2KNDA

Psb27 structure from synechocystis
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
110
structure length
110
Chain Sequence
CDSGTGLTGNYSQDTLTVIATLREAIDLPQDAPNRQEVQDTARGQINDYISRYRRKGDAGGLKSFTTMQTALNSLAGYYTSYGARPIPEKLKKRLQLEFTQAERSIERGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photosystem II 11 kDa protein
publication title Structure of Psb27 in solution: implications for transient binding to photosystem II during biogenesis and repair
pubmed doi rcsb
source organism Synechocystis sp.
molecule tags Photosynthesis
total genus 27
structure length 110
sequence length 110
ec nomenclature
pdb deposition date 2009-08-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.810 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2kndA00
2KNDA 2Y6XA 2KMFA
chains in the Genus database with same CATH superfamily
3NRXA 5H6QB 5KX5E 5LHGB 4DVDA 3PUSA 2V6YB 2I6HA 3A5XA 1R8IA 2DCFA 2KXPB 3A7MA 3FB2A 4IT4A 4HWFA 2VVNA 1G73A 4MLKA 2MBGA 4UR9A 2RA1A 2BVMA 4TZ4C 3AE9A 1BR2A 3TLSA 2D0TA 3ZSSA 3R6NA 2CHNA 3ONXA 4F6RC 2CA5A 1BR0A 2Q9QB 1O3XA 1MMNA 1MMAA 1UK5A 4J2CA 4O4IE 4CI2B 5ABFB 2BKOA 2HN1A 4PW8A 4XZCA 5AQJB 4YJ2E 4HWDA 5FNVE 3OYZA 4UELA 1D1BA 2VKHA 2C5IT 4O4HE 3AEBA 4O2BE 4FJOA 5JR9C 3PV0F 2XQ4A 3GN5A 4EOZB 2VKOA 4GK5E 4Z8XA 1MIWA 2EHOB 4AQGA 5DQWA 3U78A 5LG3A 4DV2T 1HNXT 4ZZBA 2FJEA 1Z8UA 4Z91A 2C5JA 2VKDA 4AKGA 3N9NA 3FZFB 2JJ9A 2MYSA 3LFMA 4QX8B 2LHRA 3J7Yq 4DR4T 2NTYA 2H3RA 4U7IA 3IBPA 4PK4A 4JI8T 1WR6A 1WYCA 4L0RA 2LHNA 3RRWA 2SPCA 5FYMA 2UUBT 2NW7A 3PU3A 3AAAB 3NKZA 2J62A 4X66T 2WWUA 2KMFA 5J2UE 5JDQA 5JTGA 1HX8A 4IHJE 2M6IA 2H89A 3O4XE 1XMOT 3SFEA 2QYWA 4KBMB 4ADZA 2XSAA 4GYSA 3UFGA 3AA1B 1MIYA 2K3WA 3OYXA 2CM0A 3WAKA 2VWAA 4QWNB 3CQXC 1YXRA 3PUVF 3C98B 2ZM8A 3H3AA 4HTEA 5L4EA 3JC6C 1OEDB 4P0BA 4GYRA 4IL4A 3HKBE 4WZXA 2Q9QC 4PJMA 3ZPOA 1JNZA 3AA7B 1M7KA 1LVFA 1YKHB 3RPUA 3EVYA 4MALA 3EUHA 3BQLA 4ILCA 5L4HA 2WAUA 3OTOT 3KVAA 3PU8A 3AB3B 3ZCIA 3CQGB 4U31A 1HNZT 4YSYA 3AE2A 1LKXA 2IAKA 5DABA 4NXMT 5JRCB 3ZMUB 2EHOC 2IW5B 2V6YA 4PFPA 4IE4A 2IC6A 5AQVB 4LF6T 2IHR1 3TLUA 2N1GA 5AQLB 4MHCA 2HPLA 3RI5A 5JDMA 4LF4T 4N78D 2YU2A 3CX7B 2VK9A 4X65T 5C2TA 1XDOA 4JI4T 2XQAA 3GWHA 3VKGA 4UV9B 4CZZB 5JDFA 2BZBA 2Q9QA 2IIUA 3Q5XA 5LOVE 3ZJ2A 2F4VT 2BG9E 5ABFA 1VRBA 3ZMTB 2ODUA 4PJLA 4U3CA 1Z0PA 1HCIA 4OX9T 5LA6E 3ZN0B 1HG5A 3JC6D 1ZOYA 5JDLA 2D5UA 3VRAA 2EHOA 5CA0E 5M4YA 3C4XA 3DJBA 2V6XA 5ABEA 4I0UA 3DP7A 4QX7B 1I94T 2W62A 2MPKA 5HXSA 2A72A 1MNEA 4B3RT 3ZYLA 1E1HB 3PUGA 2XQ9A 2NW9A 2BBHA 2X9WA 1OXZA 4HWHA 5JQGE 1US7B 4WW0A 3AA0B 5HEHA 2LSKA 2LKHA 3UT5E 4ZI2C 2FUPA 2K48A 2ODVA 1KF6A 1AJ3A 4I4TE 2N2NA 2VL0A 4QH4A 4DO0A 1N34T 3RYFE 3X1DA 3QUJA 1VCSA 4UVBB 2P9BA 4KMCA 5LHIB 4B6XA 4H9PC 2WDRA 1OEDC 1OWAA 3TLVA 2R6GF 2UXNB 4ILUA 2EHOD 3PURA 4EIWA 4DV6T 3LSVA 3DTOA 1MMDA 4L5GA 5ETWA 3N5LA 1KNRA 2HH7A 4KI0F 3ZC1A 2GK9A 3EDUA 2UUAT 3ONLC 4X20E 3A8YC 4UEMA 3HKEE 5LMUT 2V7JA 2A2FX 1FJGT 5HAXA 2PTFA 3HR0A 3B13A 3QB5K 4ILBA 1W0AA 3PUAA 4U7YA 4YXDA 3NBXX 1J5ET 3VR9A 4X5TA 3PUWF 4EEBA 5LBQB 4LF9T 2J1DG 3UULA 3WI3A 3ZT5A 5DJQC 2XJ7A 1FIOA 4YHHT 1HTJF 1X79A 3MKDA 3JCFA 1ZV4X 3NZPA 1OEDA 3ZYMA 2LSIA 2XAFB 5AQQB 5AQOB 5HCMA 1HS7A 2YOEA 4HFEA 1KNZA 2OV9A 3C64A 4LFAT 2WDVA 2WMNA 3CIRA 4U2ZA 4JI7T 3F2EA 1S35A 3N9PA 4ZI2D 2RPAA 5JH7E 1UURA 5C8YE 3ZT7A 4JI5T 4YLHA 2K9AA 3PJAJ 2CE7A 2QGSA 3BQIA 2OLTA 4EB6E 3RQWA 4A98A 4DV0T 5L47A 1W9RA 2D0UA 4XBFB 4G63A 4AQYT 4GIWA 2XAQB 2AXDS 2BS4A 4AISA 2YN6A 2V26A 2B76A 4JBWF 3JAEA 5HYAA 3U3IA 2A3DA 2N9DA 4X1KE 2V5CA 2D9DA 4CQIA 1V9DA 1XNQT 3PUXF 2MAWA 3RYIE 4EXTA 5EK4A 3V5SA 1ZHCA 3HKDE 3C51A 3UUNA 1JNRA 4U33A 4ZS3A 2JIWA 4H63V 5J1GA 3ZMVB 2VKJA 4LMKA 2WZHA 3UTKA 4A97A 4LF8T 2HN2A 2XUEA 3O1HA 4EAHA 1E2AA 5HEJA 4I43B 2V8SV 4JI3T 4PAGA 3VKHA 4IREA 5ABHA 4X1IE 5JVDE 5LJMA 2LRLA 3GMIA 4OHFA 4ZZCA 4BJMA 4DR3T 2LEHA 4HFIA 3IEEA 4O4JE 3FXDB 1BR4A 1KFYA 2CRBA 2WZIA 4TN7B 3UUMA 5IHYA 4E7ZA 2C5KT 3PUZF 4ASKA 5FXZA 2L9QA 3M65A 1FEWA 1D0XA 3CX8B 2KINB 4CN1A 4LFBT 5LP6E 1UCUA 3KINB 4DV7T 4QH5A 2CCQA 4HFDA 3O1IA 3AEEA 3N9QA 4YSXA 3AAIA 3CKDA 2WBLA 2B1EA 4ZS2A 5LNKA 5EK3A 1YW0A 2C0SA 4ISTA 5BMVE 4JI1T 5LXTE 2LSJA 2CEAA 3SOLA 3MA9A 3C50A 4AKLA 4AXPA 1WR0A 2HPJA 2X67A 4C91A 3O1JA 5JR9A 1WCRA 5L3EB 3UUXB 2XTLA 5F5WA 3QOFA 2KT9A 5CFBA 2YDSA 4PNIA 2V1DB 3I0QA 2ACXA 4JLEA 2WCAA 3HL6A 2KLQA 3R84B 5L3FB 2X9YA 2UXDT 4OK0A 3EHZA 1QUUA 2LRKA 3VRBA 4ILAA 2CMRA 3K3NA 4TNVA 2E2AA 4DV3T 3KV9A 3CVRA 4WNKA 2X68A 3T8OA 1FMWA 4TWHA 1UGOA 2DHRA 4YTPA 5FY1A 5AQTB 2IUBA 1YQ3A 2D2SA 4HFCA 5LCYA 3AE6A 2NWBA 4UIGA 3N9MA 4H63H 5AQFB 4F8HA 3TLTA 5AQGB 2ZLYA 5L3BB 3ZLIA 3I9WA 4H9SE 4LF5T 4NXNT 2RP4A 3AEFA 3ZYKA 1U4QA 2W63A 3BK9A 4B3TT 3ONJA 3AEAA 4AKIA 2BVLA 1WYBA 2X66A 2WWVA 3BQKA 3ETVA 2W0GA 1H7CA 3UQ4A 3E08A 4HWCA 1XZYA 2X0HA 4EYYR 5L3DB 1SE7A 3RIUC 3P4RA 5AQUB 1BR1A 3LK42 4DV4T 3O9XA 4JEHB 2YKSA 1E7PA 4M1PA 4EYUA 3C4ZA 3ZMSB 2NTXA 1VOMA 1NAFA 3UQ7A 2LKGA 4Q25A 2IDOB 3I1AA 5FL0A 5L2LA 3FZHB 5LMNT 5A1LA 4QXBB 3OVUA 3G06A 5HEGA 5LHHB 4EEDA 3B57A 2V7MA 2CXFA 2WM9A 2CLYB 2DWKA 2W66A 2XQ7A 5KDMC 2BDEA 3AXJB 2E8IA 4JV5T 4O2AE 4YY3T 5LB7B 4UVCB 4IGUA 4X62T 4TNWA 3P4SA 2W2UA 4COFA 2ACZA 5CA1E 4QH1A 4TUYE 3RYHE 3Q9DA 4MFRA 1M62A 3RC8A 2ZM0A 4P09A 1GQEA 1T98A 1QSDA 3RIUA 3LG7A 1QLBA 1ZP0A 4UV8B 5ADXL 1IBLT 1NWMX 2MOZA 2LLYA 5L3CB 5FXVA 5HWXA 1I6ZA 3RX6A 2J4GA 5JDGA 3UU5A 3LK3B 1XNRT 2LT3A 3OKQA 4Z90A 1LVKA 2Z6EA 1D1AA 3RIFA 2YDQA 4HFBA 3FHNA 2XPKA 2DWGA 4JYAT 1N32T 2K24A 3KV4A 2E5VA 1XMQT 2CPTA 2AE9A 4KP3C 4ZI7E 4X64T 3JADA 4IIJE 3RF1A 1IJ5A 4JI2T 3P8CD 2ZM6T 3KVBA 2NR4A 4WBNE 3SS1A 3AVSA 4I50E 3IA3A 3MJXA 4IE7A 3RHWA 2XAJB 4DR5T 3LK2B 3Q5DA 3FBZA 4DIDB 2W00A 4YFSA 2QRXA 3GA8A 3ZT6A 3NVOA 4PK6A 3N2OA 2BKPA 4JUYA 5JREA 5FVLA 2E9XD 2JPFA 1OEDE 2KNDA 2VQFT 2Y6XA 2VL8A 3VR8A 3UU6A 3KV6A 4IDQA 2XASB 2X9XA 1D0ZA 2NW8A 3NRYA 4NPPA 5LBMA 3B5MA 2QVAA 4DBQA 4DR7T 4NIQA 4ZOLE 4DR2T 3ZSTA 4EV6A 4QXCB 2J47A 4QXHB 4CXXA 2WP9A 3CQCB 5AQKB 3AE3A 4HGAA 3ZCJA 2CLYC 1J1JA 1ZEEA 2WU2A 4GKKT 3ZKRA 3MACA 3SRZA 4A5XA 4DV5T 4I55E 2V7IA 4K0UA 2DNXA 4U74A 2DLRA 3LDQB 3ANWB 3HKCE 4UVAB 2JQHA 1G8XA 3AE8A 2IMLA 1WLXA 3ZEFB 2H88A 5F8PA 5JRCA 2DI4A 1T7SA 4IE5A 4OYJA 1WRDA 3AEDA 2CHOA 2W67A 2CBJA 2LE8A 3VHLA 1D1CA 2LM2A 3UFEA 1U5PA 3IHRA 2V5DA 1XDPA 2WY2A 2YEVC 2WQYA 5LG4A 4IDOA 3AA6B 3P4WA 4WBOA 4TWDA 3L09A 4DR1T 5EZYE 2LSGA 1D0YA 3Q2MA 2MTQA 4KHZF 2KWIB 4IDZA 1T72A 1W0BA 5F3JA 3AE1A 4UF0B 3MXZA 1YKEB 2CWOA 4ZI3C 4K0KT 2UU9T 1VCTA 3RLFF 2CBIA 3KBUA 3UU8A 4KX6A 3AEGA 1WFDA 2PG8A 4B3ST 4B3MT 5HCJA 1NENA 2H7VC 3IF8B 5L3GB 1HNWT 4EZHA 3FZLB 4ISSA 3P7IA 2M67A 3PUQA 3KBTA 4LMJA 2VURA 3ETUA 3ZJ1A 2CXLA 5EK2A 2UXCT 2UUCT 3T1HT 3UU3A 1HG2A 3RGLA 1CHUA 2PFVA 3NWIA 5CB4E 3KV5A 2VASA 1SHZC 5BR8T 2LSYA 2YK0A 2FJAA 4EGWA 4X1YE 2PBIA 5DQVA 1MMGA 4QHOA 3UUBA 4DNDA 2W4XA 5LGNB 5AFUL 1DU2A 4C90A 4YTMA 5FXXA 3CMLA 3AE5A 1HX1B 2Y8DA 2BG9B 4OYKA 4JEUB 5HXCA 4P0AA 4HFVA 2ES0A 3CPZA 2E9XB 5LJNA 2M6BA 2KWHA 2XAHB 1YD8G 4OFZA 3N2GE 5FY0A 2OA5A 3AVRA 2Y48B 5LYJE 2LJLA 3JAFA 5ABGA 3KFWX 1NEKA 2VQET 2G0UA 2V7KA 4ZI3D 4O4LE 1W09A 2X0YA 4CI1B 5JDHA 2QA7A 1YQ4A 2WS3A 3K1SA 4H9OC 2HHHT 1HFAA 3Q5WA 4O8SA 2UXBT 4GOUA 5FKYA 4YSZA 3L8RA 3EABA 4KUMB 4E7SA 4CI3B 3W15B 4U72A 2PJQA 3QNUA 2I0MA 4AKRB 2X0LB 1S94A 3PDYA 4DR6T 2ZMAA 5FY7A 3WAJA 3HA4A 4H9QC 4A56A 4TV8E 5IYZE 4IL9A 3KDSE 2FJBA 4YTNA 2XM2A 3ANWA 4LMLA 5TAOA 4QKNA 1IBKT 3FZKB 4JI0T 4TV9E 4LF7T 1UX4A 3RYCE 1KK7A 5HXEA 4HE8A 1MIVA 2JRKA 3EAMA 3S4UA 4AQFC 2YINA 3SWHA 5H6RB 2KSRA 2LOSA 3MZKB 3NZQA 5FVKA 1MNDA 4G2AA 3RH3A 4LFCT 3OPCA 1UX5A 3H3MA 3MK7C 3ESLA 3K3OA 2IC9A 2LM9A 2WB5A 5J0ZA 1B7TA 4PJNA 3E22E 3QK6A 1IZNB 3P4QA 1HR0T 3ZN1B 1SUMB 4HN9A 4DMVA 1HF8A 3CX6B 2XM1A 2X9HA 4UF0A 3K3QC 3VU7H 3LBXB 3L3PA 3J9X1 2BS2A 2BG9C 5LGUB 4BJNA 3HI2A 4IDPA 2XQ5A 4XAXB 2L3LA 3RIAA 2FJDA 4L9IA 2E9XC 5FXWA 4CN6A 4PFOA 4AQFA 3N9OA 4NUVA 4DMWA 4ZEYA 4FI5A 5AQMB 3PTRB 4TX5A 1X9BA 3N9LA 4HWIB 5FMNA 2DL1A 4CN4A 5KXJA 2X51A 4HEAA 3D0TA 3ZC0A 2XQ6A 4NUUA 2LOPA 3FBLA 3AECA 1CUNA 3OBVE 5J2TE 4WYVA 1T8BA 5AQSB 4HKAA 2ZM2A 5AQHB 5AQRB 4MBQA 4BA9A 3TLWA 1EZ3A 5IUXA 2BG9A 2H7OA 2JMHA 3PJAA 3RQUA 2Q9QD 5HXRA 2FBWA 2XY8B 1Y64B 2E9XA 2BKNA 3LJCA 3N2KE 4ERRA 2YDRA 4JI6T 5HEUA 3V5UA 4U2YA 4AKHA 2VB6A 2CWYA 3CWZB 5E0OA 2WMOA 5CJ5A 3GN5B 3L39A 3F57A 4DBRA 2A9UA 3QC9A 3EI0A 3I9YA 4DUZT 4KHPT 1L0VA 1IAPA 2BBJA 3AE7A 4H9RC 3P50A 2VVSA 3I0OA 3AAEB 4AI6A 1Y01A 3FXEB 5FP3A 4ZHQE 4TWFA 2YU1A 3C4WA 2V7LA 1UUSA 4DUYT 4BAYB 3QB5A 5AQNB 1FMVA 4GK0E 3CK6A 5CGMA 5IWAT 3FZMB 4V1Av 5GONE 5HWYA 1KNPA 4IE6A 5KMGP 4IDNA 4P1NA 3PE0A 5HEOA 2K5BB 3EDVA 2XQ3A 3TKLB 4YT0A 2JQQA 2NP9A 1LRZA 5C3JA 2E5LT 1XWMA 3T1YT 5JR9B 5AQPB 4IE0A 2XQ8A 2XZEA 3RKOA 2W61A 3P4PA 2WDQA 2WSSV 4H9NC 3AE4A 3Q5EA 1N33T 4EZ4A 1ZKEA 3E0ZA 4ANJA 4AIUA 2CXDA 2NOXA 5FL1A 3SFDA 2WU5A 2JQ9A 4CXWA 1J5WA 4PJJA 3ABVA 3F31A 2L8KA 2KZ7B 1IJ6A 4YJ3E 5LGTB 3PUYF 3OJAA 4PK5A 3ZMZB 3LBXA 2JQKA 2XAGB 3M3ZB 2UXXB 4YHJA 3H37A 2XQYA 5AQIB 4UXNB 5HXHA 4HFHA 3K8PC 3RC3A 3UU4A 3RRCA 3RKGA 2JMKA 3AXJA 1KEYA 4GKJT 1SA0E 4DV1T 1N36T 4ZXLA 2BS3A 2XSBA 5JDNA 1IBMT 4CXYA 2XHEB 2I59A
chains in the Genus database with same CATH topology
3NRXA 4UEMA 5JDHA 3HKEE 2V7JA 2A2FX 2QA7A 5H6QB 5A1LA 5KX5E 5HAXA 4H9OC 4QXBB 5LHGB 4DVDA 3PUSA 5LHHB 1HFAA 3B57A 3Q5WA 3HR0A 2V7MA 3B13A 3A5XA 4O8SA 2CXFA 4GOUA 2WM9A 2CLYB 2DWKA 2DCFA 4KUMB 4E7SA 3PUAA 4CI3B 2KXPB 3FB2A 3NBXX 5KDMC 3W15B 2BDEA 4U72A 5LBQB 2E8IA 2J1DG 2PJQA 3UULA 4AKRB 2X0LB 4O2AE 1G73A 1S94A 3PDYA 4MLKA 2ZMAA 5FY7A 2MBGA 3WI3A 3WAJA 4UVCB 5DJQC 4IGUA 3HA4A 4H9QC 4A56A 1FIOA 4TV8E 5IYZE 2RA1A 1HTJF 2BVMA 4TZ4C 1BR2A 2D0TA 3R6NA 1X79A 3KDSE 3ONXA 4F6RC 2CA5A 3MKDA 5CA1E 1BR0A 2Q9QB 3ANWA 4TUYE 5TAOA 1ZV4X 4QKNA 3NZPA 3RYHE 1O3XA 3Q9DA 3ZYMA 1MMNA 4MFRA 1MMAA 3RC8A 2LSIA 4TV9E 2XAFB 4J2CA 2ZM0A 1UX4A 4P09A 4O4IE 4CI2B 3RYCE 1KK7A 5HXEA 1T98A 4HE8A 1HS7A 1MIVA 4PW8A 1QSDA 2JRKA 4XZCA 4YJ2E 3LG7A 5FNVE 3OYZA 4UELA 1D1BA 3S4UA 2VKHA 2C5IT 4O4HE 1KNZA 4UV8B 4AQFC 4O2BE 4FJOA 5ADXL 3C64A 5JR9C 2YINA 3SWHA 2WMNA 5H6RB 3F2EA 1S35A 2LOSA 3MZKB 3GN5A 3N9PA 4EOZB 4ZI2D 2VKOA 4GK5E 3NZQA 1MNDA 1NWMX 4G2AA 3RH3A 5JH7E 4Z8XA 2MOZA 5C8YE 4YLHA 2K9AA 5L3CB 1UX5A 5FXVA 1MIWA 2EHOB 2CE7A 2QGSA 3BQIA 3RX6A 4EB6E 3MK7C 5HWXA 5JDGA 3ESLA 3LK3B 3K3OA 4AQGA 5DQWA 2LT3A 2IC9A 3OKQA 3U78A 1LVKA 2LM9A 2Z6EA 1D1AA 1B7TA 4PJNA 2D0UA 3E22E 3QK6A 4XBFB 3FHNA 4G63A 1IZNB 2DWGA 4GIWA 2XAQB 3ZN1B 2K24A 2C5JA 2VKDA 3KV4A 4AKGA 4HN9A 3N9NA 4DMVA 2V26A 1HF8A 3CX6B 2JJ9A 2MYSA 3LFMA 2X9HA 4QX8B 2LHRA 4KP3C 4UF0A 4ZI7E 3K3QC 3VU7H 3J7Yq 5HYAA 3U3IA 4IIJE 1IJ5A 2A3DA 2N9DA 4X1KE 4CQIA 2NTYA 1V9DA 3P8CD 2H3RA 3IBPA 3LBXB 3KVBA 4WBNE 3L3PA 3SS1A 3AVSA 4PK4A 4I50E 3RYIE 3MJXA 3J9X1 4EXTA 4IE7A 5EK4A 2XAJB 3V5SA 5LGUB 3LK2B 3FBZA 1ZHCA 2W00A 3HI2A 3GA8A 3HKDE 4YFSA 4BJNA 1WR6A 1WYCA 4XAXB 4PK6A 4L0RA 2L3LA 2LHNA 3N2OA 4JUYA 2SPCA 3RRWA 5FYMA 5JREA 4L9IA 3C51A 3UUNA 2E9XD 2NW7A 2JPFA 3PU3A 2E9XC 2KNDA 5FXWA 2Y6XA 3AAAB 2VL8A 4ZS3A 4PFOA 4AQFA 3N9OA 4NUVA 4H63V 4DMWA 3KV6A 2WWUA 5J1GA 2VKJA 3ZMVB 2XASB 2KMFA 5J2UE 2X9XA 1D0ZA 2NW8A 4FI5A 3UTKA 3PTRB 5JDQA 3NRYA 5LBMA 2XUEA 1HX8A 4IHJE 3O1HA 4TX5A 3N9LA 4DBQA 4EAHA 3O4XE 4ZOLE 5FMNA 4I43B 2X51A 4QXCB 4HEAA 3D0TA 4QXHB 4CXXA 4KBMB 4ADZA 4PAGA 3VKHA 3CQCB 3ZC0A 4GYSA 4HGAA 4X1IE 5JVDE 3AA1B 4NUUA 1MIYA 2LOPA 3ZCJA 2CLYC 5LJMA 3OYXA 1ZEEA 3GMIA 3FBLA 4OHFA 3OBVE 1CUNA 2CM0A 3WAKA 4BJMA 2VWAA 2LEHA 5J2TE 3MACA 3SRZA 4QWNB 3CQXC 4HKAA 2ZM2A 3C98B 3IEEA 4O4JE 4I55E 3FXDB 1BR4A 2V7IA 4MBQA 2ZM8A 4K0UA 3H3AA 2DNXA 4U74A 4HTEA 4BA9A 2DLRA 4TN7B 3JC6C 3UUMA 1EZ3A 3ANWB 3HKCE 5IHYA 4P0BA 2H7OA 2JMHA 4E7ZA 2C5KT 4GYRA 3HKBE 4UVAB 2Q9QD 4ASKA 5HXRA 1G8XA 5FXZA 2Q9QC 4PJMA 1WLXA 2L9QA 3M65A 3ZPOA 1FEWA 3AA7B 3ZEFB 1Y64B 5F8PA 1LVFA 1YKHB 5JRCA 2E9XA 1D0XA 3CX8B 3LJCA 3RPUA 3N2KE 2KINB 3EVYA 2DI4A 4ERRA 5LP6E 4IE5A 4MALA 3V5UA 3EUHA 3BQLA 1UCUA 4OYJA 4AKHA 1WRDA 3KINB 2VB6A 2WAUA 2CWYA 2CCQA 3KVAA 3CWZB 2LE8A 5E0OA 3PU8A 3AB3B 3VHLA 2WMOA 1D1CA 3O1IA 3GN5B 3N9QA 3ZCIA 3CQGB 3AAIA 3CKDA 3F57A 2WBLA 4DBRA 2B1EA 3UFEA 1U5PA 3QC9A 1LKXA 3IHRA 4ZS2A 5LNKA 5EK3A 1YW0A 2YEVC 2C0SA 3I9YA 4ISTA 5BMVE 2IAKA 5LG4A 5LXTE 3AA6B 5DABA 1IAPA 2LSJA 5JRCB 2CEAA 4WBOA 2EHOC 4H9RC 3L09A 2IW5B 3ZMUB 4PFPA 5EZYE 3SOLA 2LSGA 3I0OA 1D0YA 3AAEB 3MA9A 3FXEB 3Q2MA 4AI6A 5FP3A 4IE4A 2MTQA 2IC6A 3C50A 4ZHQE 2YU1A 4AKLA 4AXPA 2N1GA 3C4WA 2KWIB 4MHCA 2V7LA 4IDZA 2HPLA 5JDMA 4N78D 4BAYB 2YU2A 2HPJA 5F3JA 1FMVA 2X67A 3CX7B 2VK9A 4GK0E 4UF0B 3MXZA 1YKEB 4C91A 2CWOA 3O1JA 5JR9A 4ZI3C 5L3EB 4V1Av 5GONE 5HWYA 3UUXB 3KBUA 2XTLA 2KT9A 3GWHA 4IE6A 5KMGP 3VKGA 4PNIA 2V1DB 3I0QA 2PG8A 4UV9B 4CZZB 2ACXA 5JDFA 2BZBA 2Q9QA 4JLEA 3PE0A 3HL6A 2KLQA 3R84B 2K5BB 3EDVA 3Q5XA 5L3FB 3TKLB 5LOVE 2JQQA 2X9YA 2NP9A 1LRZA 4OK0A 3ZJ2A 1QUUA 1VRBA 2H7VC 3IF8B 5L3GB 3ZMTB 2ODUA 4PJLA 2CMRA 4EZHA 3K3NA 5JR9B 4ISSA 3P7IA 1Z0PA 2M67A 1HCIA 4IE0A 3PUQA 3KBTA 3RKOA 2W61A 3ETUA 3ZJ1A 2CXLA 2WSSV 5EK2A 3KV9A 4H9NC 5LA6E 3ZN0B 3CVRA 4WNKA 1HG5A 3JC6D 2X68A 3T8OA 2D5UA 1FMWA 1HG2A 5JDLA 2DHRA 2EHOA 4EZ4A 5CA0E 5M4YA 3C4XA 3DJBA 2PFVA 1ZKEA 3E0ZA 3DP7A 5FY1A 5CB4E 4ANJA 3KV5A 2VASA 4QX7B 1SHZC 2W62A 5HXSA 2A72A 1MNEA 2D2SA 2LSYA 5LCYA 3ZYLA 2YK0A 1E1HB 2CXDA 4X1YE 3PUGA 2NWBA 4UIGA 3N9MA 2PBIA 4H63H 2NW9A 2X9WA 1OXZA 2NOXA 5DQVA 1MMGA 4QHOA 4DNDA 5JQGE 4CXWA 1US7B 4PJJA 2ZLYA 5LGNB 4WW0A 5L3BB 3AA0B 3ZLIA 3F31A 3I9WA 5AFUL 2LSKA 4H9SE 2L8KA 4C90A 2RP4A 3UT5E 4ZI2C 2K48A 2ODVA 2KZ7B 1IJ6A 5FXXA 1AJ3A 3ZYKA 4I4TE 2N2NA 1U4QA 3CMLA 4YJ3E 4DO0A 5LGTB 3RYFE 2W63A 3OJAA 4PK5A 2Y8DA 3QUJA 3BK9A 4UVBB 2P9BA 3ZMZB 3LBXA 2XAGB 4KMCA 4OYKA 4AKIA 5LHIB 4B6XA 4JEUB 5HXCA 4P0AA 4H9PC 2BVLA 2UXXB 1WYBA 2X66A 4HFVA 3BQKA 3ETVA 4YHJA 1OWAA 2ES0A 3H37A 2W0GA 1H7CA 2UXNB 3CPZA 4ILUA 3E08A 2EHOD 2E9XB 5LJNA 3PURA 4EIWA 2XQYA 3DTOA 4UXNB 5HXHA 1MMDA 2KWHA 3K8PC 4EYYR 2XAHB 1YD8G 4OFZA 3RC3A 4L5GA 3RRCA 3N2GE 5L3DB 5ETWA 5FY0A 2OA5A 3AVRA 3N5LA 1BR1A 2HH7A 3LK42 2JMKA 3O9XA 4JEHB 2Y48B 5LYJE 4EYUA 4M1PA 3ZC1A 1SA0E 3C4ZA 2LJLA 3ZMSB 2NTXA 1VOMA 1NAFA 2GK9A 3KFWX 3EDUA 5JDNA 2G0UA 2V7KA 4CXYA 4ZI3D 4O4LE 2XHEB 2I59A 3I1AA 4X20E 5L2LA 4CI1B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KND A;  2Y6X A;  2KMF A; 
#chains in the Genus database with same CATH topology
 3NRX A;  5H6Q B;  5KX5 E;  5LHG B;  4DVD A;  3PUS A;  2V6Y B;  2I6H A;  3A5X A;  1R8I A;  2DCF A;  2KXP B;  3A7M A;  3FB2 A;  4IT4 A;  4HWF A;  2VVN A;  1G73 A;  4MLK A;  2MBG A;  4UR9 A;  2RA1 A;  2BVM A;  4TZ4 C;  3AE9 A;  1BR2 A;  3TLS A;  2D0T A;  3ZSS A;  3R6N A;  2CHN A;  3ONX A;  4F6R C;  2CA5 A;  1BR0 A;  2Q9Q B;  1O3X A;  1MMN A;  1MMA A;  1UK5 A;  4J2C A;  4O4I E;  4CI2 B;  5ABF B;  2BKO A;  2HN1 A;  4PW8 A;  4XZC A;  5AQJ B;  4YJ2 E;  4HWD A;  5FNV E;  3OYZ A;  4UEL A;  1D1B A;  2VKH A;  2C5I T;  4O4H E;  3AEB A;  4O2B E;  4FJO A;  5JR9 C;  3PV0 F;  2XQ4 A;  3GN5 A;  4EOZ B;  2VKO A;  4GK5 E;  4Z8X A;  1MIW A;  2EHO B;  4AQG A;  5DQW A;  3U78 A;  5LG3 A;  4DV2 T;  1HNX T;  4ZZB A;  2FJE A;  1Z8U A;  4Z91 A;  2C5J A;  2VKD A;  4AKG A;  3N9N A;  3FZF B;  2JJ9 A;  2MYS A;  3LFM A;  4QX8 B;  2LHR A;  3J7Y q;  4DR4 T;  2NTY A;  2H3R A;  4U7I A;  3IBP A;  4PK4 A;  4JI8 T;  1WR6 A;  1WYC A;  4L0R A;  2LHN A;  3RRW A;  2SPC A;  5FYM A;  2UUB T;  2NW7 A;  3PU3 A;  3AAA B;  3NKZ A;  2J62 A;  4X66 T;  2WWU A;  2KMF A;  5J2U E;  5JDQ A;  5JTG A;  1HX8 A;  4IHJ E;  2M6I A;  2H89 A;  3O4X E;  1XMO T;  3SFE A;  2QYW A;  4KBM B;  4ADZ A;  2XSA A;  4GYS A;  3UFG A;  3AA1 B;  1MIY A;  2K3W A;  3OYX A;  2CM0 A;  3WAK A;  2VWA A;  4QWN B;  3CQX C;  1YXR A;  3PUV F;  3C98 B;  2ZM8 A;  3H3A A;  4HTE A;  5L4E A;  3JC6 C;  1OED B;  4P0B A;  4GYR A;  4IL4 A;  3HKB E;  4WZX A;  2Q9Q C;  4PJM A;  3ZPO A;  1JNZ A;  3AA7 B;  1M7K A;  1LVF A;  1YKH B;  3RPU A;  3EVY A;  4MAL A;  3EUH A;  3BQL A;  4ILC A;  5L4H A;  2WAU A;  3OTO T;  3KVA A;  3PU8 A;  3AB3 B;  3ZCI A;  3CQG B;  4U31 A;  1HNZ T;  4YSY A;  3AE2 A;  1LKX A;  2IAK A;  5DAB A;  4NXM T;  5JRC B;  3ZMU B;  2EHO C;  2IW5 B;  2V6Y A;  4PFP A;  4IE4 A;  2IC6 A;  5AQV B;  4LF6 T;  2IHR 1;  3TLU A;  2N1G A;  5AQL B;  4MHC A;  2HPL A;  3RI5 A;  5JDM A;  4LF4 T;  4N78 D;  2YU2 A;  3CX7 B;  2VK9 A;  4X65 T;  5C2T A;  1XDO A;  4JI4 T;  2XQA A;  3GWH A;  3VKG A;  4UV9 B;  4CZZ B;  5JDF A;  2BZB A;  2Q9Q A;  2IIU A;  3Q5X A;  5LOV E;  3ZJ2 A;  2F4V T;  2BG9 E;  5ABF A;  1VRB A;  3ZMT B;  2ODU A;  4PJL A;  4U3C A;  1Z0P A;  1HCI A;  4OX9 T;  5LA6 E;  3ZN0 B;  1HG5 A;  3JC6 D;  1ZOY A;  5JDL A;  2D5U A;  3VRA A;  2EHO A;  5CA0 E;  5M4Y A;  3C4X A;  3DJB A;  2V6X A;  5ABE A;  4I0U A;  3DP7 A;  4QX7 B;  1I94 T;  2W62 A;  2MPK A;  5HXS A;  2A72 A;  1MNE A;  4B3R T;  3ZYL A;  1E1H B;  3PUG A;  2XQ9 A;  2NW9 A;  2BBH A;  2X9W A;  1OXZ A;  4HWH A;  5JQG E;  1US7 B;  4WW0 A;  3AA0 B;  5HEH A;  2LSK A;  2LKH A;  3UT5 E;  4ZI2 C;  2FUP A;  2K48 A;  2ODV A;  1KF6 A;  1AJ3 A;  4I4T E;  2N2N A;  2VL0 A;  4QH4 A;  4DO0 A;  1N34 T;  3RYF E;  3X1D A;  3QUJ A;  1VCS A;  4UVB B;  2P9B A;  4KMC A;  5LHI B;  4B6X A;  4H9P C;  2WDR A;  1OED C;  1OWA A;  3TLV A;  2R6G F;  2UXN B;  4ILU A;  2EHO D;  3PUR A;  4EIW A;  4DV6 T;  3LSV A;  3DTO A;  1MMD A;  4L5G A;  5ETW A;  3N5L A;  1KNR A;  2HH7 A;  4KI0 F;  3ZC1 A;  2GK9 A;  3EDU A;  2UUA T;  3ONL C;  4X20 E;  3A8Y C;  4UEM A;  3HKE E;  5LMU T;  2V7J A;  2A2F X;  1FJG T;  5HAX A;  2PTF A;  3HR0 A;  3B13 A;  3QB5 K;  4ILB A;  1W0A A;  3PUA A;  4U7Y A;  4YXD A;  3NBX X;  1J5E T;  3VR9 A;  4X5T A;  3PUW F;  4EEB A;  5LBQ B;  4LF9 T;  2J1D G;  3UUL A;  3WI3 A;  3ZT5 A;  5DJQ C;  2XJ7 A;  1FIO A;  4YHH T;  1HTJ F;  1X79 A;  3MKD A;  3JCF A;  1ZV4 X;  3NZP A;  1OED A;  3ZYM A;  2LSI A;  2XAF B;  5AQQ B;  5AQO B;  5HCM A;  1HS7 A;  2YOE A;  4HFE A;  1KNZ A;  2OV9 A;  3C64 A;  4LFA T;  2WDV A;  2WMN A;  3CIR A;  4U2Z A;  4JI7 T;  3F2E A;  1S35 A;  3N9P A;  4ZI2 D;  2RPA A;  5JH7 E;  1UUR A;  5C8Y E;  3ZT7 A;  4JI5 T;  4YLH A;  2K9A A;  3PJA J;  2CE7 A;  2QGS A;  3BQI A;  2OLT A;  4EB6 E;  3RQW A;  4A98 A;  4DV0 T;  5L47 A;  1W9R A;  2D0U A;  4XBF B;  4G63 A;  4AQY T;  4GIW A;  2XAQ B;  2AXD S;  2BS4 A;  4AIS A;  2YN6 A;  2V26 A;  2B76 A;  4JBW F;  3JAE A;  5HYA A;  3U3I A;  2A3D A;  2N9D A;  4X1K E;  2V5C A;  2D9D A;  4CQI A;  1V9D A;  1XNQ T;  3PUX F;  2MAW A;  3RYI E;  4EXT A;  5EK4 A;  3V5S A;  1ZHC A;  3HKD E;  3C51 A;  3UUN A;  1JNR A;  4U33 A;  4ZS3 A;  2JIW A;  4H63 V;  5J1G A;  3ZMV B;  2VKJ A;  4LMK A;  2WZH A;  3UTK A;  4A97 A;  4LF8 T;  2HN2 A;  2XUE A;  3O1H A;  4EAH A;  1E2A A;  5HEJ A;  4I43 B;  2V8S V;  4JI3 T;  4PAG A;  3VKH A;  4IRE A;  5ABH A;  4X1I E;  5JVD E;  5LJM A;  2LRL A;  3GMI A;  4OHF A;  4ZZC A;  4BJM A;  4DR3 T;  2LEH A;  4HFI A;  3IEE A;  4O4J E;  3FXD B;  1BR4 A;  1KFY A;  2CRB A;  2WZI A;  4TN7 B;  3UUM A;  5IHY A;  4E7Z A;  2C5K T;  3PUZ F;  4ASK A;  5FXZ A;  2L9Q A;  3M65 A;  1FEW A;  1D0X A;  3CX8 B;  2KIN B;  4CN1 A;  4LFB T;  5LP6 E;  1UCU A;  3KIN B;  4DV7 T;  4QH5 A;  2CCQ A;  4HFD A;  3O1I A;  3AEE A;  3N9Q A;  4YSX A;  3AAI A;  3CKD A;  2WBL A;  2B1E A;  4ZS2 A;  5LNK A;  5EK3 A;  1YW0 A;  2C0S A;  4IST A;  5BMV E;  4JI1 T;  5LXT E;  2LSJ A;  2CEA A;  3SOL A;  3MA9 A;  3C50 A;  4AKL A;  4AXP A;  1WR0 A;  2HPJ A;  2X67 A;  4C91 A;  3O1J A;  5JR9 A;  1WCR A;  5L3E B;  3UUX B;  2XTL A;  5F5W A;  3QOF A;  2KT9 A;  5CFB A;  2YDS A;  4PNI A;  2V1D B;  3I0Q A;  2ACX A;  4JLE A;  2WCA A;  3HL6 A;  2KLQ A;  3R84 B;  5L3F B;  2X9Y A;  2UXD T;  4OK0 A;  3EHZ A;  1QUU A;  2LRK A;  3VRB A;  4ILA A;  2CMR A;  3K3N A;  4TNV A;  2E2A A;  4DV3 T;  3KV9 A;  3CVR A;  4WNK A;  2X68 A;  3T8O A;  1FMW A;  4TWH A;  1UGO A;  2DHR A;  4YTP A;  5FY1 A;  5AQT B;  2IUB A;  1YQ3 A;  2D2S A;  4HFC A;  5LCY A;  3AE6 A;  2NWB A;  4UIG A;  3N9M A;  4H63 H;  5AQF B;  4F8H A;  3TLT A;  5AQG B;  2ZLY A;  5L3B B;  3ZLI A;  3I9W A;  4H9S E;  4LF5 T;  4NXN T;  2RP4 A;  3AEF A;  3ZYK A;  1U4Q A;  2W63 A;  3BK9 A;  4B3T T;  3ONJ A;  3AEA A;  4AKI A;  2BVL A;  1WYB A;  2X66 A;  2WWV A;  3BQK A;  3ETV A;  2W0G A;  1H7C A;  3UQ4 A;  3E08 A;  4HWC A;  1XZY A;  2X0H A;  4EYY R;  5L3D B;  1SE7 A;  3RIU C;  3P4R A;  5AQU B;  1BR1 A;  3LK4 2;  4DV4 T;  3O9X A;  4JEH B;  2YKS A;  1E7P A;  4M1P A;  4EYU A;  3C4Z A;  3ZMS B;  2NTX A;  1VOM A;  1NAF A;  3UQ7 A;  2LKG A;  4Q25 A;  2IDO B;  3I1A A;  5FL0 A;  5L2L A;  3FZH B;  5LMN T;  5A1L A;  4QXB B;  3OVU A;  3G06 A;  5HEG A;  5LHH B;  4EED A;  3B57 A;  2V7M A;  2CXF A;  2WM9 A;  2CLY B;  2DWK A;  2W66 A;  2XQ7 A;  5KDM C;  2BDE A;  3AXJ B;  2E8I A;  4JV5 T;  4O2A E;  4YY3 T;  5LB7 B;  4UVC B;  4IGU A;  4X62 T;  4TNW A;  3P4S A;  2W2U A;  4COF A;  2ACZ A;  5CA1 E;  4QH1 A;  4TUY E;  3RYH E;  3Q9D A;  4MFR A;  1M62 A;  3RC8 A;  2ZM0 A;  4P09 A;  1GQE A;  1T98 A;  1QSD A;  3RIU A;  3LG7 A;  1QLB A;  1ZP0 A;  4UV8 B;  5ADX L;  1IBL T;  1NWM X;  2MOZ A;  2LLY A;  5L3C B;  5FXV A;  5HWX A;  1I6Z A;  3RX6 A;  2J4G A;  5JDG A;  3UU5 A;  3LK3 B;  1XNR T;  2LT3 A;  3OKQ A;  4Z90 A;  1LVK A;  2Z6E A;  1D1A A;  3RIF A;  2YDQ A;  4HFB A;  3FHN A;  2XPK A;  2DWG A;  4JYA T;  1N32 T;  2K24 A;  3KV4 A;  2E5V A;  1XMQ T;  2CPT A;  2AE9 A;  4KP3 C;  4ZI7 E;  4X64 T;  3JAD A;  4IIJ E;  3RF1 A;  1IJ5 A;  4JI2 T;  3P8C D;  2ZM6 T;  3KVB A;  2NR4 A;  4WBN E;  3SS1 A;  3AVS A;  4I50 E;  3IA3 A;  3MJX A;  4IE7 A;  3RHW A;  2XAJ B;  4DR5 T;  3LK2 B;  3Q5D A;  3FBZ A;  4DID B;  2W00 A;  4YFS A;  2QRX A;  3GA8 A;  3ZT6 A;  3NVO A;  4PK6 A;  3N2O A;  2BKP A;  4JUY A;  5JRE A;  5FVL A;  2E9X D;  2JPF A;  1OED E;  2KND A;  2VQF T;  2Y6X A;  2VL8 A;  3VR8 A;  3UU6 A;  3KV6 A;  4IDQ A;  2XAS B;  2X9X A;  1D0Z A;  2NW8 A;  3NRY A;  4NPP A;  5LBM A;  3B5M A;  2QVA A;  4DBQ A;  4DR7 T;  4NIQ A;  4ZOL E;  4DR2 T;  3ZST A;  4EV6 A;  4QXC B;  2J47 A;  4QXH B;  4CXX A;  2WP9 A;  3CQC B;  5AQK B;  3AE3 A;  4HGA A;  3ZCJ A;  2CLY C;  1J1J A;  1ZEE A;  2WU2 A;  4GKK T;  3ZKR A;  3MAC A;  3SRZ A;  4A5X A;  4DV5 T;  4I55 E;  2V7I A;  4K0U A;  2DNX A;  4U74 A;  2DLR A;  3LDQ B;  3ANW B;  3HKC E;  4UVA B;  2JQH A;  1G8X A;  3AE8 A;  2IML A;  1WLX A;  3ZEF B;  2H88 A;  5F8P A;  5JRC A;  2DI4 A;  1T7S A;  4IE5 A;  4OYJ A;  1WRD A;  3AED A;  2CHO A;  2W67 A;  2CBJ A;  2LE8 A;  3VHL A;  1D1C A;  2LM2 A;  3UFE A;  1U5P A;  3IHR A;  2V5D A;  1XDP A;  2WY2 A;  2YEV C;  2WQY A;  5LG4 A;  4IDO A;  3AA6 B;  3P4W A;  4WBO A;  4TWD A;  3L09 A;  4DR1 T;  5EZY E;  2LSG A;  1D0Y A;  3Q2M A;  2MTQ A;  4KHZ F;  2KWI B;  4IDZ A;  1T72 A;  1W0B A;  5F3J A;  3AE1 A;  4UF0 B;  3MXZ A;  1YKE B;  2CWO A;  4ZI3 C;  4K0K T;  2UU9 T;  1VCT A;  3RLF F;  2CBI A;  3KBU A;  3UU8 A;  4KX6 A;  3AEG A;  1WFD A;  2PG8 A;  4B3S T;  4B3M T;  5HCJ A;  1NEN A;  2H7V C;  3IF8 B;  5L3G B;  1HNW T;  4EZH A;  3FZL B;  4ISS A;  3P7I A;  2M67 A;  3PUQ A;  3KBT A;  4LMJ A;  2VUR A;  3ETU A;  3ZJ1 A;  2CXL A;  5EK2 A;  2UXC T;  2UUC T;  3T1H T;  3UU3 A;  1HG2 A;  3RGL A;  1CHU A;  2PFV A;  3NWI A;  5CB4 E;  3KV5 A;  2VAS A;  1SHZ C;  5BR8 T;  2LSY A;  2YK0 A;  2FJA A;  4EGW A;  4X1Y E;  2PBI A;  5DQV A;  1MMG A;  4QHO A;  3UUB A;  4DND A;  2W4X A;  5LGN B;  5AFU L;  1DU2 A;  4C90 A;  4YTM A;  5FXX A;  3CML A;  3AE5 A;  1HX1 B;  2Y8D A;  2BG9 B;  4OYK A;  4JEU B;  5HXC A;  4P0A A;  4HFV A;  2ES0 A;  3CPZ A;  2E9X B;  5LJN A;  2M6B A;  2KWH A;  2XAH B;  1YD8 G;  4OFZ A;  3N2G E;  5FY0 A;  2OA5 A;  3AVR A;  2Y48 B;  5LYJ E;  2LJL A;  3JAF A;  5ABG A;  3KFW X;  1NEK A;  2VQE T;  2G0U A;  2V7K A;  4ZI3 D;  4O4L E;  1W09 A;  2X0Y A;  4CI1 B;  5JDH A;  2QA7 A;  1YQ4 A;  2WS3 A;  3K1S A;  4H9O C;  2HHH T;  1HFA A;  3Q5W A;  4O8S A;  2UXB T;  4GOU A;  5FKY A;  4YSZ A;  3L8R A;  3EAB A;  4KUM B;  4E7S A;  4CI3 B;  3W15 B;  4U72 A;  2PJQ A;  3QNU A;  2I0M A;  4AKR B;  2X0L B;  1S94 A;  3PDY A;  4DR6 T;  2ZMA A;  5FY7 A;  3WAJ A;  3HA4 A;  4H9Q C;  4A56 A;  4TV8 E;  5IYZ E;  4IL9 A;  3KDS E;  2FJB A;  4YTN A;  2XM2 A;  3ANW A;  4LML A;  5TAO A;  4QKN A;  1IBK T;  3FZK B;  4JI0 T;  4TV9 E;  4LF7 T;  1UX4 A;  3RYC E;  1KK7 A;  5HXE A;  4HE8 A;  1MIV A;  2JRK A;  3EAM A;  3S4U A;  4AQF C;  2YIN A;  3SWH A;  5H6R B;  2KSR A;  2LOS A;  3MZK B;  3NZQ A;  5FVK A;  1MND A;  4G2A A;  3RH3 A;  4LFC T;  3OPC A;  1UX5 A;  3H3M A;  3MK7 C;  3ESL A;  3K3O A;  2IC9 A;  2LM9 A;  2WB5 A;  5J0Z A;  1B7T A;  4PJN A;  3E22 E;  3QK6 A;  1IZN B;  3P4Q A;  1HR0 T;  3ZN1 B;  1SUM B;  4HN9 A;  4DMV A;  1HF8 A;  3CX6 B;  2XM1 A;  2X9H A;  4UF0 A;  3K3Q C;  3VU7 H;  3LBX B;  3L3P A;  3J9X 1;  2BS2 A;  2BG9 C;  5LGU B;  4BJN A;  3HI2 A;  4IDP A;  2XQ5 A;  4XAX B;  2L3L A;  3RIA A;  2FJD A;  4L9I A;  2E9X C;  5FXW A;  4CN6 A;  4PFO A;  4AQF A;  3N9O A;  4NUV A;  4DMW A;  4ZEY A;  4FI5 A;  5AQM B;  3PTR B;  4TX5 A;  1X9B A;  3N9L A;  4HWI B;  5FMN A;  2DL1 A;  4CN4 A;  5KXJ A;  2X51 A;  4HEA A;  3D0T A;  3ZC0 A;  2XQ6 A;  4NUU A;  2LOP A;  3FBL A;  3AEC A;  1CUN A;  3OBV E;  5J2T E;  4WYV A;  1T8B A;  5AQS B;  4HKA A;  2ZM2 A;  5AQH B;  5AQR B;  4MBQ A;  4BA9 A;  3TLW A;  1EZ3 A;  5IUX A;  2BG9 A;  2H7O A;  2JMH A;  3PJA A;  3RQU A;  2Q9Q D;  5HXR A;  2FBW A;  2XY8 B;  1Y64 B;  2E9X A;  2BKN A;  3LJC A;  3N2K E;  4ERR A;  2YDR A;  4JI6 T;  5HEU A;  3V5U A;  4U2Y A;  4AKH A;  2VB6 A;  2CWY A;  3CWZ B;  5E0O A;  2WMO A;  5CJ5 A;  3GN5 B;  3L39 A;  3F57 A;  4DBR A;  2A9U A;  3QC9 A;  3EI0 A;  3I9Y A;  4DUZ T;  4KHP T;  1L0V A;  1IAP A;  2BBJ A;  3AE7 A;  4H9R C;  3P50 A;  2VVS A;  3I0O A;  3AAE B;  4AI6 A;  1Y01 A;  3FXE B;  5FP3 A;  4ZHQ E;  4TWF A;  2YU1 A;  3C4W A;  2V7L A;  1UUS A;  4DUY T;  4BAY B;  3QB5 A;  5AQN B;  1FMV A;  4GK0 E;  3CK6 A;  5CGM A;  5IWA T;  3FZM B;  4V1A v;  5GON E;  5HWY A;  1KNP A;  4IE6 A;  5KMG P;  4IDN A;  4P1N A;  3PE0 A;  5HEO A;  2K5B B;  3EDV A;  2XQ3 A;  3TKL B;  4YT0 A;  2JQQ A;  2NP9 A;  1LRZ A;  5C3J A;  2E5L T;  1XWM A;  3T1Y T;  5JR9 B;  5AQP B;  4IE0 A;  2XQ8 A;  2XZE A;  3RKO A;  2W61 A;  3P4P A;  2WDQ A;  2WSS V;  4H9N C;  3AE4 A;  3Q5E A;  1N33 T;  4EZ4 A;  1ZKE A;  3E0Z A;  4ANJ A;  4AIU A;  2CXD A;  2NOX A;  5FL1 A;  3SFD A;  2WU5 A;  2JQ9 A;  4CXW A;  1J5W A;  4PJJ A;  3ABV A;  3F31 A;  2L8K A;  2KZ7 B;  1IJ6 A;  4YJ3 E;  5LGT B;  3PUY F;  3OJA A;  4PK5 A;  3ZMZ B;  3LBX A;  2JQK A;  2XAG B;  3M3Z B;  2UXX B;  4YHJ A;  3H37 A;  2XQY A;  5AQI B;  4UXN B;  5HXH A;  4HFH A;  3K8P C;  3RC3 A;  3UU4 A;  3RRC A;  3RKG A;  2JMK A;  3AXJ A;  1KEY A;  4GKJ T;  1SA0 E;  4DV1 T;  1N36 T;  4ZXL A;  2BS3 A;  2XSB A;  5JDN A;  1IBM T;  4CXY A;  2XHE B;  2I59 A; 
#chains in the Genus database with same CATH homology
 3NRX A;  4UEM A;  5JDH A;  3HKE E;  2V7J A;  2A2F X;  2QA7 A;  5H6Q B;  5A1L A;  5KX5 E;  5HAX A;  4H9O C;  4QXB B;  5LHG B;  4DVD A;  3PUS A;  5LHH B;  1HFA A;  3B57 A;  3Q5W A;  3HR0 A;  2V7M A;  3B13 A;  3A5X A;  4O8S A;  2CXF A;  4GOU A;  2WM9 A;  2CLY B;  2DWK A;  2DCF A;  4KUM B;  4E7S A;  3PUA A;  4CI3 B;  2KXP B;  3FB2 A;  3NBX X;  5KDM C;  3W15 B;  2BDE A;  4U72 A;  5LBQ B;  2E8I A;  2J1D G;  2PJQ A;  3UUL A;  4AKR B;  2X0L B;  4O2A E;  1G73 A;  1S94 A;  3PDY A;  4MLK A;  2ZMA A;  5FY7 A;  2MBG A;  3WI3 A;  3WAJ A;  4UVC B;  5DJQ C;  4IGU A;  3HA4 A;  4H9Q C;  4A56 A;  1FIO A;  4TV8 E;  5IYZ E;  2RA1 A;  1HTJ F;  2BVM A;  4TZ4 C;  1BR2 A;  2D0T A;  3R6N A;  1X79 A;  3KDS E;  3ONX A;  4F6R C;  2CA5 A;  3MKD A;  5CA1 E;  1BR0 A;  2Q9Q B;  3ANW A;  4TUY E;  5TAO A;  1ZV4 X;  4QKN A;  3NZP A;  3RYH E;  1O3X A;  3Q9D A;  3ZYM A;  1MMN A;  4MFR A;  1MMA A;  3RC8 A;  2LSI A;  4TV9 E;  2XAF B;  4J2C A;  2ZM0 A;  1UX4 A;  4P09 A;  4O4I E;  4CI2 B;  3RYC E;  1KK7 A;  5HXE A;  1T98 A;  4HE8 A;  1HS7 A;  1MIV A;  4PW8 A;  1QSD A;  2JRK A;  4XZC A;  4YJ2 E;  3LG7 A;  5FNV E;  3OYZ A;  4UEL A;  1D1B A;  3S4U A;  2VKH A;  2C5I T;  4O4H E;  1KNZ A;  4UV8 B;  4AQF C;  4O2B E;  4FJO A;  5ADX L;  3C64 A;  5JR9 C;  2YIN A;  3SWH A;  2WMN A;  5H6R B;  3F2E A;  1S35 A;  2LOS A;  3MZK B;  3GN5 A;  3N9P A;  4EOZ B;  4ZI2 D;  2VKO A;  4GK5 E;  3NZQ A;  1MND A;  1NWM X;  4G2A A;  3RH3 A;  5JH7 E;  4Z8X A;  2MOZ A;  5C8Y E;  4YLH A;  2K9A A;  5L3C B;  1UX5 A;  5FXV A;  1MIW A;  2EHO B;  2CE7 A;  2QGS A;  3BQI A;  3RX6 A;  4EB6 E;  3MK7 C;  5HWX A;  5JDG A;  3ESL A;  3LK3 B;  3K3O A;  4AQG A;  5DQW A;  2LT3 A;  2IC9 A;  3OKQ A;  3U78 A;  1LVK A;  2LM9 A;  2Z6E A;  1D1A A;  1B7T A;  4PJN A;  2D0U A;  3E22 E;  3QK6 A;  4XBF B;  3FHN A;  4G63 A;  1IZN B;  2DWG A;  4GIW A;  2XAQ B;  3ZN1 B;  2K24 A;  2C5J A;  2VKD A;  3KV4 A;  4AKG A;  4HN9 A;  3N9N A;  4DMV A;  2V26 A;  1HF8 A;  3CX6 B;  2JJ9 A;  2MYS A;  3LFM A;  2X9H A;  4QX8 B;  2LHR A;  4KP3 C;  4UF0 A;  4ZI7 E;  3K3Q C;  3VU7 H;  3J7Y q;  5HYA A;  3U3I A;  4IIJ E;  1IJ5 A;  2A3D A;  2N9D A;  4X1K E;  4CQI A;  2NTY A;  1V9D A;  3P8C D;  2H3R A;  3IBP A;  3LBX B;  3KVB A;  4WBN E;  3L3P A;  3SS1 A;  3AVS A;  4PK4 A;  4I50 E;  3RYI E;  3MJX A;  3J9X 1;  4EXT A;  4IE7 A;  5EK4 A;  2XAJ B;  3V5S A;  5LGU B;  3LK2 B;  3FBZ A;  1ZHC A;  2W00 A;  3HI2 A;  3GA8 A;  3HKD E;  4YFS A;  4BJN A;  1WR6 A;  1WYC A;  4XAX B;  4PK6 A;  4L0R A;  2L3L A;  2LHN A;  3N2O A;  4JUY A;  2SPC A;  3RRW A;  5FYM A;  5JRE A;  4L9I A;  3C51 A;  3UUN A;  2E9X D;  2NW7 A;  2JPF A;  3PU3 A;  2E9X C;  2KND A;  5FXW A;  2Y6X A;  3AAA B;  2VL8 A;  4ZS3 A;  4PFO A;  4AQF A;  3N9O A;  4NUV A;  4H63 V;  4DMW A;  3KV6 A;  2WWU A;  5J1G A;  2VKJ A;  3ZMV B;  2XAS B;  2KMF A;  5J2U E;  2X9X A;  1D0Z A;  2NW8 A;  4FI5 A;  3UTK A;  3PTR B;  5JDQ A;  3NRY A;  5LBM A;  2XUE A;  1HX8 A;  4IHJ E;  3O1H A;  4TX5 A;  3N9L A;  4DBQ A;  4EAH A;  3O4X E;  4ZOL E;  5FMN A;  4I43 B;  2X51 A;  4QXC B;  4HEA A;  3D0T A;  4QXH B;  4CXX A;  4KBM B;  4ADZ A;  4PAG A;  3VKH A;  3CQC B;  3ZC0 A;  4GYS A;  4HGA A;  4X1I E;  5JVD E;  3AA1 B;  4NUU A;  1MIY A;  2LOP A;  3ZCJ A;  2CLY C;  5LJM A;  3OYX A;  1ZEE A;  3GMI A;  3FBL A;  4OHF A;  3OBV E;  1CUN A;  2CM0 A;  3WAK A;  4BJM A;  2VWA A;  2LEH A;  5J2T E;  3MAC A;  3SRZ A;  4QWN B;  3CQX C;  4HKA A;  2ZM2 A;  3C98 B;  3IEE A;  4O4J E;  4I55 E;  3FXD B;  1BR4 A;  2V7I A;  4MBQ A;  2ZM8 A;  4K0U A;  3H3A A;  2DNX A;  4U74 A;  4HTE A;  4BA9 A;  2DLR A;  4TN7 B;  3JC6 C;  3UUM A;  1EZ3 A;  3ANW B;  3HKC E;  5IHY A;  4P0B A;  2H7O A;  2JMH A;  4E7Z A;  2C5K T;  4GYR A;  3HKB E;  4UVA B;  2Q9Q D;  4ASK A;  5HXR A;  1G8X A;  5FXZ A;  2Q9Q C;  4PJM A;  1WLX A;  2L9Q A;  3M65 A;  3ZPO A;  1FEW A;  3AA7 B;  3ZEF B;  1Y64 B;  5F8P A;  1LVF A;  1YKH B;  5JRC A;  2E9X A;  1D0X A;  3CX8 B;  3LJC A;  3RPU A;  3N2K E;  2KIN B;  3EVY A;  2DI4 A;  4ERR A;  5LP6 E;  4IE5 A;  4MAL A;  3V5U A;  3EUH A;  3BQL A;  1UCU A;  4OYJ A;  4AKH A;  1WRD A;  3KIN B;  2VB6 A;  2WAU A;  2CWY A;  2CCQ A;  3KVA A;  3CWZ B;  2LE8 A;  5E0O A;  3PU8 A;  3AB3 B;  3VHL A;  2WMO A;  1D1C A;  3O1I A;  3GN5 B;  3N9Q A;  3ZCI A;  3CQG B;  3AAI A;  3CKD A;  3F57 A;  2WBL A;  4DBR A;  2B1E A;  3UFE A;  1U5P A;  3QC9 A;  1LKX A;  3IHR A;  4ZS2 A;  5LNK A;  5EK3 A;  1YW0 A;  2YEV C;  2C0S A;  3I9Y A;  4IST A;  5BMV E;  2IAK A;  5LG4 A;  5LXT E;  3AA6 B;  5DAB A;  1IAP A;  2LSJ A;  5JRC B;  2CEA A;  4WBO A;  2EHO C;  4H9R C;  3L09 A;  2IW5 B;  3ZMU B;  4PFP A;  5EZY E;  3SOL A;  2LSG A;  3I0O A;  1D0Y A;  3AAE B;  3MA9 A;  3FXE B;  3Q2M A;  4AI6 A;  5FP3 A;  4IE4 A;  2MTQ A;  2IC6 A;  3C50 A;  4ZHQ E;  2YU1 A;  4AKL A;  4AXP A;  2N1G A;  3C4W A;  2KWI B;  4MHC A;  2V7L A;  4IDZ A;  2HPL A;  5JDM A;  4N78 D;  4BAY B;  2YU2 A;  2HPJ A;  5F3J A;  1FMV A;  2X67 A;  3CX7 B;  2VK9 A;  4GK0 E;  4UF0 B;  3MXZ A;  1YKE B;  4C91 A;  2CWO A;  3O1J A;  5JR9 A;  4ZI3 C;  5L3E B;  4V1A v;  5GON E;  5HWY A;  3UUX B;  3KBU A;  2XTL A;  2KT9 A;  3GWH A;  4IE6 A;  5KMG P;  3VKG A;  4PNI A;  2V1D B;  3I0Q A;  2PG8 A;  4UV9 B;  4CZZ B;  2ACX A;  5JDF A;  2BZB A;  2Q9Q A;  4JLE A;  3PE0 A;  3HL6 A;  2KLQ A;  3R84 B;  2K5B B;  3EDV A;  3Q5X A;  5L3F B;  3TKL B;  5LOV E;  2JQQ A;  2X9Y A;  2NP9 A;  1LRZ A;  4OK0 A;  3ZJ2 A;  1QUU A;  1VRB A;  2H7V C;  3IF8 B;  5L3G B;  3ZMT B;  2ODU A;  4PJL A;  2CMR A;  4EZH A;  3K3N A;  5JR9 B;  4ISS A;  3P7I A;  1Z0P A;  2M67 A;  1HCI A;  4IE0 A;  3PUQ A;  3KBT A;  3RKO A;  2W61 A;  3ETU A;  3ZJ1 A;  2CXL A;  2WSS V;  5EK2 A;  3KV9 A;  4H9N C;  5LA6 E;  3ZN0 B;  3CVR A;  4WNK A;  1HG5 A;  3JC6 D;  2X68 A;  3T8O A;  2D5U A;  1FMW A;  1HG2 A;  5JDL A;  2DHR A;  2EHO A;  4EZ4 A;  5CA0 E;  5M4Y A;  3C4X A;  3DJB A;  2PFV A;  1ZKE A;  3E0Z A;  3DP7 A;  5FY1 A;  5CB4 E;  4ANJ A;  3KV5 A;  2VAS A;  4QX7 B;  1SHZ C;  2W62 A;  5HXS A;  2A72 A;  1MNE A;  2D2S A;  2LSY A;  5LCY A;  3ZYL A;  2YK0 A;  1E1H B;  2CXD A;  4X1Y E;  3PUG A;  2NWB A;  4UIG A;  3N9M A;  2PBI A;  4H63 H;  2NW9 A;  2X9W A;  1OXZ A;  2NOX A;  5DQV A;  1MMG A;  4QHO A;  4DND A;  5JQG E;  4CXW A;  1US7 B;  4PJJ A;  2ZLY A;  5LGN B;  4WW0 A;  5L3B B;  3AA0 B;  3ZLI A;  3F31 A;  3I9W A;  5AFU L;  2LSK A;  4H9S E;  2L8K A;  4C90 A;  2RP4 A;  3UT5 E;  4ZI2 C;  2K48 A;  2ODV A;  2KZ7 B;  1IJ6 A;  5FXX A;  1AJ3 A;  3ZYK A;  4I4T E;  2N2N A;  1U4Q A;  3CML A;  4YJ3 E;  4DO0 A;  5LGT B;  3RYF E;  2W63 A;  3OJA A;  4PK5 A;  2Y8D A;  3QUJ A;  3BK9 A;  4UVB B;  2P9B A;  3ZMZ B;  3LBX A;  2XAG B;  4KMC A;  4OYK A;  4AKI A;  5LHI B;  4B6X A;  4JEU B;  5HXC A;  4P0A A;  4H9P C;  2BVL A;  2UXX B;  1WYB A;  2X66 A;  4HFV A;  3BQK A;  3ETV A;  4YHJ A;  1OWA A;  2ES0 A;  3H37 A;  2W0G A;  1H7C A;  2UXN B;  3CPZ A;  4ILU A;  3E08 A;  2EHO D;  2E9X B;  5LJN A;  3PUR A;  4EIW A;  2XQY A;  3DTO A;  4UXN B;  5HXH A;  1MMD A;  2KWH A;  3K8P C;  4EYY R;  2XAH B;  1YD8 G;  4OFZ A;  3RC3 A;  4L5G A;  3RRC A;  3N2G E;  5L3D B;  5ETW A;  5FY0 A;  2OA5 A;  3AVR A;  3N5L A;  1BR1 A;  2HH7 A;  3LK4 2;  2JMK A;  3O9X A;  4JEH B;  2Y48 B;  5LYJ E;  4EYU A;  4M1P A;  3ZC1 A;  1SA0 E;  3C4Z A;  2LJL A;  3ZMS B;  2NTX A;  1VOM A;  1NAF A;  2GK9 A;  3KFW X;  3EDU A;  5JDN A;  2G0U A;  2V7K A;  4CXY A;  4ZI3 D;  4O4L E;  2XHE B;  2I59 A;  3I1A A;  4X20 E;  5L2L A;  4CI1 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...