4DUYT

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, u13c
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
total genus 34
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 4duyT00
1HNZT 1XMQT 3T1YT 4LF9T 4JI7T 2VQET 1HR0T 4KHPT 4B3MT 1IBKT 1I94T 2UUCT 4JI1T 4DR6T 4DV7T 4B3ST 5LMNT 4LFBT 4AQYT 1IBLT 4DR3T 4LFCT 4NXNT 4DV3T 4DR2T 4JI4T 4JI3T 4LF7T 1N33T 4K0KT 4DR7T 2VQFT 4GKKT 1XNQT 3T1HT 2UU9T 2E5LT 2UUBT 4LF6T 4JI0T 4JYAT 4LF5T 4JI5T 4X66T 4DV4T 4OX9T 4LF4T 5LMUT 4YHHT 1XMOT 4DR1T 2UXCT 2UXBT 1N32T 4LFAT 2UXDT 1HNWT 4JI6T 4X65T 4DV5T 2UUAT 1HNXT 4DV1T 4YY3T 4DV6T 4X62T 5IWAT 4JI2T 4JV5T 3OTOT 4LF8T 4DUZT 1N36T 4B3TT 1J5ET 2HHHT 2ZM6T 1XNRT 2F4VT 4NXMT 4DUYT 4JI8T 4X64T 1FJGT 4B3RT 4DR5T 4DV0T 4DR4T 4DV2T 1N34T 4GKJT 5BR8T 1IBMT
chains in the Genus database with same CATH superfamily
3GA8A 2L9QA 2VVNA 3KBUA 2BBHA 5L4EA 3EAMA 3SS1A 4LFCT 3ZC0A 2W4XA 3RLFF 2CHOA 2BVMA 2XAQB 3AVSA 4YTMA 4ISSA 3L3PA 4K0KT 5JQGE 3M65A 2MPKA 1HF8A 2VKHA 3NZQA 4MHCA 1ZV4X 1Y01A 3B13A 5JDGA 1MMAA 2BDEA 3OKQA 2BBJA 4LF5T 3ABVA 2I59A 2E8IA 2VL8A 1KNPA 1WYBA 4DR1T 2WMOA 2YEVC 1KNZA 3OJAA 3VU7H 2NW8A 3UFEA 1HG5A 4AQGA 5LHHB 3QK6A 3LBXB 2Q9QD 1OXZA 2X9XA 2LHNA 5ABHA 2WSSV 3N9LA 2AXDS 1T98A 3JAEA 3PUGA 2KMFA 3NVOA 1XMQT 2ES0A 1BR1A 3FBLA 5JTGA 5AQVB 5J0ZA 1IBLT 3WI3A 4ZHQE 4ZI2C 4DVDA 2XSBA 4ILAA 3NZPA 4LF7T 2V7LA 4Q25A 4DR7T 3A8YC 2LOSA 5ABEA 1XDPA 2CXLA 3VKGA 1HX1B 3FXDB 3UU5A 3Q5DA 5LP6E 2E9XD 4EXTA 1BR0A 3GN5A 3ZCJA 2LHRA 3IA3A 4JEHB 4PK4A 2ODUA 1XMOT 4KP3C 4BA9A 1N32T 4GYSA 4U33A 2KT9A 1WFDA 2X0HA 5FXWA 5FXXA 4DV1T 4DV6T 3N5LA 4EEDA 1W0BA 3H3AA 4P09A 3IBPA 5AQIB 3K3QC 1XDOA 2JQ9A 3ETVA 2YOEA 4MBQA 1UX4A 4YJ3E 4C91A 3ZYLA 1T72A 5CFBA 2HPJA 2Q9QB 1NENA 4B6XA 1ZEEA 3ONJA 2CM0A 3S4UA 3FB2A 2CBIA 5L3CB 3ZN1B 2H7VC 2FUPA 5HEJA 2BZBA 2XQ7A 2PFVA 3UQ4A 3HR0A 5JR9A 1H7CA 3T1HT 2LKGA 3N2OA 5HXSA 2QYWA 4ZS3A 4J2CA 5AQTB 2NTYA 2WAUA 5HEHA 4COFA 5ABFB 2W61A 4H9NC 4OYKA 4YT0A 4JYAT 4TX5A 3LFMA 4X66T 4DV4T 5AQUB 4DO0A 2V6YA 4IDNA 1MIYA 1WR0A 2E9XB 5LG4A 4YHJA 2KNDA 4A5XA 1HNWT 4U2ZA 4BJMA 3MXZA 4QH4A 2Y48B 2XM1A 2J1DG 3ZYKA 4WBOA 2A3DA 5IYZE 4TNVA 2XQ5A 1NWMX 3C4WA 2E2AA 3FZFB 3OVUA 3GN5B 3QNUA 4P0BA 2RPAA 3AAIA 3CIRA 4MFRA 4YSZA 3KINB 2ZM6T 3PUAA 2YDRA 3J9X1 5F5WA 3AE4A 4KX6A 1ZOYA 2YKSA 3AXJA 5LXTE 4UR9A 5LBQB 2IHR1 2NP9A 3Q5WA 4O4HE 3U78A 5L4HA 5LMNT 2M6BA 4LFBT 3Q9DA 2IUBA 2OV9A 3U3IA 3C4ZA 3E22E 5JDQA 4O4IE 2WCAA 4U31A 4YTPA 4E7ZA 3A7MA 5LB7B 5FXZA 2ACXA 3OYXA 4WYVA 1MNDA 4P0AA 3AE9A 2WDRA 4AQFC 4QX8B 4DIDB 3A5XA 5DJQC 2CPTA 4UVBB 1S94A 2BG9A 4X1IE 3AE7A 5JR9B 4AKGA 4CZZB 2KLQA 4L0RA 2IIUA 1SHZC 3LK3B 2D0TA 3RIAA 2ACZA 3AAEB 5KX5E 5LHGB 2CHNA 3RRCA 4JI2T 5AQPB 4CI2B 3DJBA 2V6YB 2CWYA 2W63A 3E0ZA 4DBRA 2LSIA 3IF8B 1R8IA 3PURA 3EUHA 4AKIA 2XPKA 3L09A 5JDFA 3ZMTB 4DV2T 5JH7E 1IBMT 1FEWA 1QLBA 3NRXA 4FI5A 3VR8A 2NW7A 3MACA 3N9OA 3QB5A 4PK6A 3VR9A 3DP7A 3ZT5A 4DV3T 4DR2T 2VKJA 4JI4T 4OHFA 4O8SA 3AEBA 3O1IA 1WCRA 4L9IA 3CX7B 3F57A 4MLKA 1E2AA 5JR9C 4UIGA 1E1HB 3AA1B 3AXJB 4KMCA 4CI3B 4IL4A 5L3GB 1E7PA 5LHIB 1X9BA 3H37A 1FIOA 2XSAA 2WMNA 3H3MA 4LF4T 3V5UA 3LG7A 2LM9A 3OPCA 4M1PA 3C64A 5AQRB 2Y8DA 4ILUA 3ZLIA 1LKXA 2YINA 3QB5K 2NOXA 3CWZB 5CB4E 4KHZF 5HCMA 4PJJA 4AKRB 2J4GA 5AQMB 1OEDE 5AQFB 3UU6A 5DABA 4CN6A 3KV4A 3RI5A 3PJAA 4MALA 4DMWA 4Z8XA 5F8PA 2CWOA 3C51A 4A56A 5KMGP 4JBWF 1DU2A 1O3XA 2DHRA 2HH7A 2ODVA 5FXVA 3Q5EA 4PNIA 5A1LA 5DQVA 2C5KT 4TWDA 1Y64B 4HWFA 5C2TA 2A2FX 3CQCB 5HWXA 3FBZA 5FVKA 2K9AA 3K8PC 4NXNT 2K48A 3CMLA 3W15B 4AKHA 3AB3B 1WLXA 4LMKA 5KXJA 4GYRA 5M4YA 2L8KA 2YDQA 5E0OA 5LGTB 2ZM8A 3I0OA 2V7IA 3SOLA 5AQLB 1B7TA 3RH3A 1VCSA 4ZI3C 4HFCA 5AQJB 4X1YE 1SUMB 2V7KA 3ZJ1A 2VKOA 3TLSA 2V8SV 4HWIB 2BG9C 3ZN0B 3N2GE 4FJOA 4JI6T 2FJAA 4HFHA 4PJMA 3QOFA 2D2SA 2CCQA 1MIWA 1KK7A 3CQGB 3OTOT 2K3WA 1N36T 3CVRA 3RIFA 3ONLC 1J5ET 2Q9QA 4HWDA 4NXMT 2MBGA 4PFPA 3ZJ2A 4EZ4A 2ZM2A 2MAWA 2LJLA 3RHWA 5HXCA 2V26A 3LK42 2DI4A 3RF1A 1HNZT 2CA5A 4HGAA 4LMLA 2XJ7A 2H3RA 3R6NA 1IBKT 2DWKA 2JQHA 4B3ST 3LSVA 3RYCE 3ZMZB 5JVDE 2W67A 5ABFA 3QUJA 4QWNB 2V7MA 1XNQT 4AKLA 2VASA 2OLTA 4TZ4C 4ILCA 3HKBE 4QHOA 4OYJA 4DMVA 2NR4A 2E9XA 2VVSA 2XQ4A 2MYSA 2P9BA 3C4XA 3CK6A 3L39A 3AVRA 2BKPA 3D0TA 1KEYA 4A98A 1J5WA 3AA6B 4ZOLE 3OBVE 2LOPA 5IHYA 5ABGA 2UXXB 4TWFA 2PBIA 2WP9A 2N9DA 4JEUB 3O4XE 3JCFA 3TLWA 3FZHB 5LCYA 1IJ5A 5HYAA 5FL0A 4I0UA 3KVBA 3WAJA 4H9PC 3SWHA 2WS3A 4AI6A 4I43B 3AA7B 3X1DA 1OEDB 2MOZA 2KXPB 3EVYA 4EYUA 3AE5A 3I9WA 4U72A 3ANWA 2AE9A 3ZSSA 2XQ9A 4UVCB 2I6HA 4YJ2E 1N34T 2KZ7B 2WB5A 2HPLA 2OA5A 2DCFA 4I55E 5FMNA 3UUBA 2X0YA 3P4QA 2CBJA 2QVAA 3HKDE 5HXEA 1W9RA 2PTFA 4U74A 2HN2A 4ANJA 4NPPA 5LJMA 1XWMA 3P8CD 4UV8B 5FL1A 1SE7A 1HCIA 3AA0B 2B76A 2QA7A 3F31A 3P4WA 4G2AA 5JREA 3HL6A 1ZP0A 2DLRA 3I1AA 2LT3A 5CA0E 1HG2A 3NBXX 3PUQA 4PFOA 2Z6EA 3SRZA 2LSYA 1S35A 3VHLA 2UUAT 3ZC1A 2JIWA 3PUVF 4F8HA 4CN1A 4ZI7E 4WW0A 4YY3T 2Y6XA 3P4SA 4H63V 2L3LA 4EAHA 4GK5E 5LOVE 5BMVE 2VK9A 4ADZA 5FKYA 2Q9QC 2JMKA 3ZT7A 3AE2A 4YXDA 4DR4T 2FBWA 3SFDA 2XQYA 1X79A 3N9MA 2W62A 3PU8A 3CQXC 2KSRA 2ZMAA 1M7KA 2J62A 5FY1A 4PAGA 1CUNA 2WY2A 5LGUB 5JRCA 4DR3T 3PUWF 4HKAA 3WAKA 5CA1E 2BS3A 1US7B 1N33T 2V5CA 3ANWB 2E5LT 1D0YA 4ISTA 3UU4A 4N78D 2XQ8A 4OX9T 2E9XC 3RGLA 2M67A 5AQHB 3O9XA 3I9YA 4CN4A 1G73A 1EZ3A 1YD8G 4CQIA 2WU5A 4IE5A 3P7IA 5L3BB 4KI0F 5FY7A 4ZS2A 2BKOA 3ZMVB 3UUXB 5FNVE 4U2YA 3PV0F 4IE4A 4HFEA 2D9DA 3KBTA 4U3CA 5L47A 2SPCA 2IC6A 5AQKB 4HN9A 2XHEB 2BKNA 2IW5B 1XNRT 2K24A 2G0UA 5FVLA 3G06A 4I50E 3EABA 2WWUA 2GK9A 5ADXL 2VQET 4O4LE 4JI1T 2N2NA 2CXFA 1FMWA 1LRZA 2WU2A 3UU8A 2XAHB 3UULA 2V6XA 4TV9E 5LGNB 2XQ6A 4IREA 4TNWA 1WYCA 3PUXF 1FMVA 4YSXA 4JI0T 2RP4A 2MTQA 1J1JA 5JRCB 3FZMB 3O1JA 2XZEA 2UXCT 3UT5E 2N1GA 4IDOA 3RC3A 5EK2A 3TLVA 4LFAT 2UXDT 3KDSE 5HAXA 3V5SA 1UK5A 3PTRB 5ETWA 1D1BA 3ZYMA 4G63A 4O2BE 4TV8E 1MMDA 5CJ5A 3ETUA 1W09A 4LF8T 4E7SA 4UVAB 3ESLA 5JDLA 3KVAA 2JPFA 4DNDA 4DUYT 2CEAA 4X64T 3P50A 2DNXA 3AAAB 3AE6A 1QSDA 4TUYE 3CKDA 4DV0T 4AISA 3N9PA 3JC6D 3EI0A 1I94T 4CI1B 4ZI2D 3CX6B 2X9WA 2PG8A 4H9QC 5AQOB 1YKEB 4KBMB 4JI3T 4GOUA 3RPUA 2XAFB 4YFSA 2DWGA 3ZKRA 2X9YA 5AFUL 3DTOA 5JDHA 2LE8A 5L3DB 4NIQA 5LBMA 4EZHA 1MMGA 4O4JE 4ZEYA 3BQIA 2LLYA 3K3NA 3MA9A 4H63H 2BS2A 1SA0E 2QRXA 2XM2A 4IE0A 2E5VA 4PJLA 3ZEFB 3NRYA 1KF6A 3P4RA 4H9OC 4IE7A 1MIVA 4LMJA 3PUSA 5HXHA 3PJAJ 1VOMA 2X66A 2CRBA 2XUEA 4IGUA 4X62T 1OEDA 5IWAT 3RIUA 4PK5A 4EGWA 5JDMA 2KINB 3RKOA 3OYZA 5L3EB 3ZMUB 4PW8A 4QH1A 3UFGA 3PDYA 4C90A 4HWHA 3ZCIA 3GWHA 4IDQA 4WZXA 3T1YT 4LF9T 4IHJE 4I4TE 1D0ZA 2CXDA 4EYYR 4DV7T 4CXWA 4YTNA 3Q2MA 4AQYT 1D0XA 1D1CA 3ZMSB 1XZYA 2YDSA 1KNRA 3UUMA 1GQEA 5LJNA 2X68A 4GKKT 3B5MA 4ILBA 3T8OA 2VL0A 3HKCE 3JAFA 5HEOA 1LVFA 2W0GA 3AEGA 1UURA 3FZKB 5LMUT 5F3JA 3UQ7A 2JQKA 1Z8UA 2D5UA 4QXHB 5JDNA 5KDMC 3MKDA 1D1AA 2LSJA 1VCTA 3L8RA 3SFEA 3IHRA 1IJ6A 2B1EA 3AEDA 2D0UA 4EIWA 3AE3A 3ZSTA 1YQ4A 4IL9A 5C8YE 1WRDA 1WR6A 4BAYB 4JV5T 2XY8B 2FJEA 3JC6C 3VRAA 2WWVA 4WNKA 1UGOA 2LEHA 3N2KE 3RX6A 5H6QB 4ZXLA 2XTLA 3EHZA 2H88A 1Z0PA 4A97A 3E08A 2KWIB 1V9DA 4F6RC 2VURA 3RQWA 1U5PA 2UXNB 3J7Yq 4HTEA 2V7JA 1JNRA 2XAJB 3O1HA 4U7YA 4AQFA 2K5BB 1VRBA 5J2TE 4KUMB 3M3ZB 2CMRA 2LSGA 3ONXA 4NUUA 5FY0A 3AEFA 2ZLYA 3LDQB 4GIWA 5HXRA 3UUNA 3C98B 2UXBT 1G8XA 2IMLA 4EOZB 3NKZA 4ASKA 4OFZA 4X65T 3TKLB 4DV5T 1YQ3A 2WBLA 4OK0A 1I6ZA 2JJ9A 5TAOA 5J1GA 2C0SA 4X1KE 4UEMA 4XZCA 3EDUA 1OEDC 3RIUC 1T7SA 2A9UA 1YW0A 4B3TT 5AQGB 2WDVA 4IT4A 4ZZBA 1NAFA 2XQ3A 2DL1A 1AJ3A 5CGMA 2BVLA 4IDZA 3QC9A 2FJDA 2IDOB 2WM9A 2X0LB 3F2EA 5BR8T 3RYHE 4QH5A 2XASB 3Q5XA 4JI7T 2M6IA 5EK3A 1HR0T 4B3MT 2EHOA 2VB6A 3LJCA 5EZYE 4EEBA 3RKGA 3JADA 3IEEA 4HFIA 4H9SE 3EDVA 2VQFT 2JRKA 2R6GF 1BR2A 2X67A 3AE1A 2EHOD 1ZHCA 4UF0A 4X20E 4ERRA 2JQQA 4JI5T 2C5IT 3RYIE 1T8BA 1MMNA 2QGSA 4H9RC 2C5JA 3FHNA 3MJXA 3KV6A 3HI2A 2WZIA 4Z91A 5LNKA 5L2LA 2V1DB 5AQNB 1HFAA 3RC8A 3UU3A 2YN6A 3PUYF 2BG9E 4P1NA 2WDQA 4JUYA 1HNXT 2RA1A 4CXXA 1BR4A 2HN1A 1KFYA 4EV6A 2KWHA 2VWAA 5H6RB 4QX7B 2V5DA 1IAPA 4DUZT 5LA6E 4CXYA 3K3OA 2LSKA 3BQLA 2PJQA 3N9NA 2LM2A 1OWAA 3CPZA 1LVKA 2CLYB 4V1Av 2XQAA 4DBQA 2YK0A 3AEEA 4QXCB 2UUCT 4DR6T 2H7OA 2NW9A 3FZLB 2ZM0A 2NWBA 4NUVA 1W0AA 2WZHA 2YU2A 5IUXA 2WQYA 4X5TA 5FYMA 3KV9A 4UELA 1MNEA 1UUSA 4YLHA 2UU9T 3KFWX 4GK0E 3BK9A 4EB6E 2LRLA 2EHOB 4YSYA 4ZI3D 5HEGA 2H89A 3PUZF 4YHHT 3BQKA 4HFDA 3NWIA 4WBNE 3C50A 3CX8B 1QUUA 4JLEA 2CLYC 4UF0B 3PU3A 2CE7A 2I0MA 5GONE 1HX8A 4TWHA 4QKNA 4AXPA 3RQUA 3HKEE 3VKHA 5L3FB 2F4VT 2W00A 5DQWA 1FJGT 4B3RT 1UCUA 3ZT6A 4IDPA 5J2UE 1HTJF 3VRBA 4KHPT 4HWCA 4L5GA 2EHOC 3B57A 4IE6A 5EK4A 2NTXA 4PJNA 4HFVA 5FP3A 1YXRA 2W2UA 3MK7C 5LYJE 5AQQB 3TLTA 3HA4A 3AE8A 1IZNB 4QXBB 1M62A 2XAGB 1ZKEA 4K0UA 1NEKA 4O2AE 5C3JA 2BS4A 2LRKA 4TN7B 3K1SA 4Z90A 3AEAA 3RRWA 3TLUA 1L0VA 2UUBT 4LF6T 3PE0A 2FJBA 4ZZCA 5HWYA 3LBXA 3ZPOA 1YKHB 4HEAA 5HEUA 3MZKB 3P4PA 1UX5A 2LKHA 2X51A 3N9QA 2JMHA 3UTKA 3GMIA 4BJNA 3LK2B 2VKDA 2BG9B 4XBFB 3FXEB 2A72A 3RYFE 1CHUA 3I0QA 2IC9A 2J47A 4XAXB 4AIUA 2W66A 2IAKA 1JNZA 3R84B 4U7IA 4UV9B 4HFBA 2HHHT 5HCJA 4JI8T 5AQSB 2YU1A 3KV5A 4DR5T 3AECA 1HS7A 1U4QA 4HE8A 4IIJE 2X9HA 5LG3A 4GKJT 4UXNB
chains in the Genus database with same CATH topology
1HNZT 1XMQT 3T1YT 4LF9T 4JI7T 2VQET 1HR0T 4KHPT 4B3MT 1IBKT 1I94T 2UUCT 4JI1T 4DR6T 4DV7T 4B3ST 5LMNT 4LFBT 4AQYT 1IBLT 4DR3T 4LFCT 4NXNT 4DV3T 4DR2T 4JI4T 4JI3T 4LF7T 1N33T 4K0KT 4DR7T 2VQFT 4GKKT 1XNQT 3T1HT 2UU9T 2E5LT 2UUBT 4LF6T 4JI0T 4JYAT 4LF5T 4JI5T 4X66T 4DV4T 4OX9T 4LF4T 5LMUT 4YHHT 1XMOT 4DR1T 2UXCT 2UXBT 1N32T 4LFAT 2UXDT 1HNWT 4JI6T 4X65T 4DV5T 2UUAT 1HNXT 4DV1T 4YY3T 4DV6T 4X62T 5IWAT 4JI2T 4JV5T 3OTOT 4LF8T 4DUZT 1N36T 4B3TT 1J5ET 2HHHT 2ZM6T 1XNRT 2F4VT 4NXMT 4DUYT 4JI8T 4X64T 1FJGT 4B3RT 4DR5T 4DV0T 4DR4T 4DV2T 1N34T 4GKJT 5BR8T 1IBMT
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HNZ T;  1XMQ T;  3T1Y T;  4LF9 T;  4JI7 T;  2VQE T;  1HR0 T;  4KHP T;  4B3M T;  1IBK T;  1I94 T;  2UUC T;  4JI1 T;  4DR6 T;  4DV7 T;  4B3S T;  5LMN T;  4LFB T;  4AQY T;  1IBL T;  4DR3 T;  4LFC T;  4NXN T;  4DV3 T;  4DR2 T;  4JI4 T;  4JI3 T;  4LF7 T;  1N33 T;  4K0K T;  4DR7 T;  2VQF T;  4GKK T;  1XNQ T;  3T1H T;  2UU9 T;  2E5L T;  2UUB T;  4LF6 T;  4JI0 T;  4JYA T;  4LF5 T;  4JI5 T;  4X66 T;  4DV4 T;  4OX9 T;  4LF4 T;  5LMU T;  4YHH T;  1XMO T;  4DR1 T;  2UXC T;  2UXB T;  1N32 T;  4LFA T;  2UXD T;  1HNW T;  4JI6 T;  4X65 T;  4DV5 T;  2UUA T;  1HNX T;  4DV1 T;  4YY3 T;  4DV6 T;  4X62 T;  5IWA T;  4JI2 T;  4JV5 T;  3OTO T;  4LF8 T;  4DUZ T;  1N36 T;  4B3T T;  1J5E T;  2HHH T;  2ZM6 T;  1XNR T;  2F4V T;  4NXM T;  4DUY T;  4JI8 T;  4X64 T;  1FJG T;  4B3R T;  4DR5 T;  4DV0 T;  4DR4 T;  4DV2 T;  1N34 T;  4GKJ T;  5BR8 T;  1IBM T; 
#chains in the Genus database with same CATH topology
 3GA8 A;  2L9Q A;  2VVN A;  3KBU A;  2BBH A;  5L4E A;  3EAM A;  3SS1 A;  4LFC T;  3ZC0 A;  2W4X A;  3RLF F;  2CHO A;  2BVM A;  2XAQ B;  3AVS A;  4YTM A;  4ISS A;  3L3P A;  4K0K T;  5JQG E;  3M65 A;  2MPK A;  1HF8 A;  2VKH A;  3NZQ A;  4MHC A;  1ZV4 X;  1Y01 A;  3B13 A;  5JDG A;  1MMA A;  2BDE A;  3OKQ A;  2BBJ A;  4LF5 T;  3ABV A;  2I59 A;  2E8I A;  2VL8 A;  1KNP A;  1WYB A;  4DR1 T;  2WMO A;  2YEV C;  1KNZ A;  3OJA A;  3VU7 H;  2NW8 A;  3UFE A;  1HG5 A;  4AQG A;  5LHH B;  3QK6 A;  3LBX B;  2Q9Q D;  1OXZ A;  2X9X A;  2LHN A;  5ABH A;  2WSS V;  3N9L A;  2AXD S;  1T98 A;  3JAE A;  3PUG A;  2KMF A;  3NVO A;  1XMQ T;  2ES0 A;  1BR1 A;  3FBL A;  5JTG A;  5AQV B;  5J0Z A;  1IBL T;  3WI3 A;  4ZHQ E;  4ZI2 C;  4DVD A;  2XSB A;  4ILA A;  3NZP A;  4LF7 T;  2V7L A;  4Q25 A;  4DR7 T;  3A8Y C;  2LOS A;  5ABE A;  1XDP A;  2CXL A;  3VKG A;  1HX1 B;  3FXD B;  3UU5 A;  3Q5D A;  5LP6 E;  2E9X D;  4EXT A;  1BR0 A;  3GN5 A;  3ZCJ A;  2LHR A;  3IA3 A;  4JEH B;  4PK4 A;  2ODU A;  1XMO T;  4KP3 C;  4BA9 A;  1N32 T;  4GYS A;  4U33 A;  2KT9 A;  1WFD A;  2X0H A;  5FXW A;  5FXX A;  4DV1 T;  4DV6 T;  3N5L A;  4EED A;  1W0B A;  3H3A A;  4P09 A;  3IBP A;  5AQI B;  3K3Q C;  1XDO A;  2JQ9 A;  3ETV A;  2YOE A;  4MBQ A;  1UX4 A;  4YJ3 E;  4C91 A;  3ZYL A;  1T72 A;  5CFB A;  2HPJ A;  2Q9Q B;  1NEN A;  4B6X A;  1ZEE A;  3ONJ A;  2CM0 A;  3S4U A;  3FB2 A;  2CBI A;  5L3C B;  3ZN1 B;  2H7V C;  2FUP A;  5HEJ A;  2BZB A;  2XQ7 A;  2PFV A;  3UQ4 A;  3HR0 A;  5JR9 A;  1H7C A;  3T1H T;  2LKG A;  3N2O A;  5HXS A;  2QYW A;  4ZS3 A;  4J2C A;  5AQT B;  2NTY A;  2WAU A;  5HEH A;  4COF A;  5ABF B;  2W61 A;  4H9N C;  4OYK A;  4YT0 A;  4JYA T;  4TX5 A;  3LFM A;  4X66 T;  4DV4 T;  5AQU B;  4DO0 A;  2V6Y A;  4IDN A;  1MIY A;  1WR0 A;  2E9X B;  5LG4 A;  4YHJ A;  2KND A;  4A5X A;  1HNW T;  4U2Z A;  4BJM A;  3MXZ A;  4QH4 A;  2Y48 B;  2XM1 A;  2J1D G;  3ZYK A;  4WBO A;  2A3D A;  5IYZ E;  4TNV A;  2XQ5 A;  1NWM X;  3C4W A;  2E2A A;  3FZF B;  3OVU A;  3GN5 B;  3QNU A;  4P0B A;  2RPA A;  3AAI A;  3CIR A;  4MFR A;  4YSZ A;  3KIN B;  2ZM6 T;  3PUA A;  2YDR A;  3J9X 1;  5F5W A;  3AE4 A;  4KX6 A;  1ZOY A;  2YKS A;  3AXJ A;  5LXT E;  4UR9 A;  5LBQ B;  2IHR 1;  2NP9 A;  3Q5W A;  4O4H E;  3U78 A;  5L4H A;  5LMN T;  2M6B A;  4LFB T;  3Q9D A;  2IUB A;  2OV9 A;  3U3I A;  3C4Z A;  3E22 E;  5JDQ A;  4O4I E;  2WCA A;  4U31 A;  4YTP A;  4E7Z A;  3A7M A;  5LB7 B;  5FXZ A;  2ACX A;  3OYX A;  4WYV A;  1MND A;  4P0A A;  3AE9 A;  2WDR A;  4AQF C;  4QX8 B;  4DID B;  3A5X A;  5DJQ C;  2CPT A;  4UVB B;  1S94 A;  2BG9 A;  4X1I E;  3AE7 A;  5JR9 B;  4AKG A;  4CZZ B;  2KLQ A;  4L0R A;  2IIU A;  1SHZ C;  3LK3 B;  2D0T A;  3RIA A;  2ACZ A;  3AAE B;  5KX5 E;  5LHG B;  2CHN A;  3RRC A;  4JI2 T;  5AQP B;  4CI2 B;  3DJB A;  2V6Y B;  2CWY A;  2W63 A;  3E0Z A;  4DBR A;  2LSI A;  3IF8 B;  1R8I A;  3PUR A;  3EUH A;  4AKI A;  2XPK A;  3L09 A;  5JDF A;  3ZMT B;  4DV2 T;  5JH7 E;  1IBM T;  1FEW A;  1QLB A;  3NRX A;  4FI5 A;  3VR8 A;  2NW7 A;  3MAC A;  3N9O A;  3QB5 A;  4PK6 A;  3VR9 A;  3DP7 A;  3ZT5 A;  4DV3 T;  4DR2 T;  2VKJ A;  4JI4 T;  4OHF A;  4O8S A;  3AEB A;  3O1I A;  1WCR A;  4L9I A;  3CX7 B;  3F57 A;  4MLK A;  1E2A A;  5JR9 C;  4UIG A;  1E1H B;  3AA1 B;  3AXJ B;  4KMC A;  4CI3 B;  4IL4 A;  5L3G B;  1E7P A;  5LHI B;  1X9B A;  3H37 A;  1FIO A;  2XSA A;  2WMN A;  3H3M A;  4LF4 T;  3V5U A;  3LG7 A;  2LM9 A;  3OPC A;  4M1P A;  3C64 A;  5AQR B;  2Y8D A;  4ILU A;  3ZLI A;  1LKX A;  2YIN A;  3QB5 K;  2NOX A;  3CWZ B;  5CB4 E;  4KHZ F;  5HCM A;  4PJJ A;  4AKR B;  2J4G A;  5AQM B;  1OED E;  5AQF B;  3UU6 A;  5DAB A;  4CN6 A;  3KV4 A;  3RI5 A;  3PJA A;  4MAL A;  4DMW A;  4Z8X A;  5F8P A;  2CWO A;  3C51 A;  4A56 A;  5KMG P;  4JBW F;  1DU2 A;  1O3X A;  2DHR A;  2HH7 A;  2ODV A;  5FXV A;  3Q5E A;  4PNI A;  5A1L A;  5DQV A;  2C5K T;  4TWD A;  1Y64 B;  4HWF A;  5C2T A;  2A2F X;  3CQC B;  5HWX A;  3FBZ A;  5FVK A;  2K9A A;  3K8P C;  4NXN T;  2K48 A;  3CML A;  3W15 B;  4AKH A;  3AB3 B;  1WLX A;  4LMK A;  5KXJ A;  4GYR A;  5M4Y A;  2L8K A;  2YDQ A;  5E0O A;  5LGT B;  2ZM8 A;  3I0O A;  2V7I A;  3SOL A;  5AQL B;  1B7T A;  3RH3 A;  1VCS A;  4ZI3 C;  4HFC A;  5AQJ B;  4X1Y E;  1SUM B;  2V7K A;  3ZJ1 A;  2VKO A;  3TLS A;  2V8S V;  4HWI B;  2BG9 C;  3ZN0 B;  3N2G E;  4FJO A;  4JI6 T;  2FJA A;  4HFH A;  4PJM A;  3QOF A;  2D2S A;  2CCQ A;  1MIW A;  1KK7 A;  3CQG B;  3OTO T;  2K3W A;  1N36 T;  3CVR A;  3RIF A;  3ONL C;  1J5E T;  2Q9Q A;  4HWD A;  4NXM T;  2MBG A;  4PFP A;  3ZJ2 A;  4EZ4 A;  2ZM2 A;  2MAW A;  2LJL A;  3RHW A;  5HXC A;  2V26 A;  3LK4 2;  2DI4 A;  3RF1 A;  1HNZ T;  2CA5 A;  4HGA A;  4LML A;  2XJ7 A;  2H3R A;  3R6N A;  1IBK T;  2DWK A;  2JQH A;  4B3S T;  3LSV A;  3RYC E;  3ZMZ B;  5JVD E;  2W67 A;  5ABF A;  3QUJ A;  4QWN B;  2V7M A;  1XNQ T;  4AKL A;  2VAS A;  2OLT A;  4TZ4 C;  4ILC A;  3HKB E;  4QHO A;  4OYJ A;  4DMV A;  2NR4 A;  2E9X A;  2VVS A;  2XQ4 A;  2MYS A;  2P9B A;  3C4X A;  3CK6 A;  3L39 A;  3AVR A;  2BKP A;  3D0T A;  1KEY A;  4A98 A;  1J5W A;  3AA6 B;  4ZOL E;  3OBV E;  2LOP A;  5IHY A;  5ABG A;  2UXX B;  4TWF A;  2PBI A;  2WP9 A;  2N9D A;  4JEU B;  3O4X E;  3JCF A;  3TLW A;  3FZH B;  5LCY A;  1IJ5 A;  5HYA A;  5FL0 A;  4I0U A;  3KVB A;  3WAJ A;  4H9P C;  3SWH A;  2WS3 A;  4AI6 A;  4I43 B;  3AA7 B;  3X1D A;  1OED B;  2MOZ A;  2KXP B;  3EVY A;  4EYU A;  3AE5 A;  3I9W A;  4U72 A;  3ANW A;  2AE9 A;  3ZSS A;  2XQ9 A;  4UVC B;  2I6H A;  4YJ2 E;  1N34 T;  2KZ7 B;  2WB5 A;  2HPL A;  2OA5 A;  2DCF A;  4I55 E;  5FMN A;  3UUB A;  2X0Y A;  3P4Q A;  2CBJ A;  2QVA A;  3HKD E;  5HXE A;  1W9R A;  2PTF A;  4U74 A;  2HN2 A;  4ANJ A;  4NPP A;  5LJM A;  1XWM A;  3P8C D;  4UV8 B;  5FL1 A;  1SE7 A;  1HCI A;  3AA0 B;  2B76 A;  2QA7 A;  3F31 A;  3P4W A;  4G2A A;  5JRE A;  3HL6 A;  1ZP0 A;  2DLR A;  3I1A A;  2LT3 A;  5CA0 E;  1HG2 A;  3NBX X;  3PUQ A;  4PFO A;  2Z6E A;  3SRZ A;  2LSY A;  1S35 A;  3VHL A;  2UUA T;  3ZC1 A;  2JIW A;  3PUV F;  4F8H A;  4CN1 A;  4ZI7 E;  4WW0 A;  4YY3 T;  2Y6X A;  3P4S A;  4H63 V;  2L3L A;  4EAH A;  4GK5 E;  5LOV E;  5BMV E;  2VK9 A;  4ADZ A;  5FKY A;  2Q9Q C;  2JMK A;  3ZT7 A;  3AE2 A;  4YXD A;  4DR4 T;  2FBW A;  3SFD A;  2XQY A;  1X79 A;  3N9M A;  2W62 A;  3PU8 A;  3CQX C;  2KSR A;  2ZMA A;  1M7K A;  2J62 A;  5FY1 A;  4PAG A;  1CUN A;  2WY2 A;  5LGU B;  5JRC A;  4DR3 T;  3PUW F;  4HKA A;  3WAK A;  5CA1 E;  2BS3 A;  1US7 B;  1N33 T;  2V5C A;  3ANW B;  2E5L T;  1D0Y A;  4IST A;  3UU4 A;  4N78 D;  2XQ8 A;  4OX9 T;  2E9X C;  3RGL A;  2M67 A;  5AQH B;  3O9X A;  3I9Y A;  4CN4 A;  1G73 A;  1EZ3 A;  1YD8 G;  4CQI A;  2WU5 A;  4IE5 A;  3P7I A;  5L3B B;  4KI0 F;  5FY7 A;  4ZS2 A;  2BKO A;  3ZMV B;  3UUX B;  5FNV E;  4U2Y A;  3PV0 F;  4IE4 A;  4HFE A;  2D9D A;  3KBT A;  4U3C A;  5L47 A;  2SPC A;  2IC6 A;  5AQK B;  4HN9 A;  2XHE B;  2BKN A;  2IW5 B;  1XNR T;  2K24 A;  2G0U A;  5FVL A;  3G06 A;  4I50 E;  3EAB A;  2WWU A;  2GK9 A;  5ADX L;  2VQE T;  4O4L E;  4JI1 T;  2N2N A;  2CXF A;  1FMW A;  1LRZ A;  2WU2 A;  3UU8 A;  2XAH B;  3UUL A;  2V6X A;  4TV9 E;  5LGN B;  2XQ6 A;  4IRE A;  4TNW A;  1WYC A;  3PUX F;  1FMV A;  4YSX A;  4JI0 T;  2RP4 A;  2MTQ A;  1J1J A;  5JRC B;  3FZM B;  3O1J A;  2XZE A;  2UXC T;  3UT5 E;  2N1G A;  4IDO A;  3RC3 A;  5EK2 A;  3TLV A;  4LFA T;  2UXD T;  3KDS E;  5HAX A;  3V5S A;  1UK5 A;  3PTR B;  5ETW A;  1D1B A;  3ZYM A;  4G63 A;  4O2B E;  4TV8 E;  1MMD A;  5CJ5 A;  3ETU A;  1W09 A;  4LF8 T;  4E7S A;  4UVA B;  3ESL A;  5JDL A;  3KVA A;  2JPF A;  4DND A;  4DUY T;  2CEA A;  4X64 T;  3P50 A;  2DNX A;  3AAA B;  3AE6 A;  1QSD A;  4TUY E;  3CKD A;  4DV0 T;  4AIS A;  3N9P A;  3JC6 D;  3EI0 A;  1I94 T;  4CI1 B;  4ZI2 D;  3CX6 B;  2X9W A;  2PG8 A;  4H9Q C;  5AQO B;  1YKE B;  4KBM B;  4JI3 T;  4GOU A;  3RPU A;  2XAF B;  4YFS A;  2DWG A;  3ZKR A;  2X9Y A;  5AFU L;  3DTO A;  5JDH A;  2LE8 A;  5L3D B;  4NIQ A;  5LBM A;  4EZH A;  1MMG A;  4O4J E;  4ZEY A;  3BQI A;  2LLY A;  3K3N A;  3MA9 A;  4H63 H;  2BS2 A;  1SA0 E;  2QRX A;  2XM2 A;  4IE0 A;  2E5V A;  4PJL A;  3ZEF B;  3NRY A;  1KF6 A;  3P4R A;  4H9O C;  4IE7 A;  1MIV A;  4LMJ A;  3PUS A;  5HXH A;  3PJA J;  1VOM A;  2X66 A;  2CRB A;  2XUE A;  4IGU A;  4X62 T;  1OED A;  5IWA T;  3RIU A;  4PK5 A;  4EGW A;  5JDM A;  2KIN B;  3RKO A;  3OYZ A;  5L3E B;  3ZMU B;  4PW8 A;  4QH1 A;  3UFG A;  3PDY A;  4C90 A;  4HWH A;  3ZCI A;  3GWH A;  4IDQ A;  4WZX A;  3T1Y T;  4LF9 T;  4IHJ E;  4I4T E;  1D0Z A;  2CXD A;  4EYY R;  4DV7 T;  4CXW A;  4YTN A;  3Q2M A;  4AQY T;  1D0X A;  1D1C A;  3ZMS B;  1XZY A;  2YDS A;  1KNR A;  3UUM A;  1GQE A;  5LJN A;  2X68 A;  4GKK T;  3B5M A;  4ILB A;  3T8O A;  2VL0 A;  3HKC E;  3JAF A;  5HEO A;  1LVF A;  2W0G A;  3AEG A;  1UUR A;  3FZK B;  5LMU T;  5F3J A;  3UQ7 A;  2JQK A;  1Z8U A;  2D5U A;  4QXH B;  5JDN A;  5KDM C;  3MKD A;  1D1A A;  2LSJ A;  1VCT A;  3L8R A;  3SFE A;  3IHR A;  1IJ6 A;  2B1E A;  3AED A;  2D0U A;  4EIW A;  3AE3 A;  3ZST A;  1YQ4 A;  4IL9 A;  5C8Y E;  1WRD A;  1WR6 A;  4BAY B;  4JV5 T;  2XY8 B;  2FJE A;  3JC6 C;  3VRA A;  2WWV A;  4WNK A;  1UGO A;  2LEH A;  3N2K E;  3RX6 A;  5H6Q B;  4ZXL A;  2XTL A;  3EHZ A;  2H88 A;  1Z0P A;  4A97 A;  3E08 A;  2KWI B;  1V9D A;  4F6R C;  2VUR A;  3RQW A;  1U5P A;  2UXN B;  3J7Y q;  4HTE A;  2V7J A;  1JNR A;  2XAJ B;  3O1H A;  4U7Y A;  4AQF A;  2K5B B;  1VRB A;  5J2T E;  4KUM B;  3M3Z B;  2CMR A;  2LSG A;  3ONX A;  4NUU A;  5FY0 A;  3AEF A;  2ZLY A;  3LDQ B;  4GIW A;  5HXR A;  3UUN A;  3C98 B;  2UXB T;  1G8X A;  2IML A;  4EOZ B;  3NKZ A;  4ASK A;  4OFZ A;  4X65 T;  3TKL B;  4DV5 T;  1YQ3 A;  2WBL A;  4OK0 A;  1I6Z A;  2JJ9 A;  5TAO A;  5J1G A;  2C0S A;  4X1K E;  4UEM A;  4XZC A;  3EDU A;  1OED C;  3RIU C;  1T7S A;  2A9U A;  1YW0 A;  4B3T T;  5AQG B;  2WDV A;  4IT4 A;  4ZZB A;  1NAF A;  2XQ3 A;  2DL1 A;  1AJ3 A;  5CGM A;  2BVL A;  4IDZ A;  3QC9 A;  2FJD A;  2IDO B;  2WM9 A;  2X0L B;  3F2E A;  5BR8 T;  3RYH E;  4QH5 A;  2XAS B;  3Q5X A;  4JI7 T;  2M6I A;  5EK3 A;  1HR0 T;  4B3M T;  2EHO A;  2VB6 A;  3LJC A;  5EZY E;  4EEB A;  3RKG A;  3JAD A;  3IEE A;  4HFI A;  4H9S E;  3EDV A;  2VQF T;  2JRK A;  2R6G F;  1BR2 A;  2X67 A;  3AE1 A;  2EHO D;  1ZHC A;  4UF0 A;  4X20 E;  4ERR A;  2JQQ A;  4JI5 T;  2C5I T;  3RYI E;  1T8B A;  1MMN A;  2QGS A;  4H9R C;  2C5J A;  3FHN A;  3MJX A;  3KV6 A;  3HI2 A;  2WZI A;  4Z91 A;  5LNK A;  5L2L A;  2V1D B;  5AQN B;  1HFA A;  3RC8 A;  3UU3 A;  2YN6 A;  3PUY F;  2BG9 E;  4P1N A;  2WDQ A;  4JUY A;  1HNX T;  2RA1 A;  4CXX A;  1BR4 A;  2HN1 A;  1KFY A;  4EV6 A;  2KWH A;  2VWA A;  5H6R B;  4QX7 B;  2V5D A;  1IAP A;  4DUZ T;  5LA6 E;  4CXY A;  3K3O A;  2LSK A;  3BQL A;  2PJQ A;  3N9N A;  2LM2 A;  1OWA A;  3CPZ A;  1LVK A;  2CLY B;  4V1A v;  2XQA A;  4DBQ A;  2YK0 A;  3AEE A;  4QXC B;  2UUC T;  4DR6 T;  2H7O A;  2NW9 A;  3FZL B;  2ZM0 A;  2NWB A;  4NUV A;  1W0A A;  2WZH A;  2YU2 A;  5IUX A;  2WQY A;  4X5T A;  5FYM A;  3KV9 A;  4UEL A;  1MNE A;  1UUS A;  4YLH A;  2UU9 T;  3KFW X;  4GK0 E;  3BK9 A;  4EB6 E;  2LRL A;  2EHO B;  4YSY A;  4ZI3 D;  5HEG A;  2H89 A;  3PUZ F;  4YHH T;  3BQK A;  4HFD A;  3NWI A;  4WBN E;  3C50 A;  3CX8 B;  1QUU A;  4JLE A;  2CLY C;  4UF0 B;  3PU3 A;  2CE7 A;  2I0M A;  5GON E;  1HX8 A;  4TWH A;  4QKN A;  4AXP A;  3RQU A;  3HKE E;  3VKH A;  5L3F B;  2F4V T;  2W00 A;  5DQW A;  1FJG T;  4B3R T;  1UCU A;  3ZT6 A;  4IDP A;  5J2U E;  1HTJ F;  3VRB A;  4KHP T;  4HWC A;  4L5G A;  2EHO C;  3B57 A;  4IE6 A;  5EK4 A;  2NTX A;  4PJN A;  4HFV A;  5FP3 A;  1YXR A;  2W2U A;  3MK7 C;  5LYJ E;  5AQQ B;  3TLT A;  3HA4 A;  3AE8 A;  1IZN B;  4QXB B;  1M62 A;  2XAG B;  1ZKE A;  4K0U A;  1NEK A;  4O2A E;  5C3J A;  2BS4 A;  2LRK A;  4TN7 B;  3K1S A;  4Z90 A;  3AEA A;  3RRW A;  3TLU A;  1L0V A;  2UUB T;  4LF6 T;  3PE0 A;  2FJB A;  4ZZC A;  5HWY A;  3LBX A;  3ZPO A;  1YKH B;  4HEA A;  5HEU A;  3MZK B;  3P4P A;  1UX5 A;  2LKH A;  2X51 A;  3N9Q A;  2JMH A;  3UTK A;  3GMI A;  4BJN A;  3LK2 B;  2VKD A;  2BG9 B;  4XBF B;  3FXE B;  2A72 A;  3RYF E;  1CHU A;  3I0Q A;  2IC9 A;  2J47 A;  4XAX B;  4AIU A;  2W66 A;  2IAK A;  1JNZ A;  3R84 B;  4U7I A;  4UV9 B;  4HFB A;  2HHH T;  5HCJ A;  4JI8 T;  5AQS B;  2YU1 A;  3KV5 A;  4DR5 T;  3AEC A;  1HS7 A;  1U4Q A;  4HE8 A;  4IIJ E;  2X9H A;  5LG3 A;  4GKJ T;  4UXN B; 
#chains in the Genus database with same CATH homology
 1HNZ T;  1XMQ T;  3T1Y T;  4LF9 T;  4JI7 T;  2VQE T;  1HR0 T;  4KHP T;  4B3M T;  1IBK T;  1I94 T;  2UUC T;  4JI1 T;  4DR6 T;  4DV7 T;  4B3S T;  5LMN T;  4LFB T;  4AQY T;  1IBL T;  4DR3 T;  4LFC T;  4NXN T;  4DV3 T;  4DR2 T;  4JI4 T;  4JI3 T;  4LF7 T;  1N33 T;  4K0K T;  4DR7 T;  2VQF T;  4GKK T;  1XNQ T;  3T1H T;  2UU9 T;  2E5L T;  2UUB T;  4LF6 T;  4JI0 T;  4JYA T;  4LF5 T;  4JI5 T;  4X66 T;  4DV4 T;  4OX9 T;  4LF4 T;  5LMU T;  4YHH T;  1XMO T;  4DR1 T;  2UXC T;  2UXB T;  1N32 T;  4LFA T;  2UXD T;  1HNW T;  4JI6 T;  4X65 T;  4DV5 T;  2UUA T;  1HNX T;  4DV1 T;  4YY3 T;  4DV6 T;  4X62 T;  5IWA T;  4JI2 T;  4JV5 T;  3OTO T;  4LF8 T;  4DUZ T;  1N36 T;  4B3T T;  1J5E T;  2HHH T;  2ZM6 T;  1XNR T;  2F4V T;  4NXM T;  4DUY T;  4JI8 T;  4X64 T;  1FJG T;  4B3R T;  4DR5 T;  4DV0 T;  4DR4 T;  4DV2 T;  1N34 T;  4GKJ T;  5BR8 T;  1IBM T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...