4DUYT

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, u13c
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome
total genus 34
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 4duyT00
4LF4T 1N34T 1XNQT 4JI7T 4JI0T 4LFBT 1J5ET 4DV2T 4KHPT 4X66T 4DR4T 5BR8T 5LMNT 4K0KT 4OX9T 1FJGT 4DR1T 4JI6T 2UU9T 4LFAT 4LF9T 2ZM6T 4DV6T 2UUBT 1N33T 5LMUT 4JI1T 4JI3T 4DV5T 2UXDT 1N36T 4YY3T 1IBKT 4JI8T 1XMQT 2UUCT 4NXNT 3OTOT 1HNZT 4B3ST 2VQFT 1HR0T 4GKKT 4LFCT 2F4VT 4DV0T 4AQYT 4X64T 1IBMT 4JV5T 3T1YT 4NXMT 2E5LT 1XMOT 4LF6T 4JI2T 4DR7T 4DV7T 5IWAT 4LF7T 4LF8T 1N32T 4DR6T 4DR5T 4DUYT 4DV1T 4X62T 1IBLT 4DR3T 1XNRT 4DV4T 1I94T 4X65T 4LF5T 4JYAT 4DV3T 2UXBT 4GKJT 4B3RT 4DR2T 1HNWT 2HHHT 3T1HT 2VQET 2UUAT 4JI5T 4B3MT 4DUZT 1HNXT 4JI4T 2UXCT 4YHHT 4B3TT
chains in the Genus database with same CATH superfamily
3SFDA 3K3QC 4TWDA 4DO0A 1HG2A 4COFA 2ES0A 4P0AA 1FEWA 2BS4A 1VCSA 3ETUA 3QK6A 4O4JE 1Y64B 4ILAA 1T72A 5JDQA 4UV9B 2IIUA 2XY8B 2XQ9A 3NWIA 3QB5K 3JAFA 3U3IA 4DV6T 5C3JA 1WRDA 2QRXA 3Q5EA 3OVUA 2FJDA 3JC6D 4PK6A 2UUCT 5AQHB 4O8SA 3OTOT 2VQFT 2WP9A 1LRZA 4GKKT 2BBHA 4LFCT 3ZC1A 3UU4A 4KBMB 3JCFA 3CWZB 2A3DA 2BS2A 4C91A 1WLXA 4ZZBA 2W63A 2DHRA 3P4QA 2NOXA 2LKHA 4AQFA 3I1AA 3MZKB 2NW9A 2LSJA 4EAHA 3A7MA 3K3OA 3FZLB 4GKJT 3AE4A 3AE3A 2CXDA 5JDLA 3AA6B 2QVAA 1SA0E 5EK3A 4MFRA 3I0QA 3VR9A 2CRBA 2YINA 3ZYKA 4TWHA 2DI4A 2XAHB 1KF6A 1N34T 2D9DA 1G73A 5HCMA 2E9XD 2J47A 2IC6A 1NAFA 3FB2A 5FXVA 3AA0B 3C98B 4UEMA 2V5CA 2LSKA 3P8CD 5F3JA 2UXNB 2XAFB 1SHZC 5AQIB 2N9DA 5DABA 3LSVA 1VOMA 2Y8DA 4YY3T 3QB5A 2XZEA 2ZM2A 4QHOA 4CN4A 2ACXA 3SWHA 2LSIA 3KV6A 4HEAA 4YJ2E 2XQAA 1BR4A 2J4GA 2V7KA 2ZMAA 2CHOA 4UF0A 2LM2A 5H6RB 1ZHCA 5LP6E 2QGSA 2XQ8A 4HFCA 2OLTA 4DUYT 3L3PA 2HN2A 1XNRT 2KLQA 2NP9A 5JQGE 3EVYA 2DWGA 3JC6C 3FBLA 4TX5A 4AXPA 5JDFA 2I6HA 5HEOA 4TV9E 3ZCJA 2CXLA 4UF0B 5HXSA 2NW8A 1UCUA 3Q9DA 4IE0A 4CXYA 1J5ET 4AQFC 3CQGB 2YU2A 5LGTB 5LGUB 2P9BA 3EUHA 2C5KT 2UU9T 5JVDE 4O4HE 2VWAA 3ZJ2A 3OBVE 4QX7B 2XM1A 4DV5T 2PG8A 1W0BA 4BJMA 3RIUC 2LT3A 3F57A 5TAOA 2L3LA 1J1JA 1KK7A 4X1KE 4DR6T 4P1NA 4X62T 2D0TA 3RRWA 5LBMA 3VRAA 5ABFA 4DV3T 4Z90A 3AE9A 2VL0A 3UU6A 4AQGA 4NPPA 2CE7A 3UT5E 4DMVA 3RQWA 4H9RC 2DL1A 4WZXA 4YJ3E 3QUJA 3ANWA 2CHNA 3KV5A 4IREA 2PFVA 3P50A 5KXJA 2Q9QA 2Q9QD 2XQ7A 3K3NA 3MKDA 3O1JA 4EXTA 2H88A 3O9XA 1R8IA 2BKNA 4CZZB 4B6XA 2XSBA 3HKEE 4ZI2D 3T8OA 2UUBT 2B76A 4JBWF 4G2AA 3GMIA 1WR0A 3OKQA 2SPCA 4DVDA 1HCIA 4A97A 3AE7A 5LHIB 3ANWB 2E2AA 5AQLB 5FKYA 2WAUA 5JREA 3OJAA 1WYBA 2UXXB 2Q9QB 3ZMSB 3LK42 2KINB 2W2UA 1OWAA 1ZEEA 2CMRA 3OPCA 1N32T 1J5WA 3LK3B 3VU7H 4KHZF 1U5PA 3ONXA 2OA5A 4TZ4C 3S4UA 1SUMB 5EK2A 2Z6EA 2JQKA 3GN5B 3K1SA 2WS3A 1HNWT 3CMLA 1B7TA 4CI3B 1LVKA 5DJQC 4L9IA 3AAIA 4L0RA 2LLYA 2UXCT 2M6IA 4CI1B 4YHHT 1D0XA 1XDPA 4U74A 4E7ZA 5AQNB 2VB6A 3IF8B 2OV9A 5ABGA 1GQEA 3A5XA 2ODVA 4KHPT 4EYUA 4UIGA 4NUUA 3Q2MA 5AQTB 3TLSA 2ZM6T 2K5BB 2WY2A 3RX6A 5AQRB 2JQHA 4X1IE 5F8PA 3O1IA 3ZYMA 4BAYB 1M62A 3C64A 2XSAA 1X9BA 1HR0T 3P4PA 1QUUA 2X9WA 3RC8A 1UX5A 3FZMB 4NIQA 2VVNA 5LHHB 2Q9QC 2BVMA 3QNUA 1E7PA 4H9SE 3AECA 3FZHB 1DU2A 5L2LA 4JLEA 4LMLA 3SS1A 2K48A 3RYHE 3RKGA 3QC9A 2KMFA 3NKZA 1UK5A 3SRZA 3VHLA 5LJMA 3C4ZA 3E22E 3AEDA 5HCJA 2W0GA 4LF5T 3JADA 5HEUA 1D1BA 3TLWA 3MA9A 3WI3A 5FNVE 2J62A 5M4YA 2XQ6A 4AKIA 2WU2A 1BR0A 3L39A 3SFEA 3PU3A 3C4WA 4U2YA 4IE4A 3AXJA 5EK4A 3CVRA 5HXEA 3ZN0B 4H9OC 5IHYA 5E0OA 4A5XA 2YK0A 2QYWA 3FZFB 1HTJF 4IL9A 3C4XA 4EV6A 4QXCB 2HH7A 3ZMZB 2V5DA 5JR9A 1V9DA 2V7JA 3N2OA 2FJBA 4JUYA 3FZKB 1KEYA 2Y48B 4AKHA 3RRCA 5A1LA 4OK0A 4B3ST 4IDPA 4YTMA 3RQUA 2N2NA 2AE9A 4HKAA 4M1PA 2C5JA 4DV0T 3LBXA 2VL8A 4LMJA 4QXBB 4KUMB 3AVSA 5FY1A 5KMGP 2X66A 4DBRA 5LGNB 3J7Yq 2E5LT 4JI2T 5JR9B 5L4EA 4QKNA 5CA0E 5C2TA 3WAJA 3CIRA 2LSYA 1Y01A 3ZMTB 1H7CA 2XTLA 4U31A 3AE1A 4X65T 1D0ZA 2KNDA 5L3FB 2UXBT 3AAAB 1OXZA 2PBIA 3EI0A 4AKGA 2XJ7A 5LXTE 1KNPA 2VQET 4UVAB 2W61A 3PUGA 4B3MT 4JI4T 4B3TT 3LFMA 3O4XE 2VKDA 4WBNE 2WCAA 5J1GA 3RHWA 2H3RA 2K9AA 4PJJA 2XAJB 2WMNA 3RYFE 5LNKA 1YW0A 5BR8T 4K0KT 3J9X1 4GK0E 4OX9T 2AXDS 2IUBA 4PW8A 5LYJE 4IDNA 3ZMVB 5DQWA 4EZ4A 4JI1T 3K8PC 3P4SA 3ZJ1A 2BDEA 2E9XA 3RIUA 3PE0A 1Z8UA 1ZOYA 3M65A 4YLHA 4AKLA 4GYRA 3IHRA 4L5GA 3ABVA 3BK9A 1BR1A 1IBMT 3T1YT 4NXMT 3AA7B 4O2BE 5JR9C 2FUPA 1CHUA 2LM9A 4QH4A 4H9PC 3P4RA 3P7IA 3MACA 4EEDA 2FJEA 4CI2B 5AFUL 2E9XB 3A8YC 2H7VC 5J0ZA 2V26A 3CX8B 3VKGA 3FHNA 4ISSA 2WMOA 4CN1A 4JI5T 4CQIA 1FIOA 4DUZT 2WZIA 3MXZA 5JDNA 4IGUA 5HAXA 3CX6B 2WQYA 4NUVA 1YQ4A 2WWVA 5LA6E 2JMHA 4LFBT 4IHJE 2CA5A 5FYMA 5FP3A 4IE7A 5FXZA 5AQUB 4DR1T 5JRCA 4XZCA 4LFAT 3FXEB 1MIYA 2CWYA 1MIVA 4PFPA 4UR9A 5HWYA 1QSDA 3HR0A 2BVLA 2XQ3A 1T7SA 2X0HA 4YXDA 2DNXA 3RLFF 5BMVE 4CXXA 3RC3A 3ZMUB 2IHR1 3F2EA 2X67A 4EIWA 3TLUA 4AQYT 4I4TE 2NTYA 4X64T 3IBPA 1YXRA 2LOSA 4LF6T 5HWXA 3ZEFB 5JRCB 4U72A 4YFSA 3UUNA 4JEUB 4LF7T 3IEEA 4LF8T 3PUQA 1HG5A 4HFHA 1IJ5A 3ZKRA 3EDVA 3Q5DA 2E9XC 3R6NA 2YKSA 3M3ZB 4UELA 2DWKA 4O4LE 3EHZA 1EZ3A 4I50E 4C90A 4TWFA 3OYXA 5FMNA 3PUVF 2V7IA 2PTFA 3Q5XA 4JEHB 4OFZA 2QA7A 2EHOA 2XUEA 2EHOD 3AEBA 4DR4T 4HFVA 4X20E 3PV0F 1KNZA 2G0UA 3UQ7A 1QLBA 2WZHA 4KMCA 3BQIA 5J2UE 3E08A 2LOPA 1CUNA 4HFDA 5LG4A 2C5IT 4X5TA 5H6QB 1IBKT 4K0UA 4XBFB 3AVRA 3RIAA 3DTOA 4MBQA 1HNZT 5ABFB 2EHOB 2X51A 2MPKA 4JV5T 3MJXA 3HA4A 2YN6A 4YTNA 1NEKA 3F31A 1IBLT 4ZEYA 3L8RA 4A98A 2RP4A 3HI2A 2A9UA 2X9XA 4JYAT 1MMGA 5IYZE 4UXNB 4YTPA 4B3RT 2WM9A 3CPZA 3WAKA 2CBJA 4I43B 1E2AA 3ZT7A 3Q5WA 2KZ7B 4HN9A 2WSSV 4I0UA 4TN7B 2CM0A 5AQGB 4OYKA 4ZXLA 2VKOA 2RA1A 2PJQA 2ACZA 3ZC0A 2MBGA 2IW5B 3ETVA 4HGAA 3H3AA 4UV8B 3NZQA 1D1CA 3UUBA 1FMVA 5L47A 4ZI3D 5L3GB 3FBZA 2GK9A 4LF9T 4AI6A 3ZT5A 3AE2A 4IT4A 5LMUT 3I9YA 4G63A 1WFDA 2VK9A 5LBQB 5L3CB 4HFEA 5L4HA 3B5MA 2LRKA 4FI5A 2VKJA 4X1YE 2VASA 1MMAA 2W4XA 3CQCB 5L3EB 2EHOC 3W15B 4EYYR 4ZS3A 3X1DA 3V5UA 1XMOT 2V7MA 4N78D 2LJLA 4CXWA 3RPUA 3VRBA 2V8SV 2Y6XA 1LVFA 1HX1B 2D0UA 3KFWX 4HWCA 4HWFA 5HYAA 3FXDB 2XHEB 1W9RA 2LKGA 3KDSE 4DMWA 2HHHT 2JJ9A 5HXCA 1YKEB 4ZI2C 5LG3A 3LG7A 5FVLA 1S94A 3RH3A 1MNEA 3L09A 5LJNA 3I9WA 5J2TE 4IDOA 3NBXX 3ZYLA 3RF1A 2D2SA 2BKOA 2FJAA 4JI7T 2ODUA 4HE8A 4JI0T 3JAEA 2W62A 3AEEA 2B1EA 1WR6A 3KBUA 1JNZA 2IMLA 2V6XA 1IJ6A 1W09A 1UUSA 4FJOA 4IDZA 2ZM8A 4XAXB 4DIDB 3DJBA 1G8XA 1SE7A 1KNRA 4JI3T 5FY7A 4PK5A 2W66A 1T8BA 4JI8T 4O2AE 4EOZB 2E5VA 1D1AA 2LE8A 2JQ9A 4V1Av 1VRBA 4WYVA 4HWIB 4WBOA 2X68A 4ZI3C 3ZSSA 4Z91A 2WWUA 2WBLA 1YKHB 3AXJB 3PUSA 4CN6A 4TNWA 4U7YA 3N9NA 2KWHA 2CCQA 1YD8G 5AQKB 2LHRA 4DR2T 2ZLYA 3UU3A 3T1HT 2UUAT 3KBTA 2L9QA 2XQ5A 4IE5A 4AKRB 3AEAA 1XNQT 3ZLIA 5FY0A 4GK5E 1I6ZA 3N9MA 4EGWA 2YDRA 4WNKA 3AAEB 3N5LA 4EEBA 3IA3A 3N9OA 3CKDA 3TLTA 3LBXB 3DP7A 2HPJA 4GOUA 3BQKA 3RYCE 3LDQB 3AA1B 4GIWA 2VKHA 1IAPA 2V7LA 2NW7A 2RPAA 5AQMB 3UUXB 1VCTA 5CGMA 2CLYB 3CX7B 2KSRA 2NTXA 1E1HB 3AEFA 4PK4A 5AQPB 5ABHA 5ADXL 2YU1A 3N9LA 2V1DB 3CQXC 2XAQB 4UVCB 4ZI7E 1T98A 5CJ5A 5CA1E 3ZCIA 1MMDA 1ZKEA 2YEVC 4H63V 1X79A 5LHGB 4MALA 2L8KA 2CBIA 2HN1A 4E7SA 5GONE 3ZN1B 1FMWA 4DR7T 5JDHA 4PFOA 4H9QC 5EZYE 1XDOA 3EDUA 3EAMA 4ADZA 5AQJB 3QOFA 4DV4T 2WB5A 4WW0A 3GA8A 4F8HA 4DNDA 4H9NC 3C51A 2NR4A 4F6RC 1HNXT 2IC9A 2WDQA 3NRXA 2JMKA 4LF4T 1HX8A 1UURA 4BA9A 4LMKA 4QXHB 3NRYA 2WU5A 3ONLC 2YDSA 5JDMA 4X66T 3VR8A 4HFIA 2BKPA 3ZPOA 2NWBA 2XASB 2R6GF 2WDRA 2KT9A 2YDQA 4IIJE 4TNVA 4TV8E 2XQ4A 2MOZA 4OHFA 2CLYC 5CB4E 4YT0A 2UXDT 4PNIA 3OYZA 5IUXA 5JH7E 3KVAA 4EB6E 4Z8XA 1BR2A 4P09A 5JTGA 4ASKA 2BS3A 2CPTA 3PUYF 2BG9A 4MHCA 3UU5A 5KX5E 3PDYA 5AQOB 5HEHA 1WYCA 4DBQA 3N2KE 5IWAT 4P0BA 2DLRA 4ILUA 2CXFA 3HKDE 1O3XA 3PU8A 3UTKA 1D0YA 4A56A 4KP3C 2K24A 1I94T 3H37A 3HKBE 3UU8A 4BJNA 4HWDA 3C50A 5LOVE 1MIWA 2BG9B 1YQ3A 5FL0A 2W67A 2LRLA 2C0SA 3TKLB 4ILBA 5C8YE 1L0VA 3V5SA 2JQQA 5HEJA 2IDOB 1WCRA 3N9PA 2LEHA 2BBJA 2M67A 4YSZA 4YSYA 1FJGT 4U3CA 3LJCA 5JDGA 1MNDA 1ZV4X 1US7B 1HS7A 3PUWF 1W0AA 1N36T 2CWOA 3PTRB 2XAGB 2I59A 3KINB 3ONJA 1XMQT 2I0MA 4NXNT 2XPKA 3PJAJ 4QX8B 5ABEA 2KWIB 1LKXA 2HPLA 3EABA 1KFYA 1OEDA 5FXWA 4DV7T 4ZOLE 5FL1A 3HKCE 4KI0F 3UQ4A 3PUAA 1XZYA 4ANJA 4TUYE 2LHNA 3RI5A 2VURA 3ESLA 1UX4A 3UULA 3KV4A 3BQLA 3N2GE 2A72A 3SOLA 2E8IA 5KDMC 3LK2B 3ZT6A 4YSXA 2ZM0A 2BG9C 3U78A 1OEDB 1S35A 3AE5A 3UFEA 3I0OA 4HWHA 4J2CA 3NZPA 2X9HA 4O4IE 2IAKA 2J1DG 4Q25A 2X9YA 4U2ZA 5AQQB 3PUXF 4DV2T 2BG9E 3GN5A 5LB7B 1MMNA 5F5WA 2LSGA 5HXRA 4JI6T 2H7OA 2K3WA 3D0TA 1NENA 4OYJA 3RYIE 1N33T 3RGLA 3UFGA 4PJNA 5CFBA 1NWMX 3CK6A 4ILCA 4KX6A 2JPFA 4MLKA 5HXHA 3E0ZA 5DQVA 2JIWA 3H3MA 3B13A 4IDQA 5AQFB 3P4WA 2X0YA 2DCFA 4ZS2A 5L3BB 2XQYA 4AISA 1UGOA 5ETWA 4DR3T 3AE6A 3RIFA 5HEGA 4EZHA 1HF8A 1ZP0A 3O1HA 2A2FX 1OEDC 1M7KA 3B57A 4QH5A 2MAWA 5FVKA 4HFBA 2FBWA 3HL6A 2V6YA 2BZBA 3R84B 3UUMA 1IZNB 2M6BA 4PAGA 3AEGA 1AJ3A 2D5UA 5LMNT 4HTEA 3AB3B 4QWNB 1OEDE 2JRKA 2VVSA 1XWMA 5AQVB 2CEAA 4H63H 1JNRA 2WDVA 2X0LB 1Z0PA 2MTQA 3PJAA 2YOEA 3NVOA 4I55E 4IE6A 2MYSA 3G06A 1HFAA 2V6YB 2KXPB 3MK7C 3KV9A 3PURA 2F4VT 4U7IA 5FXXA 4ZZCA 4PJLA 4GYSA 2H89A 3AE8A 4QH1A 1U4QA 3KVBA 5LCYA 3GWHA 4AIUA 3RKOA 4DR5T 4DV1T 3VKHA 4ERRA 5L3DB 4U33A 4UVBB 3TLVA 4ZHQE 2W00A 4PJMA 3PUZF 4YHJA 2N1GA 4ISTA 4IL4A 5AQSB 3ZSTA 2XM2A 3N9QA
chains in the Genus database with same CATH topology
4LF4T 1N34T 1XNQT 4JI7T 4JI0T 4LFBT 1J5ET 4DV2T 4KHPT 4X66T 4DR4T 5BR8T 5LMNT 4K0KT 4OX9T 1FJGT 4DR1T 4JI6T 2UU9T 4LFAT 4LF9T 2ZM6T 4DV6T 2UUBT 1N33T 5LMUT 4JI1T 4JI3T 4DV5T 2UXDT 1N36T 4YY3T 1IBKT 4JI8T 1XMQT 2UUCT 4NXNT 3OTOT 1HNZT 4B3ST 2VQFT 1HR0T 4GKKT 4LFCT 2F4VT 4DV0T 4AQYT 4X64T 1IBMT 4JV5T 3T1YT 4NXMT 2E5LT 1XMOT 4LF6T 4JI2T 4DR7T 4DV7T 5IWAT 4LF7T 4LF8T 1N32T 4DR6T 4DR5T 4DUYT 4DV1T 4X62T 1IBLT 4DR3T 1XNRT 4DV4T 1I94T 4X65T 4LF5T 4JYAT 4DV3T 2UXBT 4GKJT 4B3RT 4DR2T 1HNWT 2HHHT 3T1HT 2VQET 2UUAT 4JI5T 4B3MT 4DUZT 1HNXT 4JI4T 2UXCT 4YHHT 4B3TT
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LF4 T;  1N34 T;  1XNQ T;  4JI7 T;  4JI0 T;  4LFB T;  1J5E T;  4DV2 T;  4KHP T;  4X66 T;  4DR4 T;  5BR8 T;  5LMN T;  4K0K T;  4OX9 T;  1FJG T;  4DR1 T;  4JI6 T;  2UU9 T;  4LFA T;  4LF9 T;  2ZM6 T;  4DV6 T;  2UUB T;  1N33 T;  5LMU T;  4JI1 T;  4JI3 T;  4DV5 T;  2UXD T;  1N36 T;  4YY3 T;  1IBK T;  4JI8 T;  1XMQ T;  2UUC T;  4NXN T;  3OTO T;  1HNZ T;  4B3S T;  2VQF T;  1HR0 T;  4GKK T;  4LFC T;  2F4V T;  4DV0 T;  4AQY T;  4X64 T;  1IBM T;  4JV5 T;  3T1Y T;  4NXM T;  2E5L T;  1XMO T;  4LF6 T;  4JI2 T;  4DR7 T;  4DV7 T;  5IWA T;  4LF7 T;  4LF8 T;  1N32 T;  4DR6 T;  4DR5 T;  4DUY T;  4DV1 T;  4X62 T;  1IBL T;  4DR3 T;  1XNR T;  4DV4 T;  1I94 T;  4X65 T;  4LF5 T;  4JYA T;  4DV3 T;  2UXB T;  4GKJ T;  4B3R T;  4DR2 T;  1HNW T;  2HHH T;  3T1H T;  2VQE T;  2UUA T;  4JI5 T;  4B3M T;  4DUZ T;  1HNX T;  4JI4 T;  2UXC T;  4YHH T;  4B3T T; 
#chains in the Genus database with same CATH topology
 3SFD A;  3K3Q C;  4TWD A;  4DO0 A;  1HG2 A;  4COF A;  2ES0 A;  4P0A A;  1FEW A;  2BS4 A;  1VCS A;  3ETU A;  3QK6 A;  4O4J E;  1Y64 B;  4ILA A;  1T72 A;  5JDQ A;  4UV9 B;  2IIU A;  2XY8 B;  2XQ9 A;  3NWI A;  3QB5 K;  3JAF A;  3U3I A;  4DV6 T;  5C3J A;  1WRD A;  2QRX A;  3Q5E A;  3OVU A;  2FJD A;  3JC6 D;  4PK6 A;  2UUC T;  5AQH B;  4O8S A;  3OTO T;  2VQF T;  2WP9 A;  1LRZ A;  4GKK T;  2BBH A;  4LFC T;  3ZC1 A;  3UU4 A;  4KBM B;  3JCF A;  3CWZ B;  2A3D A;  2BS2 A;  4C91 A;  1WLX A;  4ZZB A;  2W63 A;  2DHR A;  3P4Q A;  2NOX A;  2LKH A;  4AQF A;  3I1A A;  3MZK B;  2NW9 A;  2LSJ A;  4EAH A;  3A7M A;  3K3O A;  3FZL B;  4GKJ T;  3AE4 A;  3AE3 A;  2CXD A;  5JDL A;  3AA6 B;  2QVA A;  1SA0 E;  5EK3 A;  4MFR A;  3I0Q A;  3VR9 A;  2CRB A;  2YIN A;  3ZYK A;  4TWH A;  2DI4 A;  2XAH B;  1KF6 A;  1N34 T;  2D9D A;  1G73 A;  5HCM A;  2E9X D;  2J47 A;  2IC6 A;  1NAF A;  3FB2 A;  5FXV A;  3AA0 B;  3C98 B;  4UEM A;  2V5C A;  2LSK A;  3P8C D;  5F3J A;  2UXN B;  2XAF B;  1SHZ C;  5AQI B;  2N9D A;  5DAB A;  3LSV A;  1VOM A;  2Y8D A;  4YY3 T;  3QB5 A;  2XZE A;  2ZM2 A;  4QHO A;  4CN4 A;  2ACX A;  3SWH A;  2LSI A;  3KV6 A;  4HEA A;  4YJ2 E;  2XQA A;  1BR4 A;  2J4G A;  2V7K A;  2ZMA A;  2CHO A;  4UF0 A;  2LM2 A;  5H6R B;  1ZHC A;  5LP6 E;  2QGS A;  2XQ8 A;  4HFC A;  2OLT A;  4DUY T;  3L3P A;  2HN2 A;  1XNR T;  2KLQ A;  2NP9 A;  5JQG E;  3EVY A;  2DWG A;  3JC6 C;  3FBL A;  4TX5 A;  4AXP A;  5JDF A;  2I6H A;  5HEO A;  4TV9 E;  3ZCJ A;  2CXL A;  4UF0 B;  5HXS A;  2NW8 A;  1UCU A;  3Q9D A;  4IE0 A;  4CXY A;  1J5E T;  4AQF C;  3CQG B;  2YU2 A;  5LGT B;  5LGU B;  2P9B A;  3EUH A;  2C5K T;  2UU9 T;  5JVD E;  4O4H E;  2VWA A;  3ZJ2 A;  3OBV E;  4QX7 B;  2XM1 A;  4DV5 T;  2PG8 A;  1W0B A;  4BJM A;  3RIU C;  2LT3 A;  3F57 A;  5TAO A;  2L3L A;  1J1J A;  1KK7 A;  4X1K E;  4DR6 T;  4P1N A;  4X62 T;  2D0T A;  3RRW A;  5LBM A;  3VRA A;  5ABF A;  4DV3 T;  4Z90 A;  3AE9 A;  2VL0 A;  3UU6 A;  4AQG A;  4NPP A;  2CE7 A;  3UT5 E;  4DMV A;  3RQW A;  4H9R C;  2DL1 A;  4WZX A;  4YJ3 E;  3QUJ A;  3ANW A;  2CHN A;  3KV5 A;  4IRE A;  2PFV A;  3P50 A;  5KXJ A;  2Q9Q A;  2Q9Q D;  2XQ7 A;  3K3N A;  3MKD A;  3O1J A;  4EXT A;  2H88 A;  3O9X A;  1R8I A;  2BKN A;  4CZZ B;  4B6X A;  2XSB A;  3HKE E;  4ZI2 D;  3T8O A;  2UUB T;  2B76 A;  4JBW F;  4G2A A;  3GMI A;  1WR0 A;  3OKQ A;  2SPC A;  4DVD A;  1HCI A;  4A97 A;  3AE7 A;  5LHI B;  3ANW B;  2E2A A;  5AQL B;  5FKY A;  2WAU A;  5JRE A;  3OJA A;  1WYB A;  2UXX B;  2Q9Q B;  3ZMS B;  3LK4 2;  2KIN B;  2W2U A;  1OWA A;  1ZEE A;  2CMR A;  3OPC A;  1N32 T;  1J5W A;  3LK3 B;  3VU7 H;  4KHZ F;  1U5P A;  3ONX A;  2OA5 A;  4TZ4 C;  3S4U A;  1SUM B;  5EK2 A;  2Z6E A;  2JQK A;  3GN5 B;  3K1S A;  2WS3 A;  1HNW T;  3CML A;  1B7T A;  4CI3 B;  1LVK A;  5DJQ C;  4L9I A;  3AAI A;  4L0R A;  2LLY A;  2UXC T;  2M6I A;  4CI1 B;  4YHH T;  1D0X A;  1XDP A;  4U74 A;  4E7Z A;  5AQN B;  2VB6 A;  3IF8 B;  2OV9 A;  5ABG A;  1GQE A;  3A5X A;  2ODV A;  4KHP T;  4EYU A;  4UIG A;  4NUU A;  3Q2M A;  5AQT B;  3TLS A;  2ZM6 T;  2K5B B;  2WY2 A;  3RX6 A;  5AQR B;  2JQH A;  4X1I E;  5F8P A;  3O1I A;  3ZYM A;  4BAY B;  1M62 A;  3C64 A;  2XSA A;  1X9B A;  1HR0 T;  3P4P A;  1QUU A;  2X9W A;  3RC8 A;  1UX5 A;  3FZM B;  4NIQ A;  2VVN A;  5LHH B;  2Q9Q C;  2BVM A;  3QNU A;  1E7P A;  4H9S E;  3AEC A;  3FZH B;  1DU2 A;  5L2L A;  4JLE A;  4LML A;  3SS1 A;  2K48 A;  3RYH E;  3RKG A;  3QC9 A;  2KMF A;  3NKZ A;  1UK5 A;  3SRZ A;  3VHL A;  5LJM A;  3C4Z A;  3E22 E;  3AED A;  5HCJ A;  2W0G A;  4LF5 T;  3JAD A;  5HEU A;  1D1B A;  3TLW A;  3MA9 A;  3WI3 A;  5FNV E;  2J62 A;  5M4Y A;  2XQ6 A;  4AKI A;  2WU2 A;  1BR0 A;  3L39 A;  3SFE A;  3PU3 A;  3C4W A;  4U2Y A;  4IE4 A;  3AXJ A;  5EK4 A;  3CVR A;  5HXE A;  3ZN0 B;  4H9O C;  5IHY A;  5E0O A;  4A5X A;  2YK0 A;  2QYW A;  3FZF B;  1HTJ F;  4IL9 A;  3C4X A;  4EV6 A;  4QXC B;  2HH7 A;  3ZMZ B;  2V5D A;  5JR9 A;  1V9D A;  2V7J A;  3N2O A;  2FJB A;  4JUY A;  3FZK B;  1KEY A;  2Y48 B;  4AKH A;  3RRC A;  5A1L A;  4OK0 A;  4B3S T;  4IDP A;  4YTM A;  3RQU A;  2N2N A;  2AE9 A;  4HKA A;  4M1P A;  2C5J A;  4DV0 T;  3LBX A;  2VL8 A;  4LMJ A;  4QXB B;  4KUM B;  3AVS A;  5FY1 A;  5KMG P;  2X66 A;  4DBR A;  5LGN B;  3J7Y q;  2E5L T;  4JI2 T;  5JR9 B;  5L4E A;  4QKN A;  5CA0 E;  5C2T A;  3WAJ A;  3CIR A;  2LSY A;  1Y01 A;  3ZMT B;  1H7C A;  2XTL A;  4U31 A;  3AE1 A;  4X65 T;  1D0Z A;  2KND A;  5L3F B;  2UXB T;  3AAA B;  1OXZ A;  2PBI A;  3EI0 A;  4AKG A;  2XJ7 A;  5LXT E;  1KNP A;  2VQE T;  4UVA B;  2W61 A;  3PUG A;  4B3M T;  4JI4 T;  4B3T T;  3LFM A;  3O4X E;  2VKD A;  4WBN E;  2WCA A;  5J1G A;  3RHW A;  2H3R A;  2K9A A;  4PJJ A;  2XAJ B;  2WMN A;  3RYF E;  5LNK A;  1YW0 A;  5BR8 T;  4K0K T;  3J9X 1;  4GK0 E;  4OX9 T;  2AXD S;  2IUB A;  4PW8 A;  5LYJ E;  4IDN A;  3ZMV B;  5DQW A;  4EZ4 A;  4JI1 T;  3K8P C;  3P4S A;  3ZJ1 A;  2BDE A;  2E9X A;  3RIU A;  3PE0 A;  1Z8U A;  1ZOY A;  3M65 A;  4YLH A;  4AKL A;  4GYR A;  3IHR A;  4L5G A;  3ABV A;  3BK9 A;  1BR1 A;  1IBM T;  3T1Y T;  4NXM T;  3AA7 B;  4O2B E;  5JR9 C;  2FUP A;  1CHU A;  2LM9 A;  4QH4 A;  4H9P C;  3P4R A;  3P7I A;  3MAC A;  4EED A;  2FJE A;  4CI2 B;  5AFU L;  2E9X B;  3A8Y C;  2H7V C;  5J0Z A;  2V26 A;  3CX8 B;  3VKG A;  3FHN A;  4ISS A;  2WMO A;  4CN1 A;  4JI5 T;  4CQI A;  1FIO A;  4DUZ T;  2WZI A;  3MXZ A;  5JDN A;  4IGU A;  5HAX A;  3CX6 B;  2WQY A;  4NUV A;  1YQ4 A;  2WWV A;  5LA6 E;  2JMH A;  4LFB T;  4IHJ E;  2CA5 A;  5FYM A;  5FP3 A;  4IE7 A;  5FXZ A;  5AQU B;  4DR1 T;  5JRC A;  4XZC A;  4LFA T;  3FXE B;  1MIY A;  2CWY A;  1MIV A;  4PFP A;  4UR9 A;  5HWY A;  1QSD A;  3HR0 A;  2BVL A;  2XQ3 A;  1T7S A;  2X0H A;  4YXD A;  2DNX A;  3RLF F;  5BMV E;  4CXX A;  3RC3 A;  3ZMU B;  2IHR 1;  3F2E A;  2X67 A;  4EIW A;  3TLU A;  4AQY T;  4I4T E;  2NTY A;  4X64 T;  3IBP A;  1YXR A;  2LOS A;  4LF6 T;  5HWX A;  3ZEF B;  5JRC B;  4U72 A;  4YFS A;  3UUN A;  4JEU B;  4LF7 T;  3IEE A;  4LF8 T;  3PUQ A;  1HG5 A;  4HFH A;  1IJ5 A;  3ZKR A;  3EDV A;  3Q5D A;  2E9X C;  3R6N A;  2YKS A;  3M3Z B;  4UEL A;  2DWK A;  4O4L E;  3EHZ A;  1EZ3 A;  4I50 E;  4C90 A;  4TWF A;  3OYX A;  5FMN A;  3PUV F;  2V7I A;  2PTF A;  3Q5X A;  4JEH B;  4OFZ A;  2QA7 A;  2EHO A;  2XUE A;  2EHO D;  3AEB A;  4DR4 T;  4HFV A;  4X20 E;  3PV0 F;  1KNZ A;  2G0U A;  3UQ7 A;  1QLB A;  2WZH A;  4KMC A;  3BQI A;  5J2U E;  3E08 A;  2LOP A;  1CUN A;  4HFD A;  5LG4 A;  2C5I T;  4X5T A;  5H6Q B;  1IBK T;  4K0U A;  4XBF B;  3AVR A;  3RIA A;  3DTO A;  4MBQ A;  1HNZ T;  5ABF B;  2EHO B;  2X51 A;  2MPK A;  4JV5 T;  3MJX A;  3HA4 A;  2YN6 A;  4YTN A;  1NEK A;  3F31 A;  1IBL T;  4ZEY A;  3L8R A;  4A98 A;  2RP4 A;  3HI2 A;  2A9U A;  2X9X A;  4JYA T;  1MMG A;  5IYZ E;  4UXN B;  4YTP A;  4B3R T;  2WM9 A;  3CPZ A;  3WAK A;  2CBJ A;  4I43 B;  1E2A A;  3ZT7 A;  3Q5W A;  2KZ7 B;  4HN9 A;  2WSS V;  4I0U A;  4TN7 B;  2CM0 A;  5AQG B;  4OYK A;  4ZXL A;  2VKO A;  2RA1 A;  2PJQ A;  2ACZ A;  3ZC0 A;  2MBG A;  2IW5 B;  3ETV A;  4HGA A;  3H3A A;  4UV8 B;  3NZQ A;  1D1C A;  3UUB A;  1FMV A;  5L47 A;  4ZI3 D;  5L3G B;  3FBZ A;  2GK9 A;  4LF9 T;  4AI6 A;  3ZT5 A;  3AE2 A;  4IT4 A;  5LMU T;  3I9Y A;  4G63 A;  1WFD A;  2VK9 A;  5LBQ B;  5L3C B;  4HFE A;  5L4H A;  3B5M A;  2LRK A;  4FI5 A;  2VKJ A;  4X1Y E;  2VAS A;  1MMA A;  2W4X A;  3CQC B;  5L3E B;  2EHO C;  3W15 B;  4EYY R;  4ZS3 A;  3X1D A;  3V5U A;  1XMO T;  2V7M A;  4N78 D;  2LJL A;  4CXW A;  3RPU A;  3VRB A;  2V8S V;  2Y6X A;  1LVF A;  1HX1 B;  2D0U A;  3KFW X;  4HWC A;  4HWF A;  5HYA A;  3FXD B;  2XHE B;  1W9R A;  2LKG A;  3KDS E;  4DMW A;  2HHH T;  2JJ9 A;  5HXC A;  1YKE B;  4ZI2 C;  5LG3 A;  3LG7 A;  5FVL A;  1S94 A;  3RH3 A;  1MNE A;  3L09 A;  5LJN A;  3I9W A;  5J2T E;  4IDO A;  3NBX X;  3ZYL A;  3RF1 A;  2D2S A;  2BKO A;  2FJA A;  4JI7 T;  2ODU A;  4HE8 A;  4JI0 T;  3JAE A;  2W62 A;  3AEE A;  2B1E A;  1WR6 A;  3KBU A;  1JNZ A;  2IML A;  2V6X A;  1IJ6 A;  1W09 A;  1UUS A;  4FJO A;  4IDZ A;  2ZM8 A;  4XAX B;  4DID B;  3DJB A;  1G8X A;  1SE7 A;  1KNR A;  4JI3 T;  5FY7 A;  4PK5 A;  2W66 A;  1T8B A;  4JI8 T;  4O2A E;  4EOZ B;  2E5V A;  1D1A A;  2LE8 A;  2JQ9 A;  4V1A v;  1VRB A;  4WYV A;  4HWI B;  4WBO A;  2X68 A;  4ZI3 C;  3ZSS A;  4Z91 A;  2WWU A;  2WBL A;  1YKH B;  3AXJ B;  3PUS A;  4CN6 A;  4TNW A;  4U7Y A;  3N9N A;  2KWH A;  2CCQ A;  1YD8 G;  5AQK B;  2LHR A;  4DR2 T;  2ZLY A;  3UU3 A;  3T1H T;  2UUA T;  3KBT A;  2L9Q A;  2XQ5 A;  4IE5 A;  4AKR B;  3AEA A;  1XNQ T;  3ZLI A;  5FY0 A;  4GK5 E;  1I6Z A;  3N9M A;  4EGW A;  2YDR A;  4WNK A;  3AAE B;  3N5L A;  4EEB A;  3IA3 A;  3N9O A;  3CKD A;  3TLT A;  3LBX B;  3DP7 A;  2HPJ A;  4GOU A;  3BQK A;  3RYC E;  3LDQ B;  3AA1 B;  4GIW A;  2VKH A;  1IAP A;  2V7L A;  2NW7 A;  2RPA A;  5AQM B;  3UUX B;  1VCT A;  5CGM A;  2CLY B;  3CX7 B;  2KSR A;  2NTX A;  1E1H B;  3AEF A;  4PK4 A;  5AQP B;  5ABH A;  5ADX L;  2YU1 A;  3N9L A;  2V1D B;  3CQX C;  2XAQ B;  4UVC B;  4ZI7 E;  1T98 A;  5CJ5 A;  5CA1 E;  3ZCI A;  1MMD A;  1ZKE A;  2YEV C;  4H63 V;  1X79 A;  5LHG B;  4MAL A;  2L8K A;  2CBI A;  2HN1 A;  4E7S A;  5GON E;  3ZN1 B;  1FMW A;  4DR7 T;  5JDH A;  4PFO A;  4H9Q C;  5EZY E;  1XDO A;  3EDU A;  3EAM A;  4ADZ A;  5AQJ B;  3QOF A;  4DV4 T;  2WB5 A;  4WW0 A;  3GA8 A;  4F8H A;  4DND A;  4H9N C;  3C51 A;  2NR4 A;  4F6R C;  1HNX T;  2IC9 A;  2WDQ A;  3NRX A;  2JMK A;  4LF4 T;  1HX8 A;  1UUR A;  4BA9 A;  4LMK A;  4QXH B;  3NRY A;  2WU5 A;  3ONL C;  2YDS A;  5JDM A;  4X66 T;  3VR8 A;  4HFI A;  2BKP A;  3ZPO A;  2NWB A;  2XAS B;  2R6G F;  2WDR A;  2KT9 A;  2YDQ A;  4IIJ E;  4TNV A;  4TV8 E;  2XQ4 A;  2MOZ A;  4OHF A;  2CLY C;  5CB4 E;  4YT0 A;  2UXD T;  4PNI A;  3OYZ A;  5IUX A;  5JH7 E;  3KVA A;  4EB6 E;  4Z8X A;  1BR2 A;  4P09 A;  5JTG A;  4ASK A;  2BS3 A;  2CPT A;  3PUY F;  2BG9 A;  4MHC A;  3UU5 A;  5KX5 E;  3PDY A;  5AQO B;  5HEH A;  1WYC A;  4DBQ A;  3N2K E;  5IWA T;  4P0B A;  2DLR A;  4ILU A;  2CXF A;  3HKD E;  1O3X A;  3PU8 A;  3UTK A;  1D0Y A;  4A56 A;  4KP3 C;  2K24 A;  1I94 T;  3H37 A;  3HKB E;  3UU8 A;  4BJN A;  4HWD A;  3C50 A;  5LOV E;  1MIW A;  2BG9 B;  1YQ3 A;  5FL0 A;  2W67 A;  2LRL A;  2C0S A;  3TKL B;  4ILB A;  5C8Y E;  1L0V A;  3V5S A;  2JQQ A;  5HEJ A;  2IDO B;  1WCR A;  3N9P A;  2LEH A;  2BBJ A;  2M67 A;  4YSZ A;  4YSY A;  1FJG T;  4U3C A;  3LJC A;  5JDG A;  1MND A;  1ZV4 X;  1US7 B;  1HS7 A;  3PUW F;  1W0A A;  1N36 T;  2CWO A;  3PTR B;  2XAG B;  2I59 A;  3KIN B;  3ONJ A;  1XMQ T;  2I0M A;  4NXN T;  2XPK A;  3PJA J;  4QX8 B;  5ABE A;  2KWI B;  1LKX A;  2HPL A;  3EAB A;  1KFY A;  1OED A;  5FXW A;  4DV7 T;  4ZOL E;  5FL1 A;  3HKC E;  4KI0 F;  3UQ4 A;  3PUA A;  1XZY A;  4ANJ A;  4TUY E;  2LHN A;  3RI5 A;  2VUR A;  3ESL A;  1UX4 A;  3UUL A;  3KV4 A;  3BQL A;  3N2G E;  2A72 A;  3SOL A;  2E8I A;  5KDM C;  3LK2 B;  3ZT6 A;  4YSX A;  2ZM0 A;  2BG9 C;  3U78 A;  1OED B;  1S35 A;  3AE5 A;  3UFE A;  3I0O A;  4HWH A;  4J2C A;  3NZP A;  2X9H A;  4O4I E;  2IAK A;  2J1D G;  4Q25 A;  2X9Y A;  4U2Z A;  5AQQ B;  3PUX F;  4DV2 T;  2BG9 E;  3GN5 A;  5LB7 B;  1MMN A;  5F5W A;  2LSG A;  5HXR A;  4JI6 T;  2H7O A;  2K3W A;  3D0T A;  1NEN A;  4OYJ A;  3RYI E;  1N33 T;  3RGL A;  3UFG A;  4PJN A;  5CFB A;  1NWM X;  3CK6 A;  4ILC A;  4KX6 A;  2JPF A;  4MLK A;  5HXH A;  3E0Z A;  5DQV A;  2JIW A;  3H3M A;  3B13 A;  4IDQ A;  5AQF B;  3P4W A;  2X0Y A;  2DCF A;  4ZS2 A;  5L3B B;  2XQY A;  4AIS A;  1UGO A;  5ETW A;  4DR3 T;  3AE6 A;  3RIF A;  5HEG A;  4EZH A;  1HF8 A;  1ZP0 A;  3O1H A;  2A2F X;  1OED C;  1M7K A;  3B57 A;  4QH5 A;  2MAW A;  5FVK A;  4HFB A;  2FBW A;  3HL6 A;  2V6Y A;  2BZB A;  3R84 B;  3UUM A;  1IZN B;  2M6B A;  4PAG A;  3AEG A;  1AJ3 A;  2D5U A;  5LMN T;  4HTE A;  3AB3 B;  4QWN B;  1OED E;  2JRK A;  2VVS A;  1XWM A;  5AQV B;  2CEA A;  4H63 H;  1JNR A;  2WDV A;  2X0L B;  1Z0P A;  2MTQ A;  3PJA A;  2YOE A;  3NVO A;  4I55 E;  4IE6 A;  2MYS A;  3G06 A;  1HFA A;  2V6Y B;  2KXP B;  3MK7 C;  3KV9 A;  3PUR A;  2F4V T;  4U7I A;  5FXX A;  4ZZC A;  4PJL A;  4GYS A;  2H89 A;  3AE8 A;  4QH1 A;  1U4Q A;  3KVB A;  5LCY A;  3GWH A;  4AIU A;  3RKO A;  4DR5 T;  4DV1 T;  3VKH A;  4ERR A;  5L3D B;  4U33 A;  4UVB B;  3TLV A;  4ZHQ E;  2W00 A;  4PJM A;  3PUZ F;  4YHJ A;  2N1G A;  4IST A;  4IL4 A;  5AQS B;  3ZST A;  2XM2 A;  3N9Q A; 
#chains in the Genus database with same CATH homology
 4LF4 T;  1N34 T;  1XNQ T;  4JI7 T;  4JI0 T;  4LFB T;  1J5E T;  4DV2 T;  4KHP T;  4X66 T;  4DR4 T;  5BR8 T;  5LMN T;  4K0K T;  4OX9 T;  1FJG T;  4DR1 T;  4JI6 T;  2UU9 T;  4LFA T;  4LF9 T;  2ZM6 T;  4DV6 T;  2UUB T;  1N33 T;  5LMU T;  4JI1 T;  4JI3 T;  4DV5 T;  2UXD T;  1N36 T;  4YY3 T;  1IBK T;  4JI8 T;  1XMQ T;  2UUC T;  4NXN T;  3OTO T;  1HNZ T;  4B3S T;  2VQF T;  1HR0 T;  4GKK T;  4LFC T;  2F4V T;  4DV0 T;  4AQY T;  4X64 T;  1IBM T;  4JV5 T;  3T1Y T;  4NXM T;  2E5L T;  1XMO T;  4LF6 T;  4JI2 T;  4DR7 T;  4DV7 T;  5IWA T;  4LF7 T;  4LF8 T;  1N32 T;  4DR6 T;  4DR5 T;  4DUY T;  4DV1 T;  4X62 T;  1IBL T;  4DR3 T;  1XNR T;  4DV4 T;  1I94 T;  4X65 T;  4LF5 T;  4JYA T;  4DV3 T;  2UXB T;  4GKJ T;  4B3R T;  4DR2 T;  1HNW T;  2HHH T;  3T1H T;  2VQE T;  2UUA T;  4JI5 T;  4B3M T;  4DUZ T;  1HNX T;  4JI4 T;  2UXC T;  4YHH T;  4B3T T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...