4DUYT

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, u13c
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
99
structure length
99
Chain Sequence
b'RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
molecule tags Ribosome
publication title A structural basis for streptomycin resistance
rcsb
total genus 34
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 4duyT00
3OTOT 4NXNT 4JI8T 2UXDT 4JV5T 4JI5T 4JI4T 4DV6T 2ZM6T 4B3TT 4DV1T 4DV0T 4B3RT 4X62T 1N36T 4DR5T 4DV2T 1XMQT 1FJGT 1I94T 5LMUT 4B3MT 4DR2T 3T1YT 4DR6T 2UUCT 4DUZT 4JI3T 4JI1T 4YHHT 4DR4T 5LMNT 4LF8T 4NXMT 4LFAT 4LF6T 1HR0T 4DV3T 4DV5T 4X66T 4JYAT 1XNRT 2F4VT 4LFCT 4GKJT 4B3ST 4DR7T 4LF7T 4LFBT 4JI0T 1N34T 4OX9T 4JI6T 2HHHT 1XNQT 4DV4T 1HNZT 1HNXT 1IBMT 5IWAT 5BR8T 1J5ET 4DUYT 4X64T 4LF4T 2UU9T 1IBKT 2UUBT 4JI2T 4AQYT 2UXBT 1N33T 3T1HT 2VQET 1IBLT 2UXCT 4K0KT 4DR1T 4KHPT 2E5LT 1XMOT 4DR3T 2UUAT 2VQFT 4X65T 4DV7T 4LF5T 4YY3T 1HNWT 4GKKT 4JI7T 1N32T 4LF9T
chains in the Genus database with same CATH superfamily
4YJ3E 3RKOA 5JR9A 5JDLA 3OTOT 2M6BA 4X5TA 1UK5A 1OXZA 2OLTA 5JRCB 2JPFA 2YU2A 4ILUA 4HFBA 4ILBA 4JI5T 3RQWA 2NR4A 3K3NA 4DV6T 5IHYA 3UT5E 2A9UA 3HKBE 2NP9A 2V8SV 3IF8B 3UFGA 2LSKA 4A5XA 2CLYC 3I1AA 5A1LA 2IUBA 2J62A 2E5VA 2X0LB 4OHFA 2UXXB 2VASA 4BJNA 4KI0F 4DV2T 2DNXA 4EYYR 2CA5A 4A56A 1B7TA 2LSYA 3UU3A 3LBXA 1I94T 4DO0A 2IMLA 2WS3A 5LMUT 2BVMA 1G8XA 4O4IE 3MK7C 4TX5A 3J9X1 4EV6A 4YTPA 3QK6A 1ZP0A 1U5PA 4PFPA 2UUCT 2WDVA 4DUZT 4JI3T 2MOZA 3Q5DA 2QA7A 3AEDA 2W2UA 4OK0A 4ZXLA 3AAIA 3EUHA 1YXRA 2WU2A 3CIRA 2HPLA 5LMNT 5AQNB 2I59A 5JDFA 4LF8T 2FJEA 4EZ4A 1MMAA 4LMJA 5L3FB 2JQHA 2DLRA 1QLBA 4LFAT 3UFEA 5LXTE 3GMIA 1O3XA 2K48A 2W61A 4E7ZA 1KNPA 5FP3A 1M62A 4DV3T 1KFYA 2D2SA 2JMHA 2V1DB 3AEAA 5EZYE 4ZI3C 3AAAB 3U3IA 4X66T 4DV5T 4JYAT 5LBMA 5LYJE 2HPJA 3B57A 4L9IA 5M4YA 3RQUA 1JNRA 1L0VA 2I6HA 4GKJT 5JVDE 3QOFA 4DNDA 4B3ST 3NWIA 4H9RC 2WP9A 2X0HA 4U33A 2K5BB 4JI0T 2WBLA 2V5CA 4WNKA 2DWGA 2E9XC 3C51A 2VKJA 5AQJB 3ZCJA 4GYRA 4O8SA 1S94A 5CGMA 3F2EA 3VHLA 4HWDA 4CN4A 3BQKA 2DCFA 2W67A 3CWZB 5LCYA 4X1KE 5KDMC 2DHRA 3NKZA 4IE7A 4MHCA 5LP6E 3LSVA 3T8OA 4PW8A 1LRZA 1MMGA 2WU5A 3RYCE 3VU7H 3ZMTB 3PJAA 4KBMB 3ONJA 1BR2A 4Z91A 4UR9A 1HX8A 1ZEEA 2LLYA 3JAEA 3P7IA 1Y01A 4MALA 2X0YA 4YFSA 4YJ2E 3A8YC 3UTKA 4JI2T 4GYSA 1W0BA 2X9XA 3K8PC 3KVAA 3SRZA 4YT0A 3T1HT 1WRDA 4QH4A 2JRKA 2A3DA 2VQET 3N9MA 1IBLT 3C50A 2JQ9A 1QUUA 4TWFA 2N9DA 3EDUA 4I0UA 3TLTA 3WAKA 4K0UA 5L2LA 1D0ZA 2NWBA 2OV9A 3PU3A 4UVCB 2K3WA 3RGLA 2E5LT 2CMRA 2CXLA 1X9BA 4U74A 1YKEB 4IE6A 4GOUA 3I0QA 1KNZA 3KDSE 3TLUA 3AAEB 2YN6A 4PK5A 3DTOA 5LBQB 3O9XA 2AE9A 3NBXX 4H63V 2VQFT 2X51A 3Q5XA 2IHR1 4UV8B 2XM1A 1KK7A 3VKGA 2LHNA 3ONLC 1VOMA 2V5DA 3CX6B 5EK4A 3N2GE 5L3DB 2BZBA 3I9WA 1D1BA 2LEHA 4UVBB 4LF5T 2KSRA 3GA8A 5F8PA 3AE4A 2WWVA 4I43B 4YY3T 1HNWT 1E1HB 3E22E 4GKKT 2CHNA 3FZLB 3X1DA 2YINA 4HWFA 2D9DA 4ILCA 1YD8G 5FY0A 4AIUA 5JH7E 1T72A 3P4RA 5AQPB 5AQFB 3EDVA 3N9PA 2XAJB 5JREA 1UX5A 4N78D 1Z8UA 2Y8DA 4DMVA 4JEUB 5FKYA 2V7MA 4QWNB 2LOSA 3QNUA 4X20E 3AA1B 3F31A 3KINB 4QXCB 4QH5A 1SHZC 5LGTB 4JI8T 3AE8A 4EZHA 2BKOA 4U7IA 2WWUA 5AQIB 1W0AA 4AXPA 2Q9QB 2DI4A 3HI2A 4JV5T 3LJCA 4CXXA 3EAMA 3PUWF 3DJBA 2YKSA 3MJXA 4UEMA 4B3TT 2LKHA 2VL8A 5FVKA 1J1JA 5JDMA 1CHUA 1V9DA 2XJ7A 4UF0A 2LE8A 2RPAA 4QX7B 4CXWA 3CX7B 2JJ9A 2ES0A 4PJLA 4WW0A 1FIOA 3RH3A 5E0OA 5FXVA 5AQHB 5AQLB 3UU4A 4B3MT 3LFMA 4I55E 3VRBA 1IJ5A 2LSIA 2N1GA 4AISA 2XASB 4YTMA 4ZS2A 3LG7A 5LB7B 2UXNB 1US7B 3UUNA 4ZEYA 4ZI3D 4JI1T 1W9RA 1T7SA 3EABA 1E2AA 1MMNA 2J1DG 4KUMB 4CI3B 5CA1E 5L3GB 5HXEA 5LJMA 2JMKA 4QXBB 5J2TE 4TUYE 4AKIA 4IDPA 2ZM0A 2J47A 2YDRA 4U31A 4Z8XA 2ZM2A 2H89A 1FMVA 3PE0A 5FYMA 1MNEA 2DL1A 2P9BA 1NEKA 1D1CA 1M7KA 1ZV4X 2CWOA 2CHOA 2E9XD 3ANWA 4IE4A 2Z6EA 5FMNA 3RF1A 3ZYKA 5L3BB 3N2OA 5JDQA 2F4VT 1OWAA 3PUAA 4IL9A 4IT4A 2MYSA 1LVKA 4PNIA 4C90A 4LFCT 3L3PA 1HF8A 4O2BE 2RP4A 3I9YA 5DJQC 4TWHA 3UU6A 2C0SA 3ZT6A 4DR7T 2EHOB 3ZT7A 4COFA 4LFBT 4TNWA 3NVOA 1N34T 1MNDA 3CPZA 5EK2A 3OYXA 3ZSTA 2IC9A 2WQYA 3A5XA 4AKHA 5AQTB 5KXJA 1YKHB 3A7MA 3L8RA 1NWMX 4ISSA 4OYJA 5ABGA 2D0UA 4ZZCA 3RC8A 4KP3C 2GK9A 3ONXA 1HCIA 4HWHA 3ZMZB 4IE5A 1LKXA 2KWHA 2D5UA 2RA1A 2EHOC 2IC6A 4YHJA 3RRCA 4BA9A 2VURA 4PJNA 5C8YE 2Y48B 4JEHB 2JQQA 3B5MA 3JC6D 2A2FX 3S4UA 4X64T 4LF4T 3Q2MA 3D0TA 3LK42 4U3CA 1XDPA 2LKGA 4HFIA 4EIWA 4MFRA 2NW9A 3P4PA 2UUBT 5JR9C 4BJMA 2CBIA 2YDSA 1VCTA 3O1JA 3AECA 3AVSA 4ISTA 3AA7B 5JDGA 5F3JA 3RHWA 1UCUA 4UIGA 4QX8B 2VB6A 2CWYA 2YOEA 3TKLB 1ZHCA 5AQQB 4CQIA 4DIDB 5FY7A 2E9XB 4EOZB 3AE7A 5HEJA 1XMOT 1J5WA 3QB5K 5LHHB 3KV6A 4HN9A 3ZC0A 3ZJ2A 3IEEA 2XQYA 3ETUA 1MIVA 2KLQA 2Q9QA 3I0OA 3U78A 3OPCA 5AQGB 4O2AE 5FXZA 4AKLA 2FUPA 3C98B 4IL4A 3BK9A 2FJAA 2BKPA 2CCQA 4G63A 3CKDA 3R6NA 1OEDC 2FBWA 2CPTA 4IIJE 1VRBA 2WAUA 4A97A 2NOXA 4HFEA 1UX4A 5HEUA 4U2ZA 4HWCA 3LK3B 3C64A 4ERRA 4CI1B 4JI7T 4KX6A 1UUSA 2NTXA 1KF6A 2BG9A 1N32T 4WZXA 1MMDA 1SUMB 2PJQA 3KV5A 3Q5WA 3K3OA 3LBXB 4HEAA 3ZPOA 3AE2A 5LGNB 5AQKB 4AI6A 1AJ3A 4H9PC 5HXSA 2XSAA 4XBFB 4MLKA 4EAHA 5LA6E 2AXDS 3E0ZA 4JUYA 2V7KA 2NTYA 5EK3A 4IDNA 3RLFF 4A98A 4AQFA 4NXNT 2BS2A 2XHEB 5HCMA 1XWMA 4CN1A 3OVUA 4IDQA 5HEOA 2UXDT 3PDYA 2X68A 5HEHA 1FEWA 4JBWF 1WFDA 5L4EA 1BR0A 1R8IA 2FJBA 3AA0B 3OYZA 3UUMA 3VKHA 4XZCA 4DV0T 2IAKA 4PJJA 4QHOA 2QRXA 3PUSA 2IDOB 3FB2A 4LMKA 4WYVA 3PJAJ 3UU5A 3ZCIA 1IJ6A 3VR8A 3ZMSB 5LHIB 2WZHA 3EI0A 4KHZF 2BKNA 1S35A 2WDQA 3WI3A 1IAPA 1MIWA 2XY8B 3ETVA 4O4LE 3GN5B 2E9XA 4HFVA 2MPKA 1DU2A 4HTEA 5JRCA 3MXZA 4NPPA 4DR2T 1SE7A 3T1YT 3H37A 5ABHA 1G73A 2CE7A 4WBOA 3LK2B 2ODUA 5HAXA 5FVLA 1KEYA 3P8CD 3VRAA 4IREA 3ZYLA 3ZC1A 2BDEA 2CEAA 5AQUB 5IYZE 2H7OA 2LRKA 2MTQA 2L8KA 2C5KT 4L5GA 5AQOB 4F8HA 3CQCB 5L3CB 5LGUB 2M67A 3AE5A 1BR4A 5FY1A 2X9YA 2XM2A 4Q25A 4M1PA 1ZKEA 5IUXA 5JDHA 1WR6A 2E8IA 2X9WA 3ESLA 3PUXF 4PK4A 5ABFA 1HR0T 3SS1A 4U7YA 4U72A 2N2NA 1X79A 4IGUA 2WSSV 3O1HA 3SWHA 1OEDB 1YQ3A 1SA0E 2IW5B 3RPUA 3PU8A 3TLVA 2W63A 2J4GA 2VL0A 3EHZA 3CQXC 2VVNA 3P4WA 4H9SE 4TN7B 2G0UA 3AA6B 5AQSB 4EB6E 3FHNA 4I4TE 3FXEB 2ZMAA 3N9LA 2K9AA 4OYKA 5FL0A 3ZN1B 4CN6A 5CFBA 3AXJB 4PFOA 4CZZB 4IE0A 3F57A 1XZYA 1UURA 1T98A 2KXPB 2HN1A 5LOVE 2BS3A 2DWKA 4FJOA 3ZMVB 4JI6T 2HHHT 3AE9A 5LJNA 5KX5E 3AE6A 1WCRA 3WAJA 2LM9A 4UF0B 5CJ5A 1XNQT 4QXHB 3IBPA 2NW8A 2V7LA 3FZKB 4JLEA 4NUVA 2ACZA 3UU8A 4DV4T 3ZLIA 1HNZT 1IBMT 2VKHA 5BR8T 4YXDA 4QH1A 1J5ET 5JR9B 3AEEA 2L9QA 4DUYT 4ZI2D 3BQIA 3Q5EA 4GK5E 2D0TA 2Q9QD 3AE1A 4X1IE 3SFEA 4UELA 3TLWA 1D1AA 3JC6C 1HFAA 5H6RB 3RIFA 2UXBT 2CM0A 3PURA 2QVAA 2CXDA 5HYAA 3FZHB 5CA0E 3NRYA 1HTJF 2XQAA 2LM2A 3OKQA 3RC3A 4DR1T 2YEVC 5L47A 2X67A 5F5WA 2K24A 1MIYA 2VKOA 2QGSA 2XSBA 4O4HE 4YLHA 3RI5A 4EXTA 4WBNE 3O1IA 3VR9A 2XQ4A 2C5IT 4IHJE 4H9QC 2ACXA 2CXFA 2KINB 3ANWB 2V7JA 4GK0E 2W0GA 5TAOA 2H7VC 3UUXB 3FBZA 2V6YA 2V26A 3ZJ1A 3HKCE 3PUQA 1WR0A 4X65T 5LHGB 2L3LA 1NAFA 1U4QA 3MKDA 3FZMB 5C3JA 2KT9A 3CVRA 2WCAA 5DQVA 4DV7T 5H6QB 3OJAA 3CK6A 4HFDA 3NZQA 3O4XE 4H9NC 2CRBA 2WMOA 3NRXA 4TNVA 2KMFA 3JCFA 2JQKA 3FZFB 4ASKA 2ZLYA 3KV4A 2IIUA 5AQMB 3ABVA 4ADZA 1I6ZA 5HWYA 4NUUA 4E7SA 1HS7A 2CLYB 3PV0F 2SPCA 2ODVA 4YSYA 3RYIE 4YSZA 2XQ9A 3V5UA 3CX8B 4LF9T 2VK9A 3OBVE 5AQRB 1FMWA 4HFCA 4ZS3A 1Y64B 5HCJA 2B1EA 4J2CA 4P0AA 2KZ7B 2CBJA 2I0MA 2PG8A 3MA9A 2YK0A 2WY2A 2VVSA 3P4SA 5FL1A 5JDNA 5L4HA 2EHOD 1IBKT 3C4XA 1QSDA 4DBRA 3AEBA 1OEDE 3IHRA 4QKNA 4TWDA 4P09A 5KMGP 2XAQB 4HWIB 2FJDA 5DABA 4JI4T 3JADA 5LG3A 4ZZBA 2ZM6T 1WLXA 1IZNB 4DV1T 2V6XA 2X9HA 2LSJA 3CMLA 3MZKB 5HXRA 2YDQA 3HKEE 4EEDA 3UQ7A 2HN2A 4NIQA 4GIWA 5HEGA 1HG5A 2LOPA 3C4WA 4X62T 1N36T 3N2KE 3RYHE 3IA3A 4DR5T 2PFVA 3H3AA 5FNVE 2BVLA 4MBQA 4AQGA 4ZI7E 4TV8E 1XMQT 1FJGT 5C2TA 1H7CA 4HKAA 2W66A 2XZEA 2LRLA 4CXYA 3P4QA 2Q9QC 2XQ6A 2Y6XA 5FXWA 3TLSA 4DR6T 2LT3A 3AE3A 1UGOA 2M6IA 4YSXA 3P50A 5J0ZA 4YHHT 3NZPA 3QC9A 4DR4T 2NW7A 3KBUA 1ZOYA 3LDQB 4ILAA 2MBGA 5J2UE 3ZYMA 4TV9E 3HR0A 1CUNA 4UVAB 3RRWA 1W09A 2EHOA 3ZN0B 4NXMT 3DP7A 3N9OA 5DQWA 2BG9C 2PBIA 2XQ5A 2WB5A 3RX6A 1E7PA 2BS4A 4EGWA 2W00A 3HL6A 3PUVF 4LF6T 3GWHA 1HX1B 3JAFA 4ZHQE 2XQ7A 2LSGA 3PTRB 3RIUC 3UUBA 4YTNA 4V1Av 1XDOA 2C5JA 2E2AA 5AQVB 4BAYB 4P1NA 3ZEFB 2VWAA 1HG2A 1XNRT 2VKDA 4AQFC 4L0RA 3RIAA 5LG4A 3V5SA 2H3RA 2WM9A 3N9NA 1EZ3A 4U2YA 2BG9E 4KHPT 5GONE 4FI5A 3KV9A 4LF7T 4PJMA 4OX9T 4HGAA 3RYFE 3N5LA 2A72A 3QB5A 1D0YA 3CQGB 3R84B 3ZSSA 4C91A 3M65A 1WYBA 1YW0A 5ADXL 1JNZA 3RIUA 1GQEA 1T8BA 4H9OC 4X1YE 4DBQA 1WYCA 1OEDA 3BQLA 4LMLA 1Z0PA 2W62A 3FBLA 4PAGA 4UXNB 5IWAT 4O4JE 1HNXT 4HFHA 3EVYA 3PUGA 2W4XA 5ETWA 2WDRA 3GN5A 2BBHA 4UV9B 5CB4E 3KVBA 5HXCA 2XAGB 3G06A 4CI2B 3AXJA 3PUYF 4B3RT 2UU9T 5HWXA 1NENA 5JQGE 4G2AA 3H3MA 3AEGA 3MACA 3QUJA 3PUZF 3W15B 4ANJA 4EEBA 2XUEA 4PK6A 5J1GA 2XTLA 3K1SA 1YQ4A 3Q9DA 4AQYT 1N33T 2PTFA 2WZIA 2QYWA 3L39A 3FXDB 2UXCT 2KNDA 2V7IA 4K0KT 2BG9B 4XAXB 1LVFA 1D0XA 3KBTA 4KMCA 3ZKRA 4IDZA 5ABFB 2XAHB 4EYUA 5BMVE 1VCSA 2LHRA 4Z90A 3ZT5A 4F6RC 4DMWA 5JTGA 4TZ4C 3KFWX 3HKDE 5HXHA 4H63H 4DR3T 4I50E 3RKGA 2UUAT 3ZMUB 4B6XA 2XPKA 4P0BA 4AKGA 2XQ8A 3B13A 2X66A 5LNKA 5L3EB 3AVRA 4ZI2C 5ABEA 2BBJA 3E08A 5AFUL 4HE8A 2XAFB 2KWIB 2HH7A 5FXXA 3N9QA 3UULA 2ZM8A 3AB3B 3SFDA 2R6GF 4AKRB 3C4ZA 1BR1A 2XQ3A 3L09A 2OA5A 4OFZA 3UQ4A 3K3QC 2H88A 2LJLA 2WMNA 4IDOA 3AEFA 3M3ZB 2JIWA 2MAWA 2V6YB 3SOLA 3J7Yq 4DVDA 2YU1A 2B76A 4ZOLE 3HA4A 1KNRA
chains in the Genus database with same CATH topology
3OTOT 4NXNT 4JI8T 2UXDT 4JV5T 4JI5T 4JI4T 4DV6T 2ZM6T 4B3TT 4DV1T 4DV0T 4B3RT 4X62T 1N36T 4DR5T 4DV2T 1XMQT 1FJGT 1I94T 5LMUT 4B3MT 4DR2T 3T1YT 4DR6T 2UUCT 4DUZT 4JI3T 4JI1T 4YHHT 4DR4T 5LMNT 4LF8T 4NXMT 4LFAT 4LF6T 1HR0T 4DV3T 4DV5T 4X66T 4JYAT 1XNRT 2F4VT 4LFCT 4GKJT 4B3ST 4DR7T 4LF7T 4LFBT 4JI0T 1N34T 4OX9T 4JI6T 2HHHT 1XNQT 4DV4T 1HNZT 1HNXT 1IBMT 5IWAT 5BR8T 1J5ET 4DUYT 4X64T 4LF4T 2UU9T 1IBKT 2UUBT 4JI2T 4AQYT 2UXBT 1N33T 3T1HT 2VQET 1IBLT 2UXCT 4K0KT 4DR1T 4KHPT 2E5LT 1XMOT 4DR3T 2UUAT 2VQFT 4X65T 4DV7T 4LF5T 4YY3T 1HNWT 4GKKT 4JI7T 1N32T 4LF9T
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OTO T;  4NXN T;  4JI8 T;  2UXD T;  4JV5 T;  4JI5 T;  4JI4 T;  4DV6 T;  2ZM6 T;  4B3T T;  4DV1 T;  4DV0 T;  4B3R T;  4X62 T;  1N36 T;  4DR5 T;  4DV2 T;  1XMQ T;  1FJG T;  1I94 T;  5LMU T;  4B3M T;  4DR2 T;  3T1Y T;  4DR6 T;  2UUC T;  4DUZ T;  4JI3 T;  4JI1 T;  4YHH T;  4DR4 T;  5LMN T;  4LF8 T;  4NXM T;  4LFA T;  4LF6 T;  1HR0 T;  4DV3 T;  4DV5 T;  4X66 T;  4JYA T;  1XNR T;  2F4V T;  4LFC T;  4GKJ T;  4B3S T;  4DR7 T;  4LF7 T;  4LFB T;  4JI0 T;  1N34 T;  4OX9 T;  4JI6 T;  2HHH T;  1XNQ T;  4DV4 T;  1HNZ T;  1HNX T;  1IBM T;  5IWA T;  5BR8 T;  1J5E T;  4DUY T;  4X64 T;  4LF4 T;  2UU9 T;  1IBK T;  2UUB T;  4JI2 T;  4AQY T;  2UXB T;  1N33 T;  3T1H T;  2VQE T;  1IBL T;  2UXC T;  4K0K T;  4DR1 T;  4KHP T;  2E5L T;  1XMO T;  4DR3 T;  2UUA T;  2VQF T;  4X65 T;  4DV7 T;  4LF5 T;  4YY3 T;  1HNW T;  4GKK T;  4JI7 T;  1N32 T;  4LF9 T; 
#chains in the Genus database with same CATH topology
 4YJ3 E;  3RKO A;  5JR9 A;  5JDL A;  3OTO T;  2M6B A;  4X5T A;  1UK5 A;  1OXZ A;  2OLT A;  5JRC B;  2JPF A;  2YU2 A;  4ILU A;  4HFB A;  4ILB A;  4JI5 T;  3RQW A;  2NR4 A;  3K3N A;  4DV6 T;  5IHY A;  3UT5 E;  2A9U A;  3HKB E;  2NP9 A;  2V8S V;  3IF8 B;  3UFG A;  2LSK A;  4A5X A;  2CLY C;  3I1A A;  5A1L A;  2IUB A;  2J62 A;  2E5V A;  2X0L B;  4OHF A;  2UXX B;  2VAS A;  4BJN A;  4KI0 F;  4DV2 T;  2DNX A;  4EYY R;  2CA5 A;  4A56 A;  1B7T A;  2LSY A;  3UU3 A;  3LBX A;  1I94 T;  4DO0 A;  2IML A;  2WS3 A;  5LMU T;  2BVM A;  1G8X A;  4O4I E;  3MK7 C;  4TX5 A;  3J9X 1;  4EV6 A;  4YTP A;  3QK6 A;  1ZP0 A;  1U5P A;  4PFP A;  2UUC T;  2WDV A;  4DUZ T;  4JI3 T;  2MOZ A;  3Q5D A;  2QA7 A;  3AED A;  2W2U A;  4OK0 A;  4ZXL A;  3AAI A;  3EUH A;  1YXR A;  2WU2 A;  3CIR A;  2HPL A;  5LMN T;  5AQN B;  2I59 A;  5JDF A;  4LF8 T;  2FJE A;  4EZ4 A;  1MMA A;  4LMJ A;  5L3F B;  2JQH A;  2DLR A;  1QLB A;  4LFA T;  3UFE A;  5LXT E;  3GMI A;  1O3X A;  2K48 A;  2W61 A;  4E7Z A;  1KNP A;  5FP3 A;  1M62 A;  4DV3 T;  1KFY A;  2D2S A;  2JMH A;  2V1D B;  3AEA A;  5EZY E;  4ZI3 C;  3AAA B;  3U3I A;  4X66 T;  4DV5 T;  4JYA T;  5LBM A;  5LYJ E;  2HPJ A;  3B57 A;  4L9I A;  5M4Y A;  3RQU A;  1JNR A;  1L0V A;  2I6H A;  4GKJ T;  5JVD E;  3QOF A;  4DND A;  4B3S T;  3NWI A;  4H9R C;  2WP9 A;  2X0H A;  4U33 A;  2K5B B;  4JI0 T;  2WBL A;  2V5C A;  4WNK A;  2DWG A;  2E9X C;  3C51 A;  2VKJ A;  5AQJ B;  3ZCJ A;  4GYR A;  4O8S A;  1S94 A;  5CGM A;  3F2E A;  3VHL A;  4HWD A;  4CN4 A;  3BQK A;  2DCF A;  2W67 A;  3CWZ B;  5LCY A;  4X1K E;  5KDM C;  2DHR A;  3NKZ A;  4IE7 A;  4MHC A;  5LP6 E;  3LSV A;  3T8O A;  4PW8 A;  1LRZ A;  1MMG A;  2WU5 A;  3RYC E;  3VU7 H;  3ZMT B;  3PJA A;  4KBM B;  3ONJ A;  1BR2 A;  4Z91 A;  4UR9 A;  1HX8 A;  1ZEE A;  2LLY A;  3JAE A;  3P7I A;  1Y01 A;  4MAL A;  2X0Y A;  4YFS A;  4YJ2 E;  3A8Y C;  3UTK A;  4JI2 T;  4GYS A;  1W0B A;  2X9X A;  3K8P C;  3KVA A;  3SRZ A;  4YT0 A;  3T1H T;  1WRD A;  4QH4 A;  2JRK A;  2A3D A;  2VQE T;  3N9M A;  1IBL T;  3C50 A;  2JQ9 A;  1QUU A;  4TWF A;  2N9D A;  3EDU A;  4I0U A;  3TLT A;  3WAK A;  4K0U A;  5L2L A;  1D0Z A;  2NWB A;  2OV9 A;  3PU3 A;  4UVC B;  2K3W A;  3RGL A;  2E5L T;  2CMR A;  2CXL A;  1X9B A;  4U74 A;  1YKE B;  4IE6 A;  4GOU A;  3I0Q A;  1KNZ A;  3KDS E;  3TLU A;  3AAE B;  2YN6 A;  4PK5 A;  3DTO A;  5LBQ B;  3O9X A;  2AE9 A;  3NBX X;  4H63 V;  2VQF T;  2X51 A;  3Q5X A;  2IHR 1;  4UV8 B;  2XM1 A;  1KK7 A;  3VKG A;  2LHN A;  3ONL C;  1VOM A;  2V5D A;  3CX6 B;  5EK4 A;  3N2G E;  5L3D B;  2BZB A;  3I9W A;  1D1B A;  2LEH A;  4UVB B;  4LF5 T;  2KSR A;  3GA8 A;  5F8P A;  3AE4 A;  2WWV A;  4I43 B;  4YY3 T;  1HNW T;  1E1H B;  3E22 E;  4GKK T;  2CHN A;  3FZL B;  3X1D A;  2YIN A;  4HWF A;  2D9D A;  4ILC A;  1YD8 G;  5FY0 A;  4AIU A;  5JH7 E;  1T72 A;  3P4R A;  5AQP B;  5AQF B;  3EDV A;  3N9P A;  2XAJ B;  5JRE A;  1UX5 A;  4N78 D;  1Z8U A;  2Y8D A;  4DMV A;  4JEU B;  5FKY A;  2V7M A;  4QWN B;  2LOS A;  3QNU A;  4X20 E;  3AA1 B;  3F31 A;  3KIN B;  4QXC B;  4QH5 A;  1SHZ C;  5LGT B;  4JI8 T;  3AE8 A;  4EZH A;  2BKO A;  4U7I A;  2WWU A;  5AQI B;  1W0A A;  4AXP A;  2Q9Q B;  2DI4 A;  3HI2 A;  4JV5 T;  3LJC A;  4CXX A;  3EAM A;  3PUW F;  3DJB A;  2YKS A;  3MJX A;  4UEM A;  4B3T T;  2LKH A;  2VL8 A;  5FVK A;  1J1J A;  5JDM A;  1CHU A;  1V9D A;  2XJ7 A;  4UF0 A;  2LE8 A;  2RPA A;  4QX7 B;  4CXW A;  3CX7 B;  2JJ9 A;  2ES0 A;  4PJL A;  4WW0 A;  1FIO A;  3RH3 A;  5E0O A;  5FXV A;  5AQH B;  5AQL B;  3UU4 A;  4B3M T;  3LFM A;  4I55 E;  3VRB A;  1IJ5 A;  2LSI A;  2N1G A;  4AIS A;  2XAS B;  4YTM A;  4ZS2 A;  3LG7 A;  5LB7 B;  2UXN B;  1US7 B;  3UUN A;  4ZEY A;  4ZI3 D;  4JI1 T;  1W9R A;  1T7S A;  3EAB A;  1E2A A;  1MMN A;  2J1D G;  4KUM B;  4CI3 B;  5CA1 E;  5L3G B;  5HXE A;  5LJM A;  2JMK A;  4QXB B;  5J2T E;  4TUY E;  4AKI A;  4IDP A;  2ZM0 A;  2J47 A;  2YDR A;  4U31 A;  4Z8X A;  2ZM2 A;  2H89 A;  1FMV A;  3PE0 A;  5FYM A;  1MNE A;  2DL1 A;  2P9B A;  1NEK A;  1D1C A;  1M7K A;  1ZV4 X;  2CWO A;  2CHO A;  2E9X D;  3ANW A;  4IE4 A;  2Z6E A;  5FMN A;  3RF1 A;  3ZYK A;  5L3B B;  3N2O A;  5JDQ A;  2F4V T;  1OWA A;  3PUA A;  4IL9 A;  4IT4 A;  2MYS A;  1LVK A;  4PNI A;  4C90 A;  4LFC T;  3L3P A;  1HF8 A;  4O2B E;  2RP4 A;  3I9Y A;  5DJQ C;  4TWH A;  3UU6 A;  2C0S A;  3ZT6 A;  4DR7 T;  2EHO B;  3ZT7 A;  4COF A;  4LFB T;  4TNW A;  3NVO A;  1N34 T;  1MND A;  3CPZ A;  5EK2 A;  3OYX A;  3ZST A;  2IC9 A;  2WQY A;  3A5X A;  4AKH A;  5AQT B;  5KXJ A;  1YKH B;  3A7M A;  3L8R A;  1NWM X;  4ISS A;  4OYJ A;  5ABG A;  2D0U A;  4ZZC A;  3RC8 A;  4KP3 C;  2GK9 A;  3ONX A;  1HCI A;  4HWH A;  3ZMZ B;  4IE5 A;  1LKX A;  2KWH A;  2D5U A;  2RA1 A;  2EHO C;  2IC6 A;  4YHJ A;  3RRC A;  4BA9 A;  2VUR A;  4PJN A;  5C8Y E;  2Y48 B;  4JEH B;  2JQQ A;  3B5M A;  3JC6 D;  2A2F X;  3S4U A;  4X64 T;  4LF4 T;  3Q2M A;  3D0T A;  3LK4 2;  4U3C A;  1XDP A;  2LKG A;  4HFI A;  4EIW A;  4MFR A;  2NW9 A;  3P4P A;  2UUB T;  5JR9 C;  4BJM A;  2CBI A;  2YDS A;  1VCT A;  3O1J A;  3AEC A;  3AVS A;  4IST A;  3AA7 B;  5JDG A;  5F3J A;  3RHW A;  1UCU A;  4UIG A;  4QX8 B;  2VB6 A;  2CWY A;  2YOE A;  3TKL B;  1ZHC A;  5AQQ B;  4CQI A;  4DID B;  5FY7 A;  2E9X B;  4EOZ B;  3AE7 A;  5HEJ A;  1XMO T;  1J5W A;  3QB5 K;  5LHH B;  3KV6 A;  4HN9 A;  3ZC0 A;  3ZJ2 A;  3IEE A;  2XQY A;  3ETU A;  1MIV A;  2KLQ A;  2Q9Q A;  3I0O A;  3U78 A;  3OPC A;  5AQG B;  4O2A E;  5FXZ A;  4AKL A;  2FUP A;  3C98 B;  4IL4 A;  3BK9 A;  2FJA A;  2BKP A;  2CCQ A;  4G63 A;  3CKD A;  3R6N A;  1OED C;  2FBW A;  2CPT A;  4IIJ E;  1VRB A;  2WAU A;  4A97 A;  2NOX A;  4HFE A;  1UX4 A;  5HEU A;  4U2Z A;  4HWC A;  3LK3 B;  3C64 A;  4ERR A;  4CI1 B;  4JI7 T;  4KX6 A;  1UUS A;  2NTX A;  1KF6 A;  2BG9 A;  1N32 T;  4WZX A;  1MMD A;  1SUM B;  2PJQ A;  3KV5 A;  3Q5W A;  3K3O A;  3LBX B;  4HEA A;  3ZPO A;  3AE2 A;  5LGN B;  5AQK B;  4AI6 A;  1AJ3 A;  4H9P C;  5HXS A;  2XSA A;  4XBF B;  4MLK A;  4EAH A;  5LA6 E;  2AXD S;  3E0Z A;  4JUY A;  2V7K A;  2NTY A;  5EK3 A;  4IDN A;  3RLF F;  4A98 A;  4AQF A;  4NXN T;  2BS2 A;  2XHE B;  5HCM A;  1XWM A;  4CN1 A;  3OVU A;  4IDQ A;  5HEO A;  2UXD T;  3PDY A;  2X68 A;  5HEH A;  1FEW A;  4JBW F;  1WFD A;  5L4E A;  1BR0 A;  1R8I A;  2FJB A;  3AA0 B;  3OYZ A;  3UUM A;  3VKH A;  4XZC A;  4DV0 T;  2IAK A;  4PJJ A;  4QHO A;  2QRX A;  3PUS A;  2IDO B;  3FB2 A;  4LMK A;  4WYV A;  3PJA J;  3UU5 A;  3ZCI A;  1IJ6 A;  3VR8 A;  3ZMS B;  5LHI B;  2WZH A;  3EI0 A;  4KHZ F;  2BKN A;  1S35 A;  2WDQ A;  3WI3 A;  1IAP A;  1MIW A;  2XY8 B;  3ETV A;  4O4L E;  3GN5 B;  2E9X A;  4HFV A;  2MPK A;  1DU2 A;  4HTE A;  5JRC A;  3MXZ A;  4NPP A;  4DR2 T;  1SE7 A;  3T1Y T;  3H37 A;  5ABH A;  1G73 A;  2CE7 A;  4WBO A;  3LK2 B;  2ODU A;  5HAX A;  5FVL A;  1KEY A;  3P8C D;  3VRA A;  4IRE A;  3ZYL A;  3ZC1 A;  2BDE A;  2CEA A;  5AQU B;  5IYZ E;  2H7O A;  2LRK A;  2MTQ A;  2L8K A;  2C5K T;  4L5G A;  5AQO B;  4F8H A;  3CQC B;  5L3C B;  5LGU B;  2M67 A;  3AE5 A;  1BR4 A;  5FY1 A;  2X9Y A;  2XM2 A;  4Q25 A;  4M1P A;  1ZKE A;  5IUX A;  5JDH A;  1WR6 A;  2E8I A;  2X9W A;  3ESL A;  3PUX F;  4PK4 A;  5ABF A;  1HR0 T;  3SS1 A;  4U7Y A;  4U72 A;  2N2N A;  1X79 A;  4IGU A;  2WSS V;  3O1H A;  3SWH A;  1OED B;  1YQ3 A;  1SA0 E;  2IW5 B;  3RPU A;  3PU8 A;  3TLV A;  2W63 A;  2J4G A;  2VL0 A;  3EHZ A;  3CQX C;  2VVN A;  3P4W A;  4H9S E;  4TN7 B;  2G0U A;  3AA6 B;  5AQS B;  4EB6 E;  3FHN A;  4I4T E;  3FXE B;  2ZMA A;  3N9L A;  2K9A A;  4OYK A;  5FL0 A;  3ZN1 B;  4CN6 A;  5CFB A;  3AXJ B;  4PFO A;  4CZZ B;  4IE0 A;  3F57 A;  1XZY A;  1UUR A;  1T98 A;  2KXP B;  2HN1 A;  5LOV E;  2BS3 A;  2DWK A;  4FJO A;  3ZMV B;  4JI6 T;  2HHH T;  3AE9 A;  5LJN A;  5KX5 E;  3AE6 A;  1WCR A;  3WAJ A;  2LM9 A;  4UF0 B;  5CJ5 A;  1XNQ T;  4QXH B;  3IBP A;  2NW8 A;  2V7L A;  3FZK B;  4JLE A;  4NUV A;  2ACZ A;  3UU8 A;  4DV4 T;  3ZLI A;  1HNZ T;  1IBM T;  2VKH A;  5BR8 T;  4YXD A;  4QH1 A;  1J5E T;  5JR9 B;  3AEE A;  2L9Q A;  4DUY T;  4ZI2 D;  3BQI A;  3Q5E A;  4GK5 E;  2D0T A;  2Q9Q D;  3AE1 A;  4X1I E;  3SFE A;  4UEL A;  3TLW A;  1D1A A;  3JC6 C;  1HFA A;  5H6R B;  3RIF A;  2UXB T;  2CM0 A;  3PUR A;  2QVA A;  2CXD A;  5HYA A;  3FZH B;  5CA0 E;  3NRY A;  1HTJ F;  2XQA A;  2LM2 A;  3OKQ A;  3RC3 A;  4DR1 T;  2YEV C;  5L47 A;  2X67 A;  5F5W A;  2K24 A;  1MIY A;  2VKO A;  2QGS A;  2XSB A;  4O4H E;  4YLH A;  3RI5 A;  4EXT A;  4WBN E;  3O1I A;  3VR9 A;  2XQ4 A;  2C5I T;  4IHJ E;  4H9Q C;  2ACX A;  2CXF A;  2KIN B;  3ANW B;  2V7J A;  4GK0 E;  2W0G A;  5TAO A;  2H7V C;  3UUX B;  3FBZ A;  2V6Y A;  2V26 A;  3ZJ1 A;  3HKC E;  3PUQ A;  1WR0 A;  4X65 T;  5LHG B;  2L3L A;  1NAF A;  1U4Q A;  3MKD A;  3FZM B;  5C3J A;  2KT9 A;  3CVR A;  2WCA A;  5DQV A;  4DV7 T;  5H6Q B;  3OJA A;  3CK6 A;  4HFD A;  3NZQ A;  3O4X E;  4H9N C;  2CRB A;  2WMO A;  3NRX A;  4TNV A;  2KMF A;  3JCF A;  2JQK A;  3FZF B;  4ASK A;  2ZLY A;  3KV4 A;  2IIU A;  5AQM B;  3ABV A;  4ADZ A;  1I6Z A;  5HWY A;  4NUU A;  4E7S A;  1HS7 A;  2CLY B;  3PV0 F;  2SPC A;  2ODV A;  4YSY A;  3RYI E;  4YSZ A;  2XQ9 A;  3V5U A;  3CX8 B;  4LF9 T;  2VK9 A;  3OBV E;  5AQR B;  1FMW A;  4HFC A;  4ZS3 A;  1Y64 B;  5HCJ A;  2B1E A;  4J2C A;  4P0A A;  2KZ7 B;  2CBJ A;  2I0M A;  2PG8 A;  3MA9 A;  2YK0 A;  2WY2 A;  2VVS A;  3P4S A;  5FL1 A;  5JDN A;  5L4H A;  2EHO D;  1IBK T;  3C4X A;  1QSD A;  4DBR A;  3AEB A;  1OED E;  3IHR A;  4QKN A;  4TWD A;  4P09 A;  5KMG P;  2XAQ B;  4HWI B;  2FJD A;  5DAB A;  4JI4 T;  3JAD A;  5LG3 A;  4ZZB A;  2ZM6 T;  1WLX A;  1IZN B;  4DV1 T;  2V6X A;  2X9H A;  2LSJ A;  3CML A;  3MZK B;  5HXR A;  2YDQ A;  3HKE E;  4EED A;  3UQ7 A;  2HN2 A;  4NIQ A;  4GIW A;  5HEG A;  1HG5 A;  2LOP A;  3C4W A;  4X62 T;  1N36 T;  3N2K E;  3RYH E;  3IA3 A;  4DR5 T;  2PFV A;  3H3A A;  5FNV E;  2BVL A;  4MBQ A;  4AQG A;  4ZI7 E;  4TV8 E;  1XMQ T;  1FJG T;  5C2T A;  1H7C A;  4HKA A;  2W66 A;  2XZE A;  2LRL A;  4CXY A;  3P4Q A;  2Q9Q C;  2XQ6 A;  2Y6X A;  5FXW A;  3TLS A;  4DR6 T;  2LT3 A;  3AE3 A;  1UGO A;  2M6I A;  4YSX A;  3P50 A;  5J0Z A;  4YHH T;  3NZP A;  3QC9 A;  4DR4 T;  2NW7 A;  3KBU A;  1ZOY A;  3LDQ B;  4ILA A;  2MBG A;  5J2U E;  3ZYM A;  4TV9 E;  3HR0 A;  1CUN A;  4UVA B;  3RRW A;  1W09 A;  2EHO A;  3ZN0 B;  4NXM T;  3DP7 A;  3N9O A;  5DQW A;  2BG9 C;  2PBI A;  2XQ5 A;  2WB5 A;  3RX6 A;  1E7P A;  2BS4 A;  4EGW A;  2W00 A;  3HL6 A;  3PUV F;  4LF6 T;  3GWH A;  1HX1 B;  3JAF A;  4ZHQ E;  2XQ7 A;  2LSG A;  3PTR B;  3RIU C;  3UUB A;  4YTN A;  4V1A v;  1XDO A;  2C5J A;  2E2A A;  5AQV B;  4BAY B;  4P1N A;  3ZEF B;  2VWA A;  1HG2 A;  1XNR T;  2VKD A;  4AQF C;  4L0R A;  3RIA A;  5LG4 A;  3V5S A;  2H3R A;  2WM9 A;  3N9N A;  1EZ3 A;  4U2Y A;  2BG9 E;  4KHP T;  5GON E;  4FI5 A;  3KV9 A;  4LF7 T;  4PJM A;  4OX9 T;  4HGA A;  3RYF E;  3N5L A;  2A72 A;  3QB5 A;  1D0Y A;  3CQG B;  3R84 B;  3ZSS A;  4C91 A;  3M65 A;  1WYB A;  1YW0 A;  5ADX L;  1JNZ A;  3RIU A;  1GQE A;  1T8B A;  4H9O C;  4X1Y E;  4DBQ A;  1WYC A;  1OED A;  3BQL A;  4LML A;  1Z0P A;  2W62 A;  3FBL A;  4PAG A;  4UXN B;  5IWA T;  4O4J E;  1HNX T;  4HFH A;  3EVY A;  3PUG A;  2W4X A;  5ETW A;  2WDR A;  3GN5 A;  2BBH A;  4UV9 B;  5CB4 E;  3KVB A;  5HXC A;  2XAG B;  3G06 A;  4CI2 B;  3AXJ A;  3PUY F;  4B3R T;  2UU9 T;  5HWX A;  1NEN A;  5JQG E;  4G2A A;  3H3M A;  3AEG A;  3MAC A;  3QUJ A;  3PUZ F;  3W15 B;  4ANJ A;  4EEB A;  2XUE A;  4PK6 A;  5J1G A;  2XTL A;  3K1S A;  1YQ4 A;  3Q9D A;  4AQY T;  1N33 T;  2PTF A;  2WZI A;  2QYW A;  3L39 A;  3FXD B;  2UXC T;  2KND A;  2V7I A;  4K0K T;  2BG9 B;  4XAX B;  1LVF A;  1D0X A;  3KBT A;  4KMC A;  3ZKR A;  4IDZ A;  5ABF B;  2XAH B;  4EYU A;  5BMV E;  1VCS A;  2LHR A;  4Z90 A;  3ZT5 A;  4F6R C;  4DMW A;  5JTG A;  4TZ4 C;  3KFW X;  3HKD E;  5HXH A;  4H63 H;  4DR3 T;  4I50 E;  3RKG A;  2UUA T;  3ZMU B;  4B6X A;  2XPK A;  4P0B A;  4AKG A;  2XQ8 A;  3B13 A;  2X66 A;  5LNK A;  5L3E B;  3AVR A;  4ZI2 C;  5ABE A;  2BBJ A;  3E08 A;  5AFU L;  4HE8 A;  2XAF B;  2KWI B;  2HH7 A;  5FXX A;  3N9Q A;  3UUL A;  2ZM8 A;  3AB3 B;  3SFD A;  2R6G F;  4AKR B;  3C4Z A;  1BR1 A;  2XQ3 A;  3L09 A;  2OA5 A;  4OFZ A;  3UQ4 A;  3K3Q C;  2H88 A;  2LJL A;  2WMN A;  4IDO A;  3AEF A;  3M3Z B;  2JIW A;  2MAW A;  2V6Y B;  3SOL A;  3J7Y q;  4DVD A;  2YU1 A;  2B76 A;  4ZOL E;  3HA4 A;  1KNR A; 
#chains in the Genus database with same CATH homology
 3OTO T;  4NXN T;  4JI8 T;  2UXD T;  4JV5 T;  4JI5 T;  4JI4 T;  4DV6 T;  2ZM6 T;  4B3T T;  4DV1 T;  4DV0 T;  4B3R T;  4X62 T;  1N36 T;  4DR5 T;  4DV2 T;  1XMQ T;  1FJG T;  1I94 T;  5LMU T;  4B3M T;  4DR2 T;  3T1Y T;  4DR6 T;  2UUC T;  4DUZ T;  4JI3 T;  4JI1 T;  4YHH T;  4DR4 T;  5LMN T;  4LF8 T;  4NXM T;  4LFA T;  4LF6 T;  1HR0 T;  4DV3 T;  4DV5 T;  4X66 T;  4JYA T;  1XNR T;  2F4V T;  4LFC T;  4GKJ T;  4B3S T;  4DR7 T;  4LF7 T;  4LFB T;  4JI0 T;  1N34 T;  4OX9 T;  4JI6 T;  2HHH T;  1XNQ T;  4DV4 T;  1HNZ T;  1HNX T;  1IBM T;  5IWA T;  5BR8 T;  1J5E T;  4DUY T;  4X64 T;  4LF4 T;  2UU9 T;  1IBK T;  2UUB T;  4JI2 T;  4AQY T;  2UXB T;  1N33 T;  3T1H T;  2VQE T;  1IBL T;  2UXC T;  4K0K T;  4DR1 T;  4KHP T;  2E5L T;  1XMO T;  4DR3 T;  2UUA T;  2VQF T;  4X65 T;  4DV7 T;  4LF5 T;  4YY3 T;  1HNW T;  4GKK T;  4JI7 T;  1N32 T;  4LF9 T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...