4DUYT

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, u13c
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome
total genus 34
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 4duyT00
2UXDT 4K0KT 4DR1T 4DV5T 4LFAT 5BR8T 4AQYT 4X65T 4LF7T 4DV0T 4YHHT 4LF9T 1N33T 1XNQT 1IBKT 4B3ST 4B3RT 1FJGT 1HNWT 4LF5T 2UXBT 4LFCT 5LMUT 4JI1T 2UUAT 4JI2T 4DV3T 4DV1T 4X66T 4JI4T 4X62T 4DR5T 5IWAT 2HHHT 1N36T 2UXCT 4JV5T 2E5LT 4DR3T 4DUYT 4LF6T 4LF8T 4NXNT 1N32T 4DV6T 2VQFT 4JI7T 4JI3T 4DR6T 4DUZT 1HNXT 1IBMT 4X64T 2VQET 3T1HT 4JI5T 4DV7T 1IBLT 1J5ET 1HR0T 4KHPT 4JI6T 4LF4T 3OTOT 4NXMT 2F4VT 1XMOT 4JI8T 4JYAT 4OX9T 4YY3T 1I94T 4DR4T 4LFBT 2ZM6T 2UUCT 1XMQT 4GKJT 4B3TT 4GKKT 4DR2T 4DV2T 1XNRT 2UU9T 2UUBT 1N34T 1HNZT 4JI0T 4DR7T 5LMNT 4DV4T 4B3MT 3T1YT
chains in the Genus database with same CATH superfamily
1CUNA 3SS1A 5HWXA 2G0UA 3LFMA 3HL6A 5HEHA 4AQYT 3KVBA 2FUPA 4HFCA 4FI5A 2DNXA 4DV0T 3K3OA 4TX5A 3ZT7A 5DQVA 3FHNA 3V5UA 5FP3A 3PJAJ 4AKHA 4H63V 2A72A 1KNPA 4DV1T 4BJNA 3ZEFB 4JI4T 2XTLA 3ZYLA 2XQ5A 2DLRA 1HX1B 2MYSA 5AQHB 3AE3A 2XY8B 3CIRA 4I43B 5FKYA 2MTQA 3DTOA 2XAGB 2LOSA 3GN5A 4Z8XA 4CQIA 4WBNE 2C5JA 2WDVA 5CGMA 3UUMA 2WM9A 4H9QC 5CB4E 3RC3A 2XQ6A 4DIDB 5ABEA 4QHOA 3UQ4A 4LFBT 5AQRB 5LHGB 4B3TT 3UUNA 5FL1A 4OFZA 4YHJA 2FJEA 2QGSA 2XZEA 3UULA 2XSBA 4HTEA 4PW8A 4IIJE 2XJ7A 2VK9A 4ILAA 3Q9DA 4JLEA 4NIQA 4O2BE 3ZC1A 5AQPB 3B13A 3N2KE 1SHZC 5EK2A 4YTPA 5JVDE 4TV8E 4A97A 5J0ZA 2IAKA 2E9XD 2BS3A 3ETVA 5FNVE 1MMGA 5AQJB 4DR5T 1OWAA 1T8BA 5IWAT 2UXCT 2BG9A 5AQNB 3I9WA 5ABGA 5IYZE 4DUZT 2WU2A 2JQQA 3IA3A 3KV6A 5AQMB 4GYSA 4KHZF 1D0YA 5FY0A 3N9PA 1HR0T 3BQIA 3EVYA 3ONXA 3ZN0B 1XMOT 4JEHB 2RP4A 1W0AA 2VURA 3R84B 3ZLIA 3RI5A 2VVNA 4ILCA 3K1SA 3Q5WA 5LNKA 2NTYA 2VKJA 5HEOA 3AE8A 4DR4T 2HH7A 2XAHB 3I1AA 3KINB 3RRWA 5AQUB 3C4XA 3UT5E 3KV9A 4IE6A 1S94A 1T7SA 3OYXA 1X79A 3P4PA 2MOZA 4DR1T 1D1BA 2YINA 3KBUA 4TWHA 2KWIB 5L3BB 3UFGA 4ZZBA 4TV9E 4WNKA 4K0UA 4UF0B 2KLQA 2N1GA 3P50A 5J2TE 1H7CA 3VR8A 3ABVA 2H89A 5HWYA 3ZCJA 2IC6A 2NP9A 3B5MA 2KINB 3PUSA 1Z0PA 2JQKA 4LF6T 2FJBA 1D1CA 3N9QA 3UTKA 4TN7B 3C98B 4MALA 2M67A 3N9NA 5LJMA 2V6YB 2D2SA 4NUVA 3W15B 2DHRA 3BK9A 2ACZA 2LEHA 5AQQB 3RYHE 3VKGA 2VB6A 4UV8B 3NZQA 3RX6A 2QA7A 4ILBA 3RRCA 2HPLA 4OYKA 1CHUA 5EK3A 3Q5EA 1E7PA 5JDNA 5LJNA 3VRBA 3ETUA 3UFEA 3ESLA 5AQSB 1T98A 3UU3A 4HFVA 3UU8A 2LHNA 2XQYA 2W0GA 1L0VA 2P9BA 3NKZA 3V5SA 3QC9A 2LRLA 4YHHT 1N33T 2VKOA 1W0BA 4IDOA 2OA5A 5LMUT 2WWUA 3P4RA 4JI1T 5CJ5A 1V9DA 2WBLA 2X9XA 2GK9A 1W09A 4DMVA 3D0TA 3EUHA 1N36T 4AI6A 2E5LT 3RLFF 3AE1A 4GOUA 3UU5A 5E0OA 2Q9QB 4IHJE 4EYUA 2CE7A 4OYJA 3QOFA 3TLUA 3K8PC 2VKHA 2LLYA 3RIAA 4UEMA 1SUMB 2LJLA 1WLXA 5LBMA 2NWBA 4UF0A 2JJ9A 3A8YC 1YQ4A 5L3CB 4B6XA 5DJQC 3I0QA 1Y64B 4DV2T 3ZPOA 3AEGA 4DBQA 2D5UA 2BZBA 2BG9E 3ZMTB 4GK5E 2BDEA 1YW0A 2X9HA 2E8IA 2WCAA 3O4XE 2V6YA 4EV6A 3RQWA 2QRXA 3AA7B 5FVKA 4Q25A 3JCFA 3VR9A 2L3LA 4AKGA 4BJMA 4WBOA 4N78D 2XQ9A 3OPCA 5HCMA 3F57A 1OEDC 2X9WA 3A5XA 3MACA 4U7YA 4JV5T 3VRAA 1HFAA 3LBXB 3AE5A 2CPTA 4LF8T 4UVCB 3AE7A 5JDMA 4DR6T 5CA0E 1ZP0A 2PG8A 4PJJA 5FMNA 4U33A 1MNDA 1US7B 5L3EB 4JI5T 2X66A 1LVFA 4EEBA 2YN6A 3K3QC 3ZMUB 3PUGA 2K24A 4ASKA 2Y8DA 3LK2B 1MIWA 5CFBA 4JYAT 2W4XA 2MAWA 2LSYA 2Y48B 1UGOA 4FJOA 4KMCA 2XQ4A 4EAHA 2CRBA 4ZEYA 2A2FX 2WQYA 3TLSA 2Z6EA 4DR2T 4U74A 2V8SV 2WWVA 4KP3C 3MKDA 5EK4A 4YTNA 3HA4A 3ZCIA 5F3JA 4UVBB 1UX5A 4IT4A 4K0KT 5A1LA 3H3MA 4GK0E 4UR9A 4DO0A 4IDPA 5HEJA 2Q9QA 1HTJF 3LK42 4B3RT 2QYWA 4HE8A 3JC6D 4LFCT 4U31A 3AA1B 3RHWA 1VCSA 2FJDA 2PTFA 2EHOB 4TNVA 2YKSA 2XM1A 3PUXF 4CN1A 2VL0A 3UQ7A 4IE7A 4A5XA 2L8KA 2BKPA 2Q9QD 4QWNB 2H3RA 5JREA 3O9XA 3TLTA 3C50A 2VQFT 2L9QA 3E0ZA 1LRZA 1WRDA 3CPZA 3LSVA 4PFPA 1D0ZA 2KT9A 4MFRA 3EAMA 1UUSA 5IHYA 2ACXA 2WSSV 2W00A 3CMLA 4GIWA 4TNWA 3JAFA 3HKEE 4BA9A 3F31A 4WZXA 2XSAA 2JRKA 4WW0A 4P0BA 3OBVE 4CN6A 4U72A 2LM2A 2LT3A 1U4QA 2ODUA 4JI0T 3O1IA 4ILUA 4ZZCA 2W62A 2ZM2A 4PK6A 3LBXA 2IC9A 3UUBA 5L4EA 4X65T 4PAGA 3ZC0A 3KBTA 4H9NC 2R6GF 3AEFA 1IBKT 2NOXA 5L2LA 2A3DA 5LGTB 3ZSTA 1J5WA 4HKAA 3B57A 4O4HE 3AE2A 4O2AE 5HEUA 3ZMZB 5KXJA 3QB5K 3CQGB 4EOZB 2HHHT 4ANJA 3AXJB 4ZI2C 2XM2A 4KX6A 2PFVA 4CXXA 2LSGA 3RYIE 2BVMA 3RH3A 1YXRA 3MZKB 2NTXA 1IBMT 3AEEA 5LXTE 1BR2A 2FBWA 2LHRA 4XZCA 1G8XA 2V6XA 2YU2A 4C91A 4JI6T 1UK5A 2YDRA 4LMKA 3FZLB 3M3ZB 4AKRB 4CZZB 4F8HA 5ABHA 1IJ6A 4CI3B 4EIWA 2WY2A 4P0AA 1DU2A 5LBQB 1XMQT 1LVKA 2W63A 2ZMAA 5KX5E 1VOMA 1IZNB 2J4GA 4QH1A 2ZM0A 2EHOA 4AKIA 1YD8G 2HPJA 1WFDA 1KNRA 1D1AA 3GA8A 3PUZF 1JNRA 4LFAT 3A7MA 1I6ZA 4LF9T 2XAQB 1JNZA 2XQAA 5LA6E 1FJGT 4ISTA 2YK0A 3AAEB 2V7MA 2XASB 2LKHA 2EHOD 3AE9A 4Z91A 3IHRA 5ETWA 5FXZA 3ZKRA 4U2ZA 4TZ4C 3NZPA 1WCRA 5L3GB 3KFWX 2JMKA 2PJQA 4QXHB 4EGWA 4YSYA 4X20E 3PE0A 4DVDA 5JDFA 1KK7A 3P7IA 4U2YA 3SFDA 4JEUB 4AQFA 3CVRA 2ZLYA 2NW8A 1HNXT 4LMJA 1M7KA 2CCQA 2CLYC 3UUXB 3R6NA 3LK3B 2IMLA 2ZM8A 3Q2MA 3ZJ1A 4HFBA 4PK5A 5L3FB 5DABA 3OTOT 2V1DB 2E5VA 1MIYA 3MJXA 1HS7A 4QKNA 3J7Yq 4X1YE 2K3WA 2VL8A 2I6HA 2ZM6T 3C51A 2K9AA 2BBJA 4QX7B 2D9DA 5AQVB 3LG7A 2X0LB 3IEEA 3PJAA 1FMVA 3AB3B 4EXTA 3AXJA 3LJCA 2IUBA 4AKLA 2KWHA 5GONE 3ZYMA 5LGUB 4UIGA 4LF7T 5JDGA 3ZT5A 4Z90A 1O3XA 4IL9A 3RPUA 4ZS2A 3EDUA 4DV3T 4GYRA 2DWGA 2XHEB 3WI3A 2MPKA 4PJLA 2WZHA 4TWDA 1OXZA 3OYZA 2E9XC 4TWFA 3N9MA 2CXFA 3HKDE 3ZMSB 2I59A 4WYVA 2CBJA 3RQUA 3PUWF 4I50E 2CWYA 3T8OA 3MA9A 3KV5A 1W9RA 1IBLT 5HXHA 3PUQA 4HFIA 3E22E 3CKDA 2X51A 1MIVA 1MNEA 2NW7A 3NRXA 3ZSSA 5AQOB 3FZKB 5HXSA 3Q5DA 3FZHB 5H6RB 4ZS3A 3AECA 2QVAA 2BG9C 4IE0A 1NAFA 1MMAA 1KNZA 1XNRT 1SA0E 1FMWA 4KI0F 3OKQA 2UU9T 4P1NA 4DV4T 3FBZA 5JRCB 4PK4A 2UXDT 3HI2A 4DNDA 1Z8UA 2YU1A 4DV5T 3N9LA 4O4IE 5AQIB 3UU4A 1XWMA 2AE9A 5AQLB 2UXBT 4XAXB 4AIUA 4P09A 1EZ3A 2UXXB 2JQHA 2CLYB 2X68A 3AE6A 2RPAA 5FXVA 3PURA 1HCIA 4ZI3C 3AEBA 4IE4A 3KDSE 2LOPA 3X1DA 4L9IA 4LMLA 1BR4A 5LB7B 3HKCE 3CX8B 4OHFA 1FIOA 4JI3T 2J47A 4X64T 2VQET 4DV7T 5HXCA 4H9PC 4KHPT 1E2AA 4LF4T 4NXMT 2KNDA 3LDQB 5C8YE 1MMDA 3PTRB 5C2TA 1AJ3A 4OK0A 2WU5A 4YTMA 4J2CA 5J2UE 1D0XA 3C64A 1WYBA 2H7OA 4U3CA 4GKJT 3H3AA 2YDSA 3Q5XA 2D0TA 1T72A 4ZI7E 3H37A 4BAYB 4M1PA 4X5TA 2WS3A 5FL0A 2XQ8A 4B3MT 1YKEB 4I55E 3RIUC 5JR9C 2OV9A 3TLWA 2E9XB 4I4TE 3FZMB 4IGUA 4EZHA 4DBRA 2JIWA 3BQKA 3CQXC 3RIFA 4ADZA 3KV4A 3VU7H 4AXPA 2W67A 4UV9B 1XZYA 3N9OA 5JTGA 4HWCA 4DMWA 1HG2A 2WDRA 2CM0A 4DUYT 3ONJA 3U3IA 1N32T 3P8CD 4XBFB 1XDOA 5HXRA 4F6RC 4HGAA 4CXWA 2XUEA 2IHR1 5FYMA 5M4YA 3OVUA 3AE4A 5JRCA 3RGLA 3WAJA 1BR0A 4H9SE 3OJAA 4CI1B 2YOEA 1IAPA 4KBMB 2W61A 2YDQA 3O1JA 4OX9T 1ZHCA 1B7TA 1YQ3A 4CXYA 1HG5A 3N2GE 2K5BB 1NENA 4HWHA 3G06A 1XDPA 2MBGA 2WZIA 5JH7E 3RYFE 2BS2A 3PV0F 4YJ3E 2A9UA 4YLHA 2M6IA 5LMNT 4DR7T 4QH5A 1VCTA 3L39A 1J1JA 2PBIA 2IDOB 3CK6A 1ZV4X 4HWFA 3U78A 5JDHA 3AEDA 3P4WA 4B3ST 3AA0B 1HNWT 3F2EA 3UU6A 4IL4A 5HEGA 3C4WA 2UUAT 5F8PA 4JBWF 1NEKA 4AQGA 4PFOA 1OEDB 3ZMVB 4HWIB 5L4HA 4QXBB 1SE7A 2CEAA 2BVLA 3AEAA 3MXZA 4O4LE 4ISSA 4PJMA 2K48A 4YSZA 3AVRA 3T1HT 4G63A 2X67A 3ZJ2A 2AXDS 2WAUA 2E9XA 2V7IA 5LP6E 3BQLA 2KSRA 5JR9B 4YY3T 1MMNA 5H6QB 3GWHA 3NRYA 1KFYA 2VKDA 1WR6A 5KMGP 2LRKA 3WAKA 3N5LA 5LG4A 1QUUA 5FXWA 4QXCB 2V5CA 3EABA 2LKGA 5BR8T 5HYAA 2X9YA 3I0OA 1GQEA 3NVOA 2OLTA 3ZYKA 3IF8B 2NW9A 4JUYA 1ZEEA 4U7IA 5AQTB 3VKHA 5ABFB 1ZKEA 3DP7A 3N2OA 3JC6C 4MLKA 3PUVF 5J1GA 3PUAA 2DCFA 2B76A 4ERRA 2N2NA 5LHHB 4DR3T 4QX8B 2UXNB 3QUJA 3RYCE 5JQGE 2JMHA 3AA6B 2KXPB 1HF8A 2DI4A 2Q9QC 2LSIA 2CXLA 2VASA 2XAJB 3P4SA 5JDLA 5TAOA 3VHLA 5HXEA 2CBIA 2RA1A 2X0YA 5CA1E 3EHZA 4NUUA 4O4JE 4AISA 2IIUA 3CX7B 4IDZA 4PNIA 3JAEA 3M65A 5JDQA 3ONLC 4UELA 5LG3A 3TKLB 2UUBT 1ZOYA 1N34T 1OEDA 2B1EA 5LYJE 3PU3A 4ZI3D 2IW5B 2W66A 2CHNA 2ES0A 2LE8A 4CI2B 3NBXX 2DWKA 3J9X1 3E08A 3CWZB 4UXNB 2VWAA 1XNQT 3I9YA 3AVSA 5L47A 2V7JA 3RF1A 4ZHQE 3RC8A 2M6BA 1KF6A 4ZOLE 4JI2T 2V7LA 2J62A 2XPKA 4H9OC 3HR0A 3RIUA 4ZXLA 5JR9A 4EZ4A 1FEWA 3CQCB 1UURA 5LHIB 2WMOA 2WP9A 4G2AA 3SFEA 1VRBA 3FBLA 2SPCA 4IE5A 4NXNT 4PJNA 4JI7T 2BS4A 4H63H 1KEYA 4YFSA 5LGNB 3ANWB 2D0UA 2CMRA 5IUXA 4X1KE 5F5WA 1YKHB 2DL1A 5EZYE 4E7SA 3MK7C 4JI8T 4MHCA 2KMFA 3SWHA 2UUCT 1LKXA 4GKKT 2V26A 5ABFA 4HEAA 2V5DA 4CN4A 2X0HA 1U5PA 5FY1A 5LOVE 3FZFB 2XAFB 3RKGA 2H7VC 2N9DA 2C5IT 2CA5A 3EI0A 2WB5A 4TUYE 4L0RA 2CHOA 2XQ3A 4HFHA 3EDVA 2LSKA 1QLBA 3O1HA 4COFA 3PUYF 4X1IE 5BMVE 4X62T 2EHOC 4HFDA 2Y6XA 2CXDA 4C90A 4DV6T 3QB5A 3AAAB 5LCYA 4E7ZA 3ZN1B 1R8IA 1X9BA 4EEDA 2W2UA 1HX8A 2V7KA 1J5ET 4YXDA 4IDQA 1WR0A 1M62A 2WDQA 3FXEB 3PDYA 3AAIA 3SRZA 3NWIA 5AQFB 1WYCA 3FXDB 4L5GA 1NWMX 3HKBE 4YSXA 2HN2A 3GMIA 1S35A 3GN5B 1Y01A 4MBQA 2FJAA 5AQGB 3K3NA 4AQFC 1HNZT 5FY7A 4HN9A 2C0SA 1QSDA 2XQ7A 2LM9A 3JADA 2NR4A 3CX6B 3KVAA 3DJBA 2H88A 4A98A 1BR1A 3ANWA 2JQ9A 4LF5T 2WMNA 5HCJA 3FB2A 3ZT6A 2I0MA 2BKOA 3IBPA 4UVAB 1E1HB 5HAXA 4ZI2D 4QH4A 4X66T 5FXXA 2CWOA 3L3PA 2BBHA 1G73A 2C5KT 5AFUL 4O8SA 5DQWA 3S4UA 1OEDE 1UX4A 4NPPA 2LSJA 3SOLA 2YEVC 4KUMB 3P4QA 1IJ5A 2JPFA 2BKNA 2KZ7B 3TLVA 5C3JA 3QNUA 4HWDA 2E2AA 4YJ2E 5AQKB 4HFEA 2ODVA 2F4VT 4A56A 4YT0A 5L3DB 2J1DG 1I94T 4V1Av 1UCUA 3RKOA 5ADXL 2BG9B 3QK6A 4IDNA 4IREA 4H9RC 3L09A 2VVSA 4I0UA 3L8RA 4EYYR 3C4ZA 5FVLA 4EB6E 5KDMC 3T1YT 3PU8A 2HN1A
chains in the Genus database with same CATH topology
2UXDT 4K0KT 4DR1T 4DV5T 4LFAT 5BR8T 4AQYT 4X65T 4LF7T 4DV0T 4YHHT 4LF9T 1N33T 1XNQT 1IBKT 4B3ST 4B3RT 1FJGT 1HNWT 4LF5T 2UXBT 4LFCT 5LMUT 4JI1T 2UUAT 4JI2T 4DV3T 4DV1T 4X66T 4JI4T 4X62T 4DR5T 5IWAT 2HHHT 1N36T 2UXCT 4JV5T 2E5LT 4DR3T 4DUYT 4LF6T 4LF8T 4NXNT 1N32T 4DV6T 2VQFT 4JI7T 4JI3T 4DR6T 4DUZT 1HNXT 1IBMT 4X64T 2VQET 3T1HT 4JI5T 4DV7T 1IBLT 1J5ET 1HR0T 4KHPT 4JI6T 4LF4T 3OTOT 4NXMT 2F4VT 1XMOT 4JI8T 4JYAT 4OX9T 4YY3T 1I94T 4DR4T 4LFBT 2ZM6T 2UUCT 1XMQT 4GKJT 4B3TT 4GKKT 4DR2T 4DV2T 1XNRT 2UU9T 2UUBT 1N34T 1HNZT 4JI0T 4DR7T 5LMNT 4DV4T 4B3MT 3T1YT
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UXD T;  4K0K T;  4DR1 T;  4DV5 T;  4LFA T;  5BR8 T;  4AQY T;  4X65 T;  4LF7 T;  4DV0 T;  4YHH T;  4LF9 T;  1N33 T;  1XNQ T;  1IBK T;  4B3S T;  4B3R T;  1FJG T;  1HNW T;  4LF5 T;  2UXB T;  4LFC T;  5LMU T;  4JI1 T;  2UUA T;  4JI2 T;  4DV3 T;  4DV1 T;  4X66 T;  4JI4 T;  4X62 T;  4DR5 T;  5IWA T;  2HHH T;  1N36 T;  2UXC T;  4JV5 T;  2E5L T;  4DR3 T;  4DUY T;  4LF6 T;  4LF8 T;  4NXN T;  1N32 T;  4DV6 T;  2VQF T;  4JI7 T;  4JI3 T;  4DR6 T;  4DUZ T;  1HNX T;  1IBM T;  4X64 T;  2VQE T;  3T1H T;  4JI5 T;  4DV7 T;  1IBL T;  1J5E T;  1HR0 T;  4KHP T;  4JI6 T;  4LF4 T;  3OTO T;  4NXM T;  2F4V T;  1XMO T;  4JI8 T;  4JYA T;  4OX9 T;  4YY3 T;  1I94 T;  4DR4 T;  4LFB T;  2ZM6 T;  2UUC T;  1XMQ T;  4GKJ T;  4B3T T;  4GKK T;  4DR2 T;  4DV2 T;  1XNR T;  2UU9 T;  2UUB T;  1N34 T;  1HNZ T;  4JI0 T;  4DR7 T;  5LMN T;  4DV4 T;  4B3M T;  3T1Y T; 
#chains in the Genus database with same CATH topology
 1CUN A;  3SS1 A;  5HWX A;  2G0U A;  3LFM A;  3HL6 A;  5HEH A;  4AQY T;  3KVB A;  2FUP A;  4HFC A;  4FI5 A;  2DNX A;  4DV0 T;  3K3O A;  4TX5 A;  3ZT7 A;  5DQV A;  3FHN A;  3V5U A;  5FP3 A;  3PJA J;  4AKH A;  4H63 V;  2A72 A;  1KNP A;  4DV1 T;  4BJN A;  3ZEF B;  4JI4 T;  2XTL A;  3ZYL A;  2XQ5 A;  2DLR A;  1HX1 B;  2MYS A;  5AQH B;  3AE3 A;  2XY8 B;  3CIR A;  4I43 B;  5FKY A;  2MTQ A;  3DTO A;  2XAG B;  2LOS A;  3GN5 A;  4Z8X A;  4CQI A;  4WBN E;  2C5J A;  2WDV A;  5CGM A;  3UUM A;  2WM9 A;  4H9Q C;  5CB4 E;  3RC3 A;  2XQ6 A;  4DID B;  5ABE A;  4QHO A;  3UQ4 A;  4LFB T;  5AQR B;  5LHG B;  4B3T T;  3UUN A;  5FL1 A;  4OFZ A;  4YHJ A;  2FJE A;  2QGS A;  2XZE A;  3UUL A;  2XSB A;  4HTE A;  4PW8 A;  4IIJ E;  2XJ7 A;  2VK9 A;  4ILA A;  3Q9D A;  4JLE A;  4NIQ A;  4O2B E;  3ZC1 A;  5AQP B;  3B13 A;  3N2K E;  1SHZ C;  5EK2 A;  4YTP A;  5JVD E;  4TV8 E;  4A97 A;  5J0Z A;  2IAK A;  2E9X D;  2BS3 A;  3ETV A;  5FNV E;  1MMG A;  5AQJ B;  4DR5 T;  1OWA A;  1T8B A;  5IWA T;  2UXC T;  2BG9 A;  5AQN B;  3I9W A;  5ABG A;  5IYZ E;  4DUZ T;  2WU2 A;  2JQQ A;  3IA3 A;  3KV6 A;  5AQM B;  4GYS A;  4KHZ F;  1D0Y A;  5FY0 A;  3N9P A;  1HR0 T;  3BQI A;  3EVY A;  3ONX A;  3ZN0 B;  1XMO T;  4JEH B;  2RP4 A;  1W0A A;  2VUR A;  3R84 B;  3ZLI A;  3RI5 A;  2VVN A;  4ILC A;  3K1S A;  3Q5W A;  5LNK A;  2NTY A;  2VKJ A;  5HEO A;  3AE8 A;  4DR4 T;  2HH7 A;  2XAH B;  3I1A A;  3KIN B;  3RRW A;  5AQU B;  3C4X A;  3UT5 E;  3KV9 A;  4IE6 A;  1S94 A;  1T7S A;  3OYX A;  1X79 A;  3P4P A;  2MOZ A;  4DR1 T;  1D1B A;  2YIN A;  3KBU A;  4TWH A;  2KWI B;  5L3B B;  3UFG A;  4ZZB A;  4TV9 E;  4WNK A;  4K0U A;  4UF0 B;  2KLQ A;  2N1G A;  3P50 A;  5J2T E;  1H7C A;  3VR8 A;  3ABV A;  2H89 A;  5HWY A;  3ZCJ A;  2IC6 A;  2NP9 A;  3B5M A;  2KIN B;  3PUS A;  1Z0P A;  2JQK A;  4LF6 T;  2FJB A;  1D1C A;  3N9Q A;  3UTK A;  4TN7 B;  3C98 B;  4MAL A;  2M67 A;  3N9N A;  5LJM A;  2V6Y B;  2D2S A;  4NUV A;  3W15 B;  2DHR A;  3BK9 A;  2ACZ A;  2LEH A;  5AQQ B;  3RYH E;  3VKG A;  2VB6 A;  4UV8 B;  3NZQ A;  3RX6 A;  2QA7 A;  4ILB A;  3RRC A;  2HPL A;  4OYK A;  1CHU A;  5EK3 A;  3Q5E A;  1E7P A;  5JDN A;  5LJN A;  3VRB A;  3ETU A;  3UFE A;  3ESL A;  5AQS B;  1T98 A;  3UU3 A;  4HFV A;  3UU8 A;  2LHN A;  2XQY A;  2W0G A;  1L0V A;  2P9B A;  3NKZ A;  3V5S A;  3QC9 A;  2LRL A;  4YHH T;  1N33 T;  2VKO A;  1W0B A;  4IDO A;  2OA5 A;  5LMU T;  2WWU A;  3P4R A;  4JI1 T;  5CJ5 A;  1V9D A;  2WBL A;  2X9X A;  2GK9 A;  1W09 A;  4DMV A;  3D0T A;  3EUH A;  1N36 T;  4AI6 A;  2E5L T;  3RLF F;  3AE1 A;  4GOU A;  3UU5 A;  5E0O A;  2Q9Q B;  4IHJ E;  4EYU A;  2CE7 A;  4OYJ A;  3QOF A;  3TLU A;  3K8P C;  2VKH A;  2LLY A;  3RIA A;  4UEM A;  1SUM B;  2LJL A;  1WLX A;  5LBM A;  2NWB A;  4UF0 A;  2JJ9 A;  3A8Y C;  1YQ4 A;  5L3C B;  4B6X A;  5DJQ C;  3I0Q A;  1Y64 B;  4DV2 T;  3ZPO A;  3AEG A;  4DBQ A;  2D5U A;  2BZB A;  2BG9 E;  3ZMT B;  4GK5 E;  2BDE A;  1YW0 A;  2X9H A;  2E8I A;  2WCA A;  3O4X E;  2V6Y A;  4EV6 A;  3RQW A;  2QRX A;  3AA7 B;  5FVK A;  4Q25 A;  3JCF A;  3VR9 A;  2L3L A;  4AKG A;  4BJM A;  4WBO A;  4N78 D;  2XQ9 A;  3OPC A;  5HCM A;  3F57 A;  1OED C;  2X9W A;  3A5X A;  3MAC A;  4U7Y A;  4JV5 T;  3VRA A;  1HFA A;  3LBX B;  3AE5 A;  2CPT A;  4LF8 T;  4UVC B;  3AE7 A;  5JDM A;  4DR6 T;  5CA0 E;  1ZP0 A;  2PG8 A;  4PJJ A;  5FMN A;  4U33 A;  1MND A;  1US7 B;  5L3E B;  4JI5 T;  2X66 A;  1LVF A;  4EEB A;  2YN6 A;  3K3Q C;  3ZMU B;  3PUG A;  2K24 A;  4ASK A;  2Y8D A;  3LK2 B;  1MIW A;  5CFB A;  4JYA T;  2W4X A;  2MAW A;  2LSY A;  2Y48 B;  1UGO A;  4FJO A;  4KMC A;  2XQ4 A;  4EAH A;  2CRB A;  4ZEY A;  2A2F X;  2WQY A;  3TLS A;  2Z6E A;  4DR2 T;  4U74 A;  2V8S V;  2WWV A;  4KP3 C;  3MKD A;  5EK4 A;  4YTN A;  3HA4 A;  3ZCI A;  5F3J A;  4UVB B;  1UX5 A;  4IT4 A;  4K0K T;  5A1L A;  3H3M A;  4GK0 E;  4UR9 A;  4DO0 A;  4IDP A;  5HEJ A;  2Q9Q A;  1HTJ F;  3LK4 2;  4B3R T;  2QYW A;  4HE8 A;  3JC6 D;  4LFC T;  4U31 A;  3AA1 B;  3RHW A;  1VCS A;  2FJD A;  2PTF A;  2EHO B;  4TNV A;  2YKS A;  2XM1 A;  3PUX F;  4CN1 A;  2VL0 A;  3UQ7 A;  4IE7 A;  4A5X A;  2L8K A;  2BKP A;  2Q9Q D;  4QWN B;  2H3R A;  5JRE A;  3O9X A;  3TLT A;  3C50 A;  2VQF T;  2L9Q A;  3E0Z A;  1LRZ A;  1WRD A;  3CPZ A;  3LSV A;  4PFP A;  1D0Z A;  2KT9 A;  4MFR A;  3EAM A;  1UUS A;  5IHY A;  2ACX A;  2WSS V;  2W00 A;  3CML A;  4GIW A;  4TNW A;  3JAF A;  3HKE E;  4BA9 A;  3F31 A;  4WZX A;  2XSA A;  2JRK A;  4WW0 A;  4P0B A;  3OBV E;  4CN6 A;  4U72 A;  2LM2 A;  2LT3 A;  1U4Q A;  2ODU A;  4JI0 T;  3O1I A;  4ILU A;  4ZZC A;  2W62 A;  2ZM2 A;  4PK6 A;  3LBX A;  2IC9 A;  3UUB A;  5L4E A;  4X65 T;  4PAG A;  3ZC0 A;  3KBT A;  4H9N C;  2R6G F;  3AEF A;  1IBK T;  2NOX A;  5L2L A;  2A3D A;  5LGT B;  3ZST A;  1J5W A;  4HKA A;  3B57 A;  4O4H E;  3AE2 A;  4O2A E;  5HEU A;  3ZMZ B;  5KXJ A;  3QB5 K;  3CQG B;  4EOZ B;  2HHH T;  4ANJ A;  3AXJ B;  4ZI2 C;  2XM2 A;  4KX6 A;  2PFV A;  4CXX A;  2LSG A;  3RYI E;  2BVM A;  3RH3 A;  1YXR A;  3MZK B;  2NTX A;  1IBM T;  3AEE A;  5LXT E;  1BR2 A;  2FBW A;  2LHR A;  4XZC A;  1G8X A;  2V6X A;  2YU2 A;  4C91 A;  4JI6 T;  1UK5 A;  2YDR A;  4LMK A;  3FZL B;  3M3Z B;  4AKR B;  4CZZ B;  4F8H A;  5ABH A;  1IJ6 A;  4CI3 B;  4EIW A;  2WY2 A;  4P0A A;  1DU2 A;  5LBQ B;  1XMQ T;  1LVK A;  2W63 A;  2ZMA A;  5KX5 E;  1VOM A;  1IZN B;  2J4G A;  4QH1 A;  2ZM0 A;  2EHO A;  4AKI A;  1YD8 G;  2HPJ A;  1WFD A;  1KNR A;  1D1A A;  3GA8 A;  3PUZ F;  1JNR A;  4LFA T;  3A7M A;  1I6Z A;  4LF9 T;  2XAQ B;  1JNZ A;  2XQA A;  5LA6 E;  1FJG T;  4IST A;  2YK0 A;  3AAE B;  2V7M A;  2XAS B;  2LKH A;  2EHO D;  3AE9 A;  4Z91 A;  3IHR A;  5ETW A;  5FXZ A;  3ZKR A;  4U2Z A;  4TZ4 C;  3NZP A;  1WCR A;  5L3G B;  3KFW X;  2JMK A;  2PJQ A;  4QXH B;  4EGW A;  4YSY A;  4X20 E;  3PE0 A;  4DVD A;  5JDF A;  1KK7 A;  3P7I A;  4U2Y A;  3SFD A;  4JEU B;  4AQF A;  3CVR A;  2ZLY A;  2NW8 A;  1HNX T;  4LMJ A;  1M7K A;  2CCQ A;  2CLY C;  3UUX B;  3R6N A;  3LK3 B;  2IML A;  2ZM8 A;  3Q2M A;  3ZJ1 A;  4HFB A;  4PK5 A;  5L3F B;  5DAB A;  3OTO T;  2V1D B;  2E5V A;  1MIY A;  3MJX A;  1HS7 A;  4QKN A;  3J7Y q;  4X1Y E;  2K3W A;  2VL8 A;  2I6H A;  2ZM6 T;  3C51 A;  2K9A A;  2BBJ A;  4QX7 B;  2D9D A;  5AQV B;  3LG7 A;  2X0L B;  3IEE A;  3PJA A;  1FMV A;  3AB3 B;  4EXT A;  3AXJ A;  3LJC A;  2IUB A;  4AKL A;  2KWH A;  5GON E;  3ZYM A;  5LGU B;  4UIG A;  4LF7 T;  5JDG A;  3ZT5 A;  4Z90 A;  1O3X A;  4IL9 A;  3RPU A;  4ZS2 A;  3EDU A;  4DV3 T;  4GYR A;  2DWG A;  2XHE B;  3WI3 A;  2MPK A;  4PJL A;  2WZH A;  4TWD A;  1OXZ A;  3OYZ A;  2E9X C;  4TWF A;  3N9M A;  2CXF A;  3HKD E;  3ZMS B;  2I59 A;  4WYV A;  2CBJ A;  3RQU A;  3PUW F;  4I50 E;  2CWY A;  3T8O A;  3MA9 A;  3KV5 A;  1W9R A;  1IBL T;  5HXH A;  3PUQ A;  4HFI A;  3E22 E;  3CKD A;  2X51 A;  1MIV A;  1MNE A;  2NW7 A;  3NRX A;  3ZSS A;  5AQO B;  3FZK B;  5HXS A;  3Q5D A;  3FZH B;  5H6R B;  4ZS3 A;  3AEC A;  2QVA A;  2BG9 C;  4IE0 A;  1NAF A;  1MMA A;  1KNZ A;  1XNR T;  1SA0 E;  1FMW A;  4KI0 F;  3OKQ A;  2UU9 T;  4P1N A;  4DV4 T;  3FBZ A;  5JRC B;  4PK4 A;  2UXD T;  3HI2 A;  4DND A;  1Z8U A;  2YU1 A;  4DV5 T;  3N9L A;  4O4I E;  5AQI B;  3UU4 A;  1XWM A;  2AE9 A;  5AQL B;  2UXB T;  4XAX B;  4AIU A;  4P09 A;  1EZ3 A;  2UXX B;  2JQH A;  2CLY B;  2X68 A;  3AE6 A;  2RPA A;  5FXV A;  3PUR A;  1HCI A;  4ZI3 C;  3AEB A;  4IE4 A;  3KDS E;  2LOP A;  3X1D A;  4L9I A;  4LML A;  1BR4 A;  5LB7 B;  3HKC E;  3CX8 B;  4OHF A;  1FIO A;  4JI3 T;  2J47 A;  4X64 T;  2VQE T;  4DV7 T;  5HXC A;  4H9P C;  4KHP T;  1E2A A;  4LF4 T;  4NXM T;  2KND A;  3LDQ B;  5C8Y E;  1MMD A;  3PTR B;  5C2T A;  1AJ3 A;  4OK0 A;  2WU5 A;  4YTM A;  4J2C A;  5J2U E;  1D0X A;  3C64 A;  1WYB A;  2H7O A;  4U3C A;  4GKJ T;  3H3A A;  2YDS A;  3Q5X A;  2D0T A;  1T72 A;  4ZI7 E;  3H37 A;  4BAY B;  4M1P A;  4X5T A;  2WS3 A;  5FL0 A;  2XQ8 A;  4B3M T;  1YKE B;  4I55 E;  3RIU C;  5JR9 C;  2OV9 A;  3TLW A;  2E9X B;  4I4T E;  3FZM B;  4IGU A;  4EZH A;  4DBR A;  2JIW A;  3BQK A;  3CQX C;  3RIF A;  4ADZ A;  3KV4 A;  3VU7 H;  4AXP A;  2W67 A;  4UV9 B;  1XZY A;  3N9O A;  5JTG A;  4HWC A;  4DMW A;  1HG2 A;  2WDR A;  2CM0 A;  4DUY T;  3ONJ A;  3U3I A;  1N32 T;  3P8C D;  4XBF B;  1XDO A;  5HXR A;  4F6R C;  4HGA A;  4CXW A;  2XUE A;  2IHR 1;  5FYM A;  5M4Y A;  3OVU A;  3AE4 A;  5JRC A;  3RGL A;  3WAJ A;  1BR0 A;  4H9S E;  3OJA A;  4CI1 B;  2YOE A;  1IAP A;  4KBM B;  2W61 A;  2YDQ A;  3O1J A;  4OX9 T;  1ZHC A;  1B7T A;  1YQ3 A;  4CXY A;  1HG5 A;  3N2G E;  2K5B B;  1NEN A;  4HWH A;  3G06 A;  1XDP A;  2MBG A;  2WZI A;  5JH7 E;  3RYF E;  2BS2 A;  3PV0 F;  4YJ3 E;  2A9U A;  4YLH A;  2M6I A;  5LMN T;  4DR7 T;  4QH5 A;  1VCT A;  3L39 A;  1J1J A;  2PBI A;  2IDO B;  3CK6 A;  1ZV4 X;  4HWF A;  3U78 A;  5JDH A;  3AED A;  3P4W A;  4B3S T;  3AA0 B;  1HNW T;  3F2E A;  3UU6 A;  4IL4 A;  5HEG A;  3C4W A;  2UUA T;  5F8P A;  4JBW F;  1NEK A;  4AQG A;  4PFO A;  1OED B;  3ZMV B;  4HWI B;  5L4H A;  4QXB B;  1SE7 A;  2CEA A;  2BVL A;  3AEA A;  3MXZ A;  4O4L E;  4ISS A;  4PJM A;  2K48 A;  4YSZ A;  3AVR A;  3T1H T;  4G63 A;  2X67 A;  3ZJ2 A;  2AXD S;  2WAU A;  2E9X A;  2V7I A;  5LP6 E;  3BQL A;  2KSR A;  5JR9 B;  4YY3 T;  1MMN A;  5H6Q B;  3GWH A;  3NRY A;  1KFY A;  2VKD A;  1WR6 A;  5KMG P;  2LRK A;  3WAK A;  3N5L A;  5LG4 A;  1QUU A;  5FXW A;  4QXC B;  2V5C A;  3EAB A;  2LKG A;  5BR8 T;  5HYA A;  2X9Y A;  3I0O A;  1GQE A;  3NVO A;  2OLT A;  3ZYK A;  3IF8 B;  2NW9 A;  4JUY A;  1ZEE A;  4U7I A;  5AQT B;  3VKH A;  5ABF B;  1ZKE A;  3DP7 A;  3N2O A;  3JC6 C;  4MLK A;  3PUV F;  5J1G A;  3PUA A;  2DCF A;  2B76 A;  4ERR A;  2N2N A;  5LHH B;  4DR3 T;  4QX8 B;  2UXN B;  3QUJ A;  3RYC E;  5JQG E;  2JMH A;  3AA6 B;  2KXP B;  1HF8 A;  2DI4 A;  2Q9Q C;  2LSI A;  2CXL A;  2VAS A;  2XAJ B;  3P4S A;  5JDL A;  5TAO A;  3VHL A;  5HXE A;  2CBI A;  2RA1 A;  2X0Y A;  5CA1 E;  3EHZ A;  4NUU A;  4O4J E;  4AIS A;  2IIU A;  3CX7 B;  4IDZ A;  4PNI A;  3JAE A;  3M65 A;  5JDQ A;  3ONL C;  4UEL A;  5LG3 A;  3TKL B;  2UUB T;  1ZOY A;  1N34 T;  1OED A;  2B1E A;  5LYJ E;  3PU3 A;  4ZI3 D;  2IW5 B;  2W66 A;  2CHN A;  2ES0 A;  2LE8 A;  4CI2 B;  3NBX X;  2DWK A;  3J9X 1;  3E08 A;  3CWZ B;  4UXN B;  2VWA A;  1XNQ T;  3I9Y A;  3AVS A;  5L47 A;  2V7J A;  3RF1 A;  4ZHQ E;  3RC8 A;  2M6B A;  1KF6 A;  4ZOL E;  4JI2 T;  2V7L A;  2J62 A;  2XPK A;  4H9O C;  3HR0 A;  3RIU A;  4ZXL A;  5JR9 A;  4EZ4 A;  1FEW A;  3CQC B;  1UUR A;  5LHI B;  2WMO A;  2WP9 A;  4G2A A;  3SFE A;  1VRB A;  3FBL A;  2SPC A;  4IE5 A;  4NXN T;  4PJN A;  4JI7 T;  2BS4 A;  4H63 H;  1KEY A;  4YFS A;  5LGN B;  3ANW B;  2D0U A;  2CMR A;  5IUX A;  4X1K E;  5F5W A;  1YKH B;  2DL1 A;  5EZY E;  4E7S A;  3MK7 C;  4JI8 T;  4MHC A;  2KMF A;  3SWH A;  2UUC T;  1LKX A;  4GKK T;  2V26 A;  5ABF A;  4HEA A;  2V5D A;  4CN4 A;  2X0H A;  1U5P A;  5FY1 A;  5LOV E;  3FZF B;  2XAF B;  3RKG A;  2H7V C;  2N9D A;  2C5I T;  2CA5 A;  3EI0 A;  2WB5 A;  4TUY E;  4L0R A;  2CHO A;  2XQ3 A;  4HFH A;  3EDV A;  2LSK A;  1QLB A;  3O1H A;  4COF A;  3PUY F;  4X1I E;  5BMV E;  4X62 T;  2EHO C;  4HFD A;  2Y6X A;  2CXD A;  4C90 A;  4DV6 T;  3QB5 A;  3AAA B;  5LCY A;  4E7Z A;  3ZN1 B;  1R8I A;  1X9B A;  4EED A;  2W2U A;  1HX8 A;  2V7K A;  1J5E T;  4YXD A;  4IDQ A;  1WR0 A;  1M62 A;  2WDQ A;  3FXE B;  3PDY A;  3AAI A;  3SRZ A;  3NWI A;  5AQF B;  1WYC A;  3FXD B;  4L5G A;  1NWM X;  3HKB E;  4YSX A;  2HN2 A;  3GMI A;  1S35 A;  3GN5 B;  1Y01 A;  4MBQ A;  2FJA A;  5AQG B;  3K3N A;  4AQF C;  1HNZ T;  5FY7 A;  4HN9 A;  2C0S A;  1QSD A;  2XQ7 A;  2LM9 A;  3JAD A;  2NR4 A;  3CX6 B;  3KVA A;  3DJB A;  2H88 A;  4A98 A;  1BR1 A;  3ANW A;  2JQ9 A;  4LF5 T;  2WMN A;  5HCJ A;  3FB2 A;  3ZT6 A;  2I0M A;  2BKO A;  3IBP A;  4UVA B;  1E1H B;  5HAX A;  4ZI2 D;  4QH4 A;  4X66 T;  5FXX A;  2CWO A;  3L3P A;  2BBH A;  1G73 A;  2C5K T;  5AFU L;  4O8S A;  5DQW A;  3S4U A;  1OED E;  1UX4 A;  4NPP A;  2LSJ A;  3SOL A;  2YEV C;  4KUM B;  3P4Q A;  1IJ5 A;  2JPF A;  2BKN A;  2KZ7 B;  3TLV A;  5C3J A;  3QNU A;  4HWD A;  2E2A A;  4YJ2 E;  5AQK B;  4HFE A;  2ODV A;  2F4V T;  4A56 A;  4YT0 A;  5L3D B;  2J1D G;  1I94 T;  4V1A v;  1UCU A;  3RKO A;  5ADX L;  2BG9 B;  3QK6 A;  4IDN A;  4IRE A;  4H9R C;  3L09 A;  2VVS A;  4I0U A;  3L8R A;  4EYY R;  3C4Z A;  5FVL A;  4EB6 E;  5KDM C;  3T1Y T;  3PU8 A;  2HN1 A; 
#chains in the Genus database with same CATH homology
 2UXD T;  4K0K T;  4DR1 T;  4DV5 T;  4LFA T;  5BR8 T;  4AQY T;  4X65 T;  4LF7 T;  4DV0 T;  4YHH T;  4LF9 T;  1N33 T;  1XNQ T;  1IBK T;  4B3S T;  4B3R T;  1FJG T;  1HNW T;  4LF5 T;  2UXB T;  4LFC T;  5LMU T;  4JI1 T;  2UUA T;  4JI2 T;  4DV3 T;  4DV1 T;  4X66 T;  4JI4 T;  4X62 T;  4DR5 T;  5IWA T;  2HHH T;  1N36 T;  2UXC T;  4JV5 T;  2E5L T;  4DR3 T;  4DUY T;  4LF6 T;  4LF8 T;  4NXN T;  1N32 T;  4DV6 T;  2VQF T;  4JI7 T;  4JI3 T;  4DR6 T;  4DUZ T;  1HNX T;  1IBM T;  4X64 T;  2VQE T;  3T1H T;  4JI5 T;  4DV7 T;  1IBL T;  1J5E T;  1HR0 T;  4KHP T;  4JI6 T;  4LF4 T;  3OTO T;  4NXM T;  2F4V T;  1XMO T;  4JI8 T;  4JYA T;  4OX9 T;  4YY3 T;  1I94 T;  4DR4 T;  4LFB T;  2ZM6 T;  2UUC T;  1XMQ T;  4GKJ T;  4B3T T;  4GKK T;  4DR2 T;  4DV2 T;  1XNR T;  2UU9 T;  2UUB T;  1N34 T;  1HNZ T;  4JI0 T;  4DR7 T;  5LMN T;  4DV4 T;  4B3M T;  3T1Y T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...