LOS A;  1VRB A;  4DUZ T;  5FVK A;  5LJM A;  2KSR A;  3Q5D A;  1NWM X;  1W9R A;  3C64 A;  1HFA A;  3AVS A;  1I6Z A;  2Y6X A;  5IUX A;  2VKJ A;  4H9O C;  3CQX C;  3L09 A;  1UK5 A;  1D0Z A;  4EYU A;  5LG3 A;  3QB5 K;  2QGS A;  2BG9 B;  3RH3 A;  2W62 A;  4OFZ A;  2CE7 A;  5L3B B;  2UXX B;  4EB6 E;  2XQ5 A;  2YDR A;  3LJC A;  4WNK A;  4YSX A;  3LBX B;  2LSK A;  2FJE A;  2I59 A;  4DND A;  3N9L A;  5AQQ B;  5DQW A;  3EVY A;  2ACZ A;  4EZ4 A;  4DV1 T;  3TLT A;  1SHZ C;  1N36 T;  3O1I A;  2RP4 A;  3H3A A;  2NW7 A;  3AED A;  4HFE A;  4L5G A;  3RI5 A;  3LG7 A;  2V6X A;  2YU1 A;  4P09 A;  4Z8X A;  4C90 A;  2NP9 A;  2N2N A;  4QX7 B;  4QX8 B;  1J5W A;  3PUG A;  3I9Y A;  1HS7 A;  4I0U A;  2K48 A;  4ILB A;  2UXN B;  2JMH A;  3HR0 A;  2DNX A;  2EHO C;  5LYJ E;  3RRC A;  3RKO A;  3Q9D A;  2UUA T;  2CMR A;  3TKL B;  3VR8 A;  4IIJ E;  3FZF B;  5LBQ B;  2BBJ A;  2LJL A;  2XAS B;  1FMW A;  3BQI A;  2V7K A;  4TWD A;  4GK5 E;  5LNK A;  1XWM A;  4LMJ A;  1S35 A;  3ZT6 A;  3ZYK A;  1T7S A;  2E9X C;  4ZS2 A;  3OTO T;  3K3N A;  2HPJ A;  3OVU A;  1EZ3 A;  1U5P A;  4COF A;  2XQ3 A;  5J1G A;  2LM9 A;  5HEG A;  3ZPO A;  3OPC A;  4I50 E;  5ADX L;  3GMI A;  1M7K A;  4CI1 B;  4JI1 T;  2Q9Q D;  3CPZ A;  4YTP A;  3N9Q A;  1HTJ F;  1IAP A;  4LF8 T;  2LKG A;  2C0S A;  5CB4 E;  4NXM T;  3P50 A;  2LE8 A;  3K8P C;  4NIQ A;  1XNR T;  5L47 A;  1BR1 A;  3CX8 B;  4WBO A;  2L8K A;  4GYR A;  1KFY A;  4HN9 A;  2BKP A;  3N9P A;  1YQ3 A;  3JCF A;  3PJA J;  3BK9 A;  1S94 A;  3PUY F;  2WU5 A;  5CA0 E;  3ZSS A;  4U7Y A;  3OBV E;  4B3R T;  2ZM2 A;  3HL6 A;  5HXS A;  5AQT B;  3RIA A;  5EK4 A;  1HX1 B;  3ZKR A;  3UU8 A;  4JI6 T;  4UF0 B;  5AFU L;  2BG9 A;  1N32 T;  2V5C A;  5JTG A;  4U31 A;  3E08 A;  4HFI A;  3LBX A;  3F57 A;  4IDO A;  1UCU A;  4C91 A;  5HXE A;  2XAQ B;  2GK9 A;  2W2U A;  2A3D A;  4MLK A;  2NW9 A;  4YJ2 E;  2X0Y A;  2CXL A;  4PW8 A;  3N9N A;  4DVD A;  3EDU A;  4PFO A;  3VKG A;  4ASK A;  4IE5 A;  1MMA A;  3C50 A;  1AJ3 A;  5HEH A;  1BR4 A;  2WDR A;  3MXZ A;  2VVS A;  5AQL B;  4B3T T;  4IE7 A;  2X9H A;  3PTR B;  4AKR B;  2VQE T;  4XZC A;  2AXD S;  5CA1 E;  1G73 A;  4DV2 T;  3AEF A;  1LRZ A;  2YDQ A;  1HNX T;  2X9Y A;  2Y8D A;  2C5J A;  1ZOY A;  3KDS E;  4LFC T;  1IZN B;  4EEB A;  2DI4 A;  2BG9 E;  1U4Q A;  3U78 A;  5TAO A;  2WB5 A;  2K5B B;  1WLX A;  5HCM A;  4X1K E;  4IDP A;  4HE8 A;  4DR6 T;  1XZY A;  5JH7 E;  3JC6 D;  5F3J A;  5HWX A;  4ILA A;  2LLY A;  2VK9 A;  4UVA B;  3AE4 A;  5C3J A;  2Q9Q C;  1SA0 E;  4CN4 A;  1R8I A;  3I1A A;  3SWH A;  3MKD A;  4JBW F;  4KMC A;  2BDE A;  3RC8 A;  4H9N C;  5AQU B;  3PUR A;  3FZM B;  3M65 A;  4UV8 B;  2BKO A;  3DP7 A;  3CQG B;  3KVB A;  2AE9 A;  3RQU A;  2PTF A;  5JDQ A;  3KVA A;  4P0A A;  1JNZ A;  3ZN1 B;  2YN6 A;  3NZQ A;  5LGT B;  4DID B;  4IDZ A;  3UT5 E;  4IL9 A;  4JLE A;  5JDG A;  2X68 A;  2XHE B;  4AKG A;  2C5I T;  2WMN A;  2H88 A;  1KF6 A;  2YOE A;  2XM2 A;  4DV0 T;  2PFV A;  5HWY A;  5J2T E;  4H63 V;  4O2B E;  4X65 T;  4UF0 A;  3EAM A;  3F31 A;  4KHP T;  3FZH B;  2ZM8 A;  1W0B A;  3Q5W A;  1E1H B;  1MIY A;  2ACX A;  5FXV A;  1OED B;  3L39 A;  3SFD A;  4AQF A;  2JQK A;  5L3G B;  3KV5 A;  5FY7 A;  3RIU A;  4ANJ A;  2UU9 T;  3CWZ B;  5FL1 A;  5C8Y E;  3RYI E;  3OYZ A;  5LB7 B;  3O1H A;  2P9B A;  4IE4 A;  1WR0 A;  1HF8 A;  3AA0 B;  4DBQ A;  4HWF A;  2XQ8 A;  3UUB A;  2CRB A;  2W67 A;  4GYS A;  2N9D A;  4O4H E;  4EIW A;  1YKE B;  4HFH A;  2H89 A;  1XDO A;  4DV6 T;  5FXX A;  4QWN B;  2MBG A;  3PJA A;  2WDQ A;  2CCQ A;  2CBJ A;  2D9D A;  3G06 A;  1OXZ A;  1QUU A;  2YEV C;  4OYK A;  1MIV A;  3L8R A;  1ZEE A;  3N5L A;  3VRA A;  3C98 B;  3TLS A;  3SOL A;  2J47 A;  4GOU A;  3DJB A;  2CHO A;  4CXY A;  2UUC T;  4Q25 A;  3JC6 C;  2WCA A;  1Y64 B;  4LFB T;  3CIR A;  5F8P A;  2VVN A;  4UIG A;  4ZZB A;  4JYA T;  3U3I A;  4TUY E;  2G0U A;  1HCI A;  3B13 A;  2OLT A;  4TNW A;  4QXH B;  5AQH B;  2IC6 A;  2ZM0 A;  1FMV A;  4CN1 A;  3TLV A;  2VKH A;  4PJJ A;  3PUX F;  1MMD A;  2LM2 A;  2WY2 A;  2YDS A;  4G2A A;  5ABH A;  4JV5 T;  1V9D A;  5H6R B;  1SUM B;  2UUB T;  2EHO B;  4BA9 A;  3B57 A;  4DUY T;  2PG8 A;  4IDQ A;  3HKB E;  2WQY A;  2WS3 A;  2YU2 A;  5LHH B;  3RKG A;  3N9M A;  2RPA A;  4I55 E;  2B1E A;  1NEN A;  4HWH A;  2E8I A;  5M4Y A;  4PFP A;  1OED A;  2UXD T;  2NWB A;  2QVA A;  2FJA A;  4UVB B;  1HNW T;  4AKL A;  3P4S A;  4EV6 A;  3AAI A;  2HH7 A;  1WRD A;  2LSI A;  3C4X A;  4ILU A;  4YHJ A;  3AB3 B;  4HFC A;  2RA1 A;  2W00 A;  3UU5 A;  3UUM A;  4EXT A;  1W09 A;  3SFE A;  3ZCI A;  1SE7 A;  4A56 A;  3C51 A;  2V7L A;  4LML A;  3P4W A;  2V1D B;  5HXC A;  2JRK A;  2W66 A;  4U3C A;  3V5U A;  3ZC1 A;  3FXE B;  4CI2 B;  4PNI A;  2BBH A;  3MA9 A;  2KWH A;  5IYZ E;  1OED E;  3ZYL A;  3WAK A;  4DR7 T;  3FBZ A;  3AEE A;  4AKI A;  1KK7 A;  5HXH A;  5AQI B;  1FJG T;  1Z0P A;  2XAH B;  3JAF A;  2KND A;  3KIN B;  2CPT A;  3P4P A;  4EGW A;  1KNR A;  4B3S T;  3PUW F;  3GA8 A;  3EAB A;  4JI7 T;  2BKN A;  3RF1 A;  3AEB A;  1BR2 A;  2CWO A;  1MMN A;  4YSZ A;  1CUN A;  5LJN A;  4JEH B;  1D1C A;  3AE8 A;  5IWA T;  5ABF B;  1KNP A;  1HNZ T;  3EDV A;  2H7O A;  2X9W A;  2KZ7 B;  3H3M A;  3LDQ B;  4WZX A;  4TNV A;  5HCJ A;  2D0U A;  3UU4 A;  3RC3 A;  4A97 A;  2BG9 C;  2H3R A;  3UUX B;  3LK4 2;  2CA5 A;  2EHO A;  2NR4 A;  4YTN A;  3T1Y T;  5FNV E;  3RLF F;  2V7I A;  5FP3 A;  2WU2 A;  5LGN B;  5KXJ A;  3OKQ A;  2XY8 B;  1FIO A;  5JVD E;  2XQ9 A;  2KXP B;  4WYV A;  4UXN B;  2XQY A;  4GIW A;  1MIW A;  3ZMZ B;  3S4U A;  1HX8 A;  2C5K T;  5LMU T;  2CXD A;  4EOZ B;  4TWH A;  2NOX A;  3FZL B;  3AEA A;  2KT9 A;  3AE2 A;  3ZMU B;  4AIS A;  3ETV A;  5LG4 A;  5L3F B;  5ETW A;  4HWC A;  2HN1 A;  4AI6 A;  2CHN A;  5LXT E;  3Q5E A;  2Q9Q B;  3OJA A;  3WI3 A;  2D0T A;  4CQI A;  5JDF A;  3A5X A;  2KWI B;  2HHH T;  3AE3 A;  3AA7 B;  2WBL A;  2W61 A;  2H7V C;  4ZI3 D;  2XTL A;  3PDY A;  4ZEY A;  4WW0 A;  1J5E T;  3R84 B;  2FUP A;  3UU6 A;  3T8O A;  4YT0 A;  2IML A;  4CXX A;  2R6G F;  2WM9 A;  4GKJ T;  4MAL A;  4JI5 T;  1Y01 A;  3NKZ A;  4HWI B;  1KEY A;  4Z90 A;  4PAG A;  5AQR B;  5CJ5 A;  3IEE A;  3QC9 A;  4HTE A;  1IJ6 A;  5JDL A;  3JAD A;  2XAG B;  3KBT A;  4DR4 T; 
#chains in the Genus database with same CATH homology
 3RYI E;  4MFR A;  3ESL A;  1NAF A;  3AA1 B;  3OYZ A;  3HKC E;  4PJN A;  2LOS A;  2JMK A;  4PK6 A;  3O1H A;  1VRB A;  3O9X A;  2P9B A;  4IE4 A;  5LJM A;  1HF8 A;  1O3X A;  3AA0 B;  4DBQ A;  1NWM X;  3C64 A;  3NBX X;  1HFA A;  3HI2 A;  3AVS A;  2W63 A;  4E7Z A;  4GYS A;  2N9D A;  2VAS A;  1YW0 A;  5E0O A;  3N2G E;  2Y6X A;  5LA6 E;  4O4H E;  3R6N A;  2N1G A;  5LP6 E;  4EIW A;  2VKJ A;  1YKE B;  3CQC B;  3CQX C;  4H9O C;  3L09 A;  3I9W A;  1D0Z A;  4EYU A;  1T98 A;  5FXX A;  4QWN B;  3IBP A;  3MAC A;  2MBG A;  5DAB A;  3RX6 A;  1BR0 A;  2PJQ A;  2CCQ A;  2QGS A;  4TV9 E;  1OXZ A;  1QUU A;  3RH3 A;  3GWH A;  2YEV C;  2W62 A;  4OFZ A;  2CE7 A;  3WAJ A;  5L3B B;  2E9X A;  2DWK A;  2UXX B;  3P7I A;  3GN5 B;  5LCY A;  4EB6 E;  4GK0 E;  2K9A A;  4OYJ A;  5JQG E;  3LJC A;  2JQQ A;  4WNK A;  4OYK A;  2DWG A;  3IF8 B;  3LBX B;  5DQV A;  5FXZ A;  2M67 A;  1MIV A;  3N5L A;  1ZEE A;  4X1Y E;  4ZI2 D;  4H9R C;  2LSK A;  3C98 B;  2MYS A;  2I59 A;  2IAK A;  4DND A;  5EK2 A;  1G8X A;  3SOL A;  4HEA A;  3N9L A;  4GOU A;  3ANW A;  4O8S A;  4AQF C;  3AA6 B;  3DJB A;  1MNE A;  4HFV A;  5DQW A;  3EVY A;  3Q5X A;  4EZ4 A;  4CXY A;  3VKH A;  2OA5 A;  2VKO A;  1SHZ C;  5L2L A;  3O1I A;  4H9Q C;  2JJ9 A;  2RP4 A;  4WBN E;  5EZY E;  3H3A A;  3JC6 C;  2NW7 A;  4DMW A;  1Y64 B;  4L5G A;  3FHN A;  4EYY R;  2KMF A;  3LG7 A;  3ZN0 B;  2YU1 A;  2XAJ B;  3C4W A;  3PUA A;  4P09 A;  4CXW A;  5FMN A;  2ODU A;  2SPC A;  4Z8X A;  2CEA A;  3L3P A;  4QXC B;  2BVL A;  5F8P A;  2NP9 A;  4C90 A;  1ZKE A;  2YK0 A;  2N2N A;  4UIG A;  4IST A;  5JDM A;  2CLY B;  4QX7 B;  3FXD B;  4QX8 B;  2BZB A;  2D5U A;  2WMO A;  3CX6 B;  3PUG A;  3I9Y A;  1HS7 A;  3U3I A;  2K48 A;  4TUY E;  4EAH A;  3CX7 B;  2NTX A;  2G0U A;  2JMH A;  2UXN B;  3HR0 A;  1HCI A;  2DNX A;  2EHO C;  2XUE A;  2ZLY A;  3B13 A;  5LYJ E;  2DHR A;  3RRC A;  3J9X 1;  4ZHQ E;  1WYB A;  3RKO A;  4QXH B;  2X0L B;  3Q9D A;  4L9I A;  5JRC B;  1US7 B;  2IC6 A;  2ZM0 A;  1FMV A;  2LOP A;  3FBL A;  2QA7 A;  4TV8 E;  2CMR A;  3TKL B;  4IIJ E;  4CZZ B;  5LBQ B;  3Q2M A;  2LJL A;  2XAS B;  3NZP A;  1LVF A;  3SS1 A;  1FMW A;  5L3E B;  2VKH A;  2Q9Q A;  3BQI A;  2V7K A;  3I0O A;  2A72 A;  4PJJ A;  4GK5 E;  2NW8 A;  3CML A;  1MMD A;  5LNK A;  3OYX A;  2J1D G;  3KFW X;  4NUU A;  4G2A A;  5KDM C;  2D2S A;  4NUV A;  1S35 A;  1V9D A;  2JPF A;  4H9S E;  5H6R B;  3UUN A;  3ZYK A;  4O2A E;  5J2U E;  2E9X C;  4IGU A;  4ZS2 A;  2ODV A;  4IHJ E;  1YD8 G;  2EHO B;  3K3N A;  5DJQ C;  2HPJ A;  4UVC B;  4BA9 A;  3B57 A;  3HKD E;  1EZ3 A;  1U5P A;  2PG8 A;  4UEM A;  3HKB E;  5J1G A;  2YU2 A;  4ZI3 C;  5LHH B;  1UX5 A;  3PU8 A;  2LM9 A;  4HKA A;  3ZPO A;  4I50 E;  5ADX L;  2BVM A;  3N9M A;  3ZC0 A;  4I55 E;  3GMI A;  2B1E A;  3ZCJ A;  3ZYM A;  4B6X A;  4CI1 B;  5LHI B;  2Q9Q D;  3CPZ A;  1ZHC A;  3N9Q A;  1HTJ F;  2E8I A;  5M4Y A;  4PFP A;  1IAP A;  2C0S A;  1KNZ A;  2V7M A;  5CB4 E;  3E0Z A;  2MOZ A;  2NWB A;  3D0T A;  3N2O A;  4OHF A;  4UVB B;  3IHR A;  2LE8 A;  2V7J A;  3K8P C;  4TN7 B;  4KP3 C;  5JR9 B;  3RPU A;  3SRZ A;  4H63 H;  4P0B A;  4AKL A;  3HA4 A;  3AAI A;  5IHY A;  2HH7 A;  1WRD A;  1BR1 A;  3CX8 B;  4ISS A;  4UEL A;  4JEU B;  2LSI A;  3C4X A;  4ILU A;  4WBO A;  4YHJ A;  3AB3 B;  3J7Y q;  2L8K A;  2WWU A;  4GYR A;  4HN9 A;  1B7T A;  3ZLI A;  3N9P A;  2RA1 A;  2W00 A;  3UUM A;  4EXT A;  3ZCI A;  3BK9 A;  1S94 A;  5CA0 E;  4A56 A;  3C51 A;  2V7L A;  5HAX A;  1MMG A;  3AAA B;  4QKN A;  4ZI7 E;  3RYF E;  4XAX B;  3OBV E;  2ZM2 A;  4I43 B;  2V1D B;  3HL6 A;  3W15 B;  5HXS A;  5A1L A;  3NRX A;  5HXC A;  3PUS A;  2JRK A;  5EK4 A;  2K24 A;  4X20 E;  4G63 A;  4J2C A;  3LFM A;  3MK7 C;  5LBM A;  2HPL A;  1ZV4 X;  4UF0 B;  3K3Q C;  3V5U A;  3ZC1 A;  3FXE B;  1MND A;  4HGA A;  5L3C B;  5AFU L;  3ZJ2 A;  1VOM A;  4CI2 B;  3GN5 A;  4ADZ A;  3E08 A;  4XBF B;  4PNI A;  2KIN B;  3PUQ A;  4IE0 A;  5LHG B;  3MA9 A;  4DO0 A;  2KWH A;  4X1I E;  3LBX A;  5IYZ E;  3F57 A;  3H37 A;  5LOV E;  3HKE E;  3ZYL A;  3WAK A;  1UCU A;  4C91 A;  3N9O A;  5HXE A;  2LSG A;  2XAQ B;  2WSS V;  3FBZ A;  2GK9 A;  4AKI A;  3LK3 B;  4JUY A;  1QSD A;  4ZI2 C;  1KK7 A;  4MHC A;  4ERR A;  5HXH A;  2A3D A;  4MLK A;  4AKH A;  1Z0P A;  3ZEF B;  2NW9 A;  2DLR A;  4BJM A;  4YJ2 E;  2CXL A;  2XAH B;  4H9P C;  5KX5 E;  4KBM B;  1HG5 A;  2KND A;  3FB2 A;  3N9N A;  3CKD A;  3EDU A;  3KIN B;  4PW8 A;  4PFO A;  4DVD A;  3VKG A;  3PU3 A;  4ASK A;  3ZMS B;  3EUH A;  4IE5 A;  1MMA A;  3LK2 B;  3C50 A;  4QXB B;  3KV4 A;  1AJ3 A;  1BR4 A;  3GA8 A;  3QK6 A;  3MXZ A;  4K0U A;  4IE7 A;  5FY0 A;  4QHO A;  2X9H A;  3PTR B;  3UFE A;  3I0Q A;  1BR2 A;  2CWO A;  1MMN A;  3MJX A;  2VL8 A;  4AKR B;  4XZC A;  4F6R C;  5HYA A;  1CUN A;  2V26 A;  4YFS A;  2NTY A;  2W0G A;  5LJN A;  4FI5 A;  4I4T E;  4JEH B;  1D1B A;  4DBR A;  5CA1 E;  5FYM A;  2L9Q A;  1G73 A;  2L3L A;  1D1C A;  4E7S A;  1LRZ A;  5JRC A;  3EDV A;  2X9Y A;  2H7O A;  2Y8D A;  1LVK A;  4V1A v;  1UX4 A;  5JRE A;  2X9W A;  2KZ7 B;  2C5J A;  3KDS E;  4PK5 A;  1YKH B;  1IZN B;  4KUM B;  2DI4 A;  2D0U A;  3ZMT B;  1U4Q A;  3V5S A;  3U78 A;  1WYC A;  2LHR A;  1X79 A;  5TAO A;  3ZJ1 A;  2E9X B;  3VHL A;  1HG2 A;  3RC3 A;  3BQL A;  5H6Q B;  2H3R A;  1H7C A;  3UUX B;  3LK4 2;  2K5B B;  2DCF A;  1WLX A;  1D0Y A;  2CA5 A;  2EHO A;  4EZH A;  4X1K E;  4HE8 A;  4UV9 B;  5FNV E;  4U74 A;  1IJ5 A;  3ANW B;  2X67 A;  2Y48 B;  5JH7 E;  2V7I A;  3JC6 D;  1FEW A;  3NRY A;  5F3J A;  4AXP A;  5HWX A;  2WAU A;  5FP3 A;  4O4L E;  4U72 A;  3RRW A;  5LGN B;  1D1A A;  3OKQ A;  4MBQ A;  2XAF B;  1FIO A;  5HXR A;  5JVD E;  3MZK B;  3O1J A;  3UUL A;  2VK9 A;  2ZMA A;  2KXP B;  4UVA B;  2Q9Q C;  1SA0 E;  4UXN B;  3BQK A;  2LT3 A;  2XQY A;  4GIW A;  2PBI A;  3I1A A;  1MIW A;  2EHO D;  2Z6E A;  2CXF A;  3MKD A;  3S4U A;  3SWH A;  1HX8 A;  4KMC A;  3ZMZ B;  5KMG P;  2C5K T;  5JDN A;  5JR9 A;  2BDE A;  2CXD A;  4YLH A;  4DMV A;  2MTQ A;  3RC8 A;  4EOZ B;  4H9N C;  2YIN A;  4L0R A;  3PUR A;  2CLY C;  2KLQ A;  3M65 A;  3KBU A;  2VWA A;  2NOX A;  2VB6 A;  1WR6 A;  3AVR A;  4O4I E;  4UV8 B;  2X66 A;  2KT9 A;  3DP7 A;  3ZMU B;  3CQG B;  3KVB A;  3RYH E;  2LEH A;  3AAE B;  5JDQ A;  3ETV A;  5LG4 A;  5GON E;  5L3F B;  3KVA A;  5ETW A;  4PJM A;  3VU7 H;  4TX5 A;  4P0A A;  4AI6 A;  4ZS3 A;  5LXT E;  5FXW A;  3ZN1 B;  1OWA A;  3PE0 A;  3NZQ A;  5JDH A;  5LGT B;  4IDZ A;  2Q9Q B;  3OJA A;  2E9X D;  2LSY A;  3ONX A;  3UT5 E;  4OK0 A;  4BAY B;  2X51 A;  4JLE A;  3WI3 A;  5JDG A;  3O4X E;  2D0T A;  4AQG A;  4CQI A;  2X68 A;  2XHE B;  5JDF A;  5BMV E;  4AKG A;  5EK3 A;  3A5X A;  3KV6 A;  2KWI B;  2IW5 B;  2C5I T;  2WMN A;  4IE6 A;  3AA7 B;  2WBL A;  2W61 A;  2H7V C;  4CI3 B;  4ZI3 D;  2CM0 A;  2XTL A;  3ETU A;  2PFV A;  3PDY A;  5HWY A;  5J2T E;  4FJO A;  2LSJ A;  4H63 V;  4WW0 A;  4O2B E;  3R84 B;  4UF0 A;  3T8O A;  5LGU B;  4N78 D;  3F31 A;  4O4J E;  4PJL A;  4YJ3 E;  3QUJ A;  4CXX A;  4ZOL E;  2WM9 A;  3UTK A;  2VKD A;  3E22 E;  2CWY A;  2ZM8 A;  4MAL A;  2ES0 A;  3RYC E;  3Q5W A;  1E1H B;  3DTO A;  1MIY A;  3F2E A;  2ACX A;  5FXV A;  4AQF A;  3N2K E;  2LHN A;  2A2F X;  1LKX A;  4TZ4 C;  4PAG A;  3P8C D;  3ZMV B;  5L3G B;  3KV9 A;  2X9X A;  5L3D B;  4PK4 A;  3IEE A;  3KV5 A;  5FY7 A;  3C4Z A;  3QC9 A;  4HTE A;  4ANJ A;  1IJ6 A;  2IC9 A;  3CWZ B;  5FY1 A;  5JDL A;  4BJN A;  3K3O A;  2XAG B;  4M1P A;  1D0X A;  3KBT A;  5JR9 C;  5C8Y E;  3CVR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...